472 Aquilegia coerulea Cytochrome P450s

downloaded from Phytozome by Biomart

August 17, 2012

 

Sequences were made into trees with a reduced set of sacred lotus P450s plus some additional families missing in lotus (133 sequences)

The sequences were added in 100 at a time for tree making, then

each sequence was placed in family and subfamily from the 5 trees.

This is a preliminary sorting and needs more detailed work to assign names.

 

CYP71 family 101 sequences

 

>22061829 Aquilegia coerulea|Aquca_008_00016|Aquca_008_00016.1

CYP51G1 85% to CYP51G1 sterol 14-demethylase [Arabidopsis thaliana]

MDMENTTQMTDLKENKFLNVGLLILATLVIAKLLSALLIPQSKKRLPPTVTAWPVLGGLL RFMKGPIVMIREEYPKLGSVFTLNLVNKNITFFIGPEVSAHFFKAPESDLSQQEVYQFNV PTFGPGVVFDVDYSVRQEQFRFFTESLRVTKLKGYVDQMVTEAEDYFAKWGDSGEVDLKY ELEHLIILTASRCLLGREVRDKLFDDVSALFHDLDNGMLPISVIFPYLPIPAHRRRDRAR KKLSEIFANIISSRRETGKTENDMLQCFIDSKYKDGRPTTDVEVTGLLIAALFAGQHTSS ITSTWTGAYLLRHKEYLSAVLDEQKSLMKMHGSTIDHDILSEMDVLYRCIKEALRLHPPL IMLLRSSHSEFSVTTREGKEYDIPKGHIVATSPAFANRLPHIFKDPDTYDPDRFAAGREE DKAAGAFSYISFGGGRHGCLGEPFAYLQIKAIWSHLLRNFELELISPFPEIDWNAMVVGV KGKVMVRFKRRQLSID*

 

>22037554 Aquilegia coerulea|Aquca_012_00266|Aquca_012_00266.1

CYP51G 71% to CYP51G1 sterol 14-demethylase [Arabidopsis thaliana]

METDMRWMDWRQNNLINIGVLIFATLVVAKVLSVLLFPRSKNRLPPTVKTLPLVGGLVKF

MKGPTDMLRTEYLKLGSVFTINLLHKKITFLIGPEVSAHFCSAPESDLSQQEVYQFNVAI FGPGVVFDVDYPTRLQQFRFFADALNVNKMKAYVDMMIMETEEHFSKWGDEGEIDLKKEM EQLITKIVSRCLLGKEVHEKLFDDVSALFHDLDDGMLPISVLFPYLPIPAHRCRDRARKK LHKIFGKIISSRKATDKKENDMLQSLIDAKYKDGRPTTESEISGMLIAALFGGQNTSSIT TIWSGAYLLRHRQYLSVALDEQKRLMKKHRDMIDRDILSEMDVLYRCIKEALRLHPPLVM LLRSSHSDFSVTTLEGKEYDIPKGHIVATSPAVANRLPQIYKNPDSYDPDRFAAGREEDK AAGSFSYLSFGGGKHKCLGEAFAYLQIKVIWTHLLRNFDMELISQFPENDENDIVVGVKG KVMVRYKRRKLSVDYL*

 

>22060653 Aquilegia coerulea|Aquca_056_00026|Aquca_056_00026.1

CYP71AP

MAVLQSSMETLHSILPSFLLASSFLLVVVYFFLKKTSSKRLNLPPCPSKLPIIGNLHQLG NSPHLSLSCIAEKFGPIFYLQLGHIPTVIISSARLAKEVLLTHDLALASRPQLYSAKHLF YNCTDMVYSPYGAYWRHIRKICILELLSPRRVQSYGFIREEEVKRMVNRIAQGYPSTTDL TKILGLYANDVLCRAAFGRDFSGGGEYDLHGFQKMLEEYQILLGGFNLGEYFPSMEWINT LTGMKSRLINTFRRFDSFFNDIIEEHQNPNRISQEHKDLVDVLLDLQKGGSLDMALTMDN IKAVILDMFAAGTDTTFIILDWAMTELVMNPKAMEKAQHEIRNVMGERTIVLESDLPGLH YLKAVIKEIFRLHPPAPVLVPRESMEDVVIDGYDIPAKTRIFINAWAIGREQQSWNNPEK FEPERFIGSSIDFRGQDFELIPFGAGRRSCPAITFGVATVELALAQLLHSFDWELPTGVE AKDLDMTEVFGITMHRVQHLIVVAKPHFTKILQC*

 

>22040067 Aquilegia coerulea|Aquca_123_00019|Aquca_123_00019.1

CYP71BG 69% TO CYP71BG1 Solanum tuberosum

MEDFHFLSIFVPLCLTVLFIFLVLHRKQSKSLRPPSPPKLPILGHLHLLTDMPHHSLSEL AHKHGPILFLQLGQVPTLIVSSARLAREILKTHDHVFCSRPQLISAQYLSFGCSDITFSS YGPYWRQARKICVTELLSPRRVNSFQLIRDEEVNRLLCSVSAMSGGETDMSNRFFVLAND VLCRVAFGKRFIGDSNRLPEILTETQALFAGFSIGDFYPRLEWVNSISGLKRRLTKNLND LRTVCDEIISEHIEKRNVTTDISSSGGQEDFVDVLLRVQKSGDLEVPITDDNLKALVLDM FVAGTDTTSATLEWIMTELARHPRVMKKAQDEVRKVAGTKGKVDESDLPQLKYMKAVIKE TLRVHPPVPLLVPRESIEECTIDGYIIPAKTRVLINTYEIGRDPQSWDNPLEYNPDRFID SNIDVKGQDFELLPFGGGRRGCPGYSFGLATIETALARLLYHFDWSLPYGTRADDVDLSE TFGLATRKKVPLVLIPTTNMNLEFRRSDT*

 

>22023432 Aquilegia coerulea|Aquca_005_00014|Aquca_005_00014.1

CYP71 CLUSTER Q

MYVKLGEVPTVVISSPGVAEQIMKTHDLKFVGRPDNLVIKVVTYGYKDVVGAPYGDSWRQ LRKICVLELLSAKKVQSFWSLREDEVSKLVGRISSVAGSQINLSKMIFTLMNDITARAAF GKTCKDKEAFMSVAEYIIRMVAGFSIADLFPSMKFLATICGINSKVEMVHQKVDKILDDI IKEHKENRMNNFEGEVEEDLVDVLLRIQEAQEVHKHPITMENVKAVIFDMFVAGTDTSST LMDWTITELLRNPSVMERVQAEVRQIFNGKKKIDQTDIDKLNYLRLAMKESLRLHPPAPL LGPRECRESCEIEGYEIPKGSKVLVNAWAMGRDPKNWKDPERFEPERFQDMSIDYKGHNF KYIPFGAGRRICPGIAFGTANVELPLALLLYHFDWKFANGVKPEELDMTEVFSGVTRRKQ NLLLIPTIYNPS*

 

>22037332 Aquilegia coerulea|Aquca_012_00109|Aquca_012_00109.1

CYP71 CLUSTER Q

MDLQQLTIFSFTLTFIIFLLMLVKISKKSTHSSSPLPPGPFKLPIIGHLHHLLGGLPHHK LKDLAKIHGPIMYLKLGEISAVVISSPGVAKQVMKTHDLMFVDRPFNFASNIVTYGSKGV IMSPYGEYWRQVKKICVLELLSAKKVQSFWSVREEEVFGKISMMAGSQMNLSETIFTLTN DIVARAAFGKIFKDKEAFLSETKQFLILAPGFSIVDLFPSLKFLETINGIMSKIEMIHKK IDKMLEDIIKEHKENIKGGVEGDLVDVLLRIQKGGDLEFPITMDNVKAIIFDMFIGGTDT SSTLLEWTFTELLRNPRVMEKAQAEVRQIFNGKKKIDQADIDKLNYLRLVIKESLRLHPP APFLVPRECRETCEIEGYEIPKGSKVLVNVWGMGRDPEYWKDPESFEPERFQDQSIDYTG TNFKYIPFGAGRRMCPGMLFGIANFELPLALLIYHFDWKLGNGVKPEDVDMMEAFGGVAK RNQNLHVIPTRYSPS*

