164 Amborella P450 sequences. 79 are intact, 2 are fusions, 80 are partial. Some of these are probable pseudogenes. ESTs from Genbank are posted below these.

 

D. Nelson

Jan. 14, 2014

 

Sequences were provided from orthogroups derived from the Amborella genome.

These were provided by Eric Wafula, Claude dePamphilis and Joshua Der.

Exhaustive BLAST searches have not been done to find all P450s.

(see the Amborella Genome Database at http://www.amborella.org/

 

>CYP51G1 3773.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00016.33

83% to CYP51G1 Populus trichocarpa, intact

65% to 32418.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold01010.1 (partial seq)

57% to 32418.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00016.32 (partial seq)

MDAKDNKFLNAGLVVLATLVVAKLITALLFSRSRKRLPPTVQGWPIFGGLIRFLKGPIVMLREEYPKLGSVFTVKLLNKNITFFIGPEVSTHFFKAPESDLSQQEVYQFNVPTFGPGVVFDVDYSVRQEQFRFFTESLRVNKLKGYVDQMVVEAEDYFSKWGSEGVVDLKHELEHLIILTASRCLLGREVRDKLFDDVSSLFHDLDNGMLPISVLFPRLPIPAHLRRDRARQRLAEIFAGIIAGRKRAGNPEPDMLQSFIDSRYKDGRPTTEAEVTGLLIAALFAGQHTSSITSTWTGAYLLTNKPHLNSVLEEQRAILKKHGGKIDHDILSEMDVLYRCIKEALRLHPPLILLLRSSHSDFSVTTGEGKEYEVPKGHIVATSPAFANRLGHIFKDPDRFDPDRFAPGREEDKTAGAFSYISFGGGRHGCLGEPFAYLQIKAIWSHLLRNFELEMAGPFPEIDWNAMVVGVKGKVMVRYKRCVLRAEE

>CYP51G_pseudogene 32418.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00016.32

48% to CYP51G1 Aquilegia formosa x Aquilegia pubescens, N-term fragment

85% to 32418.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold01010.1

red is revised seq. Blue is incorrect seq

MDAKVTKFINAGLVVLGTSALLFLRSRKRLPPTVQGWLIFGGLIRYLKGLIVMLREEYPKLGSPFTVKLRNKNM

SEITKQKY

GLKVSTHYCKALESDLSQEEVHQLTVLTFGPDVVYDADCSVRPEQFSFFTQSLRVNKLKVYVDQM

VVEVEVYATILEAILECLLWFNWFNIFSYYAE

>CYP51G_pseudogene 32418.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold01010.1

52% to CYP51G1a Nelumbo nucifera, probable pseudogene fragment

85% to 32418.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00016.32

same as Ambtr1_0_15-AmTr_s01010_1-Amborella_trichopoda

MDAKVTKFINAGLVVLATLLVAKPITALLFLRSRKRLPPTVQGWLIFGGLIRYLKGLIVMLREEYPKLGSPFTVKLQNKNM

VPKAWKSLYSEITKQKY

GLKVSTHYCKALESDLSQEEVYQLTVLTFGPDVVYDADCSVRPEQFRFFTQSLRVNKLKVYVDQM

VVEVE

 

>CYP71AP 2012.10 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.7

61% to CYP71AP3 Populus trichocarpa, intact

59% to CYP71AP4 Populus trichocarpa

51% to 1284.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00039.131

MSPQQICLLALALPLLLLILRLIRRQQGWRANLPPGPLNLPIIGSLHRLGSAPHLSLAELARQHGPIVYVRLGELPTCVLSSAEMAKEALKTHDAALASRPTLCAAQQLFYGSTDIAFAPYGPYWRQVRKICILELFSTKRVQSFRSMREQEAAHLVSSIRSSCRVGEVDLTELLGPFANGLLCRVALGKNYCEGGEYEREFKRMLEEYQVLLGGFSLGDFFPSLEGWLNLITGMASRMKKTFEDFDRFFDRVIEDHRRKSKVPGGENHVKDLVDVLLEIQSDGLEQIPLTMDNIKAIILDMFAAGTDTTFITLDWGMTELIRNPRVMKKAQDHIRSKIGHKEQIEESDLQELDYLSAVVKEIFRLHPAAPVLIPHLSMEDVKIGEYNIPAKTRFFVNVWAIGRNPKSWDNPEEFCPERFMNSLIDFKGQDFELLPFGAGRRSCPAITFGAATVELALANLLYHFNWELPPGVRPEEFDLTEVFGITMHRKEHLVVVAKPYN

>CYP71AP 24473.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.19

74% to CYP71AP5 Vitis vinifera, C-term

70% to CYP83E30P Glycine max

67% to CYP71AP4 Populus trichocarpa

98% to 2012.10 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.7

100% to 24473.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.23

95% to 24473.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.30

MEDVKIGEYNIPAKTRFFVNVWAIGRNPKSWDNPEEFCPERFMNSLIDFKGQDLELLPFGVGRRSCPAITFGAATVELALANLLYHFNWELPPGVRPEEFDLTEVFGITMHRKEHLVVVAKPYN

>CYP71AP 24473.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.23

68% to CYP71AP5 Vitis vinifera, C-term

96% to 2012.10 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.7

MTELIRNPRVMKKAQDHIRSKIGHKEQIEECDLLELDYLRDVVKEIFRLHPAAPVLLPHLS

MEDVKIGEYNIPAKTRFFVNVWAIGRNPKSWDNPEEFCPERFMNSLIDFKGQDLELLPFGVGRRSCPAITFGAATVELALANLLYHFNWELPPGVRPEEFDLTEVFGITMHRKEHLVVVAKPYN

>CYP71AP 24473.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.30

68% to CYP71AP5 Vitis vinifera, C-term

95% to 2012.10 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.7

MFATGTDTTFITLDWGMTELIRNPRAMKKAQDHIRSKIGHKEQIEESDLQELDYLRAVVKEIFRLHPAAPVLLPHLSMEDVKIGEYNIPAKIQFFVNVWAIGRNPKSWDNPEEFCPERFMNSLIDFKGQDYELLPFGVGRQSCPAITFGAATVELAFANLLYHFNWELPPGVRPEEFDLTEVLGITMHRKEHLVVVAKPYN

>CYP71 1022.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.120

50% to CYP71D.25 Jatropha curcas, intact

50% to CYP71D86 Medicago truncatula

50% to CYP71BE6 Vitis vinifera

71% to 1022.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.191

69% to 147.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.119

49% to 2012.7 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.33

MEDLQPKPTSPSQTSIYALLSFLLLLALKIKTDRDRKRKLPPGPPTLPIIGNIHQLGRLPHQNLASLAQEHGPLMHLQLGQITSIVVSSPELAEKVLKAHDLVFASRPALSSAKIFTYNCTDIAMSSYGPYWRAVRKICILELLSAKRVQSFGFVRDEETAHFVGSIMEASHTPVNLTERIFSVISCMLERVGLGRKYVNDEFREIIRETIEVGSGFTIEDLYPPLGFISILSGSRARMKKVHKKLDSFFDKVIEEHEMNGKGHEQGDLVDVLLRLQEEGDVNVQLTRDNIKAIIFDMFMAGIETSSSTVGWAMAELMKNPQVMEKVQKEIRHALRGKERVGEGDLIHLEYLKLVLKETLRLHPPVPLLLPRESMETCTLEGYVIPAKTRVFVNAWAIGRHRDYYEIPEKFEPERFSDGLVEYKEQRFDFIPFGGGRRGCPGALFGMVTSELVLAQLLYYFDWKLPEGMKPEEVDMSETCGMTASRKHDLVLIPIPHFITSSS

>CYP71 1022.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.191

53% to CYP71BE6 Vitis vinifera, intact

51% to CYP71D86 Medicago truncatula

71% to 1022.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.120

50% to 2012.7 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.33

MEDPQPNPTSSQTSLYALIFFIFLLVLNITTTRDRKRKNLPPGPPKLPLLGNMHQLGRLPHRTLTTLAEEYGPLMHLKLGQIETIVVSSPELAQQVLKAHDVVFASRPAISGAKHIAYNCKDLVMAPYGAYWRSVRKICIMELLSAKRVRSFCFVREEETTHLVESIAEASYTHINLTHRIFSLVSSIVERVSLGKKYAGDEFRDIIRETLEISGGFDIEDLYPSMGFLGLLSSTRARMKKIHMQFDCFLDKVIEEHLKSGRKHVGEQGDLVSVLLRFQEEGDGEIELTNDNIKAIILDMFVAGIETSSATLTWAMAELMKNPKVMEKAQREIRHALKGKAKVEESDLEQLEYLKLVLKETLRLHPPVPLLVPRESMEKCTLEGYQIPAKTRVFVNAWAIGRCSNVYENAEKFEPERFSDSLVDYKGHRFDYIPFGGGRRGCPGALFGMATAQIALAQLLFYFDWKLPHGLTPEELDMTENIGITLPMKNDLILIPISHCTSSKCA

>CYP71 1022.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00174.10

53% to CYP71AP5 Vitis vinifera, intact

55% to CYP71AP7 Nelumbo nucifera

51% to CYP71AP1 Populus trichocarpa

57% to 2012.7 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.33

54% to 1284.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00039.131

49% to 1022.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.191

MASVPQWLEKATPTSFLGFLLFSLSSILLFLSLTRSKREKGTTAEAKLPPGPPKLPLIGNLHQLSKLAHRSLRDLALKYGPLMFLQLGQVPTLVVSSPAMAKAVMKTHDLSFASRPHLTSTKNLLYNSSDIAFSPYGSYWRNMRKICILELLSIKRVESFRFVREEEVVRLMETIETSKGTVNLSHLFLSLTNNITGRIAFGRSYDKFYVLLNELQILLGGFSLGDLFPSMDWIDVLTGIQARQKKNFRELNAFIDLVIEDHLHPRTRASNPEFKDFVDVLLEVQKQAELDFPFTRDNLKAVILDMFGAGTETTATVLEWTMTELMKNPNVMKKAQDEVRKIANGRQTIGENDLPELEYLKLVMKESMRLHAPVPLLLPRESLEKCSINGYEIPKGTKVIINAWAISRHAETWASPEEFRPERFIESSIDYKGQDFEFIPFGAGRRGCPGIAFGVASLELALANLLLHFDWELPHGMSPNDMDMAEIFGLTMHRKIVY

>CYP71 147.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.119

40% to CYP71D86 Medicago truncatula, missing some internal seq, C-helix to end

69% to 1022.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.120

57% to 1022.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.191

40% to 2012.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00166.24

MCPYGPYWRAVRKICIMELLSAKRVQSFSFVREEETTHFVGSIMEVSHTPVNLTHRIFSVVSCVVERLALGRKYVGDEFREIIRS (21 aa gap)

ILSGTRARMKKVHKKLDSFFDKVIEEHEMNGKGHEDEQGDLVNVLLRLQKEGDGAVQLTRDNIKAIILDMFIAGIETSSSTLGWAMAELMNNPQVMEKVQKEVRHALKGKERVGEGQVLEYLK

(45 aa gap)

HRDYLKNPEKFEPERFSDGLVDYKGQYFDFIPFGGGRRGCPGALFSMATAELVFAQLLYYFDWKLPKGMKPEEMDMSESCGITASRKRDLVLIPIPLFISSRIS

>CYP71 1284.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00039.126

46% to CYP71AQ10P Nelumbo nucifera, missing N-term, retained intron

77% to 1284.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00039.131

45% to 2012.10 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.7

MWFFLPTASTGDRFGRFAYSSCTVQSFQSVREEEVAAMVSAISGSSNGDPVDLSKIFYTLANRIICRVALGYSEGDQTEHRFYKIIQELNSLVGSFCAADLFASMGWIDILTGFHARLKKNFRELDCFLDKVIRDHKSKEVSEATTTNEDFVDILLQAQKDYILDIPLTLDNLKAIIL

VLFHTKICFPLCKSLCLITNSGSPIVQ

DMFSAGTETKLNAYEDEVPELEYFHSVIKEVPRLHPPVPLLVPRESKEGIKIDGYDIPAKTRVYINAWAIGRHPDCWDQAGEFLPEMFMSSTIDFRGQDFEFIPFGAGRRSCPGYLFAIHTVVLAAANLIQHFEWEVPLGGLDMAESSGITAHRKYPLYVLATPRCI

>CYP71 1284.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00039.130

47% to CYP71AH1 old 71A11 Nicotiana tabacum, retained intron

47% to CYP71AP5 Vitis vinifera

82% to 1284.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00039.131

51% to 2012.10 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.7

MAGFWVWLLVFAAILAVIQILLNRKARSLNLPPGPRRFPVIGNLHQLGKRPHQSLARLSQQYGPLMFIKVGRVPTIVVSSAEIAKEVMKTQDMVFANRPGLFAAEKLLYGGTGVIFSPYGEYWRQVRKICALELLSTKKVKSFQSVREEEVASMVSTISCFSHGDPVNLSKMFYTLTNRISCKVALGHSEGDQTEYRLHKIVQELNSLLGSFFAADLFPSMGWVDVLTGIRARVKKNFRELDSFLDEVIRNHRDKGVLEPTTANKDFVDILLQAQKDYSLDIPLTLDNLKAIIL

VLFHPKICFPCYKSLDPITNSGSPIVQ

DMFAAGTETSATTLEWLMSELVKNPEAMRKAQEELHRVMGVKGKLNVSEDELPELEYLHSVIKEVLRLHPPAPLLVPRESRNSTKINEFDIPAKTRVYINAWAIGRHPDYWDRAEEFLPERFMSSAIDFKGQTFEFIPFGAGRRSCPGYLFAIHTVALTVANLINHFEWAVPPGGLDMAESNGIAHRKHPLFLLATPRCI

>CYP71 1284.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00039.131

545 to CYP71AP7 Nelumbo nucifera, intact

52% to CYP71AQ10P Nelumbo nucifera

78% to 1284.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00039.130

52% to 2012.10 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.7

MVSFWPLLLVLSAILEVIQILLNRKARRLNLPPGPGGFPVIGNLHQLGELPHQSLARLSQQYGRLMFLKLGSVPTIVVSSAEIAKEVMKTQDLAFANRPVLVAAEQLFYGGTDVAFSPYGEYWRQIRKICVLKLLSTKKVKSFQSVREVEVASMVSAISASSHGDTVDLSKTFYTLTNRIICKVALGYSGGDQTEHKFYKIIQELNSLLGSFCAADLFPSMGWIDILTGFHARLKKNFRELDCFLDKVIRDHKVSEATTTNKDFVDILLQAQKDCSLDIPLTLDNLKAIILDMFSAGTETSATTLEWLMSELVKNPAAMRKAQEELHRVMGVKGKLNVSEDEVPQLEYLHSVIKEILRLHPPVPLLVPRESKEGTKIDGYDIPPKTRVYINAWAIGRHPDYWDRAEEFLPERFMTSTIDFKGQHFQFIPFGAGRRSCPGSLFSAQTVVLAAANLIHHFEWEVPPDGLDMAESSGITAHRKHPLLLLATPRYI

>CYP71 1284.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00039.129

47% to CYP71AQ10P Nelumbo nucifera, missing N-term

83% to 1284.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00039.130

49% to 1022.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00174.10

MFIKVGRVPTIVVSSAETAKEVMKTQDMVFANRHGPFATEKLFYGGTDIPKICVLELLSTKKVQSFQSVREDEVASMVSTISGLSHGDLVNLSKMFYTLTNCIICKVALGHSERDQTEYRLYKIVQELNSILRSFFAADLFPSMGWVDVFTGIRARIKKNFRELDSFLDEVIQNHRYKGVLEPTTANKDFVDILLQAQKDYSLDIPLTMDNLKAIIPDMFAAGTETSATTLEWLMSELLKNPAAMRRAQEELHRVMGVKGKLNVSEDELPELEYLHSVIKEVLRSHPPAPLLVPRESRETTKINGFDIPAKTRFYINAWAIGRHPDYWDRAEEFLPERFMSSAIDFKGQNFEFIPFGAGRRSCSGYLFAIHTVALTVANLINHFEWEVPPGGLDMAESDGITQRKHPLFLLATPRCF

>CYP71 1284.5 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00039.137

54% to CYP71AQ10P Nelumbo nucifera, intact

80% to 1284.6 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00039.136

MGALWPWIQACLAIVTLIEILWLLLRNRSTKETARLNLPPGPLGLPIIGNLHQLGSLPHRSFASLSWKHGPLMFLQLGRVPTLVISSAKMAKEVMKTQDLAFASRPFLVAANRLCYGSTDMAFAPYGDYWRQVRKICVLQLLSIKKVQSFKLVREEEVASMVRAISGSFGGGPVNLSEAFYTLANNLICRVALGKSYYSEGQQRKYDFRKIVGEFAELLGAFCARDFFPSMGWVDIVTGIRARLNNNFKDLDGFLDEVITEHQGKEVPDPTTKQQSDFVDILLQLQKDPSLDVPLSMDNIKAIILDMFSGGTETSATTLEWLMSELIRNPIVMRTVQEELQRVVGGKGKVFVEEEDLHELQYLQSTIKETLRLYPPAPLLVPRELREKTTINGHDIPANTRVYINAWAIGRQHDSWERVDEFFPERFMNNDIDFKGHDFEFIPFGAGRRGCPGYHFALQIVELAAANLLHCFNWKLPSGCQGLDMAESSGLTMHRKSPLMLVATPRCT

>CYP71 1284.6 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00039.136

51% to CYP71AQ10P Nelumbo nucifera, intact

80% to 1284.5 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00039.137

MDALWPWIQACLAIVILIVILLLLLRNRSTKETASLNLPPGPRRLPIIGNMHQLGSLPHRSLASLSRKHGPLMLLQLGHVPSLVISSAKMAKEVLKTQDLAFASRPALVAANRLSYGRTDVVFAPYGDYWTEARKICVLHLLSIKKVQSFKPIREEEVASMVRAISCSCGGGPVDLSELFYTLTNSIICRVTVGKSYSSEGGQQRNYNFRKIVGEFTALLGVFCAGDFFPSMGWVDIVTGIRARLNKNFKDLNGFLNEVIREHLGKSVPEPTAEQQSDFVDILLQLKKDPGHGVPLSMENIKALILDMLTAGTDTTATALEWLMSELIRNPVAMRRVQEELERVVGGKGKAFVEEEDLHDLENLQSAIKEALRLHPPIPLLVPRELQENTRIDGFDIPAKTRVYINAWAIGRDNDSWDRADEFFPERFVKNDIDFKEHDFEFIPFGAGQRECPGYSFAMHTMELVVANLLHWFDWKLPSGCQGLDMAESSGITIHRKSPLMLVATPRYEREETWLENLVKS

>CYP71 2012.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00166.24

50% to CYP71AP5 Vitis vinifera, intact

91% to 2012.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.32

MNPAAKPQSTKLNLSSFHPTHGHQPMFTTLITGLLSFLLLLLLYLHHSNKSGSKTTRPPGPSGLPIIGNLHQLSSLPHRSLAHLAKIYGPLMHLKLGRVRTLVVSSPKMAELAMRTLDHALCSRPIRAATNHLTYNSTDVAFAPYGPYWRHIRKICILELLSSKRVQSFGFVRKEEVGSLVDSIFVSSEAKAPVNLRDAFHSLASNVVCRVALGKSYWEDEPELKEILDSSQPLISGFFVGDFFPSLEWVKYLTGFQRRLEKNLRQWDSFLERVIDEHLLPTHKKEKKDLVDVLLELQKEGTPDFTLSRDNIKSVVLDMFAAGTSTTADVLEWGMSELIKNQSAMKKAQDEVRGIAKSNNKSMIKETELQQLHYLKVVVKEILRLHPPAPLLIPRESIEDCDIEGYFVPSKTRVLVNAWAIGRHPDSWVDPDEFRPDRFTGSNIDYKGHDFALIPFGAGRRGCPGISFAVSVIELALANLLLCFDWAMPDGMNHEDLDMTEDSGLTVKKKTPLLLVATPPSTS

>CYP71 2012.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.32

51% to CYP71AU4 Vitis vinifera, intact

95% to 2012.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.25

MNPAAKPQSTKLNLSSFHPTHGLLHGHQPMFTTLITGLLSFLLLLLLYLHHSNKSGSKTKRPPGPSGLPIIGNLHQLGSLPHRSLAHLAKIYGPLMHLKLGQVRTLVVSSPKMAELAMRTHDHALCGRPIRAATNHLTYNSIDVAFAPYGPYWRHVRKICILELLSSKRVQSFRNVRKEEVGRLIDSIFVSSKAKAPVNLRDAFHSLTNNVVCRVALGKSYWEDEPELKEILVSARSLTSGFFVGDFFPSLEWVKYLTGFQRRLEKNLRQRDSFLERVIAEHLLPTHKKEKKDLVDVLLELQKEGTPDFTLSRDNIKSVVMDMFVAGTSTTATVLEWGMSELIKNQSAMKRAQDEVRGIAKSNNKSMIEEKELQQLHYLKVVVKEILRLHPPAPLLIPHESVEDCDIEGYFVPSKTIVLVNAWAIGRHPDSWVDPEEFRPERFIGSNIDYKGQDFALIPFGAGRRGCPGISFAMAIFELALANLLLCFDWAMPDGMNNEDLDMTEGSEVSKLKKTPLLLVATR

>CYP71 2012.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.25

50% to CYP71AP5 Vitis vinifera, intact

95% to 2012.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.32

MNPAAKPQSTKLNLSSFHPTHGLLHGHQPMFTTLITGLLSFLLLLLLYLHHSNKSGSKMKRPPGPSGLPIIGNLHQLGSLPHRSLAHLAKIYGPFMHLQLGRVSTLVVSSPKMAELAMRTHDHALCSRPIRAATNHLTYNSTDVAFAPYGPYWRHVRKICILELLSSKRVQSFRNVRKEEVGRLVDSIFVSSKAKAPVNLRDVFHFLTNNVVCRVALGKSYWEDEPELKEILNSSRPLTSGFFVGDFFPSLEWVKYLTGFQRRLEKNLRQRDSFLERVIAEHLLPTHKKEKKDLVDVLLELQKEGTPDFTLSRDNIKSVVMDMFAAGTATTATVLEWGMSELIKNRSAMKKAQDEVRGIAKSNNKSMIEEKELQQLHYLKVVVKEILRLHPPAPLLIPHESIEDCDIEGYFVPSKTTVLVNVWAIGRHPDSWVDPEEFRPERFIGSNIDYKGQDFALIPFGAGRRGCPGISFAMAILELALANLLLCFDWAMPDGMNNEDLDMTEGSGLSALKKTPLLLVATRQALDSNSNGDW

>CYP71 2012.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.21

51% to CYP71AU4 Vitis vinifera, intact

98% to 2012.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.25

MNPAAKPQSTKLNLSSFHPTHGLLHGHQPMFTTLITGLLSFLLLLLLYLHHSNKSGSKTKRPPGPSGLPIIGNLHQLGSLPYRSLAHLAKIYGPFMHLKLGQVSTLVVSSPKMAELAMRTHDLALCSRPIRAATNHLTYNSTDVVFAPYGPYWRNVRKICILELLSSKRVQSFRNVRKEEVGRLVDSIFVSSKAKAPVNLRDAFHSLTNNVVCRVALGKSYWEDEPELKEILNSSRPLTSGFFVGDFFPSLEWVKYLTGFQRRLEKNLRQRDSFLERVIAEHLLPTHKKEKKDLVDVLLELQKEGTPDFTLSRDNIKSVVMDMFAAGTATTTTVLEWGMSELIKNRSAMKKAQDEVRGIAKSNNKSMIEEKELQQLHYLKVVVKEILRLHPPAPLLIPHESVEDCDIEGYFVPSKTTVLVNVWAIGRHPDSWVDPEEFRPERFIGSNIDYKGQDFALIPFGAGRRGCPGISFAMAILELALANLLLCFDWAMPDGMNNEDLDMTEASGLFALKKTPLLLVATRQALDSNSNGDW