 

>22023433 Aquilegia coerulea|Aquca_005_00275|Aquca_005_00275.1

CYP71 CLUSTER Q

MELQCPFPTKSFVSIKGKPSTPKIRTASLPPGPLKLPLIGHLHHLLGMPHHSFRDLAKEH GPLMYLELGEVPTVVVTSPKVAKEMMKTNELMFVDRPLNLATKIMSYDCMDVIMAPYGDY WKQVRKICMMELLGHKRVQSFWSVREEEVTSLVGRISNMVGSPVNLSQSIISVTNDITAR ATFGKTFKDKDAFLVLMKEVIRLAAGFDIADLFPSIKFLGALSGTRPKLESTHLKVDKML DVVINEHRNNKNRIKNESGELEEDLVDVLLRVQASNELDMPITMNNVKGVILDMFTGGSD TSSTAIEWAFSELLKNPEAMAKAQAEVREVFNGKKRIDQEDMNKLTYLKLVVKETLRMHP SAPLLIPRECRDTCEIDGYEIPEKARIIINAWAIGRDPENWSDPDSFKPERFEDISSDYR GNDYRFTPFGSGRRICPGILFAIANVELPLALLLYHFDWKLANGVKSEELDMTEAFAATV RRKNDLYVIPSPYII*

 

>22037343 Aquilegia coerulea|Aquca_012_00275|Aquca_012_00275.1

CYP71 CLUSTER Q

MQITFFPLVSTFLIFLFMVVKVCRRSKTSKLPPGPWKLPIIGHLHHFVGLPHQSLRNLAL KYGPLMYLQLGEVPMIIVSSPSMAKEVMKTHDTVFADRPKLVAAKIGSYNYTDIVFAPFG KYWRELRKICFQELFSPKKVQAMWSIRNEEVSNLIEKISSMAGSTVNITEMISLLTNDIT SRAAFGKKCKDKEVFLSLMEESMRLAGGFDFADLYPSLKFLHGISNTQSQLEKVHHKLDM ILEDIINEHRQNRLKSETEKALEHEEDVVDVFLRLQEENNLTLPMENDNIKAVIQDIFVA GSDTSSATVVWALSELMKQPKMMEKAQTEVRSVFNGKDNVSQSDINDLKYLRLVIKETLR LHPATGLVPPRVSREDCEIDGYAIPKGTKVIVNAWAIGRDPESWTNAETFEPERFEDVCI DYKGFHFEYIPFGAGRRICPGMTFGVANIELPLAKLLYHFDWNLPNGEELDMTESFGGVV GRKVNLKLVPTIYSP*

 

>22037451 Aquilegia coerulea|Aquca_012_00180|Aquca_012_00180.1

CYP71 CLUSTER Q

MELQFTLIFTSILFLFMLLQLTRSKLQNRNSKLPPQPWKLPIIGHLHHLLGHLPHRTLSY LAIKHGPLIFLRLGEIPMVVASSPRVAKEILKTNDIVFSDRGALLAGKILTYDNAGILFS PYNERWRQLRKICTLELLSAKKVQSFFAIREEEVANLVENIFAMSGSPVDLTQKISLLGN DITSRAAFGKKCKEKEMFLSLMREVGRYGSGFAIADLFPSFKLFHGISGVKAKLEKIQYK INKILDDILNEHRLNRMKNNSTNNCKMEEDLVDVLLRVQEDNLEFHIDDNSIKAVILEIF IAGSESPSATVEWAMSELMKNPRVMEKTQSEVRKVFQGKQKVCQSDINELNYLRCVIKET LRLHPPTPLLVPRESRERCEINGYEIAKGTKVIVNAWAIGRDPEYWSEAEIFKPERFEDL SVNYMGTNFEYIPFGAGKRICPGITYGIANLEIQLAQLLYHFDWKLTKGKELDMTERSAG TVGRNSNLRLIPTPYIVLN*

 

>22037267 Aquilegia coerulea|Aquca_012_00083|Aquca_012_00083.1

CYP71 CLUSTER E

MQLEPIFISVFSIFCNRPRVTFAERLVYSKDLAFSSYGEYWKELRKISALHLLSGHRVES FRTIREEEANFMVDKIRECCSSASSAVNLSEIIFSFTNNVVCRVAMGRKFGEDEGAKKFS ELIMEFMNLIGVFNVADYIPWFSVVNNFNGLNARVAKNSKEMDCFLENVLLGMANDSTNR VSLVRDNIKAVILDLFTAGTDTSAATLVWAMTELIKHPEIMKEVQTEIREITKGKFCITE DDLGQMHYLKMVIKEALRLHSPAPSLIPHESIQDTNLLGYDIPAQTRVFINQWAIANDPM LWDEPEEFRPKRFLNTSIDYQGKDFKFIPFGAGRRGCPGILFATPNMELPLANLLYHFNW SLPNGVTSKDVDFAEELGIILRKKSPLLLVPTPCGF*

 

>22037324 Aquilegia coerulea|Aquca_012_00263|Aquca_012_00263.1

CYP71 CLUSTER E

MFEWVEQQPLLLSLFFILFVTIYVLKLTTSQKNRKLKLPPSPSKLPIIGNLHQLGLLPHR SLQFLAKEYGPLMLLRLGQTPTLIVSSVDAAREILKTQEVKFLDRPKRKFAEKLSYSYKD LAFAPYGDYWKQVRKISASHLFSSQRVASFRTLREEEANLMVDKIRHLSSTSSSIGVNLS ELVFSFTNNVVCRVTMGRKFGADEGGMKFQKIIAEFLYFVSVFNVEDFIPWLSWVNILNG LNARAVKNYNEMDEFLEKVIQEHIQSRKKDKKGVEDFVDVLLELEQNGSMGGVPFDNDNI KAIILDMFSAGTDTSLLTVVWAMTELIQQADIMKEVQMEIREIAKGKGFITEDDLEKMHYMKMVIKETLRLHIPAPMLVPREAMQDAKIQGYDIPANTNVIINAWAIARDPLYWEDPEKF IPKRFLNSSVDYKGQDFQFIPFGAGRRACPGINFAIPDMELPLANLLYHFDWTLPNGTTI KELDVTEEFRATAYKKHPLILVAKPHNFE*

 

>22037447 Aquilegia coerulea|Aquca_012_00264|Aquca_012_00264.1

CYP71 CLUSTER E

MFEWVEQQPLLLSLFFILFVTIYVLKLTTSQKYRKLKLPPSPSKLPIIGNLHQLGLLPHR SLQSLAKQYGPLMLLRLGQTPTLIVSSVDAAREIFKTQEVKFLDRPKRKFTEKLSYSYKD LAFAPYGHYWKQVRKISASHLFSSQRVASFRTHREEEANLMVDKIRHLSSTSSSIGVNLS ELVFSFTNNVVCRVTMGRKFGADEGGMKFKKMIAGFMYFVSVFNVEDFIPWLFWVNIVNG LNARAVKTYNEMDEFLEKVIQEHIQSRKKDKKGVEDFVDVLLELEQNGSMGGVPFDNGNI KAIILDMFAAGTETSLTTVVWAMTELIQQADIMKEVQMEIRDVAKGKGFITEDDLEKMHY

MKMVIKETLRLHIPGPFLVPRESIQDAKIHGYDIPANTTVIVNAWAIARDPLYWEYPEKF IPKRFLNSSVDYKGQDFQFIPFGAGRRACPAINFAIPDMELPLANLLYHFDWTLPNGTTI KELDVTEEFSATAYKKHPLILVATPHNFE*

 

>22037571 Aquilegia coerulea|Aquca_012_00067|Aquca_012_00067.1

CYP71 CLUSTER E

MFQWLLEQYGMQLDPIFISAFSIFLVTLLYTLIRPRTNKLNLPPSPSKLPIIGNLHQLGT LPHRSLQSLARKHGPLMLLHLGQTPALIVSSDDAAKEVIQIQDFNFCNRPRMSFAERLLY SSKDLAFSPYGEYWKQMRKISTQHLLSGHRVESFRTVREEEANIMIDKIHEYCSSASSVV NLSELIYSFTNNVVCRVAMGRKFDAGEGAKKFSELITEFMNLIGVFNVADYIPWLSIINN FNGLNARVRKSSKEMDCFLESVIQDHIDPKKKTNSGVEDFIDVLLGMQNDSTNRVSFARD NIKAVILDMFAAGTDTSAVTLVWAMTELIKHPEIMKEVQAEIREISKGKLHITEDDLGQM HYLKMVIKEALRLHSPASIFVPHESIQDTKLLGYDIPAKTRIFINQWAIANDPMLWDEPE EFRPKRFLNTSIDYQGKDFKFFPFGAGRRGLFATPNMELPLANLLYHFNWSLPNGLKSKD VDVAEEFGIILHKKSPLLLVPTPCGF*

 

>22037459 Aquilegia coerulea|Aquca_012_00085|Aquca_012_00085.1

CYP71 CLUSTER E

50% TO CYP71AN1 cottonwood

MFQWLLEQYGMQLDPIFISAFSIFLVTLLYTLIRSRTNKLNLPPSPSKLPIIGNLHQLGT LPHRSLRSLSRKHGPLMLLYLGQTPALIVSSADTAKEVIKTQDFNFCNRPRMSFAERLFY SNKLKTLTFPAFSVQHPASSIQHFKQTHPKTIEINKDC*

 

>22043599 Aquilegia coerulea|Aquca_001_00151|Aquca_001_00151.1

CYP71 CLUSTER E

MFQLWSEVQSLHPISLSFLSILFVLFLFKLTRSRTGKLNLPPSPWKLPVIGNLHQLGTLP HRSLQSLARKHGPLMLLHFGQSPTLIVSSVEGAKEILKTQDLNFSDRPRMNFQDRLVYAN YHLAFSPYGEYWRQVRKVCVLQLLSQHRVNSFKSVRQEETDCMLNDIRKSISSGSPIVNL SDLIFSFTNDVTCRVTLGRKFGRDEGGKKFFKIIKEFMYFIGAFNIGDFIPSLAWINNFN GLNARMDKNFEELESFLGGVIEEHIQDRKTRKFGSEGVEDFVDVLLGMEKDGSIGVPFAK DNIKALIMDMFLAATDTAAATMTWAMTELLRHPEILKEVQREVREVAKGKTHITEDDAAQ

MHYMKNVIKETLRVHTPGPLLIPHQSREDAKLQGYDVPAKTRVIVNAWAIARDPAIWEEP DEFRPKRFENSSLDFKGNDFEYLPFGAGRRICPGIAFASPTMELPMANLLYHFDWTSPNG EVPDVEEGLGIVAYKKSPLRAIATPYRV*

 

>22043682 Aquilegia coerulea|Aquca_001_00226|Aquca_001_00226.1

CYP71 CLUSTER E

MVQVWSELQSLHPISLSLLSILFVLFLIKLTRSRSGKLNLPPSPWKLPVIGNLHQLGILP HRSLQSLARKHGPLMLLHFGQSPTLIVSSVEGAKEILKTQDLNFSDRPRMNFQDRLVYAN YHLAFSPYGEYWRQVRKVCVLQLLSQHRVNSFKSVRQEETDCMLNDIRKSISSGSPIVNL SDLIFSFTNDVTCRVTLGRKFGRDEGGKKFFKIIKEFMYFIGAFNIGDFIPSLAWINNFN GLNKRMDKNFEELESFLGGVIDEHIQDRKTRKFGSEGVEDFVDVLLGMEKDGSIGVPFAK DNIKALIMDMFLAATDTAAATMTWAMTELVRHPEILKEVQREVREVAKGKTTITEDDAAQ

MNYMKNVIKETLRVHTPGPLLIPHQSREDTKLQGYDVPAKTRVIVNAWAISRDPSIWENP DEFIPKRFENSSIDFKGNDYEYLPFGSGRRICPGIAFANPTMELPLANLLYHFDWTLPNG ELPDVEEGLGIVAYKKSPLQVIATPYQI*

 

>22037357 Aquilegia coerulea|Aquca_012_00269|Aquca_012_00269.1

CYP71 CLUSTER W

MALLTLPMGWLINGSKSEKLNLPPSPPTLPIIGNLHQLGLLLHKSFHELSQKYGPFMLLH LGYVPTLVVSSSEMIREIKLNHEIAFGDRPVTTATKMLLHGCVDLAFTPYGEYWKQVRKI SMMEFFSHKKVQSYKWVREEEIALTIEKISSASSVGATVDIRELMINLTNDIYCRCALGR KHGGPNGNLNFGVLAGKVMKMLVAFCFADLYPWLGWMDHLTGFIRRINKLSKELGDFFDQ IMDEHLRQNKHNDPNYEKDYVDILLQVQMKNSIVNFTRDNIKALILDNFVAGTETTSTTI EWALAELLDNPGMMQKAQEEVRRVVGKKNKVDEEDIQRMDYLKAVVKESLRLHPSVALLP

MQTSVATNLKGYHVPAKTKALVNIWSIHRDPEFWEKPEEFNPDRFIDSPLDFIGRDFKYI PFGSGKRTCPAVVFGITGVEVVLANLLYWFDWEMPKGEELDMGEGFGITVNKKIPLHLLP

RSHFP*

 

>22037397 Aquilegia coerulea|Aquca_012_00181|Aquca_012_00181.1

CYP71 CLUSTER W

MALSRLQLPKWLDQQTSLQVDHPFTLSCILIFFTLFMVWLANRYRTKKLTNNLPPSPPKL PIIGNLHQLGSLFHYHIHILSEKYGPIMLLHLGSVPTLVVSSPDMAREIKATHEIVFANR PRTTAMNMLLYGCTNIVFSPYGEYWARLRKISAMELLSNRMVQSFRYIREEETALMIQKI TCLSSAQSSVNLTQLLKTLTNDTICRCALGRKHGEEDGKMNRADLAVELVKMMSTLCVGD LFPRFGWIDKITGWTGRIKKLSKDVDMYLDQIIDEHIIQNNKDDPQYNQDFVDVLLQIQK NDINFTRQNIKALILDMFIGGTDSTYKTIEWTMAELLQNPNVMRKAQEEVRKVVGTNKKV EEDDIQKMKYLKLVVKESMRLHPVSGINIAESSKATNVKGFQVPAKTPIFLNYWSIQRNS KSWERPEEFIPERFTNNAVDSGGQDFNFAPFGLGRRICPGKSFALSVVEFTLANLLYWFG WKTVGGEKLDMSEAFTSTICLKMPVHLVAVPYFS*

 

>22037423 Aquilegia coerulea|Aquca_012_00182|Aquca_012_00182.1

CYP71 CLUSTER W

MALSMLQLPKWLDQQTLLVDHSFALCCIFIFFTLFIVWLANQYSTRKLIKNLPPSPPKLP IIGNLHQLGSLLHHHIHILSEKYGPFMLLHLGSVPTLVISSGDMAREIKVTHEIAFANRP RTIAMNMLLYGCTDIVFSPYGEHWARLRKISAMELLSNRMVQSFRYIREEETALLIQKIT SSSSAKSPVNLTELLKTLSNDIICRCALGRKHGGEDGKTNRADLAGECVKMMSTLCVGDL FPRFGWIDKMTGMTGKIQKLSKDVDTYFDQIIDEHIIQKNNDDPHYNKDFIDVLLQIQKG DINFTRENIKALILDMFIGGTDTTYTTIEWTIAELVQNPNVMRKAQEEVRKVVGTKMKVE EDDIQKMEYLKLVVKESTRLHPAAGFNVVESAKATNVNGFQVPAKTPVFINYWSIQRNSK SWERPEEFIPERFSNNAVDSVGQDFNFAPFGVGRRICPGKSFALSVVESTIANLIYWFDW KTVGGEKLDMSEAFESTICLKMPVHLVAVPHFC*