>CYP71 2012.5 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.14

50% to CYP71AP5 Vitis vinifera, intact

77% to 2012.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00166.24

MNLAGNSQSGMETLSSFLLTHGLLHGQQPMLTTLIIPLLSTLVLLLLYLCRNKQSGSEKKRSPCPLGLPIIDSLHQVGSLPHRSLAHLAKIYGPLMHLKLGRVPTLVVSSPKMAEHVMKAYDHAFCSRPILAATNYLTYGSTNVSFAPYGSYWRHVRKTCILVLLSSKRVQSFGFVRKEEVGHLVDSIFVSSKAKAPVNLTEAFLSLSNNVVCRVALGKSYWEEEPELRGIFESSKSLIGGFFVGDFFPSLEWVKYLTGFQRRLEKSFRHRDSFLEKVITEHLLPTHGKEEEEEKEEKDLVDVLLQLQKEGNPDFTLSTDNIKAVVMDIIAAGTDTTATTLVWGMSVLMKNQLAMKKAKDEVRSIAKSNNTNMIEERDLHQLHYLKAVVKEILRLHPPTPLLVPHESVEECDIEGYFIPSKTRVLVNAWAIGRHPDYWVDPEVFRPERFIGSDIDYKGQDFALIPFGAGRRGCPGISFAASVIELALANLLLCFDWALPNGMNHKDLDMTEDSGLTVHKKTPLLLVATLPSTSC

>CYP71 2012.6 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.16

43% to CYP71AP7 Nelumbo nucifera, missing internal sequence

79% to 2012.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.32

MNPAAKPQSTKLNLSSFHPTHGLLHGHQPMFTTLITGLLSFLLLYLHHSNKSGSKTKRPPGPSGLPIIGNLHQLGSLQHRSLAHLAKIYGPLMHLKLGRVRTLVVSSPKMAELAMRTHDHALCSRPILAATNHLTYNSTDVIFAPYGPYWGHVRKICILELLSSKRVQSFRNMRKEEVGRLVDSIFLSSKAKAPINLRDAFHSLANNVVCRVALWKSYWEDEPELKEILYSSRRLIGGFFVGDFFPSLEWVKNMTGDNIKSVVL

(60 as gap)

DMFSAGTGSTAMVLEWGMSELKKNQSAMKKAQDEVRGIAKSNNKSMIEEKELQQLHYLKVVVKEILRLHPPAPLLIPHESVEDCDIEGYFVPSKTRVLVNAWAIGRHPNSWVDPEEFRPEGFIGSNIDYKGQDFALIPFGGRPKGMPWNFLYNGYPRACIG

>CYP71 2012.7 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.33

52% to CYP71AP5 Vitis vinifera, intact

76% to 2012.9 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.34

MINQQAISILWTFLFSVLSLQLFLLWKRSGTRKKLPPGPIGLPIIGNLHQLGSMPHRSLAHLAEGYGPLMHLRIGQVPTLVVSSSKMAEQVMKAHDLAFCSRPTLLSPKRLTYNCSDIIFAPYGSYWRNVRKICVQELLSTKRVESFCLVREEEVGQMIHSISSSSKHGAIVNLSETFLSLSNNVICRVAFGKRYWEDGSQLNEMIEEADRLFDCFFVGDLFPYLEWVKYVSGLKERLDECFRIRDAFLDDVIADHLIPSRVEMEDEQKDLVDVLLQLQKGGNLDFTLTRDNIKAVVMDMFGAGIDTTSATLEWGMSELIRSPRVMQKLQDEVRGIIKSSRNNKIEESDLNQFHYLKAVVKETMRLHPPAPLLVPRESIEDCDIENYHIPAKTRVLINAWAIGRHLESWEDPDEFKPERFMDSSIDFRGQDFELIPFGAGRRGCPGLSFGVAVIELTLANILLHFDWGLPNGMSPNDLDMTEAMGITVHRKSALLLKPSPLSPL

>CYP71 2012.8 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.27

44% to CYP71D.25 Jatropha curcas, some missing sequence including heme signature

probable pseudogene

65% to 2012.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00166.24

METLSYFLLTHGPQPMLTTLIIPLLSTRLLILLYLHRNKQSGSEKKRPPGPLALPIIDNHHQLGSLPHCSLAHLTKIYGPLMHLKLGQVPTLVVSSPKMAELLMKTYDHAFCSRPILVATNYLTYNGTYVAFAPYGSYWRHVRKICILELLSSKRVQSFGIVRKEEVRRLVDSIFLSSKAKALVNLRDVFLSLTNNVLCRVAFGKSYWEEEPELREIMKTS

(gap)

QKLTGLQRRLEKHLSQRDSFLEKVFAEHLLATHGKEEEEKDLVDVLLQLQKEGTPDFTLSTDNIKSVVMDMFVAGTATTATALVWGMSELMKNQLALKKAQD

(gap)

ELHYLKAVVKEILRLHPPGPLLVPRELIEDCNIEGYHIPVKTRVLVNAWAIGRHPYSWIDPEDFRPER

(gap)

AKGMPALAIVELALANVLLCFNWAMPDGKYPEDLDTNEASGLAVHKETSLPLVATPQTTSQ

>CYP71 2012.9 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.34

52% to CYP71AP5 Vitis vinifera, intact

76% to 2012.7 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.33

MADQQTAAILYTFLLCLLSLHLFWVWKRSGTKKKVPPGPSGLPIIGNLHQLGSMPHLTLARLAETYGPLIHLKMGQVPTLVVSSAKMAEEIMKTHDLTFCSRPALLSPRHLHYECSGIVFAPYGPYWRNVRRICVQELLRAKRVELESFRIVREAEVGHMIDTITSSSKAGKLVNLSEMFLSFSSNVICGVAYGKRYWEDGSELSEMMAQTDRLFGGFFVGDFFPYLDWVKYVTGLKRRLDKCFTIRDAFLEKVIDDHLLPSRGEIKDDQKDLVDVLLQLQKDGALEFPLTRDNIKAVVMDMFGAGIDTTSAILEWGMSELVKNPRVMQKAQEEVRRIVKSNHINKIKETDLHQFQYLKAVVKEIMRLHPPGPLLVPRESMEDCEIEGYHIPAKTRVLINAWAIGRHPDSWEDPEEFKPERFMDSSIDYRGQDFQLIPFGAGRRVCPGLSFGVTVLELTLANLLLHFEWGLPDGLNPNDLDMAEAFGLVVHRKSHLLLEATPLSAF

>CYP71 18619.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.22

58% to CYP83E30P Glycine max

56% to CYP71AU4 Vitis vinifera

55% to CYP71A1 avocado

97% to 18619.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold02359.1

MSELMKNQLAMTKAQDEVCGIAKSNNTNMIEERDLHQLHYLKAVVKEILRLHPSSPLLVPRELIEDCNIEGYHIPAKARVFVNAWAIGRHPYSWIDPEDFRPERFVGSNIDYRGQDFALIPFEAGRRGCPGIFFAMAIVELALAHVLLCFNWAMPDGKYPEDLDTNETSGLAVHKETSVPPVATPQTTSQ

>CYP71 18619.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold02359.1

57% to CYP83E30P Glycine max

55% to CYP71AU4 Vitis vinifera

97% to 18619.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.22

XFAEHLLATHGKEEEEKDLVDVLLQLLREGTPDFTLSTDNIKSVVMDRFVAGTATTATTLVWGMSELMKNQLAMKKAQDEVCGIAKSNNTNMIEERDLHQLHYLKAVVKEILRLHPPSPLLVPRELIEDCNIEGYHIPAKARVFVNAWAIGRHPYSWIDPEDFRPERFVGSNIDYRGQDFALIPFEAGRRGCPGIFFAMAIVELALANVLLCFNWAMPDGKYPEDLDTNEASGLAVHKETSLPLVATPQTTSQ

>CYP71 18619.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.31

61% to CYP83E30P Glycine max

56% to CYP71AH11 Thapsia villosa

98% to 2012.5 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.14

77% to 18619.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold02359.1

MFAAGTDTTATTLVWGMSVLMKNQLAMKKAKDEVRSIAKSNNTNMIEERELHQLHYLKAVVKEILRLHPPTPLLVPHESVEDCDIEGYFIPSKTRVLVNAWAIGRHPDYWVDPEVFRPERFIGSDIDYKGQDFALIPFGAGRRGCPGISFAASVIELALANLLLCFDWALPDGMNHKDLDMTEDSGLTVHKKTPLLLVATLPRTSC

>CYP71 18619.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.10

61% to CYP71AU4 Vitis vinifera

57% to CYP71J2 Muscari armeniacum

92% to 2012.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.32

82% to 18619.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.31

MFAAGTATTATVLEWGMSESIKNRSAMKKAQDEVRGIAKSNNKSMIEEKELQQPHYLKVVVKEILRLHPPAPLLIPHELVEDCDIEGYFVPSKTTVLVNVWAIGRHPDSWVDPEEFRPERFISSNIDYKGQDFALIPFGAGRRGCPGISFAMVILELALANLLLCFDWAMPDGMNNEDLDMTEGTGLFVLKKTPLLLVATRQALDSNSNGDW

>CYP71 18619.5 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold05343.1

61% to CYP83E30P Glycine max

59% to CYP71AP7 Nelumbo nucifera

80% to 2012.5 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.14

MFAGYVCSWDRYHCNNTSMGNVCADEEPIGNEKSQRRMVTKILQLHPPTPLLIPRKSVEDCDIEGYFIPSKTRVLLNAWAIGRQPVNWVDPEVFRLERFIGSDIDYKGQDFALIPFGAGRRGCPAISFAASVIELALANLLLCFDWALPNGMNHKDLDMTEDSGLTVHKKTLCY

>CYP71 20716.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold03082.1

46% to CYP71AP5 Vitis vinifera, N-term only

92% to 2012.5 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.14

92% to 20716.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.8

MLTTLIIPLLSTLVLLLLYLCRNKQSGSEKKRPPFPLGLPIIGSLHQLGSLPHRSLAHLAKIYGPLMHLKLGRVPTLVASSPKMAELIMKTYDHAFCSRPILVATNYLTYGSTNVAFAPYGSYWRHVRKICILELFSSKRVQSFGFVRKEEVEGLVDSIFVSSKAKAPVNLTEAFLSLSNNVVCRVALGKSYWEEEPELREIFESSRSLIGGFFVGDFFPSLEWVKYLTGFQRRLKKSFRHRDSFLEKVIAEHLLPTHGKEEKDLVDVLLQLQKEGNPDFTLSTDNIKAVVM

>CYP71 20716.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.8

41% to CYP71BG1 Solanum tuberosum, N-term only

93% to 20716.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold03082.1

94% to 2012.5 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.14

MHLKLGRVPTLVVSSPKMAELVMKTYDHAFCSRSILVATNYLTYGSTNVAFAPYGSYWRHVRKICILELLSSKRVQSFRFVRKEEVGRLVDSIFVSSKAKAPVNLTEAFLSLSNNVVCRVALGKSYWEEEPELREIFESSKSLIGGFFVGDFFPSLEWVKYLTGFQRRLEKSFRHRDSFLEKVIAEHLLPTHGKEDEEEEEEKDLVDVLLQLQKEGTLISPSLPITSKVLLW

>CYP71 20716.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold04578.1

44% to CYP71AP12 Catharanthus roseus, N-term only

86% to 20716.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold03082.1

84% to 2012.5 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.14

MNIPLLSILVLLFLYLCRNKQSGSEKKRPPFPLGLPIIGSLHQLGSLPHRSLAHLAKIYGSLMHLKLGRVPILVVSSPKMAELVMKTYDHAFCSRPILVPTNYLTNGSTNVAFAPYGSYWCHVRKICILELLSSKRVQSFRFVRKEEVGHLVDSILYPPKLKLRNNVVCRVALGKSYWEEEPELREIFESSKSFIGGFFVGDFFPSLEWVKYLTGFQRRLEKSFRHRDNR

>CYP71 20716.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.11

48% to CYP71AT60 Nelumbo nucifera, N-term only

95% to 2012.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.21

82% to 20716.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.8

MNPAAKPQSTKLNLSSFHPTHGLLHGHQPMFTTLITGLLSFLLLYLHHSNKSVRRPPGPSGLPIIGNLHQLGSLPYRSLAHLAKIYGPFMHLKLGRVSTLVVSSPKMAELAMRTHDRALCSRPIRAATNHLTYNSTDVVFAPYGPYWRNVRKICILELLSSKRVQSFRNVRKEEVGLLVDSIFVSSKAKAPVNLRDAFHSLTNNVVCRVALGKSYREDEPELEEILNSSQPLTSGFFVGDFFPSLEWVKYLTGFQRRLEKNLRQRDSFLERVIAEHLLPRAPKRGHP

>CYP71 32589.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00166.32

48% to CYP71AP1 Populus trichocarpa, N-term

55% to 32589.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00174.12

55% to 1022.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00174.10

MEPSSLSMPFCLALLFILLSLFCLTAMKKKPSSPKLPPGPPKLPIVGNLHQLTNHPHRALRDLALKHGSLMYLKLGQIPTLVVSSRSMAEALMKTHDYNFASRPSLTTGNHLLYNCTDIAFAPAGAYWRTIRKICVQELLSVKRVESFSAVREEEVGRLVRAVESSEGAIDLNKLFLSHTIDVICRVAFGRRYDEGGPSEVERLFRERTVLLGGFNFGDLFPSVEWLDLVSGLRRRMRRAFEEIDEFLEHVLEDHRGGTAETQNQRDLVDVLLQLQKDASLDLPLSDQNLKAVLTASSLSPSLSLSLFQISNRTVWWWEFETINSNSLKG

>CYP71 32589.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00174.12

52% to CYP71AP5 Vitis vinifera, N-term

85% to 1022.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00174.10

55% to 32589.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00166.32

MASLPQWLEKPSFLGFIFFSLSSILLFLSLTRSKREKGTTPKAKLPPGPPKLPLIGNLHQLSKLAHRSLRDLALKYGPLMFLQLGQVPTLVVSSPAMAKAVMKTHDLSFASRPQVNSAKHILYNSTDIAFSPYGSYWRNMRKICILELLSVKRVESFRFVRMEEVARMVETIERSKGAVNLSQLFLSLTNNIIGRVAFGKSYDKFYEVLNEVQILLGGFSLGDQFPSLDWIDVLTGIRARQKKTFRTLDAFMEMVIEDHLDPYTRPSNDEHKDFVDVLLEVQKRADLDFPFTRDNLKAVIL

 

>CYP72A 72.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00117.63

61% to CYP72A227 Nelumbo nucifera, intact

57% to CYP72A84 Coptis japonica

72% to 72.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00117.65

47% to 2350.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00042.17

47% to 4172.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00059.82

40% to 24367.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00002.51

41% to 24367.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00002.50

MEGVLLLCFALLVLWVTLKIGYAVWWRPRALEKHLEKQGIRGPPYKILFGDVKESNRLTQEAYSKPIDLSHQIVPRVIPFFAQTVKNYGKICVTWFGMTPRVIVMEPEMVKEVLSNKFGHFEKAPSNPLTKLLLLGLVAAEGEKWARHRRILNPAFHMEKLKGMVPEFILSCKEMIARWGKLVGEEGSCEIDVFPELQELTGDVISRTAFGSSYEEGKRLFQLQREQQDLVIQAIRNIYIPGFRFLPTKKNIRRKKIDKKVRGILKGIIQRKEEAINSGTYNSHDLLGLLLESNRTNDHKNRMTMEDVVEECKLFYFAGHETTSMLLTWTMVVLSKHPTWQERARDEVLQLVGSSTPPTLDQLSHLKIVNMILHEVLRLYPPILLIVRETYKKINAGGLDFPPGIQLALPTIIIHHDRDLWGDDAKEFKPERFSDGVSNAAKHPLAFFPFGWGPRTCIGQNFALIEAKIALTMILQHFSFHLSPSYTHAPYAQITMQPQHGAPIILHKL

>CYP72A 72.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00117.65

60% to CYP72A227 Nelumbo nucifera, intact

73% to 72.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00117.63

47% to 2350.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00042.17

47% to 4172.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00059.82

MEAALLICCCVVFISWVFTVKVGYAIWWRPRVLGKQLEKQGIRGPPYKLLYGNVKEINKLNQEAISKPMGHSHQIVPRIFPFFLETVQNYGKICVTWFGETPRVIIMDTELIKDILSDKFGHFAKPPVNPLVILLAQGLALAEGEKWARQRRIINPAFHMEKLKGMLPEFARCCKEMVERWEKLVGEDGNFEIDVLPELQNLTVDVISRTAFGSSFEEGKRIFELQQEQADLCIQAVRIIYIPGFRFVPTEKNMRRKKIHKKVRGIIQELIQKKETEIKSGTLYNHDLLGLLLESNNTNDNKSKLTLDDVIEECKLFYFAGQETTSTLLTWTMVVLSMHPTWQQRARDEVMQVIGSQYTYLPTLEQLSHLKIVNMILNEVLRLYPPGPLLLRQTYKRISLRGIDFPAGVELALPVIMIHHDRELWGDDADEFQPTRFSDGVSKASKHPFAFFPFGGGPRICIGQNFALIEAKMVLAMVLMKFSFHLSPLYTHAPCQQLTLQPQHGAPIILHKL

 

>CYP72 clan 24367.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00002.51

45% to CYP734A16 Picea sitchensis, intact

39% to CYP734A9 Populus trichocarpa

385 to CYP734A10 Populus trichocarpa

87% to 24367.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00002.50

84% to 24367.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00002.52

41% to 2350.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00042.17

MELELEWAWACVFAGVLCIMMGHLIKSVWLEPKRITEYFRAQGFEGPPYKILGIGNGVEIARLMNEARSVALPLDNNIMPVALPFYHLWSKLYGSSFLCWLGSKPVWCTDDPIAVKEVLMNKNGVIETTNLNPWIREALGRGILMLNGSDWERHRRIVIPAFGVDNLKEMVSRINESARNVIQRWAQKESTWDEFELDVFKEFKIFAADIIGTTSFGSDPGQAKRIIELLDEQIALAIADYSFVPGYRYLFLKRRWRSMKLNREIRKCMTELVEGRKKMAKRDNDLLGSMLEADRKEAGSGGLSTEEIIDECKTFFFAGHESTAVLLAWTFMLLGIHQEWQDRARAEVLKVLGTERIPSWSDVNKLTTVGMILNESLRLYPPAVAIVRKAVKDCKLGSICIPKDTQIFVPLLPMNHSETIWGDDAEKFDPNRFSEGSEKALGSFFPFGKGPRACVGQKLALLESKILMAMILQNFSFHLSQNYIHSPVVFITLYPQHGVPIILHALKR

>CYP72 clan 24367.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00002.52

41% to CYP734A16 Picea sitchensis, missing the C-term

38% to CYP721A29 Nelumbo nucifera

84% to 24367.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00002.51

MEWAWVGVFAGFLCIMVGHLIKSLWLEPKRKTEYFRAQGFEGPPYKILGMGNGVEIARLMTESRSMALPLDNNIMPVALPFYHLWSKLYGSRFLCWFGSKPALCTDDPIVVKELLMNNNGVLQTMIFNPSIKEALGRGILVLNGSDWERHRRIVIPAFGIDNLKEMVSRINESAKNVIQCWTQKARSCDEFELDVFKEFKIFTANVIGTTSFGSEPGQAKRIIELLDEQIALAIANYSFVPGYRYLFVKRRWRNMKLRREIRKCFTELVEGRKKMGKRDRDLLGSMLEANQKEAVNGGLSTEEIIDECKTFFFAGHETSAALLAWTCMLLGIHQEWQDSARAEVFEVLGTERVPTWSDVNKLKTIYLGNATITPKSLILNFVLAFQFYAPVT

>CYP72 clan 24367.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00002.50

46% to CYP734A16 Picea sitchensis, missing the N-term

41% to CYP721A29 Nelumbo nucifera

37% to CYP721A3 Populus trichocarpa

40% to CYP734A9 Populus trichocarpa

87% to 24367.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00002.51

MVYIGSRFLCWFGNKPVLCTDDPIVVKEVLMNSNGVLESMNFNPSVREALGRGILILNGSDWERHRRIVVPAFGVDNLKEMVSRINESGRNVIQRWTQKASTCDEFELDVFKEFKIFTADVIGTTSFGSDPGQAKRVIELIDEQIALAIADYSFVPGYRYLCVKRRWHSMKLNREIKKCLTELVEGRRKMATRDSDLLGSMLEANQKDADNGGLSIEEIIDECKTFFFAGHESTAVLLAWTCMLLGIHQEWQDRARAEVFEVLGTDRVPTWSDVNKLKTVGMILNESLRLYPPGVAIVRKAVMDCKIGSICIPKDTQIFIPLLPMNHNETTWGEDAEKFNPNRFSEASEKASFFPFGKGPRACVGQKLALLESKILMAMILQNFSFHLSKNYIHSPVVFITMYPQHGVPIILHALKR

 

>CYP73A 919.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00077.91

87% to CYP73A104 Jatropha curcas, intact

69% to 919.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00025.258

same as Ambtr1_0_15-AmTr_s00077_61-Amborella_trichopoda

MDLLLAEKVLLGLFVAIVTAITVSKLRGKRLRLPPGPLTIPIFGNWLQVGDDLNHRNLSDLAKKFGDVFLLRMGQRNLVVVSSPDLAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGWEDEIGRVVEDVRNNLAAQKEGVVLRKRLQLMMYNNMYRIMFDRRFESEDDPLFVKLKALNGERSRLAQSFEYNYGDFIPILRPLLRGYLKLCKEVKERRLQLFKDYFLEERKKLASTKGSSGDLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPHIQAKLRAELDSVLGPGVPITEPDTYKLPYLQAVIKETLRFRMAIPLLVPHMNLHDAKLTGYDIPAESKVLVNAWWLANNPDNWVRPEEFRPERFLAEEARVEANGNDFRYLPFGVGRRSCPGIILALPILGLTLGRLVQNFELLPPPGQDKVDTTEKGGQFSLHILKHSTIVAKPRVF

>CYP73A 919.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00025.258

73% to CYP73A81 Vitis vinifera, intact

69% to 919.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00077.91

MKPTFFIPLIFLLLSQFLPLNLSIALSLSLLLFSIFKSSARDSNLPPGPLALPLFGNWLQVGDDLNHRFLASLAQKYGNVLLLKLGCRNLVVVSDPQLATHVLHTQGVEFGSRPRNVVFDIFTGKGQDMVFTVYGDHWRKMRRIMTLPFFTAKVVQNHKEEWENEIDLVARDLEKDSRVREEGIVIRKRLQLMLYNIMYRMMFDYRFEAMDDPLFLQATKFNAERSRLAQSFDYNYGDFIPLLRPFLRSYLNRCKDLQSKRLAFFNNYFVENRRKVMAKNGERHQIKCAIDHIIEAERKGEITSDNVLYIVENINVAAIETTLWSMEWALAELVNHPRVQAKLRHELSTVLAGKPVTESDLDNLPYLQAVVKESLRLHTPIPLLVPHMNLEEAKLGGYTVPKESKVVVNAWWLANNPAWWQNPQEFRPERFLEEEKKTEALVGGKVDFRFLPFGMGRRSCPGIILALPILGLVVGRLVSEFELLPPPGAEKVDVSEKGGQFSLHIANHSTVVFRPLEA

 

>CYP74A 2528.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00059.204

58% to CYP74A27 Ricinus communis, intact

MALSYPKILVSASVTPEIPIVSAKSTKFPLISASVTPETPRFSTKAPKLPPREIPGSYGLPILGPISDRLDYFKGRDEFFKSRMQRYQSTVYRTNMPPGPPIASDPRCIVLLDGVSFPVLFDNEKVEKKDLFTGTYMPSVELTGGYRVLSYLDVREPSHSRLKRFLFGVLEASRNRIVPEFSTAMTELFSEVEDKLSADGKADFNSPNQQACFNFLARALLGHDPAEPGPDKLGKDAPTLIQKWVAFQLYPILSLGLPTPIEEVLLRTTGLPTFLVKNDYERLFKFFNSSKTKPLEIADELGIDRVEASHNLLFATCFNTWGGLIIVLPGLMKWVGRAGATLHRELAQEVRAAVQATSQHSSSGLSPAALAQMPLVKSCVYEALRIEPPVPTQYGRARKDLIIDSHISSFRVRAGEMLCGYQPFATRDPLIFDRPEEFVAKRFMGEEGEKMLNYLLWSNGKETEDTTENNKQCAGKDFVVMVARLFLAELFLRYDSFDVEISSAKLGSAVAITSLKRATF

 