 

>22037262 Aquilegia coerulea|Aquca_012_00178|Aquca_012_00178.1

CYP71 CLUSTER W

MLADHSFTLSCIFIFFTFFVVWLTNRYRAEKLNLPPSPPRLPIIGNLHQLGFLLHRHVHI LSEKYGPLMLLHLGSTPTLVVSSADMVREIKVTHDIDFANRPHTTAMKMLLYGCTNIAFS PYGEYWARLRKIAAMELLNNKKVQSFRNVREEEIALIIQKITSSSSVGSPVNLTELVTTL ANNILCRCALGRKDGGQDGKKNNADLAVELLELMTTFCFGDLFPRFGWIDNITGLTGRIK KLSKNLDIYFEQTIDEHLSHNNYDNPHYNKDFVDVLLQVHKNDANFTRDTIKALILDMFI GGIETVSTTLEWTMAELLQNPNVMRKAQEEVRRVVGKNKEVKEEDIQKMEYLKLVVQESM RLHPAAGINLVESSMATTVKGFQVPAKTTVLINHWSIHRNSKSWERPNEFVPERFSNNAV DYTLGQDFNFTPFGSGRRICPGKLFALIAVESTIANLLYWFDWKMMGGEKLDMSEAFMTT IKLKMPVHVVAVPHFS*

 

>22037506 Aquilegia coerulea|Aquca_012_00218|Aquca_012_00218.1

CYP71 CLUSTER W

MALPTLPLKWLALAKHQENLFYQYPFVFTLIFISFTFILLKLITGSFSEKLNLPPSPPRL PILGNIHQLGLLLHRSLHNLSQKYGPLMYLRLGYSDVLVVSSAEMAREIKINHEIPFGNR PSTTSTRMLFYGPKDMAFSPYGDYWRQVRKISVLEIFSNKKVDSFKSVREEEVALLINKI SNLASMKTPVNITESVINVVNDIMWAMAELVNNPHVMQKAREEVRRVVGKKNKVEEEDIQ QMEFLKGVVKESLRLHPPAALLPMETSTITNVNGYHIPAKTKVHINIWSIHMDPNLWERP EEFIPERFINSPINFSGQDFKYIPFGSGRRICPGILFGTTAVELVIANLLYWFDWETPGG EKLDMAESFGLSVIKKLPYQLLPIPISHLG*

 

>22058134 Aquilegia coerulea|Aquca_093_00003|Aquca_093_00003.1

CYP71 CLUSTER W

MDSTTTNSKPQQHKPKLPPSPPKLPIIGNLHQLGTHPHRSLRDLSRRYGPTMLLHMGSVP TIVVSSADMAREIKKTHDVTFANKPFMTAAELLFYGRADMAFSPYGHYWRQVRKICVLEL LSIKRVQSFKFIREEEVALMIESISRSCLLQLPINLSEILLTLNNNIVSRCAIGRKCEGG GNEHGTDKNFGELSRELMRLLGAFCFRDFFPWLGWVDVVSGLVRRMKKVSRELDSFLDPI IDEHLSRRRQQNDDHKEDFVDLLLRVQTDNILDIKLTRENIKALILNMFIGGTESVSTTI EWVIAELVKNPKVMEKVQEKVRRVVANKSKVDEEDIPHMDYLKSVVKEALRLHAPGPLIP AESSTSTNLNGYHLPAKTRVLINVSAIQTDVKSWENPDDFIPERFLNNPIDFKGQDFEFI PFGAGRRGCPGMSFGIVIVEYVVANLLYWFDWKLPQGEIELDMSEASGMTASKRTPLNLI

PKLHFSRF*

 

>22058170 Aquilegia coerulea|Aquca_079_00012|Aquca_079_00012.1

CYP71 CLUSTER W

MALPEAMLHWFENLQETLIYHGLSSSLVLFFSITLLLWINRAFRAKNSFNFPPSPPKLPI VGHLHRLGPLPHRSFRDLSEKYGPLMLLQMGFGPTVIVSSAEIAKQIMTTHDLIFANRPA TTASKAFLYGAKDIAFANYGEYWRQMRKICVVDLLSVKRVQSFSSIRGEGVANMVNKIKQ SCLMKNEVNLSELIVSYTTNVISRVALGRSLEGDWGKSKYADLPKQMMELFGIFSVEDMF PSLGWVDYLTGYAQKVKTVAKSMDDFLDEVIEDHLNSRNDDDDTRDFVDLLLKYQKDATL GIEITRECIKAVILDMYVGGTDSTNATLEWAMAEIFNHPNVMEKLKKEVHQVVGEKFKVC EDDVNKMDYLQCVIKETLRLHPPLTIIVPRIPSESTTIEGYHIPAQTRVIINAWAIGRDP KMWDKPEEFMPERFIDKPVDLVGQNFDFIPFGGGRRKCPAILFATTSIGSVLANLLYWFN WELPSDARDAKNVSMTEAFGLTSHKKHPLRLVPIPHAF*

 

>22058180 Aquilegia coerulea|Aquca_079_00014|Aquca_079_00014.1

CYP71 CLUSTER W

MEWFDKHQNEASFQHWLFVVVLIFIFTFIILIWIERINPSKKSLNLPPSPPKLPIIGHLL YLGKLPHRSFLALSERYGPIMLLHFGQTPTLIVSSARICKEIMKTHDTIFANRPNSSASR AFVGELDVGFAPYGEYWREIRKIFVTDLLTAKRRESFKFVREEEIGKMVSIIKESCSVGS DVTVNVSELVATVVRNFIPRIALGESWGRTSKYADLPKLVAQNLGTITFEDVLPSLKWLD VLTGLDKRIKDVAQTVEQFLDEVIDDHLKSRKGADEPGDFVDTLLAYQSDPASAIDLTRE SLKTIILDMYVGGSDMLNTSSEWVMTEVFNHPSVMKKLQNEIREVVGTKSKLDESDIIRM DYLHCVIKETLRIRPTLALLVPRLSSASVTIEGYHIPAKTRVYVNAWAILRDPKIWDRPE EFIPERFIDSPTDFKYNNDFGFIPFGGGRRMCPAVSFATNSLEAVIANLFYWFDWKLPND AKEKKLDTTECSGATLHKKYPVVLVPIAHTF*

 

>22038903 Aquilegia coerulea|Aquca_028_00261|Aquca_028_00261.1

CYP71 cluster A

MEMTLTIFSLVFTFLLSLFMLRVNSRSKIKWPPGPRKLPLIGNLHNLQGIPHHTLRNLAR EYGPLMYLQLGQVPMIVVSSPRVAKEVLKTQDPLFADRPDLLAAKIGSYNYKGIVFSPFG KYWRQMRKICFQELFSAKKVQSMWSIREEEVSNLIEKVSAMAGTPVNLSQMLSSLANDIT ARAAFGKKCKEKDKEAFLALMKESMRLAGGFDFADLYPSLTLLHGINGKKLKLEEIRQKL DKILEGIINEHKEKRTIREIENNPGYVEDVLDVILRLQEENNLDVPVENDNIKAVIQDIF VGGSDTSSTTVIWALSEMMKTPKILEKAQNEVRKVFNGKAKIDQSDINQLKYLSLVIKET LRMYPATGVVPPRESRERCEIDGYEIPKGTKVIVNSWAIGRDPDFWTNPDRFEPERFENL SIDYKGHNFEYIPFGAGRRICPGLLFGIANIELPLAKLLYHFDWKLPNGLKAEELDMTEV FGATISRKVNLSLIPTIYNPLLTVET*

 