>CYP75B 5415.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00110.124

60% to CYP75B15 Gerbera hybrida, intact

63% to CYP75B65 Podophyllum species

39% to 1669.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00022.287

MAAVAAVLLYFLLRPSHRNRGGLPLPPTPGWAWPVLGHLPLLGLIPHHSLAALAKKHGPHFLLLNLGTTSPTLVVSSPAAVRSLLKSLDPLVSSRPPNAGATHMAYNYQDLVFAPYGPRWRLLRKLCNVHLFSQKALDHFSSVRESEAQDLVSRLSSSRSAAVTIGPMLTDCTTNALGRTMLGRRVFVPGEGGEFREMVLELMVLAGVFNIGDFVPELEWLDLQGVVKKMKRLHKRFDDFFERMIEENSNGGEMCFLGVLMALKEDADGEGSKISRREIKALLMDLFTAGTDTSSSTVEWAIAELIRHPSLLDALQLELDSVAGRDRLVLESDLPNLTLLQAIIKEIFRLHPSTPLLLPRIVAEDCEAMGYHIPKDTRVLINAWAISRDPDVWKDPLEFKPVERFMPGAPTAHMDVKGNDFEFIPFGAGRRICAGMSMGIRNVQFLTAALVHAFDWELLEGETPEKLNMEEVYGLTLQRKVPLVVKPKPRLAPHVYANAAK

 

>CYP76 181.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00018.128

49% to CYP76Y7 Solanum tuberosum, intact

72% to 181.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.230

56% to 181.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.222

52% to 181.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.211

72% to 20692.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00067.195

MGKDWGSLPWLMSMLICLYTLVVWAGRKSPKLPPGPKGLPLLGSLLELGNRPHAALATLAKTHGPLMTLRLGLRTVVVASSSDMAKEVCQKNDHALASRFAPEAIKVDSHDQYSIAWGGISPLWRNVRRVSTTHLFTKQQVESQEFLHHQKVQQMVGIIEKDCAAKRAVAIRRVAFLTGINLLSNMIFSVDVVDPEASEFKQLLSSLGEELGRPNVADYFPLLRHFDLQGIQRRAAGCIKKLHQIFNEKIEERLRFRESGQPRCGDFLDILLDPIDAKGSKFSRAEILSLIIELYFGGSESNSITVEWAMAELLHNPAQMATVKQELSEKVGHQRAVEEADMDRLPYLQAVIKESLRLHPPGPLLLPRRADATVEIAGFVIPKHTTVVINVWAISREARTWENPTTFSPERFIGSDVNYKGGDFSFIPFGAGRRICPGLLLAERIVQLMLASLLQSFDWELPLGWKPEEMDMSEELGFTLHKKVPLEVIPMKKN

>CYP76 181.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.230

46% to CYP76Y6 tomato

72% to 181.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00018.128

63% to 20692.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00067.195

MDWVSVAWVMSMLICVHTIIVRACSFTTRKLPPGPKGLPLVGSLLEFGNRPHEALATLAKTHGPLMTLRLGLQTMVVVSSSDMAKEVYQKNDHALAGRFIPLALKVESHDQNTLVWAQIGPQWRNFRRFCTTQLFTKQRLKSQEVLRHQKVRQMVGLIEKDSAAKRAVAIRRVALLTALNLLWNIIFSIDMVDPEP

(28 aa gap)

FDPQGIQRQAAGCIKKFHQIFNDKIEERLRSRESGCPRCGDFLDSLLDPIDEKGSKFSRAEILALILELNLAGASTAAVVVEWAMAELLQNPEKMATVKQELSKTVGYERPVEEADMDRLPYLQAVIKETLRFHPPGPLFLPHRANATVEVAGFIIPKNTTVVINYWAISREACTWENPTTFSPERFMGSDINYKGRDFSFIPFGGGRRICPGLPLGERMVQLLLASLLHSFEWELPLGCKPEEMDMSDKLGLALHKKVPLEAIPMKKN

>CYP76 181.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.222

53% to CYP76Y5 Solanum tuberosum , intact

62% to 181.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.211

MYFCWEKLVPNKSGRLPPGPTGLPIVGSLHKLGAKPNEALTALARTHGPIMTLRLGFLTTVVVSSSDMAREVLQKNDQAFAGRVILDAVTVDSHHNFSIAWGQVGPYWRTLRRLCNTQLFTTQRLDALQALRHRKVHELLELVDQYSDARKAVHMGRMAFVTSLNLLSNMIFSSDMVDPQSESVGELKELIWSIMEGVGTPNIADYFPFLRPLDPQGIKRKNIVQVRRLHQLLNEKIDERVGARERGQPIYGDFIDVLLDYSDQESGSKFSRAGILAPLVDMYLAGSDTTATTLEWAMAELLHNPEKMAAAKQELKENIAGSMHTVQESDLGRLPYLQAVVKETLRLHPPVPLLLPHRADVTVKVSGYVIPEHTQVLVNAWAIGRDVQVWENPTAFIPERFVGSNIDFKGRDFQYIPFGAGRRICPGLPLGVRMVHIMLASLLHSFYWELPDGLKPEEMDIKDKFGVTLQKAVPLVAVPVKYLGGVAA

>CYP76 181.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.211

48% to CYP76F14 Vitis vinifera, retained intron

62% to 181.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.222

80% to 20692.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold01143.2

MEQVLWSTGACALSLLFCALALALMLLTGKRQSHLPPGPKGLPMVGSLHRLGSRPHEALAALAETHGSLMTLQLGFMTTVVVSSSEMAKEVLQKNDLVFGGRTVIEVLKMRSYPEGSLVWAQTGPRWRALRRICTTQLFTPQRLDSLQALRCQKVHEMVELIRQAEPAVDIGRAAFVTSMNIISNMIFSADMVNPNSGSAQEFRDVVWAIMEVAGAPNLADYFPMLKALDPQGLKGRCNKLFGRLHQFLNVKIDERLQSRERGGVDRGDFIDAILDSKQENGVDFSRSEILALLTVRHYPRLCYAENEKDLFVAGSDTSSTTVEWAMAELLRNPDKMAMANMELSRILGGPEHIMEELDISRLPYLQSVVKETWRFHPPVPLLIPHRADATVNVAGYIVPKHTQVLINYWAIGRDPKVWDNPTAFLPERFLGCNVDYKGKDFQFIPFGAGRRICPGLPLGVRMVHLILASLLHYFDWGLPDGMKAEEMDMRDKFGVTLQKLVPLRVIPVQSS

>CYP76 19260.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00011.119

51% to CYP76Z1 Picea sitchensis, intact

41% to CYP75B13 Pinus taeda

41% to CYP706C14 tomato

MLLIVVAVSTLIFLLLTFLISNYTSAKAQAPSPPKWPIIGHLHLLGKLPHQSLAALSLTYGPIMPFKLGMRKAVVISSPHPAKQIFKTHDRKFSSRPVPLAAKTLSYGGNSLVWAAYGHHWRLLRRLSFTELFSTKRLNSMEKFRKAEVSKTMASIYEESIKGNSVNIGSTVFSTMLGIVENMVCGNYVFKKGDELATELKGMVRDVLKLSGEPNASDFFPFLRGLDLQGVERRAQKLRERFDGIFSEMIERRLKDMREKGMVNERDEESGRGIKESDFLGVLLELMDHNEGLQMEHVKGMLMDMFIAGTDTTSATVEWAMAELLNHPYVMEEARDELRRVIGKDKMMEESHIPDVPFLQAIVKEVLRLHPAAPLLIPRLCDSDCQIDGHIIEKNTEVLVNVWAIGRDPKVWSDPLKFDPSRFVGTNLEFKGNDYELLPFGAGRRICIGMPLASSMVHLVLGSLLHYFNWKVEGEVDMTEEFGITLQKALPLVVVATPSLPLNPYL

>CYP76 20692.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.217

44% to CYP76F31 Nelumbo nucifera, missing N-term and C-term

49% to CYP76F15 Vitis vinifera

81% to 181.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.222

59% to 20692.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold01143.2

MTLRLGYRTTVVVSSSDMAQEVLQKNDQAFAGRTTLQAITAESHHRFSIAWAQVGPYWSTLRGLCNTQLFTTQRLNALHALRHRKICELLELVRQYSDARRAVDIGHVAFVTSLNLLSNMIFSSDMVNPQSESAEEMKELVWSIMEVVGTPNIADYFPILRPLDPQGIKRKTVILVRRMHQLLNVKIDERVRVRESGQPICGDFIDVLLYYSDQESGSKFSRAEILAFLSA

>CYP76 20692.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold01143.2

46% to CYP76F14 Vitis vinifera, missing C-term

78% to 181.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.211

92% to 20692.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00084.14

MPMEQSLRSTAACSLSLLLCALALMVLIRKRHSHLPPGPKGLPMVGSLHRLGSRPHEALAALAETHGCLMTLQLGFVTTIVVSSSEMATEVLQKNNLAFAGCTVIEVMKIKSHYNGSLVWAQMGPRWQALRRLCNTQLFTPQRLDTLQALRYQKVHEMVELIRQTEQVVDIGRVAFVTALNLVSNMIFSTEMVDPKSGSAQEFEDVVWSIMEVSGAPNLVDYFPMLRGLDPQGLKGRSNKLFERLHQLLNVMIDERIQSREKGGVAKGDFIGVILDSNQENGVEFRRNEILALLTVQHYPCLCYAENEK

>CYP76 20692.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00067.195

42% to CYP76Y5 Solanum tuberosum, missing C-term

72% to 181.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00018.128

MEWPSLTWLMSMLICLYTIVVCAGSFTTRKTPKLPPGPKGLPLLGSLLELGNRPHAALATMAKIHGPLMTLQLGLQMVVVVSSSDMANEVFQKNDLALAGRVVPEALKVESHDQCSLTLAQISPLWRNLRRVCKIQLFTNQRLKSLEVLRHQKVQQMVGLIEKDCAATRAVAIGRVTFLTALNLLSNVIFSVDMIDPESESAKELEELLSSLSELITRPNIATYFPLLRPFDPKGIQRHAAGCIEKLHRIFNEKIDNRSRFRESGWPTCGDVQVQSCRDLGSDLGTLFGRDWYNNCSSGMGNGGIATQR

>CYP76 20692.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00084.14

50% to CYP76F14 Vitis vinifera, N-term only

92% to 20692.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold01143.2

MEQAFWSTAACALSLLLYALALMVLIRKRHSHLPPGPKGLPMVGSLHRLGSRAHEALAALAETHGSLMTLQLGFVTTIVVSSSEMAKEVLQKNNLAFSGCTVIEVMKIKSHHNGSLVWAQIGPRWQALRRLCNTQLFTPQRLDTLRALRYQKVHEMVELIRQTKQVVDIGRVAFVIALNLVSNMIFSTEMVNPKSGLA

>CYP76 41257.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.209

35% to CYP76H10 rice, region before I-helix

68% to 20692.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold01143.2

68% to 181.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.211

61% to 41257.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00084.13

MSFGRSWQWPVHPTLPTISRCLRPSTQGLKRPCTKLFERLHHFLIVKIDERPQSRQKGGVARGDVIDVILDNLLDSNQEDGVEFRHSEILALLIVRQYHGLCYAENQK

>CYP76 41257.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00084.13

43% to CYP76F31 Nelumbo nucifera, region before I-helix

92% to 20692.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold01143.2

80% to 181.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.211

59% to 20692.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.217

61% to 41257.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.209

MEVSGAPNLADYFPMLRGLDPQGLKGRSNKLFERFHQLLNVMIDERIQSREKGGVPKGDFIDVILDSKQENGVEFKRNETLALLTVQHYPCLCYDENEK

>CYP76 32463.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.219

64% to CYP76T17 Vitis vinifera, C-term

88% to 181.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.222

70% to 32463.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00084.12

MYAAGSETTATTVEWAMAELLHNPNKMAMAKQELKENIGSTMHTVEETDLGRLPYLQAVVKETLRLHPPVPLLLPHRADVTVKVRGYVIPKHTQVLVNAWAIGRDVQVWENPTAFIPERFVGSNINYKGRDFQYIPFGAGRRICPGLPLGVRMVQIVLASLLHSFDWELPDGLKPEEMDMRDKFGVTLQKAVPLEAVPVKGEGSLRVE

>CYP76 32463.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00084.12

62% to CYP76T17 Vitis vinifera, C-term

70% to 32463.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.219

85% to 181.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.211

MAELLRNPDKMAMAKMELSRTLGGPQHIVEESDISRLPYLQAVVKKTWRLHAPVPLLIPHRADTTVNVAGYIVPKNAQVLINYWAIGRDPKVWGNPTTFLPKRFLGSNVDYRGKDFQFIPFGAGRRTCPGLPFGVHMVHVMLTSLLHYFDWELPDGLKAEEMDMRDKFGVTLQKLVPLRLIPRQGS

>CYP76 32467.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.214

61% to CYP76T17 Vitis vinifera, C-term

94% to 32467.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.215

MTMAKMELSRTTAVVKEIWQLHPHVQLLIPHKTDTIENVAEYIVPKHTQVLINYWAIGRDPKVWDNPIAFLPERFLGCNVDYKGKDFQFIPFGAGWKTCPGLPLGVRMVHLMLASLLHYFDWELSGGLKAEEMDMRDKFGVTLQTLVPLRAIPSEARDLQCA

>CYP76 32467.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.215

65% to CYP76T17 Vitis vinifera, C-term

94% to 32467.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00032.214

MLLWLTILQSKKTSVWYSLFHVKSVECPSNIANCGPPCVLEGRGSFNSGLVSYLCGRWQSGWAVVKEIWQLHPPVQLLIPHRTDTIENVAEYIVPKHTQVLINYWAIGRDPKVWDNPTAFLPERFLGCNVGYKGKDFQFIPFGAGWRICPGLPLGVRMVHLMLASLLH

>CYP76 pseudogene 32419.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00018.44

52% to CYP76T13P Vitis vinifera, EXXR defective, missing PERF

90% to 32419.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold04502.1

MAELLHNPDKMAMAKMELSRTLGGPQHIVEESDISRLPYLQVVVKETWWLHAPVPLLIPHRADTTGNDFQFILFGARRRTCPGLPLGVHMVHLMLTSLLHYFDWELPDGLKAEEMDMRDKFGVTLQKLVPLRLIPRQGS

>CYP76 pseudogene 32419.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold04502.1

53% to CYP76T13P Vitis vinifera

90% to 32419.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00018.44

same as Ambtr1_0_15-AmTr_s04502_1-Amborella_trichopoda

ELFTVGSDTSSTSVEWAMAELLCNPDKMAIAKMELSRTLGDPQHIAEESDISRLPYLQAVVKKTWRLHAPVPLLIPHRADTTGKDFQFIPFGVGRRICPGLPLGVHMVHLMLVSLLHYFDWELPDGLKAEEMDMRDKFGVTLQKLVRLRLIPRQGS

 

MREPCFYGPQ

ELFTVGSDTSSTSVEWAMAELLCNPDKMAIAKMELSRTLGDPQHIAEESDISRLPYLQAVVKKTWRLHAPVPLLIPHRADTT

VNVAX

 

>CYP77A 3753.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00040.202

56% to CYP77A23 Jatropha curcas, intact

49% to 10640.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00062.27

MALLYLFSILSALLFCYLFLSSRKTKALKLPPGPKGWPLVGNLLQIARSGKPFVFIVNELSQKYGPIFTLKMGARTLIVISSAELAHEALIQKGQTFANRPAETPTRAIFSSHKKTVNSAEYGPLWRSLRRNMVQGMLTPAKLRAFRPIRRKALDKLVERLAAESKSGLVRVLSNCRFTVFRILLCMCFGVEMDENMIEKVDSVLKKVLITLEPRIDDFLPILQAIFVKKVAHAKHVRKEQLETLLPLIRSRKKTIQNAMSAEPAYIDSLFDLDMGQGPPSEDMLVTLCAEFLNGGTDTTATAVEWAMAHLVADSEIQTRVRAEIDRVSPDHRVNDEDVEKMEYLQAFVKETLRKHPPTYFLLTHAVTEKSTLGGYDIPEGVNVDFYTPSISDDPKLWGDPERFRPERFVDKMDGDDDADLTGVKGVKMMPFGVGRRICPGLGLGMLHISLMVATMVQQFEWLPNPAVPRVDMSEKFEFTVLMKTPLLAIAQPRKK

 

>CYP77B 10640.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00062.27

70% to CYP77B8 Saruma henryi, intact

47% to 3753.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00040.202

MSMSISISISSLSSSFHLSDILFVVTCLAIASLWWQRWSRTGGGRTGLPPGPPGWPIIGNLGQVVLQNRPFIFVVRDLRAKYGPIFTMQMGQRTLIIITDAALIHEALIQKGPLFASRPVDSPTRLVFSVGKCTVNSAEYGPLWRTLRRNLVTEVISPSRVRDFSWIRTWAMKNHLERLKLQAQEKGFIEVLSSCRVTISSILVCICFGAKVAEDEILKLDNVLKDIMLLSAPKLPDFLPIFTPLFRGQLKFARELRKTQMECLVPLIERRQAFLNGGEDSDMVSPKGAAYIDSLFDLEVEGRGKLGHEELVSLVSEIINAGTDTSATTIEWATLHLVLDQKLQEKLYREIIEVVGKDGAITESGVEKMVYLGAIVKETFRRHPPSHFVLSHAAIKDTTLAGYRVPSDASVEFYTAWLSEDPNMWEDPKEFRPERFLVGDGKDVDITGSRHVKMMPFGIGRRICPAWTLGTLHVHLMLARMVQAFRWVPDESAPPDPTETFAFTVVMKNPLRARIVPR

 

>CYP78A 1806.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00027.36

60% to CYP78A86 Nelumbo nucifera, intact

49% to 5009.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.173

MDSTVMDNWWLLAVPANCFLFSALNAFLLVFFSFMATMCVYWAWPGGPAWGKYWSAKGLFRRAGPTIPGPRGWPLIGSLNLMTGLPHRRLQATASRLGAVRLMAFSLGETRAIITSHPDVAKEILNSSAFADRPIKESAYGLMFHRAIGFAPYGPYWRGLRRIAATHVFSRKQINGSEPRRLEIAALMTDALAEAAKDGRDFRIRRLLKRASLNNVMATVFGRRYEFDQAEPEAVELSQLVEEGYEILGTLNWSDHLSLLDGLDLQGVRRRCSKLVPHVNRFVKGLLEENRVGLAGETANFARVLMSMEGSEKLSEDDMVAVLWEMIFRGTDTVAILIEWALARLALHPDVQARVHEELDIVVGPTRHISEADLPNLPYLNALLKETVRLHPPGPLLSWARLSTVDTTVDGRHVPQGTTAMVNMWAIARDPSLWPDPLAFRPERFLDGEDFSIMGSDLRLAPFGSGRRSCPGKALGLKSVTIWVAYLLHEFEWRPSDKEPVDLTEVMRLSCEMKRPLAVKPWPRRR

>CYP78A 3724.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00010.314

69% to CYP78A89 Nelumbo nucifera, intact

68% to CYP78A39 Vitis vinifera

49% to 1806.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00027.36

MASILGSVISSSKDSNWWVFTVPAYLGTNCFAGLGLTDSWTCTAILITFFSLALLSWAFTSGGLAWKNNRAKLGSRPIPGPRGLPILGSILAMSRGLAHRTLAGMAKVHKATELMAFSLGSTPVVVASEPVTAREILTSPNFADRPVKKSAKTLLFERAIGFAPNGTYWRMLRGIAASHLFAPRRVAAHEPGRQADCAAMLSAMARDQACDGAVTIRPHLQNAALNNIMGSVFGKRLDLEKENREVQELKEMVREGFELLGAFNFSDYLPFLGWFYDPLRIVARSEMLVPRVQKLVRGIIAEHRQRHDGASTLADAADFVDVLLSLQGEEKLEENDMVAVLWEMIFRGTDTTALLTEWALAELVLHPSVQTKLRTEIDTLLDPTEPLSDAAVAKLPYLSAVIKETLRAHPPGPLLSWARLSTSDVQLSNGMLVPAGTTAMVNMWAITHDEGVWDRPEEFRPERFVVAEGGEAVDVRGSDLRLAPFGAGRRVCPGKSLGLVTVAMWVAKLVRHFEWVQPPDSPVDLSEVLKLSCEMKNPLRAIAVPRVGIM

>CYP78A 5009.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.173

62% to CYP78A84 Nelumbo nucifera, intact

49% to 1806.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00027.36

MPFGMDSIWLLFAMAYSAGSPLLQWQTLTLIFLSLSILVFSHWLTPGGFAWSLVKTTQTHINGPFGFPFLGQFFMFSSPLAHSKLASTAKYLNSTGLMAFSLGFTRVIISSSPLTAKDILNSPSFANRPIKESAYNLMFHRAMGFAPYGDYWRNLRRISATYLFSPRRIEGSSFYRKVCGERMIEEIAVAMKRERVVAVRKILHLGSLNHVMKVVFGRDFDFNRGDGIELMDLVREGYELLGSFNWGDHVHFLGWLDLNGVRKRSKNLACRVRSFVGKIIEEHRAKGEANGVLGDGGGDFVDVLLNLHGEEGLGDSDMVAVLWEMIFRGTDTVAILLEWILARMVLHPEIQSKAQFEIEEFAGRFTGKTIPTFDSGINELPYLQAIVKETLRLHPPGPLLSWARLAITDVHIGHSFIPQGTMAMVNMWAITHDENIWENPNNFEPERFMREKVGVLGSDLRLAPFGSGRRVCPGKAMGLATVHLWLAQLLQNFRWLPSLDEKESVDLSERLMLSMEMERPLVCRALPRKSGIVNG

 

>CYP81 164.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00066.178

46% to CYP81Q35 Nelumbo nucifera, intact

48% to CYP81B54 Ricinus communis

74% to 164.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00066.179

72% to 164.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00066.180

70% to 164.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00066.184

69% to 164.5 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00066.181

67% to 32537.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00066.185

MDLMLLLAILLSLSSLYVIRSKASNANLPPGPRALPFIGHFHLLKSPLARSLSHLSSKYGPIFSLRLGMKPVVVVSSPSLAQECFTKNDLPFASRPRLAVGKYLGYDYNTVVMGPYGAHWRTVRKIQTLELLSLKKVEMFAEVRYEEVSSLLRNLVESSDREAVVNMKDKINETIFSVIVKMVANKSYYGCDGVDNREDAKEFREAIDETFMLMGQLNLGDYIPSLGWLDLQGLIRLMKALHRKRDRILQGLVDEHRKLRSEGEIFMPDFVHMLLDMKEKDPEYFTDNLIKSVFVVMITAGTETTAGTLEWALALLLNHPEALHRAQTELDHHIGRERLVQESDLSKLEYLRAIINETLRLYPPGPTIHESTEKCTLAGYTVPKGTMLLVNSYCIHRDPDSWPEPLSFKPERFMGSGIDIKGHDFRMIPFGSGRRSCPGMGLALRSVEYVLASLLHGFEWRRESPELIDMTEGGGLSLPRMVPLRAIVTRRLSPHVYPIV

>CYP81 164.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00066.179

48% to CYP81B54 Ricinus communis, intact

88% to 164.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00066.180

75% to 164.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00066.178

MDLVWVLAFFSFLAAFYVIKSKISNVNFPPGPPSLPFIGHFHILKPPLHRTLSHLSKKYGPIFWLRLGMKPVVVVSSPILAKECFTTNDIAFASRPRTAAGKYLGYDYISVVWAPYGDHWRTLRKIQTVELLSSKKIEMFANVRREQVAALFQSLLESSDEGEVVNMKDKITETIFSVIVKIVANKSYYGCGVEDLEVAKEFREVIDETFVLTGKLNLGDYIPFLRWIDLQGMTRLMKLLQRRRDRIMQGIVDEHRKLRSSGGGQLKPDFVHLLLDMKDKDPEYFTDDLIKSTIVVMITAGTETTAVTIEWVLALLLNHPEALQKAQTELDQQVGRERLVEESDLPKLEYLRAVLYETLRLYPPGPTLVPHESNTKCTLGGYTIPKGTLLLVNAWHIHRDPDVWPEPLSFKPERFIESDIDVKGQDFRVIPFGSGRRSCPGMGLALRSVEFVLANLLHAFEWRREGTELLDMSEGVSLTMPRAVPLKAFATPRLSRQLYPIA

>CYP81 164.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00066.180

48% to CYP81B54 Ricinus communis, intact

88% to 164.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00066.179

MDLVWILAFFSFLAAFYVLKSKISNVNLPPGPPSLPFIGHFHILKFPLHRALSHLSKKYGPIISLRFGMKPVVVVSSPSLAKECFTTNDIAFASRPRTAVGKYLGYDYLSVVWAPYGDHWRTLRKIQTLGLLSSTKIEMFANVRREQVAALFQSLLESSDEGEVVNMKDKITETIFSVIIKIVANRSYYGCRVEDQEAAKEFREVIDETSVVMRKLNLGDYIPFLRWIDLQGITRLMKVLQRKRDRILQGIVEEHKKSRSSGGGQLKPDFVHMLLDMKEKDPEYFTDDLIKSTIVVMIAAGTESTAVTIECALALLLNHPEALQKAQTELDQQVGRERLVEESDLPKLEYLQAIIYETLRLHPPGPILVPHESDAKCNLGGYTVPKGTMLLVNAWHIHRDPDLWPEPLSFKPERFIESGIDVKGQDFRVIPFGSGRRSCPGIGLALRSVEYVLASLLHAFEWRKEGTELLDMLEGVGLKAMPLKAFATPRLSRQLYPIA

>CYP81 164.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00066.184

46% to CYP81Q35 Nelumbo nucifera, intact

84% to 164.5 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00066.181

68% to 164.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00066.179

MELMLLVAFLLILATLYLAKEKSSTVNLPPGPRPLPFIGHFHLLKRPLYRSLSDLANQYGPIFSLRLGIRPVVIVSSASLAQECFSKNDITFASRPRLALGKYLGYNYMSVAWAPYGAHWRNLRRIQTLELLSSRKIEMFAYIRHEQVVALLQSIVEASDRGEVVQLKDRINETIFNSIVKMVAGKSYYGCGAKDLDEAKAFKRAIDETFTLSALFNMGDFIPWLSWLDLRGIRLMKALQRKRDKLVQSIVDEHRKLRSGECYALKPDFIHMLLAMKEEDPNYFTDDLIKSLVVVLIVAGTETTAVTLQWALALLLNHPDSLHKAQTELDQQVGRDRLVEESDLSKLRVPRAIINETLRLYPPVATLVPHESTAKCTLGGYTMPKGTILMVNAWHIQRDPYSWPEPLNFKPERFMATEADVKGQDYRVIPFGSGRRSCPGMGLALRSLEYVLASLLHAFEWERESPELVDMTVGAGSLLKMAVPLRALTTPRLPPHVYPPV

>CYP81 164.5 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00066.181

47% to CYP81B54 Jatropha curcas, intact

84% to 164.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00066.184

MELMFLVAFLLILAALYVAKGKNSIVNLPPGPRPLPFIGNFHLLKRPHYRSLSDLANQYGPIFSLRLGIRPVVIVSSASLAQECFTKNDITFASRPQLAFGKYLGYNYMSVAWAPYGAHWRNLRRIETLELLSSRKIEMFAYIRHEEVAALLQSIVEASDRGEVVNLKDSIEETMFNAIVKMVADKSYYGSRAKDLHEAKAFIEVINETFTLSGVLNIGDFIPWLSWLGLRGIRLMKALHRKRDRLIQRIVDEHRKLRSGDGHVFKQDFIHMLLDMHEEDPNYFTDDLIKSIIQVMIVAGTETTAVTLQWAIALLLNHPDSLQKAQTELDQQVGRDRLVEESDLSKLEYLRAIINETLRLYPPAATLLPHESTTTCTLGGYTVPKGTMLWVNAWHIQRDPCAWSEPLRFEPERFIGSGVDVKGQDFRVIPFGSGRRSCPGMGLALRSLEYVLASLLHAFEWRREGPEPVDMTDVGISLKMAAPLRALATPRLEPHVCLLA

>CYP81 32537.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00066.182

38% to CYP81B54 Jatropha curcas, N-term

40% to CYP81B54 Ricinus communis

83% to 164.5 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00066.181

57% to 32537.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00066.185

MELMFLVAFLLILAALYVAKGKNSIVNLSPGPRPLPFIGNFHLLKRSLHRSLSDLANQYGPIFSLRLGIRPVVIVSSPSLAQECFTKNDITFAFRPRLAFGKYLGYNYM

(gap)

KIEMFAYIQHEQVAALLQSIVEASDRGEVVNLKDSNEETMFNAIVKMVADKSYYGSGTKDLDEAKAFIEAINDTFTLSGVLNIGDFIPWLSWLGLRGIRLMKALHRKRDRLMQHIVDEHRKLRSGEGHVFKPDFIHMLLDRKEEDPNYFTDDLIKSIIQLFMRTPPGCIGPLNMIASLVWLPLLLSFLYHVKEDFVACLCL

>CYP81 32537.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00066.185

42% to CYP81B54 Jatropha curcas, N-term

71% to 164.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00066.179

MDLILILTFCIFLATLYAIKRKSSFVNCPPGPQPWPVIGHFHLLKPPLYRSLSQLSKQYGPVFSLWLGKRFIVVVSSANLAQECFTTNDITFASKPQLAVGKYLGYDYTSVVWAPYGAHWRNVRKIQVLELLSSKKIEMFACIRQEQVSALLQSLVEASNREKVVNMKDRITETIFSIIVKIVANKSYYGCAVQDLKEAKEFREAIEETFLLTGKVNFGDYIPFLKWVDLQGITRLLRALGRKRDRIMQQIVDEHRKLRSSENDNLKPDFVHMLLAMQENDPDYFTDDFN

 

>CYP82 276.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00059.227

56% to CYP82D14 Vitis vinifera, fusion to anotehr C-term piece, top part intact.

End modified

55% to CYP82D30 Glycine max

55% to 276.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00059.230

53% to 276.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00059.231

52% to 276.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00059.226

MKSHTHMPSQQAQQTSMDYLLLLQPILAIFFALFLHQIWLKIKKSKNTYAKEAPEPGRAIPVIGHLHLLSGSKLLHHKLAEMADVYGPAFTLRLGRRRTLVISNWELAKECFTTNDKNFANRPRDSAAKLLGYDLAMIGFAPYGPYWRETRRIATLQLLSNRRLESLKHVRSSEVDASIREIYELWKEKERRAVEVNIQQKLLDLTFSTVVRMVAGKRFLRDGEDNEEGKRFRELIEEQFYLAGTSVVSDAVPILEWVDFQGTLKSMRRVAKEVGEIVEGWVSEHRRKRATGETEAAQDFIDVLLSLVEDGSYSSSIDPAIFIKANVVNLVAAATDTTAITMTWALSLLLNNRHALRRAQAELDLHVGKDRNVDESDVKNLTFLDAIVKETLRLYPAGPLLVPHEAIQDCHVGGFNVYAGTRLVVNAWKLQRDPRVWSDPERFDPDRFLTSHVDIDVWGKNYEFIPFGSGRRSCPGISFALHLLSLTLARFLHAFEWDTPFGECVDMTEGFGLTLAKATPLRVVLTPRLPSHLYQ*

88% to 276.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00059.227 top part

62% to 276.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00059.230

PIQDCHVGGFNVDGGTRLLVNAWKLQRDPRVWSDPERFDPNRFLTSHVGIDIWGNNYEFIPFGSGRRSCPGISFAWHVLSLTLARLLHAFEWETPFGECVDMREGFGLNLAKATPLRVLLTPRLPSHLYE

>CYP82 276.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00059.230

52% to CYP82D50 Nelumbo nucifera, intact

52% to CYP82C5 Populus trichocarpa

78% to 276.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00059.231

68% to 276.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00059.226

55% to 276.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00059.227

MEYLNLLQVLLAMVVIFFVHRLLIVSGKKKLKNEAPEPKGKWPVLGHLPLLAGSALPHRTLAALAEKYGPVLTLRLGSRLTLVVSSWEFAKECFTTNDRVFATRPDNPASEHLAYNKAMLGFAPYGPYWRESRKIATLELFSARRLELLKHVRVSEVDMCVGELYNQWSLDRKDGNITVDMKQKLEDLTLNVVTRMVAGKRYYGTGVGVEGGEARRFQQLIEELFRLAATFDITDSLPFLRWAGIGGYKREMVRVSSELGETFERWAEDKKQQKSAGNDFLDVLVATVKEGTFPTDHTPNTIIKGIAVNIIMAGTDTSAATMTWALAALVNTRHVLEKVQAELDVHVGRDRMVEEADVKHLTYLNAVIKEIMRLYPAGPLLVPHEAMEDCTVGGFKVRAGTRLLVNAWKIHRDPRVWEDAEEFKPERFLTTKADVDVYGKHFEYIPFGAGRRSCPGLSLALHVMHLTLARLLQAFEWGTQTGEKVDMGENFGLTLRKDGPLELTVKPRLPLQLYQ

>CYP82 276.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00059.226

52% to CYP82D50 Nelumbo nucifera, intact

70% to 276.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00059.231

MESLELLKILAGVFAGFMIHQLWMWPEKKKRKLEAPEPLGSRPILGHLPLLSVSSLPYRLLADLADKYGPVITLRLGWRRTLIVSGWEAAKDCFTTNDRVFATRPHNPASEYLAYNRAMLGFAPYGPLWRESRKITTHELLSPRRVELLKHVRISEVDMCVRDLHRQCVESKQDSARVEMKQMLQDLTFNVITRMVAGKRFKGGRAGGSEEAQRFQELIEVLFRLAATPDVTDVLPFLRLIGVGGHKRTMLSVSEELGAMFEGWVEERRHENRSGKDFLDVLVASVTEGNFPATHTSNTIIKALALNLITGGTDTSASTMAWVVALLLNNRLVLEKVQAELDLHVGRDRVVQETDIKHLTYLNAVIKETMRLCPVSPLLVPHEAMEDCIVGGYAVRAGTRLLVNVWKIQRDPSAWEDPEEFKPERFLTTKVEVDVYGKHFELIPFGSGRRSCSGSLLAMHVMQLTLARLLQAFEWDTPNGEKVDLSESFGLTMRIDRPLDVAVKPRLSMELYQ

>CYP82 276.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00059.231

52% to CYP82D50 Nelumbo nucifera, intact

78% to 276.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00059.230

MDSLTLLKILVGVVATIFIHHLWTLPQKRKQKQEAPQPPGSWPILGHLPLLANSALPHRTLSDLADRYGSAITLRLGSRPTLIVSDSDLAKECLATNDRVLATRPDNPASTHLAYNRAMLGFAPYGPHWRESRKIATLELLSHRRLELLKHVRVSEVDLCVQELYGRWAENKGEKATVEMKQRLEDLTFNVVTRMVSGKRYYGTGTVTGAEEGEARRFQRLIEELFRLAAVFDITDAIPFLRWVGIGGYKGEMERVARELGEMFESWVEDRRHEKSNGHDFLDVLMETVKEGNFPTAHTPNTIIKGITMNIIMAGTDTSAATMTWALAALVNNRRVLEKVQAELDLHVGRDRIVEEADIKHLTYLNAVIKETMRLYPAGPLLVPHEAMENCTIGGFKVRAGTRLLVNAWKIHRDPSAWEDAEEFKPERFLTTKAHVDVYGKHFEYIPFGAGRRSCPGVSLALHVMHLTLARLLQAFEWDTLTGEKLDMSENFGLTLRKDGPLEVTLKPRLPVELYH

>CYP82 20678.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00010.210

38% to CYP82D13 Vitis vinifera, blue reqion seems wrong, missing C-term

37% to CYP81B27 Vitis vinifera

68% to 20678.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold03564.1

MRLN

LGGTAQALAASLLVAWVLIRILLHGTTTKGKLLLEPLRWPLIGHLHLLMVDKPLHRVLASLADCHGLIMKLRMGQKPTLVVSDADIARECLTTHDRAFASRPMVAAGRTLGFDYTAIAWATYGPLWRDLRKVCTLELLSTRRLETLSHVRDEESANCLKRLYSVWEARKEEGQKVQVGIRVDMVLEVIKKMVGGRSSLRLGPEEEVMEFKELVEEAFYVSGLGDVMAVLGWIDLQGSERAMKKLREKTNIISQLRLDERSGDRSLRSLHPHLTGEISYQVHTPRNLVYAMNSDTSAVRLEWALASLLSNPEAMRKVKEELDTKIGKERRVEEADIANLPYL

 

 

>CYP82 20678.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold03564.1

43% to CYP82D51 Nelumbo nucifera, intact

45% to CYP82D50 Nelumbo nucifera

same as Ambtr1_0_15-AmTr_s03564_1-Amborella_trichopoda

MDTSCFLGGTAQALAASLLVAWVIIGIRLHGTSTKRKTLPEPPGWPLIGHLHLLMGNKPLHRVLASLADHHGLIMKLRMGQKPTVVVSDADIAKECLTTHDRAFAGRPKLAVGRFLGFDYTAFVWASYGPLWQDLRKVCKVELLSTSRLETLSHVRDEETANCIKRLYGVWEAGRKEEGDKVQVGMRAHMVDMVINVIRRMVGGWGSLRLGSKEEVVKFKELVEEVFYVSGLPNLGNVLPLLGWIDLQGSQRTMKKVAKKISAISQLWLDERRQARQAVAVDGEKVTDFLDVMLSLSDDPKIVSLSESTPQRRDMIIKATLLVIVFGATDTSSVTLEWAVAALLSNPEAMRKVKEELNTKIGKERRVEEVDIANLPYLQAVIKETLRLYPPAPILIPHESMEDCMVAGFHMPAGTQLIINAWKIQRDPRWWERPLEFEPERFIGSKVDMKGQHFQFLPFGAGRRACPGTSLALSILHLALARLLHSFDWHLPLGCSSLDMTEGMGLTSPRASPLEALMEPSLPFELLCEN

 

>CYP82 20678.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00091.62

46% to CYP82D3 Coptis japonica  N-term only

88% to 20678.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00010.210

76% to 20678.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold03564.1

MDTIWFLGSTAQALAASLLVTWVLIRILLHGAATKGKLLPEPPGWPVIGHLHLLMGDKPLLHRVLASLADRHRLIMKLQMGQKSTLVVSDADIARECLTIHDRAFASRPMMAAGRILGFDYTAIAWALYGPLWRDLRKVCTLELLSTRCLETLSHVRDGETANCIKRLYSVWEARKEEGQKVQVGIRVHMV

DMVLDGWGKEQFEAGS

>CYP82 20678.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00091.61

51% to CYP82D30 Glycine max, C-term only, these two may join, or parts of a pseudogene

81% to 20678.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold03564.1

MNIISQFWFDERRQVRQGVDVDREKATDFLDVMLSLSDDPQIASLSASTPHRRDIIIKATLLVIVFAATNTSAMTLEWALASLLSNPEAMRKVKEEHDTKIGKERRVEEADIANLPYLQAIIKDTLRLYPPGPLLVPHESIEDCVVAGFHMPAGTRLLMNAWKIQRDPRWWQQPLKFELERFIGSEVDVKGQHFQLLPFGAGRRACPGMSRALSVVHLALARLLHSFDWHLPLGCSSLDMTEVVGLTTPRASPLEALMEPRLPLELLCKS

 

>CYP84A 2467.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00001.452

66% to CYP84A27 Carica papaya, intact

41% to 2012.7 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.33

MEALVGELKKEQLGLALLLGLPFVYLLWRLAVGRKRPLPPGPRPRPIVGNMALMDQLTHRGLAKLARPYGGLMYLRLGFMPNVVVSTPEMAKQVLQVQDNTFSNRPATIAIQYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRRRPESWRPVREEVDAMVKAVATKAKTEPGMPVNVGELVFGLTRNITFKAAFGSALGEGQDMFNSLLQEFSRLFGAFNIGDFLPVLSWMDLQGINKRLRNARQSLDHFIDKIIDDHMASAGQKDERTLDMVDDMLVHLGDGPASNDDTDTAALKLTRDNIKAIIMDVMFGGTETVASAIEWAMAELMHNPQEMQKVQDELKKVVGLNRQVQEGDLENLTYLKCVVKEVLRLHPPIPLLLHETAEETEVSGYRIPKQCRVMINVWAIGRDPKSWPDPDAFKPERFTKENAYDFKGSCFEFLPFGSGRRSCPGMQLGLYGLEMAVAHLVHSFDWSLPDGMKSKDMDMSDSFGLTAPKAQRLVALATVRLSCDLLAS

 

>CYP85A_pseudogene Ambtr1_0_15-AmTr_s00047_83-Amborella_trichopoda

(-) strand

90% to CYP85A1 AmTr_s00047 4076376-4081990 (-) strand

4100534 HGCFQGRQRILSLLREF
4100585 MEDRRASKESHTDMLDALLKNEEDPSKFKMTDDQIFDLLLAILYAGYETVSTTSMMTVKYLYDHPKALQKLR 4100370
4100257 EEHSAIRNAKGPDDPISWDDYKSMEFTRA 410171
4100049 VIYETMRLSTIVNGVLRKTTEDMELN 4099966
4099871 GYLIPKGWKIYVYMREINYDPILYPDPYTFNPWRWL 4099758
4096925 EKNTDAHRYFLLFGGGTRHCPGKELGTVEIAVFLHYFVTRYR 4096800
4096369 WEEIDGNKILKFPRVEAPNGLRIRIWER* 4096280
 

>CYP85A1 AmTr_s00047 4076376-4081990 (-) strand

64% to CYP85A1 Panax ginseng, intact

66% to CYP85A1 Nelumbo nucifera

4081990  MVVLVVLSWLFFWVVMGCLSCVAMLKWNEVRYRKKGLPPGTMGWPLFGETSEFLTLGIDFLKNQKAR  4081790

4080701  YGSLFKTHILGCPTIVCMDPDLNKFIFLNEGKGFVAGYPQSMFDILGEWNIAAVHGPL
         HKAMRGVMFQLTNNNMIRDHLLLDIDHFMRTHHSNWANSVLDIQEMTKK 4080381
4080290  MALLLALKQVLGMQPGQMTKVLEPEFHKLIEGIISLPINLPGTNYHKGFQ  4080141
4079544  GRQRILSFLRKFVEDRRAFKETHTDMLDALLRNEEDPSKFQISDDQIFDLLLAILYAGYETVSTTSMMAVKY  4079329

4079328  LYDHPKALQKLR 4079293

4079184  EEHSAIRNAKGPDDPITWDDYKSMEFTHA 4079098

4078977  VIYETMRLSTIVNGVFRKTTQDMELN  4078900
4078789  GYLIPKGWKIYVYVREINYDPLLYPDPFTFNPWRWL  4078682
4077040  EENTDSHRYFLLFGGGIRQCPGKELGKVEIAVFLHYFVTRYR  4076915
4076462  WEEIDGNKILKFPRVEAPNGLIIRIWER*  4076376

 

>CYP86A 726.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00009.176

76% to CYP86A73 Nelumbo nucifera, intact

76% to CYP86A68 Solanum tuberosum

40% to 7300.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00002.483

MVAYLIWFARIRRSLTGPRVWPLLGSLPGLFQNKHRMHDWIAENLTMCKGTYQTCIAAVPYLARMQGLVTVTCDPRNLEHILKTRFENYPKGPTWQAVFHDLLGDGIFNSDGDTWRFQRKTAALEFTTRTLRQAMARWVSRSIENRLVPILASCQLKNEAVDLQDLLLRLTFDNICGLAFGKDPETLRPGLPFNGFAWAFDRATEATLNRFILPAIIWKLKKWLGLGLEVNLRESVKQVDKYLDDVICKRKLELSSQQERGATHDDLLSRFMRKKEGYSNEFLRHVALNFILAGRDTSSVALSWFFWLLTQHPRVEGEIIQEISRVLTETRGRDPAAWVSRALEFEEVDRLVYLKAALSETLRLYPSVPEDSKHVVADDVLPDGTFVPAGSSVTYSIYSAGRNPAVWGADFLEFKPERWLTPDKKGFAGPLDPYAFVSFNAGPRICLGKDLAYLQMKVVAASVLLRHSLTVAPGHVVQQKMSLTLFMEQGLKVHVHPRVLPVGEEAALGT

 

>CYP86B 4441.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00029.65

63% to CYP86B9 Glycine max, missing the C-term

64% to CYP86B14 Ricinus communis

MDSYRLASNSTGIYAGNIFRRPHLDLRVLEVFLAVGVFVLFHQLRPRNRRGLASWPLLGMLPSLLFGLKNDIYEWISCVLIKEGGTFVFKGPLFSNLNCVITSDPRNIEHILKTKFVTFPKGEYFRKNLSDLLGSGIFNSDDDVWQRQRKVASIEFHSTRFRQLMHDSLERLVHERLLPVLELYGERISGIDLQDVLLRLTFDNVCMIAFGVDPGCLSHRLPEIPFANAFEKATEASVMRFLMPTSLWKIMRFFNLGSEKELREALVRVDEFAGGVIRERKRELLSDFGKKSDLLTVFMRMRDEEGRAFSEEFLRDICINFILAGRDTSSVALAWFFWLVGQNPGVEEKILEEMRGILGHRVVEGPPKWRPEEVKKMEYLQAALSEALRLYPSVPVDHKELCLPTRNK

 

>CYP86C 32590.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00166.37

58% to CYP86C10 Vitis vinifera, missing C-term

77% to 32590.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00166.43

MWRLAGTAVDLLVQVRLWDLAVALLGLFIFSGVSQRLRHKGPIIWPFLGVVPSFILHIDNVYAWATNASRQSGGTFSYRGVSPGRLFGVVTVDPANLEYILKSKFKKFPKGKYYRERFSDFLGDGIFNADDDVWKEQRRVANAEMHSSRFVEFSFKTIEHLVCNKLLKLTEKLAVSHEMVDLQDVFLRFTFDNICMAAFGVDPGCLGLDLPDVPFARAFEQATELTLFRFLVPPFVWKPMKYFDIGTERRLREVIKVVHKFAEKTVSDRKFECQRSGGILDRSDLLTRLIQGPDLQ

>CYP86C 32590.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00166.43

52% to CYP86C10 Vitis vinifera

77% to 32590.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00166.37

MWRLEGTVMDLLVQAPNALRQSGGTFSFRGVSPGRLYGVVTADPANLEYILKSKFKKFPK

(gap)

DDDVWKKQRRAANAEMNCSRFVEFSFKTIEHLVRNKLIRLTEKLAVSLEMVDLQDVFLPFTFDNICMAAFGVDLGCLGLDLPDVPFTRAFEQVTELTLFRFLVPPFVWKPMKYFDIGTERRLREVIKVVHKFAEKTVSDRRFERQKSGGVLDRSDLLTRLIQVRNDDNSPCYSDKFLKDFCISFCSFSLVLLATP

 

>CYP87A 3563.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00069.70

76% to CYP87A9 Glycine max, intact

38% to 5033.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00059.35

MWPLSLCIATLVAIWVTYWVYRWRNPKCNGKLPPGSMGFPLIGETLQFFSPNTTSDIPPFIRQRMNRYGPVFRTSLVSRPVIVSTDPELNHLIFQQEGKLFQSWYPDTFTEIFGRQNVGSLHGFMYKYLKSLVLNLFGPESLKEKLLPELELAASRNLQTWATQSSIDLKEATATMIFNLTAKKLISYDPTKSSENLQKNFVAFVDGLISFPLNIPGTSYHKCLQGRQKAMKMLKKMLEERRREPEKAHGDFFDYVLGELKKERSVLTEEIALDLMFVLLFASFETTSLALTLAVKFLSDHPKVLEELTKEHEAIRRNRENQCSGLTWKEYKSMIFTSQVINETVRLANIVPGIFRKALKEIEFKGHTIPAGWAVMACPPAVHLNPSMYPNPLAFNPWRWGGVESNGGSKNFMAFGGGLRFCVGTDFTKIQMAVFLHCLVTRYRWKPIKGGDIVRTPGLQFPNGFHIQLEDKV

 