>22038845 Aquilegia coerulea|Aquca_028_00075|Aquca_028_00075.1

CYP71 cluster A

MELQPAYFSFVFILILILFLFMLLKVNRSAKPRTTNSKLPPQPWKLPIIGHLHHLLGLPH HILRNLAQKYGPLMLLQLGEVHAIIVSSPKVAREILKTHDIEFADRPALLAGKIMSYDFV GVLFSPYGQYWRQLRKICSQELLSTKKVQSLWSIREEEVSNLIEKISSEAGFPVNISQKL NSLANDIISRAAFGKKCKDKDAFISLMLAVLRLGGGFEFVDFFPSLKFLHGISGTKIKLQ NMHQKIDKILEDIIDDHRENRVRIESKEGEYEEDLVDVLLRIQNDSDLATPLENNNIKAV LLDIFFGGSDTAAITMAWALSELMRNPRVMVKAQTEVRHVFNGKRKVEQSDINELDYLRL VIKETLRLHPPTPLLPPRENREKCEIEGYEIPRKTKVIVNIWAIGRDPKFWSNAEEFIPE RFEDHSIDFRGANFEYIPFGAGKRICPGMSFGLANVEHGLAQLLYHFDWDLPDGVKPAEL DMTEVFGATVNRRVNLKLIPTLYRPLAVVT*

 

>22038726 Aquilegia coerulea|Aquca_028_00286|Aquca_028_00286.1

CYP71 cluster A

MELQFSLTFTLILFLFLVVRQIQSKIVQNRDSKLPPGPWKLPLIGHLLHLVDPLPHQKLR DLAKKHGPLMFLQLGEVPTIIASSPRVTKELLKTNDLVFADRGSIFVGNIMTYGSIGVTL SPYGGHWRQLRKIITLELLSAKKVKSFLSVMEEEVAHLVEVISSMAGSSVNISLKTHLLT YDIICRATFGQKCKEKESFLAMMKEVFELAGGFEIADLFPSYKILPGITGLNQRAEKLHQ KMDKILIDIMNEHKLNRKDISQEDIFDVLLRLQDDRDPTFPIEDNCIKAVIMEIFTAGSD TTSTTLEWAFSELIRNPTVMAKAQSEVRHVLKGNTKASPSSDVSELSYLNLVIKETLRLH PPAPLLIPRQSRERCEVDGFEIPKGTKVFVNAWALGRDPEYWNDAEKFIPERFEDLSVDY KGTNFQFIPFGAGRRICPGMTFGLANIILPLAQLLYHFDWKLPNGVKAEELDMTENFGLT VGRKSNLFLIPTHY

 

>22038897 Aquilegia coerulea|Aquca_028_00176|Aquca_028_00176.1

CYP71 cluster A

MELQVPLILTLVLFLFLVVKGLFQSKIVQNRDPKLPPGPWKLPLIGHLLHLVDPLPHHKL RDLANKHGPLMFLQLGEVPTIIASSPRIAQEILKTNDVVFADRGAIFSGDILTYGSIGVT LSRYGGHWKQLRKIITLELLSAKKVQSFLSVREEEVAHLVEVISSMAGSSVNISLKTQSM TYDIICRTAFGQKCQEKETFLTIMKEALELAGGFEIADLFPSYNFLHGITGVKHRAQKLH QKMDKILTDIMNEHRLNQNDKSGEDIIDVLLRLQDANDSTFPIEDNCIKAVLLEIFIAGS DTSSTTLEWAFSELIRNPQSWRRHNLRLGAFLKERRKFLSHQMLVNSAT*

 

>22038743 Aquilegia coerulea|Aquca_028_00262|Aquca_028_00262.1

CYP71 cluster A

PWKLPFIGHLHHMGGLPHHTLRDLAKKHGPLMLLQLGEVPTLIVSSPKVAKKVLKVNDTV FADRPALLAAKTGTYNFTDIIFSPFGKYWRQLRKICFQELFSIKKVQMMWSIRDEEVSNL IKKISSMAGSSVNMSEMINSVSNDIISRAAFGKKCKDKEVFLSLMHESMSLAGGFDLADL YPSKKFLHGIKEDVVDVILRLNEDNELAIPMENDNIKAVIQNIFIAGSDTSSTAVIWGLS EIMRNPRVMEKVQTEVREIFNGKETINESDINELKYLNLVVRETLRMHPPTGIIPPRECR ETCEIDGYEIPKGTRLIVNAWAMGRDPEFWSNPERFEPERFETLSIDYKGNDFEYIPFGA GRRMCPGLLLGVANVELLLAKLLYHFDWKLTDGLQPEELDMTEVFGGVVVRKVDLKLIPT

IYSALDAEI*

 

>22023553 Aquilegia coerulea|Aquca_005_00271|Aquca_005_00271.1

CYP71 cluster A

MELQLLKTFTFIIVTFIFFLFMLVRQSKKSKSTCSTPPLPPGPFELPLIGHLHHLLGLPH RKLKDLSKIYGPIMYLKLGEVPTVVISSPAVAEQIMKTHDLKFADRPHNLVIEVVTYGFK DIASAPYGDYWRQLRKICVLELLSLKKVQSFWSIREDEVSKFIRRISLVAGSQINLSEMI FTLTNDITARAAFGKTCKDKEAFMSVTDDIVSLAAGFSIADLFPSLKFLETISGIKSKIK RIHQKVDKILDDIIREHKENRVEIENSEGDIEEDLVDVLLRIQGGGELEFPITIDNVKAV TLDMFIGGTDTSSTVIEWIFTELLRNPRVMEKAQAEVRQIFNGKKKIDQADIDKLKYLML VIKESLRLHPPLPLLTPRECRETCILEGYEIPKGSKVFVNAWAMGRDPENWKNPERFEPE RFLDLSIDYKGTNFAYIPFGAGRRICPGILFGIANVELPLALLLYHFDWKLANGVKPEEL DMTEVLSLVVRPRQNLHVIPTIYNP*

 

>22023508 Aquilegia coerulea|Aquca_005_00269|Aquca_005_00269.1

CYP71 cluster A

MELQQLTTFPFILTFILFLLMLVKISKKSTRTHSSSPLPPGPFKLPVIGHLHHLLGQPHH KLKDLAKIHGPIMYLKLGEISAVVISSPGVTKQMMKTHDLVFVDRPTNIVSKIMSYEHKG VIMTPYGEYWRQLRKICILELLSAKRVQSFWSVREKEASDLVKRISLAAGSKMNLSEKIF TLINDITARAAFGKTCKDKEAFLSVTDDIIRLSAVLETMSGIKSKMEMIHQKVDKILDNI IREHKENKIYSETIEDEVEEDLVDVLLRIQEGGELEFPITMDNVKAVTFDMFIAGTDTSS TVIEWIFTELLRNPRVMEKAQAEVRQIFSGKKKIDQADIDKLNYLRLVIKESLRLHPPTP LLVPRECRERCEMEGYEIPKGSKRSGNWKDPESFEPERFQDLSIDYRGTNFKYIPFGAGR RICPGILFGIANVELPLALLLYHFDWKFANGVKPDELDMTEEFSMVVRRKENLYVIPTSY

NPS*

 

>22024338 Aquilegia coerulea|Aquca_005_00267|Aquca_005_00267.1

CYP71 cluster A

MSYNCKDVVMAPYGEYWRQVRKICVLELLSTKRVQSFWSVRYEEVTNLIRRIFLVNGSQM DLSEKIFRLTNDITARAAFGKTCKDKEAFLSVTGDIIRLSAGFSFSDLFPSMKFLETISG IKSKMEMIHQKVDKIVDNIIREHKENRIGTETIEGEVEEDLVDVLLRIQEGGELEFPITM DNVKAVAYARTDTSSTVIEWAFTELLRNPRVMAKTQAEVRRIFDGKKKIDQADIEKLNYL RECRERCEIEGYEIPKGCKVMVNAWAMGRDPENWKDPESFEPERFQDLSIDYRGTNFKYI PFGAGRRMCPGILFGIANVELPLALLLYHFDWKFANDVKPEELDMAEDFSMVVRRKEKLY