>CYP88A 1925.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00149.33

65% to CYP88A40 Nelumbo nucifera, intact

62% to CYP88A41 Jatropha curcas

MGVEVFMAVSLVLLSGFGALFQLLRKVNGWFCEWKVGERRFLLPPGDMGWPLMGNMFHFLRAFKSGNPDSFLSSFVKRFGRTGIYRAFMFGSPTILVTIPETCKQVLMDDSNFVPGWPKATEELIGKKSFLLITPEEHRWLRKVTAAPVNGHEMLSNYLKFIEASVISSLESWAQLGEIEFLTELRRLTFRIIMHIFLSLEGETTMVALEKVYTALNKGIRAMAINFPGFAYYYALKARKTLVAVMQRTIDERKEVRRSRGHESSTLRKDMLDSLMDVQDENGRHLADDEIIDTLIMYLNAGHESSGHITMWATLLLQQNPLAFQKAKEEQEEILRRRPPNQKGLSLQETREMVYLSKVIDETLRVVNISFVVFRQAVNDVMINGYIVPKGWKTQVWLRNVHMDPKVYHEPGTFNPSRWDDYTPKAGSFIPFSAGSRLCPGNDLAKLEISVFLHYFLLDYQLERVNPDCAVNYLPHPRPKDNCLARIQKIRRSP

 

>CYP89A 505.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00001.175

56% to CYP89A86 Nelumbo nucifera, intact

54% to CYP89A39 Vitis vinifera

54% to CYP89A18 Populus trichocarpa

83% to 505.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00040.47

MAEAWITFLSLFFCVALAFVFFKSKTKKTLPPGPPSLPIIGNLLLLRGLGIDLEPTLSKLHKKYGPVLTLRLGRRPSIFVTTRAVAHRALVQQGAAFADRPPAAPASAVFSSRQHNISSAPYGPIWRVLRRNLISETLAPARVKAFTPARQWAVQTLIDALHERALEGPVCVIEAMRFAVFSLLLSMCFGERFGDEVVKKAETAQRRLLLNFSKFTIFALFPRIGKFIFRKRWQEVHDIKHQQEAALLPLIHAAAERRRKGQTGFFSYADSLALLELPDCRKLSDEEMVSLCSEFLNGGSDTTSTTLQWVMANLVKHPHVQAKLYKEIEQEGGVDEEKLQKMPYLKAVVTEALRLHPPGHFVLPHTVTEDSTLDGFVIPKGASVNFMVREMGVDPEAWEEPLEFRPERFLGGGEVDLTGSKEIRMMPFGVGRRICPGMGLAMMHLQYFVGHLVKEFEWKRVEGEEVDLSEKVEFTVVMKNPLRVLLIPRACSEN

>CYP89A 505.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00040.47

54% to CYP89A86 Nelumbo nucifera, intact

83% to 505.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00001.175

MAEAWLTFLCVSLSVAVSFIFFFLRPKAKKTLPPGPPSLPIIGNHLLLRGSGIDIELALRKLPKKYGPVFTLRLGGGLSIFVATRAVAHQALVQQGAKFADRPPAPPVSAVFTSQQHNISAAPYGPLWRVLRRNLMSETLIPARVKAFAPARQWAVQTLIEALHERAREGPVCVIEAMRLAVFSLLLSMCFGERFGDEVVKKAEAAQRRLLLSFSKFTVFALFPRIGKFIFRKLWQEVHDIKHQQEEVLLPLIRGAAERQTEFFSYADSLAVLELPDGRKLSEGEMLSLCSEFLNGGTDTTSTTLQWVMANLVKHPDVQAKVYEEIEKEGGVDEEKLQRMPYLKAVVTETLRLHPPGHFVLQHTVTEDSTLEGFVIPKGAGVNFMVKEMGVDPEAWEEPLEFRPERFLGGLEVDLTGSREIKMMPFGVGRRICPGMALAMMHLQYFVGHLVKEFEWKSVDGEEVDLSEKAEFTVVMRNPLKPLLIPRPTSTHTKQN

 

>CYP90A 2225.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00029.413

75% to CYP90A35 Ricinus communis, intact

44% to 5424.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00064.7

MVLFMLVLGLVSFFLFFLHLSTRKYRIRGLPPGSFGLPLVGETLQLISAYKATNPEPFLDSRRSRYGNVFTTHVFGEPTIFSTDPEVNRFILQNEGKLFVSSYPSSISNLLGKHSLLLMKGSLHKKMHSLTMSFANSSIIKDHLLLDIDRLVRLSLDSWRGRVLLQEEAKKITFELTIKQLMSVDPGDWSENLRKEYMLLIEGFFTVPFPFLGTTYARAIKARGKVAEALREMVRERKRESGDVEEKKDMVASLVREGLSDEEIVDFLLALLVAGYETTSTIMTLAVKFLTETPQAFASLKEEHEEIRRKKAGSEPLDWADYKSMSFTQCVINETLRVANIISGVFRRAVCDVHIKGCTIPKDWKVFVSFRAVHLDQDFYKDARSFNPWRWQGTLPSTNPPSVFTPFGGGPRLCPGYELARVEISVFLHYLVANFSSVTSEEDKVVFFPTTRALKRCPILVTRKEAC

 

>CYP90B 5033.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00059.35

69% to CYP90B20a Nelumbo nucifera, intact

47% to 5767.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00061.116

MEETELFLLLFSAISVAILMWRAMKRERKFQKVPPGRMGWPFVGETLAYLKPHPSTSMGEFMEQHISRYGKIFVSNLFGEPTIVSADLGLNKFILQNEGKLFESSYPKSIEGILGKWSMLVLVGDMHRNMRILSLNFMSNTKLRVHLLHEIEKHTLLVLGAWREKQVFSAKEEAKKFTFNLMAENIVSMKPGKPETESLKREYITFMKGVISAPINLPGTSYRRALQSRKTILGVLEMKMEEKKMRTNGREPEIEEEEDFLGWVMKQSDLSSEQILDLILSLLFAGHETSTVAITMAMYFLDGCPRAIEQLQEEHMGIAREKREKGESSGLNWEDYKRMEFTHSVINETLRLGNVVQFVHRKALCNVQFKGYDIPRGWKVLPVFAAVHLDPLNHHKPHHFNPWRWQDSNNSSNFMPFGGGPRLCAGADLAKLEMAIFIHHLVLNFTWEVTEPDIPTAFPFIDFPKGLPITVHRLSSNTTSTILERETTATGS

 

>CYP90D 5424.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00064.7

69% to CYP90D20 Nelumbo nucifera, intact

44% to 2225.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00029.413

MVMSTVIFAAAAAALVVAIMVREWRKRKERESGVKGSLGWPFIGETLEFIACAYSSTPESFMDKRRLLYGNVFKSHILGSKTVISTDAEVTRVVLQSDGRTLVPFYPASLTKLMGSSSILLINGPQQKRLHGLLGSFLKSAHIKAQITQDIHSYVSLSMSNWKEGHLVYIQDLTKDIAFQVLVKALISLDPGEEMEFLKEQFREFIAGLISLPINLPGTRLYRSLQAKTKMVKVVLKILGERKEHGPTSPPKDVIDVLLSEKMSVDVICDNMIDMMIPGEDSVPILITLALKYLTDSPLALQQLYLENMELKRRKAQEGQQPCWNDYISLPFMQNVLSETLRMGNIITGVMRRAVTDVEIKGHLIPKDWCVFTYFRSVHLDDEIYENAHQFNPWRWQGKDTCTNNFTPFGGGQRLCPGVDLARLEASIFLHHFVTNYRWVAEEDSVVNFPTVRMKNRMPIRVTRRPQYCIC

 

>CYP90 new lcl|AmTr_v1.0_scaffold00002

57% to CYP90D1 Arab., 55% to CYP90C1 Arab., intact

60% to CYP90D5 Populus trichocarpa

60% to CYP90D20 Nelumbo nucifera, 54% to CYP90C13b Nelumbo nucifera

56% to CYP90D 5424.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00064.7

diverging away from CYP90D, may be precursor to CYP90C

upsteam seq is pre-rRNA-processing protein esf1-like

downsteam seq is receptor-like protein kinase

5925229  MVWVVLGAWFAVIFYSWWWWGTRRGPKNVPKGSLGWPFIGETLDFMSWGYTAKPEAFMEKRSSR  5925038

5922789  YGKVFKTHVFGRATIVSTDAEVSKSVLQNDGRIFVPYYPKSLTMLMGDPSILLINGAPHR  5922610

5922609  KLHALLSSFFKSPSLKAQVARDMEHHLHLSMPSWSQRCSPLRIQDQAKS  5922460

5910661  MAFEILVRALMSVGSGKDMNFLRHEFREFIAGLMSLPFNLPGTRLRKSLQ  5910509

5910027  AKKRIMKLVRQIIEEKRKKRKQGLNPMDDVIDVLINDSQQDAQEEGNEIEMKDDLSMANT  5909848

5909847  VIDMMIPGEDSVPVLITLALKFLTDNPTALQQMR  5909746

5909317  EENLKLKRLKAQAGEKLCWTDYMSLSFTQN  5909228

5909121  VITETLRIGNIINAVMRKALKDVEIK

         GYLIPKGWCVLTSFRAVHLDEENFSNPYQFNPWRWK  5908593

5906967  DKEAGGFTFTPFGGGYRLCPGIELSRLEAAVFLHHFVTSFRYSF  5906836

5905960  WVAEEDSIVNFPTVRMKCGLPLTLTPLPSYPSFPSQ*  5905850

 

>lcl|AmTr_v1.0_scaffold00002 length=11522362 Download lcl|AmTr_v1.0_scaffold00002

 

Query  24       WRKRKERESGVKGSLGWPFIGETLEFIACAYSSTPESFMDKRRLL  68

                W  R+  ++  KGSLGWPFIGETL+F++  Y++ PE+FM+KR  L

Sbjct  5925172  WGTRRGPKNVPKGSLGWPFIGETLDFMSWGYTAKPEAFMEKRSSL  5925038

 

Query  69       YGNVFKSHILGSKTVISTDAEVTRVVLQSDGRTLVPFYPASLTKLMGSSSILLINGPQQK  128

                YG VFK+H+ G  T++STDAEV++ VLQ+DGR  VP+YP SLT LMG  SILLING   +

Sbjct  5922789  YGKVFKTHVFGRATIVSTDAEVSKSVLQNDGRIFVPYYPKSLTMLMGDPSILLINGAPHR  5922610

 

Query  129      RLHGLLGSFLKSAHIKAQITQDIHSYVSLSMSNWKE-GHLVYIQDLTKDI  177

                +LH LL SF KS  +KAQ+ +D+  ++ LSM +W +    + IQD  K +

Sbjct  5922609  KLHALLSSFFKSPSLKAQVARDMEHHLHLSMPSWSQRCSPLRIQDQAKSV  5922460

 

Query  177      IAFQVLVKALISLDPGEEMEFLKEQFREFIAGLISLPINLPGTRLYRSLQA  227

                +AF++LV+AL+S+  G++M FL+ +FREFIAGL+SLP NLPGTRL +SLQA

Sbjct  5910661  MAFEILVRALMSVGSGKDMNFLRHEFREFIAGLMSLPFNLPGTRLRKSLQA  5910509

 

Query  227      AKTKMVKVVLKILGER--KEHGPTSPPKDVIDVLLSE------------KMSVDV-ICDN  271

                AK +++K+V +I+ E+  K     +P  DVIDVL+++            +M  D+ + +

Sbjct  5910027  AKKRIMKLVRQIIEEKRKKRKQGLNPMDDVIDVLINDSQQDAQEEGNEIEMKDDLSMANT  5909848

 

Query  272      MIDMMIPGEDSVPILITLALKYLTDSPLALQQLYL  306

                +IDMMIPGEDSVP+LITLALK+LTD+P ALQQ+ +

Sbjct  5909847  VIDMMIPGEDSVPVLITLALKFLTDNPTALQQMRV  5909743

 

Query  307      ENMELKRRKAQEGQQPCWNDYISLPFMQNV  336

                EN++LKR KAQ G++ CW DY+SL F QNV

Sbjct  5909314  ENLKLKRLKAQAGEKLCWTDYMSLSFTQNV  5909225

 

Query  336      VLSETLRMGNIITGVMRRAVTDVEIKGHLI----PKDWCVFTYFRS  377

                V++ETLR+GNII  VMR+A+ DVEIKG L     P    ++  F++

Sbjct  5909121  VITETLRIGNIINAVMRKALKDVEIKGKLFLN*TPAKRTIYFLFKN  5908984

 

Query  346      IITGVMRRAVTDVEIKGHLIPKDWCVFTYFRSVHLDDEIYENAHQFNPWRWQ  397

                ++T  + +        G+LIPK WCV T FR+VHLD+E + N +QFNPWRW+

Sbjct  5908748  VVTSFLPKICRFHWFLGYLIPKGWCVLTSFRAVHLDEENFSNPYQFNPWRWK  5908593

 

Query  399      KDTCTNNFTPFGGGQRLCPGVDLARLEASIFLHHFVTNYRW  439

                K+     FTPFGGG RLCPG++L+RLEA++FLHHFVT++R+

Sbjct  5906964  KEAGGFTFTPFGGGYRLCPGIELSRLEAAVFLHHFVTSFRY  5906842

 

Query  439      WVAEEDSVVNFPTVRMKNRMPIRVTRRPQY  468

                WVAEEDS+VNFPTVRMK  +P+ +T  P Y

Sbjct  5905960  WVAEEDSIVNFPTVRMKCGLPLTLTPLPSY  5905871

 

 

 

>CYP92A 313.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00024.289

65% to CYP92A5 Nicotiana tabacum

65% to CYP92A31v1 Capsicum chinense

76% to 23340.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00024.291

MVLDKKSLEVDESGNAIVKPEEFKKMLDELFLLSDVLLIGDQIPWLSFLDLEGYIERMKAVSKKFDRFLEHVLDEHQNARKVEGFVAKDMVDVLLQVAEDPNLEVKLTRNNVKAFTQDMIAGGTESPAMIVEWAISELLRRPEIFERATQELDQVIGRTRWVDEKDMHQLPYVAGIVKETMRLHPVAPMLVPREARESCTIAG

(30 aa gap)

PERFLRSPIDVKGQDFELLPFGSGRRMCPGYNLGLKVIQASLANLVHGFEWGLPEGMKKEDLNMAEIFGLSTPRKEPLVAVMKPRLTPQLYEQLH

>CYP92A 23340.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00024.291

77% to CYP92A57 Nelumbo nucifera, C-term only

76% to 313.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00024.289

MIAGGTESSAVTVEWAISEILRRPEIFERATQELDQVIGQTRWVEEKDIPQLPYMAAIVKETMRLHPVAPMLVPRQARESCTIAGFDVPVGTRILVNVWTIGRDPKIWDSPDEFRPERFLGSQIDVKGQDFELLPFGSGRRMCPGYNLGLRVIQTSLANLVHGFEWGLPEGMKKEDLNMEEIFGLSTPKKEPLVAVVKPRLPPQLYEHLH

 

>CYP93A 1669.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00022.287

62% to CYP93A16 Vitis vinifera, intact

89% to 1669.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00022.290

39% to 2012.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.32

MEFLGGTQAYLGLFITWLISTLIVRYFIKSLMKKDQVKLPPGPMALPIIGHLHHLGPIPHQAFQALARKYGPVMQVRLGSVLSIVVSSADMAREFLKTHEHAFASRPQSKAVKCLTYGSADFSFAPYGPYWKYMKRICMMELLGGRQLDLFQSIRQQEIKNFLESLFKKSQEGKYVDMNGELTVLTNNIISSMTMSTRCSGTKDKADECRSLVKDVTELTGIFNLADFISFCKNLDLQGLEKRIKEVHKRFDDMVERILKEHEEKKSTGDEPQDLVDILLRISQDEGAEMKLTRENIKAFVLDIFAAGTDTSAITIEWALAELINNHDIFAMARDEIFSVVGRQRVVEESDIPNLPYLQAIVKETLRLHPTGPLIVRESTQDCKVGGYDIPKGAQLFVNVWALGRDPNSWEDPLKFKPERFIVESGGTNVDVKGQNFHLLPFGSGRRMCPGTSLALLVVQTALASLIQCFDFRVHNSSQDMGGNKVDMEEGRGLTLPRAHPFICSPVAHFNPFV

>CYP93A 1669.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00022.290

59% to CYP93A16 Vitis vinifera, intact

89% to 1669.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00022.287

MFITWLISTLIVRYFIKSLMKKDQVKLPPGPMALPIIGHLHHLGPIPHQAFHVLARKYGPVMQVRLGSMLSIVVSSADMAREFLKTHERAFTSRPQLKAVKSLTYGSAGFIFAPYGPYLKYMKRICMMELLGGRQLELFQSIRQQEIKHLLEYLFKKSQEGKDVDMGSELAILTNNIICSMTMSTSCPGAKDKADECRSLLKEGAELVGTFNLADFISFCKNMDLQGLEKRFKKVHERLDDMMERILKEHEEKKSNGGEPQDMVDILLRISKDEGAEMKLTRENIKAFVLDIFGAGTDTSATTMEWALAELVNNPNIFAMARDEIFSVVGRQRVVEESDLPNLPYLQAIVKETLRLYPVGPLILRESTQDCKVGGYDIPKGAHIFVNVWAIGRDPNSWEDPLKFKPERFIVESGGSNVDVKGQNFHFLPFGSGRRMCPGTSLALLVVQTALASLIQCFDFRVHNSSQDMGGNKVDMEEGRGMTLPRAHPLICSPVAHFNPFV

 

>CYP94A 7300.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00002.483

54% to CYP94A10 Populus trichocarpa, Missing some N-term sequence

54% to CYP94A15 Vitis vinifera

46% to 2070.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00013.150

MNQKKQRRNSDKNRGAVFEGPKS

YPILGCTLSFIANRHRVSQWITELLRLSPTQTIVLKRLGGIHQIITANPANVQHILKSKFPNYPKGQFGREIMADFLGQGIVNSDGEPWKFQRKIAIHGFNTKSLKKFIHHVVEEELFTRLIPLLEKAAMENMILDLQDVLESFAFDNICNIAFGWDPCCLHVDALLESEFAEAFDSAATLSSERFRSLAPWSWKLKRLFDIGTERKLRISIDKVKGLAIELIQRKKAEARPTGIEVEDLLSRFLNAGIDEDIIRDIVICFVLAGRDTTSAALTWFFWLLARHPHVEEAIIKEIGHKDGINMGLDDIKDLNYLHASIYESMRLYPPVPVDTKEAAREDVLPDGTKVRKGSRVSYHPYAMGRMEALWGKDYEDFKPERWLDKENGMFVPCDSFKYAVFQAGPRICMGKEMAFVQMKTVVVALLKRFRIRIANSNFKAVYVLGLTSKMEGGFSVRIEKRSEKVLA

 

>CYP94B 2070.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00013.150

59% to CYP94B21 Nelumbo nucifera, intact

57% to CYP94B19 tomato

46% to 7300.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00002.483

MAMKTRSPFLYYSHDFFYLLFPLLLPVLLLSLSNWLRKRSLQNRCYGPRSYPLVGCMVAYWKNQYRLLDWYTELLADSPGGTIVVQRLGAPRTVVTANPANVEYMLSTQFSNFPKGKPFTEVLGDLLGHGIFNTDGELWHTQRKVASPEFATSHLRRFVLTTLRNEIEGRLLPILRQEARSSTVLDLQDVFKRFTFDSICLVSFGMYPGCLEVPLQESRLAKAFDIAAEISARRGAATLQAIWKIKRALNLGSERKLKEAVGVVREAVAEIVREQAPKGGDHLLARLLRAGLGEELARDMVVSFIMAGRDTTSAALTWLFWLLARHTQAEREVIREAQETTTLDYQGLMGLKYLHACLCETMRLYPPVAWDSKHAARDDVLPDGTGVTKGCRITYFPYGMGRTEGIWGKDWAEFRPERWLEGRIVSAFEFPVFQGGPRQCLGKEMAFLQMKYVAASVLKEFRVVLKEADRVPLFVPLLTACMGGGGCEGRGEGNKHGRGVIV

 

>CYP94? 32565.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00090.37

42% to CYP94D25 Vitis vinifera with sequence insertions, missing C-term

MALLFVFYSLFFLSFLLVIRHFYHNALGPNPKVSYLGPKAYPIVGSLIEFMLNRHRFLEWTTELLSRSPTQTVTHWRLGRVPDVVTANPLNVEHMLKNNFENYPKGPRFISFLHDFLGDGIFNADGDTWKIQRKTASFQFSTKSLRTFMLSVVQSEINQRLIPLLEFVSSSQKLIDLQDVLERFAFDNVCKVAFGSDPACL

(33 aa gap)

EFFPMNSGKNSENSGQESSFSDKEYRTFSEKSTIAGKTTGQSSVKSVEKYEVSGECLVNSGGFDDVSREKETLKMRENAFLAAFEEATVLSAWRFLGIVPHFW

KVLKFCHVASEKKISDCVRVVHVYANGIVRARY

AGMESNDQDLMSPSAADQMLGSSD

KQMNEMNGQDLISRFMADQRFGSSDELLRDVVISFILAGRDTTSSALSRFFWLLTCHPEVEKNILAEIQNIRETAG

>CYP94? 32565.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00101.90

82% to 32565.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00090.37

MALLFVLYSLFLLSSLLLLRHFYHNTPGPNPKASYSGPKAYPILGNLIEFVLNRHRFLEWMTEMLSRSPTQTVTLRRLGGVRGIVTANPLNVEYMLKNNFENYPKGPKFISLLHDFIGDGIFNSDGDTWKIQRKMASFEFSTKSLRSFVLSMVQSEINQRLIPLLEFASSNHKLIDLQDVLERFAFDNVCKVAFGEDPACLECFPMSSGQNLE

NSSQESSVFGKNSTITGKTTGQSSVNSVEKSGFSGESYGTSIDTSENSGHLSEVSGEILVDFDEFEDVSREKEVLTLPKNAFLAAFEEATVLCAARFLSAVPQFWKVLKFFHVASEKKISDCIRVVHGFANGIIRARRAGMESNGQDLMSSSSADQRLGEHIKEMNGQDRLLCSAANQRLASCDEPRKEKNGHDRHLRSAEDQRRPGSALALHGRSTGWIVRRDPPRRGRKLHLGGSRHHVISADVVLLAADVVPRSRTEHPSRDPKHS

 

>CYP96? 20666.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00004.23

43% to CYP96P1 Nelumbo nucifera

58% to 20666.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00065.117

59% to 20666.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00060.102

46% to 20666.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00060.101

MHQVLHTAWCVPGWVEALLALACFLSLHYFRQRKEPVIDWPILHHLPALLIHLPHVHDWTTSMHSAIGPTIPILGPIFSNMDRIITCDPQNLEYMLKTRFSNFPKGKLFHDMFEEFLGDGIFNIDGDAWEAQRRTANSHVHSKGFRSFVAATSRGLANDRLVPLLRKFATEGAAIDLQEIMMRYTMDTACAAVFGESVGCLSEGLPNVPFANAINDAMQAVTVRHVLPTAWWRAIRWLGLGMEPRLERAVRTMDEFVAQQVARRRHVSSGRGGGDLLSVYAATKASKTDRL

>CYP96? 20666.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00065.117

39% to CYP96A57 Nelumbo nucifera

76% to 20666.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00060.102

MDQGGRLRSWCGLGWSEILIALLCFLFLHYMRQRHRPFISWPLLRDLPAVLINLPHIHNWSADVLRALGGTFTVRGPILTGMRIVATCDPSNMEYVLKTRFSNFPKGPDFHDIFRELMGAGIFNTDGVDWQGQRRMANTHVHSKAFRIFVEKKSRELTFNNLVPILRQAAEEGAVVDFQDLMMRYTMDTTCAVLFGEAIGCLAPELPLVPFAQAMDEAMQAVMVRHILPWWKLMRWLGLGKEARLAQGVRTMDEFVARQVCSSKRKCRKRCMFVFSVLQKASAESDVVTYLRH

>CYP96? 20666.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00060.102

40% to CYP96A57 Nelumbo nucifera

74% to 20666.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00065.117

MDHGGRLVVLCGVGWAEVLLAVLCFLVLHYKPFITWPLLRDLPALLINLPRIQDWTADVHGAVGGTFTARGPILTGMRLVLTCDPCNVEYILKTRFSNFPKGPDFQDIFRELMGDGIFNTDGDEWQAQRRTANAHVRSKAFRTFFEKKSRELAFINLVPILGRAAEEGAAIDLQDLIMRYTVDATCAALFGEAIGYLAPELPLVPFAQAADEVMEAVVVRHVLPHMWWKLMRLLGLGMESRLAKGVRTMDEFVARQVVSARGRGSGGGDLLSIFATGDCFSGKESGVSSPACYILSGPT

>CYP96? 20666.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00060.101

32% to CYP96A18 Vitis vinifera

70% to 20666.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00060.102

MKTKSGIINATALKETGGLICCSAKAMDEGGSVRRGVGGGLTCRPLLPPAPLHEAAPQCRWLRSTMLLAEVHNAVGGTFTACGPLLTRKRLVLTCDPCNVEYILETRFSNFSKGPDFQDIFWELMGDNIFNIDADEWQAQS

(gap)

AEEGAVVDLQYLMMRYMVDATCAALFNEAIGCLVPELPLVRFAQAADEVMEAVVVRHVLPHMWWKLMRRLVLGMESRLAQGVHTMDEFVARQG

(gap)

DTTGAALTWFFWLVSRHHEVEAKFLDELKEKGTEDLSELHYLHAA

 

>CYP97A 5659.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00120.41

73% to CYP97A31a Nelumbo nucifera, intact

51% to 8190.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00001.483

47% to 5804.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00042.72

44% to 5804.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00030.103

MAPSASCPLLQLPAQSLNSKAFLLRPNAKIIAISKRSNLTYFSTSTPSKNDISIHGASRSRYVGVVCSSKGKDPEINEDGVKRVEQLLEERRQAELAARIASGEFTAEQSWLGLLNLAKLRGTLSKLGFPGKFLADAIAGVERNLKIGEEDELQIPQAKGSAGFIGSAPFFIPLYELFLTYGGLFRLKFGPKSFLIVSDPSIAKRILRENSKAYSKGILAEILEFVMGQGLIPADGEVWRVRRRAIVPALHQKYVSAMISLFAQATERLCSKLDAAAQDGEDVEMESLFSRLTLDVIGKAVFNYDFDSLSNDTGIVEAVYTALREAELRSIAVIPTWKIPIWKDLSPRQRKVNASIKFINDTLDSLIDICKKMVESEELQFHEEYMNEQDPSILHFLLASGDDVSSKQLRDDLMTLLIAGHETSAAVLTWTFYLLSKEPSVMLKLQNEVDSVLGDRLPTIDDMKRLKYTTRVINESLRLYPQPPVLIRRSLENDVLGKYPIKRGEDIFISTWNLHRSPEHWVEPEKFNPERWPIDGHNPNEINQNYSYLPFGGGPRKCVGDMFATFETVVALAMLVGRFNFEMAIGAEPVGMTTGATIHTTEGLKMTVTHRIKAPVIPSFENQILAVNGNNTYTNASSSSPGISEVGQESSQQDEVSTACT

 

>CYP97B 5804.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00030.103

75% to CYP97B15 Vitis vinifera, missing N-term

75% to 5804.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00042.72

MQGILADILEPIMGKGLVPADLDTWKKRRKAIAPAFHVMYLEAMIKIFIGCTRRTMVKFEELFHGDNLSEGQFIEVDLEAEFSSLALDIIGLGVFNYDFRSVTKESPIIKALYGTLSEAEHRSTFYVAYWKLPFAKYIVPRQRKFHSDIKLINDCLDTLISNAKETRQEADVKKLQDTDYGILKDASLLRFLVDVRGEDVDDVQLRDDLMTLLIAGHETTSAVLTWTIFLLAHHPSKMRKAQAEIDAVLQSSELNFESLKNLEYIRLSVVEALRLYPQPPLLIRRSLRPDILPGGLTGDKNGYSIPAGTEICLSVYNLHRCHYFWDRPHEFEPERFLRPKKSEVEGWAGFDPQRSPGALYPNEIISDFAFLPFGGGPRKCLGDQFALMESTIALALLLHRFDVELRDPPESMEAVTGATIHTKDGLWCKLRKRRPNAMNR

 

>CYP97B 5804.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00042.72

76% to CYP97B15 Vitis vinifera, intact

75% to 5804.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00030.103

44% to 5659.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00120.41

MALLLSPSTVNGCPRFHTSRASEIGSLNCIFPIPFPGKYQKKRRNNGFMLRCQSTSKNETKFEKNLLDNASNLLTNLLSGGRIGRMPVAEGAVSDLFGRPLFFSLYDWFLEHGAVYKLAFGPKSFIVVSDPIVARHILRENAFNYDKGVLADILEPIMGKGLIPADLQTWKKRRRAIVPGFHALFLEAMVKVFSKCSESMVMKLENMYQMENSPEGHLKVDLEAEFSSLALDIIGLGVFNYDFGSVTKESPIIKAVYGTLFEAEHRSTFYVPYWKFPFARWIVPRQRKFHSDLKVINDCLDELICNAKETRQETDVEKLQQRDYSTLKDASLLRFFVDMRGEDVDDQQLRDDLMTMLIAGHETTAAVLTWAVFLLAQHPSEMKKAQAEIDKVLGSTEITIESIKKLEYIRLIIAETLRLFPQPPLLIRRTLRLDTLPGGFKGDKDGYAIPAGTDIFISVYNLHRSPYFWEQPHEFEPERFLGPRKGEGIEGWAGFDPSRSPGALYSNEIVADFAFLPFGGGPRKCVGDQFALMESTVALAMLLRKFNVELRDPPDQVELVTGATIHTKAGLWCNLKFRSAAPFDVTSKP

 

>CYP97C 8190.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00001.483

77% to CYP97C21 Nelumbo nucifera, intact

51% to 5659.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00120.41

44% to 5804.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00042.72

MSCSFSVHPLWSTCPLKRLGNGETKRITLRGNNPTTATTVLCATKNKEESSSSTWGSSSWVSPDWLTSLVRLGARRLDDGIPLVDAKLEDVSELLGGALFLPLFKWMKEYGPIYRLAAGPRDFVVVSDPTMAKHVLRNYGKYAKGLVSEVSEFLFGSGFAIAEAPLWTVRRRAVVPSLHKKYLSVIVDKVFCTCAERLLENLKSDAKIGASVNMEEKFSQLTLDVIGLSLFNYNFDSLTSDSPVIDAVYTALKEAEARSTDIFPYWKIVFLRKVIPRQIKAEKAVALIRRTVEGLIAKCREIVEAENELIDTEEYVNETDPSILRFLLASREEVTSLQLRDDLLSMLVAGHETTGSVLTWTVYLLSKNPSSLSKAQEEVDRVLQGRLPRYEDAKELKYVTRCINESMRLYPHPPVLIRRAQEDDVLPGNYKINAGQDIMISVYNIHHSAKVWDIAEEFFPERFNLDAPLPNESNTDFRFIPFSGGPRKCVGDQFAMLEAIVTLTVLLQNLTFELVPNQDIGMTTGATIHTTKGLYMILSQR

 

>CYP98A 1487.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00040.62

65% to CYP98A46 Coptis japonica, retained intron

71% to 1487.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00101.79

MESLFLLAFSLLALIISVKLLYSKRFKLPPGPRPWPLFGNLHEIEPVRFRCFAKWAERYGPIMSVWIGGSLNVIVSSPELAREVLKEQDQHLANRHRTRSAAKFSREGTDLIWADYGPHYVKVRKLCTLELFSVKRLEALRAIREEEVSAMVESLYTDCKGKSEERLVLRTYLSVVTFNHITRLVFGKRFINSKGEMEEQGKEFKDIVATGNELSASLSIAEHLPWLQSLFPLEVEAFDKHWDRRDRLTRTIMEEHTKARLESGSEQQHFVGALLSLRDEYDLSDDTVTGLLW

VPHSSPVPSLLIFGNLLFVWLTCLNEFESQ

DMIQAGMDTIAITCEWGMAELIRNPQVQAKAQEELDRVIGDKRAMTESDFSQLPYLRCIAKESLRLHPPTPLMLPHRASKHIKLGGYDVPKGSNVHVNAWAIARHPDTWKDPTVFRPERFLEDDVDMKGQDFRLLPFGSGRRICPGATLGTYLLQLMLGRMLHGFRWTTIDASSIDMSEDPGLVAFMTTPLVAVATPRLPSDLYSCQSMKV

>CYP98A 1487.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00101.79

81% to CYP98A27 Populus trichocarpa, intact

71% to 1487.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00040.62

MDFLSPLSSLSLPTISLLTLTIFFLLLKLISSLRYKLPPGPRPWPVVGNLYDIKPVRFRCFAEWAQHYGPIMSVWFGGTLDVVVSSPDLAREVLKEKDQQLADRPRSRSSAKFSRDGKDLIWADYGPHYVKVRKVCTLELFTAKRLEALRSIREDEVTAMVESIYKDCVSPGKTGESLVVKNYLGSVAFNNITRLAFGKRFVNAEGIMDEQGKEFKDIVATGLKLGASLAMAEHIPWLRWMFPLEEEAFAKHGARRDRLTRAIMDEHTRARESGSAKQHFVDALLTLQEQYDLSEDTIIGLLWDMITAGMDTTAISVEWAMAELIRNPRVQAKAQEELDSVIGHERVMTEADFPRLPYLHCVTKEALRLHPPTPLMLPHKASANVKIGGYDIPKGSNVLVNVWAIARDPTAWKEPLEFRPERFLEEDVDIKGHDFRLLPFGAGRRVCPGAQLGLNLVQSMLGHLLHHFKWAPPDGVDPSSIDMSENPGLVTYMMHSVKAIATPRLPPHLYTRVPTQM

 

>CYP701A 32622.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold03314.1

61% to CYP701A30b Solanum tuberosum, C-term

2 aa diffs to 32622.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold03588.1

57% to 2878.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00056.69

same as Ambtr1_0_15-AmTr_s03314_1-Amborella_trichopoda

MQLLVLIWEALLESSDTTPVVVEWAMYELAKNHGCQESLYEEIKSVCGDEKVTEENLPHMPYLNAVFHETLRKHSPVPIMPLKYAHKDTEIGGYHIHKGSQIAINIYGAHRDEKEWEDPEVWKPERFLTGKHQLQDMHKTLAFGLGRRACAGSMQAMNISCTAVARMAQEFKWTLKEGQGDDDDTVLFTTHKLQPLEAYITPRSTL

>CYP701A 32622.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold03588.1

61% to CYP701A30b Solanum tuberosum, C-term

57% to 2878.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00056.69

same as Ambtr1_0_15-AmTr_s03588_1-Amborella_trichopoda

MQLLVLIWEALLESSDTTPVVVEWAMYELAKNHGCQERLYEEIKSVCGDEKVTEENLPHMPYLNAVFHETLRKHSPVPIMPLKYAHKDTEIGGYHIHKGSQIAINIYGAHRDEKEWEDPEVWKPERFLTGKHQLQDMHKTLAFGLGRRACAGSMQAMNISCTAVARMAQEFKWTLKEGQGDDDDTVLFTTHKLQPLEAYITPRSTF

>CYP701A 2878.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00056.69

61% to CYP701A23 Vitis vinifera, intact

57% to 32622.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold03314.1

MVGFSLDNPLTVLATFAFALFSWFLFTRLFFSLSRKSSNAPPAVPGLPVLGNLLQLKSKKPHMTFTKWAEAYGPVYSIKTGATTLVVLNSTDVAKEALVDRFSSISTRKLSKALQILTCDKAMVAMSDYGEEHKLMKRCILTSLLGSNAQKQHRFDRNTMIENMMQSLHDEVKDNPTGSICIRDIIKKELFTFSLKKALGRDVGSVYVEELGRTVSKWEIYDILVIEPMMGALEVDWRDFFPYLRWIPNRTVEERIQRMDFHKTAVMTALIQEQKKRFAMDEEKDCYLNFLLSEAKTLSEKQIITLTWEAIIEASDTTMVAAEWAMFELAKNPKLQNCLYDEIHKICGEDKLIEDVLHRLPYLNAVFHETLRKHSPVAIMPPRYVHEDTQIGGFTIPAGSEIALNLYGCNMNKNVWEKPEEWRPERFLNGKYEQMDLFKTMAFGGGKRVCAGALQAMTIVCTAIGRFVQEFEWRLNGEEEDTEELVLLTTHKLKPMQASITPRSKILQTYG

 

>CYP703A 6979.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00092.5

70% to CYP703A14a Nelumbo nucifera, intact

41% to 2012.10 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00181.7

same as Ambtr1_0_15-AmTr_s00092_5-Amborella_trichopoda

MDLSILTMTILSITLASMILALRILQSSKVKIRLPPGPPRWPIVGNLLQLGPLPHKDFASFCSKYGPLVYLRLGNVDSITTNDPEIIKEILLKQDDAFASRPKTLAAIHLAYNSGDVALAPFGKHWKHMRRICMEHLLSTKRLESFQEQRRQEAQFMVSSVYRDAMHGKTINLREVLGAFSMNNVTRMILGKQYFGAGSAGPDEAAQFMDTTHELFWLMGVIYLGDYLPFWRWLDPYRCEEKMRDVEKRMDAFHVRILEEHRRRTKVVKEGSKDETMDFVDILLSLPGEDGKEHMEDIEIKALVQDMIAAATDTSLVTNEWAMAEVIRNPRILKKLQDELDTVVGKDRMVVESDLNHLQFLRCIVRETFRMHPAGPFLIPHESLRPTKLAGFDVPEKTRIFINAYALGRNPKIWDNVDEFYPERHMTVDGGRIEISHGADFKILPFSAGKRKCPGAPLGLCFVLLGLARLFHAFNWYPPKGMSEKDIDVNEVYGLTMPKANPLLAMAKPRLPSHLY

 

>CYP704 712.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00069.187

50% to CYP704A80 Nelumbo nucifera

56% to CYP704A15 Papaver somniferum

50% to CYP704A74a Solanum tuberosum

49% to 1195.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00069.157

41% to 6487.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00010.522

MDFLSLALSTIAGAFSLLLLFKLSTKKLFNSSYPPAVGSIINEIINYRRLYDYHTDLCRNYRTYRLLYPWSSEIYTANPANIEYFLKTNFSNYEKGRSNYEIMSDFLGDGIFTVDGDKWRQQRKLASYEFSTKAVKDYSSHVFTKNAAALAHKVSEIAAPNKVIDMQELLMKSTLDTIFIIGFGVELSSLLGAEENGKAFAEAFNETNALIFWRYVDFLWKFKRFFNVGAEAKLKKSIQTIDELIYKVIHSKRKLISTQDHS

(100 aa gap)

DGKWCVSDDTLPDGFKLRKGDGILFPAYAMGRMTYLWGENAEEFRPERWLENGVFKHESPFKFTAFQGGLRMCLGREFAYRQMKITAAILLRFFRFRFKDENKKIKYRTMFTLHIDGGLQLLAFPR

>CYP704 1195.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00069.157

55% to CYP704G12 Thapsia villosa, intact

56% to CYP704A22 Vitis vinifera

55% to CYP704A74a Solanum tuberosum

49% to 712.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00069.187

39% to 7300.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00002.483

MTPVEASILLIASVIITVFICVILERRVWRYGAYPPVVGTVVHQLINFSTLHHFHLGHAQKHTTYRLLSPARGELYTVNPANLQHILKTNFANYGKGKYQHEVLKDLFGDGIFAVDGERWKTQRKLASYEFSTKVLREFSCKVFCKNAVKLAGKISEAAKSHLIMDIQDLLMKATMDSLFKVGFGLELNTLLGCEEENKFAKAFGELSAQLLRRFTNPLWKLERFLSLGPEAMLRKNIKFIDDFVYKIIQQKREQVSKEHDSLEKHRKEDILSRFLVESEKYHEKMSDKYLRDIILNFLIAGRDTTAGTLSWFFYLLCKHPHIQEKIAQEVRESVCTKNEGNVEGVTMSGFADALTEGALGRLQFLHAALAETLRLYPAVPVNAKVAFGDDVLPDGSKVRKGDMVNYLSYAMGRMTSIWGDDAYHFRPERWIQNGVFQPKTPFEFPAFQGGPRICLGKDFAYLQMKVMAAVLIRFFKFKLRDEEQEAHYHTMLTLHIDHGLHVYAFSQNI

>CYP704B 6487.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00010.522

74% TO CYP704B32 Nelumbo nucifera, missing C-term

43% TO 1195.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00069.157

MENLNHISSTSTGFSLGLALVCVFLSWILVHRWGQRNSKGPKTWPVVGSAIEQLMNYDRMHDWLVEYLSKERTVVVRMPFASYTYIADPVNVEYVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGETWKQQRKTASFEFASKNLRDFSTVVFRDYALKLSNILSQASYCGHEVDIQELLMRMTLDSICKVGFGVEIGTLSIDLPENSFARAFDTANIIVTLRFIDPLWRIKRFLHVGSEALLKQSIQQIDDFTYSVISKRKFEIKEACISGNMNIKHDILSRFIKLSEDPNSNLNDKNLRDIVLNFVIAGRDTTATTLSWFIYLMITHPHVSQRLYLELKAFEEERAKEEHVPLVQYDLQDIQSFNERVSQFSSLMNYDSLGRLSYLYAAITETLRLYPAVPQVIGNNQFSVSNHSQIPFLVSSH

 

>CYP706C 831.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00069.158

65% to CYP706C7 Vitis vinifera, intact

59% to CYP706C6 Populus trichocarpa

62% to CYP706J7 Nelumbo nucifera

43% to 19260.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00011.119

MEPPARPWLAQPRLEIGHTNALVLVALTLIATIYAIAKRKQRLPPGPRGWPLLGNLPSLDPNLHECFASLSKRHGPLMSLRLGTKLAVVISSPELAREVLKDHDVTFANRDVPAAALRIAYGGSDIVWTPHGPLWRLLRKVCVRELLNSTILDSLYTLRRRQTRATVREMLHKAGTPVNVGAHMFLTALNIITNMLWGKDSGDQDDWAKAVEFRRLVGEITELLGRPNVSDLLPLLRPLDLQGIEKKMGGLFVRFDGIFNEIIEQRMKDGGKEGSHDFLNYLLDLKDKGDPKTPLTMTHIKALLMDMVVGGTDTTSNTVEWAMAHMLEKPEIMKRAQEEVDRVVGTSTTVEESHLSHFVYLDAIVKEVLRLHPALPLLVPHCPSAPCTVGGYNVPTGTRVFINVWSIQRDPAHWDRPLEFDPERFLREPKWDFSGRDFEYFPFGSGRRICAGIAMANRMVNYSVATLLHSFEWCLPEGEKLDMAEKFGIVLKKAVPLLAIPEPRLSDPALYEE

 

>CYP707A 1792.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00091.57

70% to CYP707A40 Vitis vinifera, intact

62% to 1935.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00011.195

59% to 12353.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00012.224

MSFVMGWSLYCFAAALSALLFGFLVKNRGRTFKSTTKLPPGTMGWPFLGETLQLYSHDPNIFFAAKQKRYGEIFKTHLLGCPCIMLASPEAARFVLMNQAHLFKPTYPKSKELMIGPNAIFFHQGDYHARLRKLVQGALSPEVIRSIVPDIEAIALPLLDSWDGRVINTFLEMKKYTFDVGILSIFGSLDLHYKEELKKNYCVVDQGYNSFPNKIPGTLYRNAVQARKELSKILGTIISERREKAMEKKKLLGSLLLSRDGNGEPLSDEQISDNIIGVLFAAQDTTASVLTWVLKYLVDNPKLLEAVRAEHVAIQEANENARNSVTWAQTRNAMPLTSKVISETLRMASILSFTFREAIADVEYKGYLIPKGWKVMPLFRNIHHNPDFFPDPHRFDPSRFQVPPKLNTFLPFGTGAHACPGNELAKLEMLILLHHLVTNFGWEVVGPRHGIQYCPFPIPKDGLLARFHKDPAIQDHKNSNQ

>CYP707A 1935.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00011.195

77% to CYP707A79 Ricinus communis, intact

64% to 12353.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00012.224

60% to 1792.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00091.57

MAAIVTTLFLFISFFSFIWVLAGHLRRGRRRLPLPPGSLGWPYIGETFQLYSQNPNTFFAQKQQRYGSVFKTHILGCPCIMISSPEGARFVLVTQAHLFKPTFPASKEKMMGPQALFFHQGDYHMKLRKLVLRAFLPESLKPKVADIETVAIDSLASWDGNTINTFQEMKTYAFNVALLSIFGKDELPFIEELKEAYYTLEKGYNSMPINLPGTLFNKAMKARKRLSQISAEIISSRRVTKMESNDLLGSFMGAKEALTDEQIADNVIGVIFAARDTTASVLTWIIKYLGENPRFLQAVTEEQEAIVKSNGEKKPLSWADTKNMPLTSRVIQETLRVATILSFTFREAVEDVEFEGYLIPKGWKVLPLFRNIHHSPDIFPDPEKFDPSRFEVAPKPNTFMPFGNGIHSCPGNELAKLEILILLHHLTTKYRWTVMGSNNGIQYSPFPLPQNGLPIKFSVKT

>CYP707A 12353.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00012.224

68% to CYP707A10 Populus trichocarpa, C-term seems wrong

64% to 1935.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00011.195

MCILLFPVALLALLFLIRLWHHPTNKHLPPGSMGWPYVGETFKLYSQSPESFFADKQRRYGAIFKTHILGCPCIMISNPEAARCVLVSQAHRFKPTFPSSKERMIGPQALFFHQGEYHTRLRKLVQASLLPNAIRDSVSDIEKVVLSLLKSWECTTVNTFHEMKKLTFEVAMLAVFGSCRDLDSEGIKSLYLSIERGYNSMPLNFPGTSFHKAMKARKRLSEMLRKVMAKRRAEKVTRGGLLEILMASSKGGKRMELTDGQIADNVIGVIFAAQDTTASALTWVLKFLRDHGPLLHSVTREQEGIRREMIKGNRRLTWNDTRNMPLTTRVIQETLRAASILSFTFREAVEDVELNGYVIPKGWKVLPLFRNIHHCAEFFPEPEKFDPSRFEVPLKPNTFMPFGNGLHSCPGSELAKLEMLVLLHHFTTKYRWDVVGKESGVQYGPFPVPKQGLPIR

VSNLRNRKSTTTITTTTTITLNKK

 

>CYP710A 4464.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00141.11

64% to CYP710A18 Vitis vinifera, intact

28% to 383.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00049.137

MDLALYAYTLLSICIFIIISEQATYLRKKGSAPGPYLVVPFLGNALSMVRNPTAYWHDQASAALSSPLGLSANLLFGRFVVFLRDSGLSQKVFANVRSGVFHLIGHPFGKKLFGEHNLIYMLDHAHKDLRRRLAPNFTPRALATYLPLQSRVIVSHLVAWGHLANAGNAPLPIPLRLLSRDLSLETSQTVFVGPYLPQNDRLAFKNDYNLFNVGLMKLPIDLPGFAFWRARLAVGRLVDTLSGCAAKSKERMRAGDEPSCLMDFWMAETVKEIAEAEKAGMPAPPDSSDREVAGHVFDFLFASQDASTSSLLWAVTLLDSHPDVLARVREEQAKVRPTGSLDITLDQLREMKYTEMVAKEVVRIRPPATLVPHVAACDFPITEGYTIPKGTIVFPSVYESSFQGFTEPEKFDPDRFSGERQEDQVFKQNWLPFGAGPHHCIGQRYALNHLMLFIAVFFTVFEFRRHKTPGCDELAYVPTIAPKDDCLVYLSFRKDFILPKYTA

 

>CYP711A 2203.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00036.59

63% to CYP711A12 Medicago truncatula, intact

MAFMEGFLLPLFRVTSPYFSIRNLFERWVPLICTVIAIVVGIIYVYFSAPSWRVRAVPGHPTRWFLGHLHLLAKHGPGVFSVLAKEYGPIYRFHMGRQPLVIIADAELCREAGIKKFKDLPNRSIPSPISASPLHLKGLFFSRGSRWSIMRNTITSLYQPSHLASLIPTMHFFIASASSMLESHLQRKEDDVNFSELTLKLTTDVIGRAAFGVNFGLTGSSSAQSGQNTLKKDENSEDGYISKFLNQHIYSTTSLKMDLTGTFSIILGLFFPILQNPVRWLLCRIPGTADREHELANKELSQRVDEVVEKRCKEIEGGSSNIDLLTAVLNAQESYRAISKKIFTPECVSSLAYEHLLAGSATTSFTMAATVYLVSAHPEVEEKLLREIDTFGPPNKRPDAEDLRLNFPYLDMVVKEAMRFFTVSPLVAREAERDVQIGGYLLPKGTWIWLALGVLAKDPSNFPEPEKFKPERFDPQGEEEKKRHPYAHIPFGIGPRACVGGKFSIQEIKLTLIYLYQRYIFRHSPNMESPLEFDYGVVLNYKHGVKLRILKRSRV