VIPMAYNP*

 

>22023826 Aquilegia coerulea|Aquca_005_00270|Aquca_005_00270.1

CYP71 cluster A

MELQQLSTLPFILTFIFFLLMLVKISKKSKRTHSSSPLPPGPFKLPLIGNLHNLLGQPHH KLRDLAKIHGPIMYLKLGEISAIIISSPGVAEQIMKTHDLMFVDRPLNLVSKIMTYGCKD IVMAPYGDYWRQLRKICVLELLSAKKVRSFSSVREEEISKLVGRISLVAGSQINLSEKIF TLTNDITARAAFGKTCKDKEAFMSVTEDIISLAAGFSIADLFPSLKFLETISGIKSKIIM IHQKVNKILDDIIREHKENRMEIENTEGDIEEDLVDVLLRIQEGGELEFPITTESVKAVI FDMFVAGTDTSSTLVEWTFAELLRNPRLMDRAQAEVRQVFNGKKKIDQADIDKLNYLRLV IKESLRLHPPAPFLVPRECRERCEMEGYKIPKGSKVLVNVWAMGRDPENWKDPERFEPER FQADPSIDYKGTNFKYIPFGAGRRICPGILFGIANVELPLALLLYHFDWKFANGVKPEEL DMTEVFSSIVRRKQNLHVIPTIYNPS*

 

>22023827 Aquilegia coerulea|Aquca_005_00197|Aquca_005_00197.1

CYP71 cluster A

MELKQLTTFPFIFFLLMLVKISKKSRSTHSSSPLPPGPFKLPLLGHLHNLLGGLPHHKLK DLAKIHGPIMYLKLGETSAVVISSPGVAKQMMKTHDLMFVDRPFNLAANIMTYGSKDVIM APYGEYWRQLRKICVLELLSAKKVQSLWSVRDEEVSHLIGRISLVTGSQMNLSESIFSLT NDITARAAFGKTFKDKEAFLSETKELIILGSGFSIADLFPSMKFLEVISGIKVKIETIHQ KINMMLVDIINEHKEKRMKIGNIEGEVIDEDLVDVLLRIQEGGELEFPITMDSVKAVTLD

MFMAGTDTSSTVLKWTFAELLRNPRVMIKAQAEVRLHFNGKKKIDQADINELNYLKLVIK ESLRLHPPTPLLVPRECRETCEIEGYKIPKGSKVLVNAWAMGRDPENWKDPESFEPERFQ DLSIDFKGTNFKYIPFGAGRRICPGILFGIANVELPLALLLYHFDWKLANGAKPEQLDMT EVFGSVVRLKQNLHVIPTSYSPS*

 

>22023856 Aquilegia coerulea|Aquca_005_00272|Aquca_005_00272.1

CYP71 cluster A

TCSTPPLPPGPFELPLIGHLHHLLGLPHRKLKDLSKIYGPIMYLKLGEVSTVVISSPGVA EQIMKTHDLKFVDRPQNLVSNVVQSFWSVREEETCKDKKAFMPVAENIISLAAGFSIADL YPSMKFLETISGIKSKIKIIHQKVDKILNDIIREHKENRMETFEGEVEEDLVDVLLRIQE RPNVLEFPITIDNVKAVILDMFIAGTDTSSTLMEWTFIELLRSPRVMEKAQEEVRRIFNG EKKIDQADIDKLNYLRLAIKESLRLHPPAPLLVPRECRERCELEGYEIPKGSKVVVNAWA

MGRDPENWKDPESFEPERFQDLSIDYRGTNFKYIPFGAGRRMCPGILFGIANVELPLALL LYHFDWKFANGVKPEELDMTEEFSISLRRKQNLHVIPTRYSPS*

 

>22023667 Aquilegia coerulea|Aquca_005_00273|Aquca_005_00273.1

CYP71 cluster A

MELQQLKTFPFILSFILILLVLVRQRKKSKSTHSRLPLPPGPLKLPLIGHLHHMLGGQPH HKLKDLAKIYGPIMYLKLGEVSTVVISSPGVAEQILKTHDLKFFDRQQNLVLKVVTYGHN DVIMAPYGNYWRQLRKICVLEILSAKKVQSFWSLMEEEVSKLVRRISLVAGSQINLSEKI FTLTNDITARATFGKTCKDKEAFLSVTDDIASLAAGTSIADLYPSLKFLETVSGIKSKVK IIHQKVDKILDDIIREHKEIRIENQNIEGEEDLVDVLLRIQEGQELELPITLENVKAIIF DMFIAGTDTSSTVLEWTFIELLRNPRVMAKAQAEVRRIFNGKKKIDQADMGKMNYLRECW ERCEIEGYEIPKGCRVVVNAWAMGRDPENWKNPESFEPERFQDLSVDYKGTNFKYIPFGA GRRMCPGILFGITNVELPLALLLYHFDWKLANGVKTEELDMSEHLSLVVRRKQKLYVIPM

PYYP*

 

>22024084 Aquilegia coerulea|Aquca_005_00265|Aquca_005_00265.1

CYP71 cluster A

MLVRQSNKKSKNSDSSSPLPPGPYFKLPLIGHLLYLLGEQPHRKLRDLAKIHGPIMYLKL GEVSNVVLSSPAVAKQMMTTHDLNFVDRPFILVTHIITYGSKDVVMAPYGNYWRQVRKIC VTELLSAKRVQSFWSVREEEISNLIGRISLVVGSEINLSEQIFTLINDITARAAFGNTCK DKEAFILAIKEFVRLASGFSIVDLFPSMKFLEVVSGIKSKIELVHKQVDKMLENIIKEHR EKSKETENILGKVEDDLVDVLLRVQEGEDLEFPFTMDNLKAVTFDMFMAGTDTSSTVIEW TFAELLRNPRVMEKAQAEVRQILNGKKKIDEADIDKMNYLRLVIKESLRLHPPLPLFVPR ECKERCEMEGYEIPKGCRVLVNAWAIGRDPVNWKDPESFEPERFQDLSIDYKGTDFKYIP FSAGRRICPGIWFGIANVELPLALLLYHFDWKFANGVNPEELDMTEEFSTIVRRKQTLYV

IPMAYNP*

 

>22024042 Aquilegia coerulea|Aquca_005_00268|Aquca_005_00268.1

CYP71 cluster A

MDLQQLTTFPFIFIFLLLSFMLVKQIKKSKSTHSSAPLPPGPSKLPLIGHLHHLIGGLPH HLFKDLAKKHGPIMYLKLGQIPAVVISSPSVAEEMMKTHDLNFADRPLNLATQIFTYNCK DVVMAPYGEYWRQLRKICVSELLSAKRAQSFWSVREEEVSSLIGTISLLAGSHINLSERI LLLINDIVARAAFGKTCKDKEAFISIMKEGISFASGFTIADFYPSLKFLEVVSGARPKIE KMHQKIDKILNHIIREHKENRMAIGGQVEEDLVDVLLRIQEGGELEFPITLDNVKAVILD

MFSAGSETSATTIEWAFSELLRNPRVMEKTQTEVRRIFNGKQKIDQADMIELNYLRLVIK ETLRLHPALPMLVPRQCRKRCELEGYEVPLGCQVLVNTWAMGRDPRNWKDPESFEPERFQ DLSIDYIGTNFAYIPFGAGRRICPGMLFGIANVELPLALLLYHFDWKIANGIRPEELDMT EVFGAAVRRKENLYVIPTSYNPSS*

 

>22024254 Aquilegia coerulea|Aquca_005_00274|Aquca_005_00274.1

CYP71 cluster A

MDLQQLTTFPFIFTFLLFLFMLVKQFKKSKSKHPSAPLPPGPSKLPVIGHLHHLIGGLPH HLLKDLAKKHGPIMYLKLGQIPAVVISSSGVAQQMMKTHDLNFADRPLNLASIVMSYECK DVVMAPYGDYWRQLRKICVLELLSAKRVQSFWSVREEEVSSLIGRVSSLAGSQLNLSERI FMLVNDITARAAFGKTCKDKELFISVMKEVIRLAAGFTIADFFPSLKFLEVISGARPKIE KIHKKIDKILSDIIREHKENRMAINGQVEEDLVDVLLRIQEGGELEFPITLDNVKAVTLD

MFSAGSDTSATTIEWAFSELLRNPRVMEKAQGEVRRIFNGKKKIDPADMSDLNYLRLVIK ETLRLHPSIPMLLPRQCRERCELEGYEVPKGSKVLVNAWAMGRDPENWKNPESFEPERFQ DLSIDYKGTNFKYIPFGAGRRICPGILFGIANVELPLALLLYHFDWKLANGVKPEELDMT EEFSMVVRRKNDLYVIPTTYNP*

 

>22040756 Aquilegia coerulea|Aquca_359_00001|Aquca_359_00001.1

CYP71 CLUSTER T

MDLYTSLYLSPLLLLFISILLLKKRNNQGNTPCNPPSPPKLPIIGNLHQLGSLPHRSLQK LSNKYGPIMLMQFGSKPTLIISSADTAREVLKTQDLNFCTRASLVGPKRLSYNFRDFAFT PYGEYWREMRRICVLELFSSKRVQSFEFVREEEVAYLMKSISEFSSSPLNLTQKLFSLTD RITSRITFGKNNQGKDYDIGKFQEVVYEAMDMLGSFTATDFFPYFGWIIDVFTGFNNRLE KCFTAFDNLYQQSREDIIDVLLGLRTDESGATRLTISHIKGILMMVVKETLRLHAPAILL IPRECMNHCKINGYDIYPKTRVLVNVWAIGRSGEYWENPEDFIPERFMDNDIDFRGQDFD FLPFGSGRRGCPGINMGLATVELGLANLLYCFNWELPNGMNKEDINMDELAGITVHKKTP

LVVVPIKYV*

 

>22041692 Aquilegia coerulea|Aquca_015_00395|Aquca_015_00395.1

CYP71 CLUSTER T

MFLLKKLNNQGDKSKSNHPPSPPKLPIIGNLHQLGSLPHRSLRNLANEYGPVMLMRFGSK PTLIISSADTALEVMKTQDLNFCTRPTLVGTKRLSYNFRDFAFTPYGDYWKDMRKICVIE LFSSKRVQSTVFVRAEEVSDLMKNIAKSAPSPINLTEIFFSLTNNITSRVTFGKSYKGKN FDIAKFVETINEAMDMLASFSATDFFPYVGWIIDVLTGFNTRLEKCFNEFDGLYQQVIDE HLDPDRKKPDHEDIIDILLGISRNETGEIRLTSSHIKGLLMNVFIGGIDTSAVTMVWVMA ELIKKPEAMKKIQEEIRNCVGKKGKVEASDINQLQYFRMVVKETFRLHPPGVFLLPRECR KHCKINGYDIYPKTRVLVNAWAIGRSSEHWENPEEFAPERFMDTSIDYIGQDFELLPFGS GRRGCPGINMGMATVDLGLANLLYCFNWELPNEKDINMDEVASLTVHKKIPLILLPTKYI

EPI*

 

>22041501 Aquilegia coerulea|Aquca_077_00042|Aquca_077_00042.1

CYP71 CLUSTER R

MQLPITWLSLVLTLVICFYKILKIGNRNRHSKLPPAPWKLPIIGHLHHLLGQLPHHSLSD LAKKHGPLMFLQLGEVPTVIVSSSKVAKEIFKTHDAVFAERPALLAAQIICYDYKCITFS TYGEYWKQMRKICIQEFLSAKKVQLLSSIRQDEVSKLVKKISSAAGSPVNLSECLMSLTN DITSRAIFGKVCKDQEVFISLMEELLTLAGGFSFDDTFPSLKFLNWTSSSTKLKLTKIQR KVDKILENIVNEHREERISFECKNGEYEEDLVDVLLRLQGDNNLAIPIEEDNVKAIVVEL TIAGSESSSSTMVWALTELMRNPRVMKKAQTEVRHTFDGKKKIDQSDITELKYLRSVIKE TLRLHSPNPLLIPRVNRERCEISGYEIPENTKVIVNAWAMGRDPAVWNNAESFEPERFED LSIDYKGTNFEYIPFGTGRRICPGMSFAIANIELPLAQLLYHFNWNLPDGVKPENLDMTE AFGATVHKKISLSLIPFCYGRS*

 

>22041527 Aquilegia coerulea|Aquca_077_00011|Aquca_077_00011.1

CYP71 CLUSTER R

MLVKQISKRLTSKTSPSSSLLPPGPSKLPVIGHLHHLVGSLPHHSLKDLAKIHGPIMYLK FGEVSAVVISSPSVVKQMMKTHDLMFVDRPLNLAAKIMSYQCKDVVMAPYGEYWRQVRKI CILELLSAKRVQSFWRVREEEVSNLIQRISSKADGSQVINLSEKIFTLTNDITARATFGK TCKDKQAPFISVIKEVIRLASGFDIADLFPSLKFMEVISGTKPKIERMHQKVDKMLNDII KEHKQNRMARLARGEAEEELVLDVLLRLLEGRELDIPITMDNVKAVTLDMFFAGTDTSST VTEWAFAELLRNPRAMKKAQAEVRRIFNGKKKIDQADMNELSYLRLVIKEALRLHPPAPL LVPRECRETCEMVGYEIPKGCKVIVNAWAMGRDPENWSDPESFEPERFEDVDIDYKGTNF KYIPFGGGRRICPGILFGIANIELPLALLLYHFDWKLADGIKPEQLDMTEAFSAVVKRQN SLYVIPTTYIDFRNNTRASTVTKYSVS*

 

>22060659 Aquilegia coerulea|Aquca_056_00025|Aquca_056_00025.1

CYP71 CLUSTER P

MNRVVLQCFEREALSANLLLLYLFFFLFIFLVIKFKKSKATKYNLPPSPSKLPFIGNLHQ LHGSPHHVFRALAQKHGPLMLLHLGRVPTLVVSSSDFAREVMKTYDHVFSSRLELMIPKR LLYGQDIAFAPYGEYWRQLRKVCVLQLFSSKKVQSFRSLREEEIALLMENIKKEASLATS VVNLSEMFVSLTNNIVCRVALGKKYNDDQSERNLKKILNEFTHLMGASNVGDFIPSLAWL NYFNGLNSKLEKNFREIDCFLDEVVEEHIEKKRRINGGDGGGEDEEDDFVDVMLGMENNL TLGIPLARDSTKAIILDMFAAGTDTSSTVLEWAMSELVRHPEIMEEVQNEVRDIAGSKLI IKENGTEEMHYLKAVIKETLRLHPPVPLLLPRESIEKVQVHGYDIPAKTTIVINAYAIGR DILSWEDPDKFLPERFLNGSSASIDYKGQDFQLIPFGAGRRGCPGILFATSILEIALANL LNRFDWALPNGMDGKDLDMHEDSGLTIHRKNELVLMAKPLY*

 

>22060689 Aquilegia coerulea|Aquca_056_00069|Aquca_056_00069.1

CYP71 CLUSTER P

MNRVLQFLERGITSANPFLMYLCFFLFVLLVIKFKTQGATKYKNLPPSPPKLPIIGNLHQ LRGIPHQAYRALAQKYGPLMYLHLGCKPTLVVSSADLARAVMKTYDHVFASRPEMMFSKR LLYGLMDVAFTPYGEYWRQGRKVCVVQLLNAKKVQSFQSSREEEINLMLEKIEHASLSNS VVNLSEMFTSFTNDNVCKIAFGRKYNEGELAGRQLRTILNEFTYFLGAFNIADFIPSLAW VNYLNGLNARLEQNFSQIDSFLDEVIEDHIGKKKIINDDGGGKNEEEADFADVMLGIEKD ASTHFIPFARECTKAILLDMFAAGTDTTSITLDWTMSELIRHPKIMKEVQKEVRDIARGK LLITENDIEGMHYLRSVLKEALRLHPPLPLLVPRESMEYITLQGYDIPAKTMVIINAAAI GRDPKYWEEPEKFWPKRFLKNGTSASVDFRGQDFQFIPFGAGKRGCPGITFAISAVELAL ANILNRFDWALPNGNAKDLDMQEGFGITAFKNTELVLTAKPHY*