 

>CYP714 2214.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00043.13

48% to CYP714G10 Nelumbo nucifera, intact

49% to CYP714E4 Populus trichocarpa

36% to 72.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00117.65

MELLLQILLSLVLVSFSSLIMCVAHNLWLRPKRIRETLSKQGIRGPRSPSFLHGNLKEMKQMKFVETDEEEQSPHDYVPRLFPYFHQWKKTYGSTFTYSSGTTVFLYVGDPDMIKEMSMCTSMELGKPRAWGKHRAALFGKGILMANGENWRRQRKIIAQELYMDKVKSMIGLMVECGISMLEGWERRVERAGGVGALRVDEDLRNFSADVFSKTCFGSSYEKGQEIYHRLRCIQRAMAKQGLLVGVPGMRFIPNTINREIWKLRREVRSIILKALKERMAEPKAAAEDDLLKAILENSKAVEAHATPDDINNLIVDNCKNLYFAGHETTASAASWCLLLLAMNPIWQTRVRDEVAEVCKGYLPNIEMLRQMKILTMVLHETMRLYAPAAFMIREAFVDLQFGGIRIPAGTNLWIPVSALHHDTEIWGSDAHIFNPERFANGIIGACKNPYAFHPFGFGSRTCVGQNFAMVELKIVISLIISKFKFSLSQTYCHSPTFQLVVEPANGLQLVMERV

 

>CYP715A 3866.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00009.253

52% to CYP715A3 Populus trichocarpa, missing C-term

52% to CYP715A17 Nelumbo nucifera

55% to CYP715A6 Vitis vinifera

37% to 2214.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00043.13

MGFSCLQHLPFAMAMVLMLCFFLLNLVWLCWLSPMKMKRRLEKKGFKGPPPKFPFGNINEMRKRAPLAPNSLINHDIHARAFPYFAQWRKSYGDTFVYWLGTEPFLYVADPEFVKLMNSSMGGKGWGKPSVFKHDRKAMFGKGLLMVEGEEWAHHRQTVAPFFSSGNLKAMIDIMVDSTNKMLDAWSKLVDSGTTEIDVESEITRSAAEIIARASFGVSYENGKDIFKMLRAIQQILFKSQRPVGVPYNGILHLRNLRKAVQLFLLSKQVDSSFLKLVNDRRSNTDIQRTDLLGLLLRDGTSEKERRFTSQELVDECKTFFFAGHETTSLALSWTLMLLASHVEWQKELREEVMEATKGETLDSNMLPKLKKMGWVMKEVMRLYPSGPNVQRQAREDIQIGDKMVPKGTNIWVDIVALHHDPRLWGEDVNEFKPQRFREGVQEACKHRTGVL

 

>CYP716 383.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00049.134

48% to CYP716B1 Picea sitchensis, missing C-term

50% to CYP716E8 Nelumbo nucifera

78% to 383.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00049.136

81% to 383.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00049.135

76% to 383.6 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00049.133

69% to 383.5 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00049.139

67% to 383.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00049.137

MEHGVMMFLWVLVIGLATLVVVSRWWHSQHHQKGLKLPPGTMGWPLIGETLQFIGAVGSKGTEGFLKEKAQKYGTEVFKISVLGRPLAVFCGAAGNKFLFSNENRVLVTTWPPSVARIFGSALNIATGDHAKRTRKLLMAFLKPEALQKFVSQMDLVAREHLRTHWNGKLEVRAYDMLKVYAFALACTLFASIEGEERRAELSALFKVFLRGLMGLDLKIPGTRHYKAKNAAAALKRELMKELEERRVALSEGRASPKQDLLSYLLTTADDQGGYMSDTEVVDNILLMLFAGHDTSSSTLLMVVKHLAEKPYFYNEILKEQREIAQSKKKEELLNWEDLRKMKYTWNVVCEVMRVSPSVSGTFRRSITDFNYAGFHIPKDWTDHYIAPVMLHKIT

>CYP716 383.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00049.135

MKDRARSKTYCPIYSSLLITRGGYMSDTEVVNNILLLLFSGHDTSSSTILMVLKHMAEKPYFYEEILK

GVGLLCVYNTYTGVGFEPVMEQGVMMLLSVLVIGFVTLMVVC

53% to CYP716E8 Nelumbo nucifera, fusion top part = I-helix region

51% to CYP716A54 Ricinus communis

N-term revised, intact

MEQGVMMLLSVLVIGFVTLMVVC

RWWCCQHDQKGLKLPPGTMGWPLIGETLQFLGSNEGFIKEKTKKYKTEVFKTNFLGRPLAVFCGAAGNKFVFSNENRVLVTTWPPSVVRIFGTALNTTTGDDAKRTRKLLMAFLRPEALQKFISRMDLVAREHFRTHWDGKPVVKAYDMMKAYVFSLACSQFASIEREERRAELSALFTVMVKGLMSLDLKIPGTSHYKAKKAAVALKKELRKEMEERKVALSEGRSSPKQDLLSYLLTTADDQGGYMSDTEVVDNILLLLFSGHDTSSSTLLMVLKHLADKPNIYNEILREQREIAQSKNKEELLNWEDIRKMKYTWNAVCEVMRVSPVVGGTFRRAITDFNYAGFHIPKDWTLHWSAHTTHMTAEYFPEPEKFDPSRFEGKGPPPYTFVPFGGGPRMCPGLEFARAEMLVFLHNLVKNYKWELVFPNEKIHMEPLPAAAKGLPIHLHPHQQHS

>CYP716 383.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00049.136

55% to CYP716B1    Picea sitchensis, intact

81% to 383.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00049.135

MEQGVMMFLWVLVIGFVTLVVVCRWWSSRHHQKGLKLPPGTMGWPLIGETLQFSGALGSEGNEGFIKERTRKYGTEVFKTHFLGKPLVVFCGPTGNKFVFSNENRVLVNSWPPSVARIFGTSLSTRAGDDAKRIRKLLMAFLRPEDFQKFVSRTDIVAQKHLRTHWYGKSEVKTFDMLKAYAFSLACSLFASIESEERRAELSALFIVLLRGLLKLDLKIPGTSHYRAKKAADALKRELRKEMEERKEALKDGRATPKQDLLSYLLTTADDRGGYMSDTEVVDNILLLLFGGHDTSSSTLLMVLKYLAEEPYCYNEILKEQREIAQSKNKEELLNWEDIKKMKYTWNVVCEVMRVAPAVSGTFRYAITDFNFAGFHIPKGWMLHWSAYTTHTMAEYFPEPEKFDPSRFEGEGPTPFTFVPFGGGPRMCPGIEFARVGMLVFLHNLVKNYKWELVFPDEKIRMDPMPVAANGLPIHLHPHQQHS

>CYP716 383.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00049.137

56% to CYP716B1 Picea sitchensis, intact

87% to 383.5 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00049.139

MVVLWSGEMVVLWAALAVGFATLMVARRWWRTKHPGEGPKLPPGTGGWPLIGETLPYLALTGSGENFIVKRMRKYRTQVFRTHILGSPMAVFCGAAGNKFIFSNENRVLVNAWPASVAKLFGRSVITTTGDEAKRVRKVLMAFLSPEALHEFVGQMDSAARLHLKRYWDGKAEVKVYSMLKVYTFSLACSLFASIESEERKAQLSAFFNVFLKGMMQMDLKIPGTRYYKAKKAVDALRRELRKEVDDRKEALRAGTANPKQDLMSYLLTTADDSGKHMSDEEVVDNIINLLFAGHDTSSSTLLMVLKHLAEKPYYYNEILNEQREIEKSKGKEEVLNWEDLKKMKYTWNVVCEVMRVSPAVAGAFRLAITDFDYAGFRIPKGWRLHWNVHTTHMMEEYFPEPEKFDPSRFEGEGPPPYTFVPFGGGPRMCPGLEFARVEMLVFLHNLVKNYKWELVFPNEKIHMDPMPVAENGLPVHLHPHQKHS

>CYP716 383.5 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00049.139

54% to CYP716B1    Picea sitchensis, intact

87% to 383.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00049.137

MEVLWALAVGLTTLVVVRRWWCAKHRGEGPRLPPGTRGWPLVGETLQFFAIFGSESTESFIVKKMQKYKTQVFRTQILGSPMAVFCGATGNKFIFSNENRVLVTSWPTSVAKLFGTSIITTAGDEAKRVRKLLMAFLSPEALHKFVGQMDSAARLHLKRNWDGKAEVKVYHMLKVYTFSLACSLLASIESEERKMELSALFNVFLQGMMHMDLKIPGTRYYKAKKAVDALRRELRKEVNGRKEALRAGTANPKQDLMSYLLTTADDSGKYMSDEEVVDNIINLLFAGHDTSSSTLLMVLKHLAEKPYYYNEILNEQREIEKSKGKEEVLNWEDLKKMKYTWNVVCEVMRVSPTVSGTFRHAITDFDYAGFRIPKGWKLHWNAHTTHKMEDYFPEPEKFDPSRFEGEGPPPYSFVPFGGGPRMCPGLEFARVEMLVFLHNLVKNYKWKLVFPNEKILMDPMPLAAKGLPVHLLPHLQHS

>CYP716 383.6 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00049.133

55% to CYP716B1    Picea sitchensis, intact

73% to 383.5 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00049.139

MECGEMMFLWVLAIRLATLVVVRSWWCSQHHQKGPKLAPGTMGWPIIGETLQFIGGSEGPESFIKEKIQKCGIHVFKTHLLGSPVAVFCGATGNKFLFSNENRVLVNAWPASVGRIFGNSLITTTGDEAKRVRKLLMAFLSPEALHKFVSRMDSVAREHLKTRWNGKPEVKAYDMIKAYTFALACSLFASIEREDHSAELSVLFTVLVKGLMRLDLKIPGTRYYKAKTATQALKRELRKEMEVRKEALREGRASPKQDLLSYLLTTADDQGGYMSDAEVVDNILLLLFAGHDTSSSTLLIVLKHLAEKPYFYNEILTEQREISQSKDKEELLNWKDIQKMKYTWNVVCEELRVSPSVAGGYRQSLTDFTFAGFHIPKGWRLHWNTHTTHKVAEYFPDPEKFDPSRFEGKGPPPYTFAPFGGGPRMCPGLEFARVEILVFLHNLVKNYEWRLVFPDEKIKIDPMPVAEKGLPIRLNRHQQDS

>CYP716 24570.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00119.10

50% to CYP716B1    Picea sitchensis, intact

49% to 383.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00049.137

MEGELMFFSLAIATLAVAVAWFKSRTRRSNHRTSCEPPGSLGWPIVGETLAILRSGRSGKPELFVQERMLRHDPDVFKTHLLGEITATFCGPNGNKFLFSNESKGLLLTCWPSSLARLFGDSFLTKLGEEAMRVRKMVVVPFLRPDTLHRLVARFDLLCKVRIERDWKGRGVVHAFPLIKKYAFSVACGLFTSIGSEEDQARLLEELSTVAKGAFQLPIYFPGTRYYRAARSGDLLRAELLKVVQSRRSNYIAGAEEEDDLMSHLMKVKDEEGNSLTDKQIADNVILLLSAGHDTSSSTMAMLLFHLAHNPHCYDRVLQEQREIAKSKAQGEFLNREDIQKMKYSWNVVNEVLRLSPPIQGTLRKPSTDLTYAGYTIPKGWKLGWSVNSTHKMDKHFPEPEKFNPARFEEEEEVEGDSPPAPYTFVPFGGGPRMCPGKDFARIQILVFLHNIVTNFRWELLFPHELISVDPMPTPSKGLPINLYPHLKH

 

>CYP720A 11926.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00171.20

63% to CYP720A1    Lotus japonicus, missing the C-term

36% to 5033.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00059.35

MIFDGISGSMGGKETIIVSVILATLLLVVLSIALGKQKSRNSVRASRLPPGVKGWPFIGDTLNWYLSISSSHPPRFVEAHVEKYGKIFSCRLFGRQAVVSADSHFNRFILQNEGRFFQSSYPKSFRDLVGKNGVIAMQGEQQRRLHGIAVNMMKMDKLKFHFLNDIQVVLLQTLNNLQENENLLFQNVCRKLAINLMVNQLLGVTTEAEINDMAHLFSDFVNGVLSIPINLRGFPYYTAMRARNIIISKINKTIELKKHSELETGNSVLGRLLNEENLSDEAVADFIISLLFAGNETTAMTMLFAISFLSQSPKALKQLIAEQDGLRKAQGLMLTWEDYKSMHFTQCVIDETLRVGGIAISLMREAKENVEYQGK

 

>CYP721A 4172.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00059.82

59% to CYP721A29 Nelumbo nucifera, intact

56% to CYP721A12 Carica papaya

47% to 2350.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00042.17

48% to 72.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00117.63

MVFVILALLLSLFSFTIIIKCIYVYLWCPFKLESEFRRQGISGPGYRPPFGNAPQIVKFYKDAESHPISFSHHILPMVAPQYHHWSPVYGKTFLYWFGSKPRLAIGEPELVREVLLKTGGPFEKLDFSPLSRHLVGQGLVGLKGQKWSLHRKMINPAFHMDQVKAMVPTIVASTTNMLKEWEQVVGGNECEIEIYKELHRLTADVISRTAFGSSYEEGKNIFKMQEEQMLLVSEGLRSVYIPGFRFVPTKKNRRRWKLEREIRSAFRKLIQKKEGERENCGNLLGLLLTTNKVQEREDQKMDLEEIVDECKTFYFAGKETTANLLTWVVVLLAVHTEWQNKAREEVLRVCKEFPDADNLNDLKIVEMIVNETLRLYSPAPFLQRETNKDVKLGRYYLPSGTQLDLPISAIHHDTSLWGEDAEDFNPQRFIGGPSVARKHMAAFVPFGLGPRICVGQNLALIETKVVLAMLLQRFSFVISPTYVHAPMLDITVQPQYGAHIVLRKL

 

>CYP724B 5767.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00061.116

71% to CYP724B19 Nelumbo nucifera, intact

72% to CYP724B13 Vitis vinifera

47% to 5033.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00059.35

41% to 2225.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00029.413

MEGLPYCFSLVLGCFGVLVFTLVFLHFLSFFKRHGVVPCGSVGWPLLGETLEFLSPHPSNSIGGFLHEHCSRYGKVFKSHLFGSPTVVSCDQELNSFILQNEEKLFECSYPKAIHGILGKSSMLVVVGDTHKRLRGLALTLVNTSKSKLEYLNDIENTAKFIMESWREKPQVIFCEEARKFTFNVIVKQVLSLRQDEPQTTKILEDFLTFMKGLISFPLYIPGTPYARAVQARARIFSTVKAIIEERRNTGSYANNGRNEDFLDILMGSNTLCEDEKVSLVLDLLLGGYETTSLLMAMVVHFLSFSPLALEQLKEEHQNIRGRKRNDEYLNWEDYKQMEFTQSVVNEALRCGNIVKFVHRKARKDVKFKDYLIPSGWKVLPVFSAVHLDPTLHEDALQFHPWRWEVQGPPSKKFTPFGGGPRFCPGSDLAKVETAFFVHHLVLKFKWTTEGADHPMAYPYVEFQRGLPLNVQPILSQPPF

 

>CYP727A 12379.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00101.80

56% to CYP727B6 Nelumbo nucifera, intact

56% to CYP727A7 Vitis vinifera

MSSCQASYTLLGFLLQKNDSLCALNAQFLRDYADRLVNALLWVSLITVTTLLLRRVFRLLRFWSKGRRIPGPPCPSFYGHSRFFSRTGSTGNLNEFLSRSHKEYGPIVRLWLGPTQLLVSVKDPELIKEMLLKAEDKLPLTGKAFRLAFGPSNLFVSSFEKVQKRRESLSTELNGSLLERVHDVSLKVANGIAERIDSAKFKGALDCGSVSQHMAFSIIGSAFFGDAFLVWSNAKVYEELLMMVAKDACFWASYKIPPLWKRSFWRYQQLCAQLKSLTRDIVQESRQHHKLSGSFNQYHRNETTTSGCMADSNAEVLFAKDTVASILFPGELNDCIDLSEESCGNIMGMMFHGCFTAAGLIGSILTRLVMHPEIQEKIYSEICSVCKKSSMPDVIEVQKMHYLFATVYESARLLPAGPLLQRCSLKHDLNLCANIIIPAGAILAVPTLLVQTDGSSWGIDASQFNPTRFLSKATNCSDHNDVKPNFRLTTSIEGSGAYGSPLTKCLGFEDPNANAAFLPFGSGVRACIGQKFAVTGITALLASLLQLYEVRLDPVSKKDPNPTMSDSVLQLPPSPSIVLVKRDC

 

>CYP728 14184.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00077.64

54% to CYP728G1 Vitis vinifera

47% to CYP728F1 Populus trichocarpa

47% to CYP728E1 Populus trichocarpa

35% to 24570.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00119.10

MAMFFGGNFSQTFRKKKLPPGNLGLPLIGESIGFLKAHKGDKAAAWIEQRIAKFGPVFKTSLMGSKTIVLIGPSANRFMFNDAAIGSHQPVGVTQILGPNNIFELNGERHKIVKSSFMGLLKPDGLRTHVPTMSSIICSQIEREFEGKDSVHAVPIMKRLALRLTCALLFGIADEEWDEDAMVQEFTDAIRAAWTVPIDFPGTTFRRGLKARAKIGEFFSGLLQRRREKMEGGEVGEDVVCSMLGVRDGEGKGLSESEIIDNLVTLMFASHDTTAVVLILTLRQMARDEKVHDKILQEQKKIGREMDGSDGRLTWNELQKMKYTWTVVQELMRMTPPVFGNFKKALKDTTFGGFDIPKGWQVFWVSSGTHLNEKIFQEPQKFEPSRFEASSKSFPSYTYIPFGAGPRSCPGNEFARVEILSTIHHLVTKYRWSEMVPNEPLTHQPLPYPAFGLPIKIETIKNSLQ

>CYP728 3024.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00062.139

50% to CYP728B6 Vitis vinifera, intact

49% to CYP728B22 tomato

39% to 14184.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00077.64

MEPSKNPTPIPQLLPSPLFYLLLALMTLLFIARSAGKLAGKRKLPPGPAGLPFVGQTFALLKAMRQNRGEQWLAEMAERYGPVFRLSLFGSNVAVLSGVNGNKVVFGGGGGGDDVVGAKQAEWALRILGRRNLLTLDGNAHRRVRGAMGVFLKGDVVRGYVGRMGELVERHLEREWKGKETVLAMPFIKSLSFDIICTLLYGLGGVADRDSLKKDFQDLIKGLWSLPLNLPFTRYRRALQAARRLRAAFAELVVTRKGQLERGEATAYDDLLTCFLSAKGEEEGFTEEEIVDNGVLAMAAGHDTLTLLITFVTRVLADPDLYARVYAEQSEIANGKGHDEPLNWEDLTKMKYTWRVAQETLRLYPPIFGSYRRILKDFEYAGYHIPKGWQILWVSSLTHMNKDFFPEPSKFEPARFDNQSSIIPYSFVGFGAGPRICIGQEFAKVETLVTIHYMVTHFSWKLACPDETVARVPVLTLSKGLPIHLLPHKI

 

>CYP729 45292.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00011.58

46% to CYP729A2 rice intact

MELGDFPLVTAIIAILIPLLLWLFSIINDWRYCRGLEKERDGHRVPPGSMGWPVIGELLDFLWCFKFTRRPDDFIAKRKSRHGDSGIFRTHLFGQPSIVTCSPEMNKFVLGRGTEDGSFGPGWPSSQLLGASSITMKDGLSHKRLKRYFMDAFNSPRALSSLLTNAQPTFVEFMENWVSKGRISAFEETRAVTFANICDILASFKEKTLLCTMERFYTGLMAGLRAMPLNFPGTSFHHALKCRKKLTDILLKEIKERKEKSIHKTDFMQVLLDSTDENGEYLSEQEIVDNTVSFILGGYESTSNVMTWALYYLAKYPTIMQKLKDETLSIRGKKPKNGLLSMEDLKAMKYTTKVADEVIRLANISPFIFRRVLKDGIVFNGYTFPKDWRILVWIRSNHIDSEYFDDPLTFNPNRWDNFKPKPGTHNVFGHGPRYCPGNNFAKLQVMMFLYYASSKYRWELINPNAGITFLPHPKPDDGVEIFFSHAL

>CYP729 9182.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00002.430

53% to CYP729A22 Jatropha curcas, missing the C-term

48% to CYP729A3 Populus trichocarpa

46% to 45292.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00011.58

MELVGMGLFCVILGLLAWVLWQWNEVWLVKPLLRDGVNLPPGHLGLPFFGEMLNFLWYFKIIRRPDEFIYSRKKRYGAQVGMYRSHLFGSPTIIVSDPTANKFVLQSDDLFEKHWPHPELVGANALVMAEGKLHKRLRKFVIDALNQPRSLRHVILKVQPRIVDALRHWASKGIIKAEHEARRVTFENICHMFASFEPGPFLEELERCYSGVVAGIRSQPSNIPGSAYQHAFNCKKKLSKAFAIELEKRKKNGSKSEDFLDALMNSCDEDGNHLQEKEVLDNIFSLLLGAYESTAISIMWALYYLSKSPHCLQRLREEHIEISKKKNGDYITIEDIRLMKYTSKVVEETIRLGNVSSVVFRIARQDVDFKGYRIPKGWKVSVWLRTLHVDPNNFDDPLNFNPDRWDAPKPFVKDI

 

>CYP733A 11868.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00030.2

71% to CYP733A1 Carica papaya, missing the C-term

34% to 1792.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00091.57

MDPHSLLISFALMVFSFIISALLYVLSSRRTLRAIQKIPGSLGWPIIGESLSFMAEFSTPSGIHAFIQKRQQRYGKVFKTSILGRLTVFMTGREASKILLSGKDGLVSLNLFYTGKQVMGPTSLLQTTGEEHKRLRRLIGEPLCLDALKKYLPFIDSLASDTLDQWAGRTVFVLEEASSFTLKVIGHIIMSLESHGEEQENFRNNFKTISSAFATLPLKIPGFAFYKGIKARDRMYSMLDIIIHKRRSGEKISDDFLQSLITNYSTRTEEDRLTDSQLKDNILTLLIAGHDTTTAALTWVIKFLEENPIALQKVREEHQQIWERRRDGIPQLSWSEVNNMPYTNKVINETLRIATILPWNSRKAAQDFEIDGYEIKKGWSINLDVVSVHHDPNLFMDPEKFDPSRFDVNFH

 

>CYP734A 2350.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00042.17

68% to CYP734A24a Nelumbo nucifera, intact

67% to CYP734A26 Ricinus communis

47% to 72.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00117.65

MMVEPRGLLWVLALLLLSLGLKGWALMWRRPKAIEAHFKRQGIGGPPYRLFLGNVKEMMSLMIKASSQPMSPSHNILPRVLSFYHHWKKAYGGTFLVWFGPTPRLTVADPDLIREIFASKSEFYEKDESHPLVRQLEGDGLLSLKGEKWALHRKIITPTFHMENLKVLLPVVGKSIIKMVENWGESSKTEIDVSESFQRLTEDIITRTAFGSSYEDGKAVFSLQSQQMELAADAFRKVFIPGYRFLPTTKNRRSWKLNKEIRRSLMRLIERREKEAEEGGVYGEDLLGLMIKARAEGAISAKDIVEECKTFFFAGKQTTSNLLTWAAVLLAMHPEWQERARAELLGLPDPPYIIPSKDQLDKLKTMSMILNEALRLYPPAVATIRQAKTNVELGGYAIPKGMELLIPILAVHHDPALWGPDADEFNPSRFSDGVARAATHPVAFIPFGLGARTCIGQSLALLEAKLVLTIILRRFDISLSPAYRHAPTVLMLLYPQHGAPLYFRPLLSAPTS

 

>CYP735A1 lcl|AmTr_v1.0_scaffold00156

53% to CYP735A1 Arab. missing C-term, (in a sequence gap)

68% to CYP735A21a Nelumbo nucifera

998157  MAAIFALAMVFSFLSVLVWMFQQGMSIYWWTPRRIKKYMEKQGVRGPKPSFLVGNLFD

        MASLLDKTTSSDMPYLTHDIVSRLLPHYILWSKLY 998435

998545  GERFIFWWGVEPRMCISETEMIKELLSSKNSLVYGKSAFQKQGSKHFIGKGL

        LMANGDEWFHQRHIVAPAFQADKLK 998775

999416  RHVGYMIECTNRTIQALHGAAKAGEEDVEICGYLCRLTADIISRTEFDSCYEKGKQIFELLTSLQLL  999616

999617  SSKASRHLWFPGSR  999658

1002437 FFPSKFNREIKSLKGEVEKLLLEIIESRRDCMEIGRSASYGNDLLGLLLAETEKK  1002601

1002602 YKKGESDDGFCFTTQHLMDECKTFFFTGHETTALLLTWTIMLLASNPGWQERAKAEVEQV  1002781

1002782 CGGSAPAVDHLPKLSL  1002829

 

>CYP749 16332.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.85

57% to CYP749A26 Ricinus communis, I-helix region

86% to 16332.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.94

MIKAREEKANNGESVGYGHDFFGMLLKSGHDTKKDAKLSLQDILDECKTFYFAGHETTYGLITWIIILLAMHPEWQDKARKEVTEVFSSSIPTMDGISRLKIVSS

>CYP749 16332.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.94

52% to CYP749A26 Ricinus communis, I-helix region

86% to 16332.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.85

MIDSRKEKANNGESVGYGNDFFGMLLKSGHEIEDEAKLSLQDILDECKTFYFAGHETTFGLISWIIILLAMYPEWQDRARKEVTEVFGSSIPTMDGIGRLKIVSF

>CYP749 16332.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.88

55% to CYP749A29 Ricinus communis, I-helix region

79% to 16332.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.91

MLMKMIKAREEKVKNGESDGYGKDFFGTLLESNHDTQDGAKHSLQDIIDECKTFYFAGHETTNGLLIWAVVLLAMHPKWQEKARKEVIEAFGFNTPTIDGVNRLKIANLTTIVY

>CYP749 16332.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.91

56% to CYP749A29 Jatropha curcas, I-helix region

79% to 16332.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.88

MMIAREEKVKNGECDGYGKDFLGMMLESNHDTQVGVKYSSQDILDECKTFYFAGHDTTSGLLTWTVVLLAMHPEWQDKVRKEVIEAFGSDTPTIDGVNRLKIMS

>CYP749 16332.5 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.83

48% to CYP749A9 Populus trichocarpa, I-helix region

86% to 16332.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.85

MIEAREEKAKNGESMGFGHDFFEMLLKSGHDTEEDSKLSLQDILDECKTLYSAGHETTYGLITWIIILLAMHLEWQDKARKEVTEVFSSSIPTMDGTSGLKLVCS

>CYP749 16332.6 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.80

47% to CYP749A9 Populus trichocarpa, I-helix region

81% to 16332.7 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.81

MIEARQEKLTNEDANGYGDDYFGMLLQSQANSKISMQDIVDECKTFYLAGHETTSALLTWTAVLLAMHPEWQERARKEVIQVLCSNTPSIDGLAQLKIVR

>CYP749 16332.7 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.81

48% to CYP749A9 Populus trichocarpa, I-helix region

81% to 16332.6 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.80

MLDQQITRSIRKMIEAREERVRNGDANGYGVDFFGMLLQSPVNSNISLQDIVDECKTFYFAGHVSSSALLTWTVVLLAMHPEWQERARKEVIQVLGSDTPSFDGLAQLKIVR

>CYP749? 20696.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.89

57% to CYP749A28 Jatropha curcas, EXXR to end

76% to 20696.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.92

69% to 20696.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.93

64% to 20696.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.86

MIINESLRLYPPVVMITRKLKRAVRVGKFTIPSGIELVQPTLAIHHDPGQWGNDANLFKPKRFSQGLMNATRSPMAFLPFGYGPRTCLGLNFAILESKLALSMILPRYALMPSPSYHHAPIVGITLAPQHGVPIIINPLQ

>CYP749? 20696.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.92

52% to CYP749B1 Petunia hybrida, EXXR to end

76% to 20696.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.89

63% to 20696.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.86

64% to 20696.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.93

MIIHESLRLYPPAVFIVRKLKRTTRFGELIIPSGIEIVLSPIAVHHDPGQWGNDVNLFKPERFLQGPVNAAKSPMAFLPFGYGPRNCAGLNFANLEAKLALSMILPRYAFMPSPSYRHAPIMRLTLGPQHGVPIIINPLQ

>CYP749? 20696.3 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.93

57% to CYP734A16 Picea sitchensis

52% to CYP72A180a tomato, EXXR to end

MIINETLRLYPSVTVLSRQLKKEVRLGKLTIPSGTEVVVPALALHYDSQQWGKDVHLFKPERFSQGITNAAKSPIAFLPFGFGPRMCVGLNFAILESKLAVSMILQRYSLLLSPSYHHAPVLMVTTRPQHGAPIIINPL

>CYP749? 20696.4 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.86

54% to CYP749A4 Populus trichocarpa, EXXR to end

MNMIINETQRLYPAATIISRQVRREVKFGKLSIPSGTEVVIPALAIQYDPQQWGTDVHLFKPERFSQGAMNASKSPMAFIPFGFGPRMCVGLNFATLQTKVALSMILQRFSLLLSPSYRHAPITRVTTQPQHGAPIILNPL

>CYP749 32507.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.87

45% to CYP749A.3 Jatropha curcas, N-term region

46% to CYP749A20 Solanum tuberosum

61% to 32507.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.95

MTRLMGKQGIRGPPYKFLYVNNEEVLQMAMESAMKAMDFTHDILPRVQPHVYAGTKIYGNTFLSWMGTKPQLFIRDPEFMREVLNNQNGDYQKPDILSISKRLFGDGLVTTNDEKKRVHLRKVANKAFNAESLKVNGVICFGIAS

>CYP749 32507.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.95

54% to CYP749A19 Solanum tuberosum

61% to 32507.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00047.87

MEKQGIRGPPYKFLHGNNKEVELMMREAIAKPMDLSHDTFSKVQPYIYTWTKIYGDTFLSWVGPKPQLFIREPELIKEILNNKSWDYRKPDRNPIIEKLLGDGLASTNIQKKWAFHRKMANKAFNAECLKVINPFVYH

 

$

>CYP? 32551.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00077.61

39% to CYP728G1 Vitis vinifera (aa 90-209 region)

32% to CYP728E1 Populus trichocarpa

33% to CYP728G2 Carica papaya

68% to 32551.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00077.63

MVLLGSSSIVMTGPASNKLLFTSDDKTVMASQLESARKIAGKYTIFELNVLKLKQMRLVYMGFLKPDRVRACIEDMDRIVKLQLAKEFFDKGNECSGKQFSAGVPPMKHMTFDVAFLLIFVLPEGLPDGKVKEE

>CYP? 32551.2 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00077.63

68% to 32551.1 gnl|Ambtr1.0.27|AmTr_v1.0_scaffold00077.61

37% to CYP728G1 Vitis vinifera (qq 82-265 region)

32% to CYP728D4 Populus trichocarpa

MTGPASNKLMFSSDDETVSTTQPESVRRIVGKHTIFELVGLKSKQMRLVYMGFLKADRVRACIKDMDRIVKLRLAKGFSDKGNEFSGKQFSDSNKEFSGDGKIYVVPAMKHITFDVAFKLIFGLPEGEVEEELFRDFTTVFKPILSVPVNFLATNFRRGLRARERIIKALVPMIREAKAKMGDELVRNKIDFITSLLRFKDEEGKGNN

 

 

P450s from genbank (ESTs)

 

>CYP71       Amborella trichopoda

            GenEMBL CD483091.2 CD481896 ESTs

            51% to 71A1, N-term

LNRANPTLSAQNMADQQTAAILYTFLLCLLSLHLFWVWKRSGTKKKVPPGPSGLPIIGNL

HQLGSMPHLTLARLAETYGPLIHLKMGQVPTLVVSSAKMAEEIMKTHDLTFCSRPALLSP

RHLHYECSGIVFAPYGPYWRNVRRICVQELLRAKRVELESFRIVREAEVGHMIDTITSSS

KAGKLVNLSEMFLSFSSNVICGVAHGKRYWEDGSELSE

 

>CYP71       Amborella trichopoda

            GenEMBL CV012267 EST

            N-term 50% to 71A25

SNKSGSQMKRSPGPSSLPIIGNLHQLGSLPDRSLAHLGKIY

GPFMHLRLGRVSTLVVSSPKMAELAMRTHDHALCSRPIRAATNQLTYNSTDVAFA

PYGPYWRHVRKICILELLSSKRVQSFRNVRKEEVGRLVDSIFVSSKGK

 

>CYP71     Amborella trichopoda

          GenEMBL CV012547

          48% to 71X11, C-term, 46% to 736A3

HELLPSLEWVKYLTGFQRRLEKNLRQRDSFLERVIAEHLLPTHKKEKKDLVDVLLELQKE

GTPDFTLSRDNIKSVVMDMFAAGTATTATVLEWGMSELIKNRSAMKKAQDEVRGIAKSNN

KSMIEEKELQQLHYLKVVVKEILRLHPPAPLLIPHESIEDCDIEGYFVPSKTTVLVNVWA

IGRHPDSWVDPEEFRPERFIGSNIDYKGQDFALIPFGAGRRGCPGISF

 

>CYP72     Amborella

          CD482646

          48% to 72A13 N-term

LLCFALLVLWVTLKIGYAVWWRPRALEKHLEKQGIRGPPYKILFGDVKDSNRLTQEAYSK

PIDLSHQIVPRVIPFFAQTVKNYGKICVTWFGMTPRVIVMEPEMVKEVLSNKFGHFEKAP

SNPLTKLLLLGLVAAEGEKWARHRRILNPAFHMEKLKGMVPEFILSCKEMITRWGKLVGE

EGSCEIDVFPELQELTGDVISRTAFGSSYEEGKRLFQLQREQQDLVIQAIRNIYIPG

 

>CYP72A    Amborella trichopoda

          GenEMBL CK756723

          62% to 72A20

KRISLRGIDFPAGVELALPVIMIHHDRELWGDDADEFQPTRFSDGVSKASKHPFAFFPFG

GGPRICIGQNFALIEAKMVLAMVLMKFSFHLSPLYTHAPCQQLTLQPQHGAPIILHKL*

 

>CYP73A60  Amborella trichopoda

          GenEMBL CV007005.1 DT578804 ESTs

          80% to 73A5

MDLLLAEKVLLGLFVAIVTAITVSQLRGKRLRLPPGPLTIPIFGNWLQVGDDLNHRNLSDLAK

KFGDVFLLRMGQRNLVVVSSPDLAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVLTVYG

EHWRKMRRIMTVPFFTNKVVQQYRYGWEDEIGRVVEDVRNNLAAQKEGVVLRKRLQLMMYNNMYRIMFDRR

FESEDDPLFVKLKALNGERSRLAQSFEYNYGDFIPILRPLLRGYLKLCKEVKERRLQLF

KDYFLEERKKLASTKGSSGDLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWS

IEWGIAELVNQPHIQAKLRAELDSVLGPGVPITEPDTYKLPYLQAVI

 

>CYP74       Amborella trichopoda

            FD438364  66% to 74A1 Arab

VKSCVYEALRIEPPVPTQYGRARKDLIIDSHISSFRVRAGEMLCGYQPFATRDPLIFDRP

EEFVAKRFMGEEGEKMLNYLLWSNGKETEDTTENNKQCAGKDFVVMVARLFLAELFLRYD

SFDVEISSAKLGSAVAITSLKRATF

 

>CYP75B?     Amborella trichopoda

            GenEMBL CD482391 EST N-term

MAAVAAVLLYFLLRPSHRNRCGLPLPPTPGWAWPVLGHLPLLGLIPHHSLAALAK

 

>CYP76       Amborella trichopoda

            GenEMBL CK761327.1 EST

            46% to 76H10 44% to 76C2, 47% to 76B7 (mid region)

VWRWRALRRICTTQLFTPQRLDSLQALRCQKVHEMVELIRQAEPAVDIGRAAFVTSMNII

SNMIFSADMVNPNSGSAQEFRDVVWAIMEVAGAPNLADYFPMLKALDPQGLKGRCK

KLFGRLHQFLNVKIDERLQSRERGGVDRGDFIDAILDSKQENGVDFSRSEILALLTDLYVA

GSDTSSSTVEWAMAELLRNPDKMAMANYGALKDP

 

>CYP76       Amborella trichopoda

            FD431383

            52% to 76C2, 49% to 76H4

ERESGQPRCGDFLDILLDPIDAKGSKFSRAEILSLIIELYFGGSESNSITVEWAMAELLH

NPAQMATVKQELSEKVGHQRAVEEADMDRLPYLQAVIKESLRLHPPGPLLLPRRADATVE

IAGFVIPKHTTVVINVWAISREARTWENPTTFSPERFIGSDVNYKGGDFSFIPFGAGRRI

CPGLLLAERIVQLMLASLLQSFDWELPLGWKPEEMDMSE

 

>CYP77A      Amborella trichopoda

            GenEMBL CD483271 CK757439 ESTs

            58% to 77A4 N-term

LYLFSILSALLFCYLFLSSRKTKALKLPPGPKGWPLVGNLLQIARSGKPFVFIVNELSQK

YGPIFTLKMGARTLIVISSAELAHEALIQKGQTFANRPAETPTRAIFSSHKKTVNSAEYG

PLWRSLRRNMVQGMLTPAKLRAFRPIRRKALDKLVERLAAESKSGLVRVLSNCRFT

VFRILLCMCFGVEMDEDMIEKVDSVLKKVLITLEPRIDDFLPILQAIFV

 

>CYP77B      Amborella trichopoda

            GenEMBL CV008470 EST

            62% to 77B1 N-term

MLMSMSMSISSLSSSFHLSDILFVVTCLAIASLWWQRWSRTGGGRTGLPPGPPGWPIIG

NLGQVVLQNRPFIFVVRDLRAKYGPIFTMQMGQRTLIIITDAXLIHEALIQKGPLFASRP

VDSPTRLVFSVGKCTVNSAEYGPLWRTLRRNLVTEVISPSRVRDFSWIRTWAMKNHLERL

KLQAQEKGFIEVLSSCRVTISSILVCICFGAKVAEEEILK

 

>CYP86      Amborella trichopoda

           DT593464.1 64% to CYP86A23 Medicago truncatula N-term

YLIWFARIRRSLTGPRVWPLLGSLPGLFQNKHRMHDWIAENLTMCKGTYQTCIAAVPY

LARMQGLVTVTCDPRNLEHILKTRFENYPKGPTWQAVFHDL*GDGIFNSDGDTWRFQRKTAALEFTTRTL

 

>CYP90B5      Amborella trichopoda (basal angiosperm)

             GenEMBL EST CD483534 cDNA clone

             66% TO 90B2 67% TO 90B1

21  PPGRMGWPFVGETLAYLKPHPSTSMGEFMEQHISRYGKIFVSNLFGEPTIVSADLGLNKF 200

201 ILQNEGKLFESSYPKSIEGILGKWSMLVLVGDMHRNMRILSLNFMSNTKLRVHLLHEIEK 380

381 HTLLVLGAWREKQVFSAKEEAKKFTFNLMAENIVSMKPGKPETESLKREYITFMKGVISA 560

561 PINLPGTSYRRALQSRKTILGVLEMKMEEKKMRTNGREPEIEEEEDFLGWVLKQSDLS 734

 

>CYP90B      Amborella trichopoda

            GenEMBL CD483534  EST

            66% to 90B1 N-term

RESSEGPPGRMGWPFVGETLAYLKPHPSTSMGEFMEQHISRYGKIFVSNLFGEPTIVSAD

LGLNKFILQNEGKLFESSYPKSIEGILGKWSMLVLVGDMHRNMRILSLNFMSNTKLRVHL

LHEIEKHTLLVLGAWREKQVFSAKEEAKKFTFNLMAENIVSMKPGKPETESLKREYITFM

KGVISAPINLPGTSYRRALQSRKTILGVLEMKMEEKKMRTNGREPEIEE

 

EEDFLGWVLKQSDLS

 

>CYP90B     Amborella trichopoda

           GenEMBL CV011348

           61% to 90B2 C-term

LDGCP*SIEQLQEEHMGIAREKREKGESSGLNWEDYKRMEFTHSVINETLRLGNVVQFVH

RKALCNVQFKGYDIPRGWKVLPVFAAVHLDPLNHHKPHLFNPWRW

SSNFMPFGGGPRLCAGADLAKLEMAIFIHHLVLNFTWEVTEP

 

>CYP94      Amborella trichopoda

           CV009821

           50% t0 94D10

FSPISPCVTNLSLSIFLSQELPIVCCSVLEEMDEEHGFLLFKVALSIFFCFLSWRFYITT

QEKIHKKNGTSVFNGPKSYPILGSALAVMANSHRFSQWVTDLIKLSPTQTIVLKSLGGNL

VVTANPDNVEYILKTNFPNYPKGHFTTNLMEDFLGQGIFNSDGDLWKIQRKVASHEFNTR

SLRKFIHQVVRQELCTRLIPLLDKAAIEGKVLDLQDVLQ

 

>CYP97A      Amborella trichopoda

            GenEMBL CK752343 EST

            75% to 97A3

FLLASGDDVSSKQLRDDLMTCLY

AGHETSAAVLTWTX

YLLSKEPSVXXXXXXXXXXXXXXXX

PTIDDMKRLKYTTRVINESLRLYPQPPVLIRRSLE

NDVLGKYPIKRGEDIFISTWNLHRSPEHWVEPEKFNPERWPIDGHNPNEINQNYSYLPCGG

 

>CYP98A      Amborella trichopoda (basal angiosperm)

            FD431762.1 65% to 98A4, 71% to 98A3

DFLSPLSSLSLPTISLLTLTILFLLLKLISSLRYKLPPGPRPWPVVGNLYDIKPVMFRCF

AEWAQHYGPIMSVWFGGTLDVVVSSPHLAREVLIENDQQLADRPRSRSSAKFSRDGKDLI

WADYGPHYVKVMKVCTLELFTAKRLEALRSIREDEVTAMVESIYKDCVSPGKTGESLVVK

NYLRSVAFNNITRLAFGKRFVN

 

>CYP701A     Amborella trichopoda

            GenEMBL CK764502 CD483667 ESTs

            53% to 701A3 N-term

MVGFSLDNPLTVLATFAFALFSWFLFTRLFFSLSRKSSNAPPAVPGLPV

LGNLLQLKSKKPHMTFTKWAEAYGPVYSIKTGATTLVVLNSTDVAKEALVDRFSSISTRK

LSKALQILTCDKAMVAMSDYGEEHKLMKRCILTSLLGSNAQKQHRFDRNTMIENMMQSLH

DEVKDNPTGSICIRDIIKKELFTFSLKKALGRDVGSVYVEELGRTV

SKWEIYDILVIEPMMGALEVDWRDFFPYLRWIPN

 

>CYP703A     Amborella trichopoda

            GenEMBL CV012183.1 EST

            67% to 703A2

STRGVSSVYRDAMH

GKTINLREVLGAFSMNNVTRMILGKQYFGAGSAGPDEAAQFMDTTHELFWLMGVIYLGD

YLPFWRWLDPYRCEEKMRDVEKRMDAFHVRILEEHRRRTKVVKEGSKDETMDFVDILLSLPG

QDGKEHMEDIEIKALVQDMIAAATDTSLVTNEWAMAEVIRNPRILKKLQDELDTVVGKDRMVVESDLNHLQ

FLRCIVRETFRMH

 

>CYP704B25   Amborella trichopoda

            GenEMBL CV010776 EST

            78% to 704B1 N-term

MENLNHISSTSTGFSLGLALVCVFLSWILVHRWGQRNSKGPKTWP

VVGSAIEQLMNYDRMHDWLVEYLSKERTVVVRMPFASYTYIADPVNVEYVLKTNFPNYPK

GEVYHSYMEVLLGDGIFNADGETWKQQRKTASFEFASKNLRDFSTVVFRDYALKLSNILS

QASYCGHEVDIQELLMRMTLDSICKVGLGVEIGTSPLI

 

>CYP707     Amborella trichopoda

           FD432258.1

FFPDPHRFDPSRFQVPPKLNTFLPFGTGAHACPGNELAKLEMLILLHHLVTNFGFDFFIY

INE*

 

>CYP716    Amborella trichopoda

          GenEMBL CD482936

          41% to 716A2 mid region

VRKMVVVPFLRPDTLHRLVARFDLLCKVRIERDWKGRGVVHAFPLIKKYAFSVACGLFTS

IGSEEDQARLLEELSTVAKGAFQLPIYFPGTRYYRAARSGDLLRAELLKVVQSRRSNYIA

GAEEEDDLMSHLMKVKDEEGNSLTDKQIADNVILLLSAGHDTSSSTMAMLLFHLAHNPHC

YDRVLQEQREIAKSKAQGEFLNREDIQKMKYSWNVVNEVLRLSPPIQGTLRKPS

 

>CYP716    Amborella trichopoda

          GenEMBL CK758129

          62% to 716A2

VWLNWEDLKKMKYTWNVVCEVMRVSPAVAGAFRLAITDFDYAGFRIPKGWRLHWNVHTTH

MMEEYFPEPEKFDPSRFEGEGPPPYTFVPFGGGPRMCPGLEFARVEMLVFLHNLVKNYKW

ELVFPNEKIHMDPMPVAANGLPVHLXPHQKHS*

 

>CYP721    Amborella trichopoda

          GenEMBL CK743846

          57% to 721B1

QTKARDEVLNVCGESPVGESLNNLKIVGMILNETLRLYPPAALVLRQTAEDLKLGQFHLP

KSTQLYLPIAALHHDPELWGDDTDTFNPDRFSEGPSAARKHPAAFIPFGFGPRTCIGQSL

AIVEAKVVLAMLLGRFAFEVSPSYVHAPMLLLTVQPRYGAQVVLRRLRG*

 

>CYP721?   Amborella trichopoda

          GenEMBL CD482363

          51% to 721B1, 48% to 735A2

VGMILNESLRLYPPAVAIVRKAVKDCKLGSICIPKDTQIFVPLLPMNHSETIWGDDAEKF

DPNRFSEGSEKALGSFFPFGKGPRACVGQKLALLESKILMAMILQNFSFHLSQNYILRGR

VNAEGTLLLRAHDLNCHSSR*

 

>CYP721     Amborella trichopoda

           FD430198.1 57% to 721B1 rice

GHETTSMLLTWTMVVLSTHPTWQQRAREEVMQIMGCTTDPPTLDQVAHLKIVTMILYEVF

RLYPPVVFFIRQTYKRVTLGGLDFPAGVRLFFPILMIHHDREIWGDDADEFRPERFLEGV

SKAGKHPLAFFPFGWGPRICIGQNFALIEGKMALAMILQHFSFHLSPSYTHAPYAQLTIH

PQFGAPIILEKL*

 

>CYP728    Amborella trichopoda

          GenEMBL CD483260

          65% to 728C5

EQSEIANGKGHDEPLNWEDLTKMKYTWRVAQETLRLYPPIFGSYR

RILKDFEYAGYHIPKGWQ

 

>CYP729A12   Amborella trichopoda (basal angiosperm)

            CV010895

            44% to 729A2 rice N-term

HRVPPGSMGWPVIGELLDFLWCFKFTRRPDDFIAKRKSRHGDSGIFRTHLFGQPSIVTCS

PEMNKFVLGRGTEDGSFGPGWPSSQLLGASSITMKDGLSHKRLKRYFMDAFNSPRALSSL

LTNAQPTFVEFMENWVSKGRISAFEETRAVTFANICDILASFKEKTLLCTMERFYTGLMA

GLRAMPLNFPGTSFQNALKCRKKL