 

>22060690 Aquilegia coerulea|Aquca_056_00022|Aquca_056_00022.1

CYP71 CLUSTER P

MKMNQFIQWLEQQAHSNLFYLIFFFLFIFLVKRFNRSETNKYKFPPSPSKLPIIGNLHQL HGSPQHAFKSLAQKHGPLMLLHLGSKPTLVVSSPETALDVMKTYDHVFSSRPELQFAKRL TYGKDIGFAPYGEYWMQVRKVCVLQLLCAKKVQLFRFVREEEVALIVDKIKDLSLSTAVV NLSEMFLCLSNDVVCRVALGKTYNEGEVGKKFKGMLKEFGYLLVVNNVGDLIPSLAWVNN LNGLNARVEKLFRDIDSFIDEVIEEHIEKNNKIGGYHSGDNEEEDFVDVMLRIEKGDSDH GISWTKDSTKAIIFDMFAAGTDTSAVVLEWAMSELIRHPNIMEDVQKEVRDIARGKVMIT ETDMDEMHYVKSVIKEILRLHPPVPLLLPRESMEKVQIQGFDIPAKTTVMINVFAIGRDP KFWDEPEKFWPKRFQNVGNVSIDFKGQDFQFIPFGAGRRGCPGILFATSIIELTLANLLN RFDWALPEGMDGKDLDMEENFGLTVHRKNDLVLTPKPH*

 

>22060717 Aquilegia coerulea|Aquca_056_00021|Aquca_056_00021.1

CYP71 CLUSTER P

MNQFLQWTEQQSHLILLYFVLFFLFLLSVIRFNKPETNKYKLPPSPFKLPIIGNLHQLHG SPHRAFQSLAQKHGPIILLHLGKIPTLLVSSVDIAQEVMKTNDHVFSSRPETDFPKRLLY GKDIAFAPYGEYWREVRKICVLQLLSAKKVQSFRFIREEEINLMVDEIKKSPLSTSVNLS ELFVSLTYNIICRVALGRKYDEGQGGRKFKAIFKEFMYLLGVSNMADLIPSLSWVNHLNG INARVEKNFRDIDTFLCEVVEENIEKQRRIGGDGSSEHEAENFVDVMLGIEKDTSIGTPL ARDNTKAIILDMFAAGTDTSSVVLEWAMSELIRNPKIMEEVQKEVRDIAGGKPILNENDI EEMHYLKSVIKETLRLHPPLPLLVPRESMEKVQILGYDIPAKTTVMINAFAIGRDPLWWD DPEKFWPKRFVNGGSASIDFKGLDFKFIPFGGGRRGCPGIVFAISILELSLANLLNIFDW ELPKDMDGKDLDMHESSGITVHRKNDLLLTAKPHYY*

 

>22060749 Aquilegia coerulea|Aquca_056_00017|Aquca_056_00017.1

CYP71 CLUSTER P

MYQFIQWLEQQAHSNLFYLIFFFLFIFLVIRFNRSETNNYKFPPSPSKLPIIGNLHQLHG SPHHAFKSLAQKHGPLMLLHLGSKPTLVVSSAEIARVVMKAYDHVFSSRPELQFAKRLFY GKDMAFAPYGEYWRQVRKICVLQLLSTKKVQSFQFVREEEVALMVNKIKDSSLSTSVINL SEMFVCLTNDIVCRVALGKKYNEGEVGKKFKWILKEYVYLLGVTNVGDLIPSLAWVNNLN GLNARVEKNFRDLDSFIDQVIEEHREKMRRIGGHGNGDNEEEDFVDVMLGIEEGDDDHGI SWARDSTKAIVLDMFAAGTDTSSVVLEWAMSELIRHPNIMEEVQKEVRGIARGKLIITET DMDEMHYLKSVIKETLRLHPPAPLLVPRESMEKVQIQGYDIPAKTTVLINAFVIGRDPKL WDEPEKFWPKRFLNGGSVSVDFKGQDFQLIPFGSGRRGCPGILFATSIIELTLANLLNRF DWALPEGMNGKNLDMEEESGITVHRKNDLVLSAKQHYC*

 

>22060643 Aquilegia coerulea|Aquca_056_00019|Aquca_056_00019.1

CYP71 CLUSTER P

MNQFLQWSEQQSHLILLYFILFFLFLLWVIRFNKPETNKYKLPPSPFKLPIIGNLHQLHG SPHRAFQSLAQKHGPIMLLHLGKIPTLVVSSVDIARDVMKTYDHVFSSRPESEIPKRLFY DKDIAFAPYGEYWRQVRKICVLQLLSAKKVQSFRSVREEEINLMVDVINKFPLSNSVNLS ELFVSLTYNIICRVALGRKYSEGERGKKFKAIFTEFTYLLSVSNMGDLIPSLAWVNRLNG INARVEKCFRDIDTFLHEVVEQHINKQRGIYGDDSGDNEEEDFVDVMLGIEKESSFGIPL VRDNTKAIILDMFGAGTDTSSVALEWAMSELIRHPNIMEEVQKEVRDVGRGKLILNENDV EEMHYLKSVIKETLRLHPPAPLLIPHESMEKVQIQGYDIPAKTTVMINVFAIGRDPLWWE EPEKFWPKRFLNGGSTIDFKGQDFQFIPFGAGRRGCPGILFAISVLLPTLANLLNIFDWE LPSGMDIQDLDMHEGPGITVHRKNDLFLTAKPHYY*

 

>22060665 Aquilegia coerulea|Aquca_056_00024|Aquca_056_00024.1

CYP71 CLUSTER P

MNQFIQWLEQQAHSNLFYLIFFFLFIFLVIRFNRSETNNYKFPPSPLKLPIIGNLHQLHG SPHHAFKSLAQKHGPLMLLHLGSKPTLVVSSPEMALDVMKTYDHVFSSRPELQFAKRLFY GKDMAFAPYGEYWRQLRKVCVLQLLSAKKVQSFRFVREEEVGLMVDRIKDSSSSTAVVNL SEMFVSLSNDVVCRVAFGRKYSEGKIGKKFKGILKEFMYLIGVSNVGDLIPSLAWLNNLN GLNARVENNFRDIDSFIDGVVEEHIEKRKLGGHGSGDNEEEDFVDVMLGIEKGDSDHGIS WARDSTKAIVLDMFAAGTDTSSVVMEWAMSELIRHPNVMEEVQKEVRDIAGGKLMINETD

MDEMHYLKSVIKEILRLHPPLPLLVPRESMQKVQIQGYDIPAKALVMINTFAIGRDPKLW EEPDKFWPKRFLNGDSTSVDFKGQNFQFIPFGSGRRGCPGAVFAISIIELVLANLLNKFD WALPDGMDFKDLDMEEESGITVHRKNDLILTAKPHYS*

 

>22060672 Aquilegia coerulea|Aquca_056_00023|Aquca_056_00023.1

CYP71 CLUSTER P

MLLHLGKIPTLVVSSVDIARDVMKTYDHVFSSRPKSEFLKRLFYGKDIAFAPYGEYWRQV RKICVLQLLSAKKVQSFRFVREEEIILMVDMIKKSSLSTSVNLSELFVSLTYNIICRVAL GRRYSEGERGKKFKAIFKELTYLMSVSNMGDLIPSLAWVNRINGLNKRVENNFQDMDSFL DEVVEEHIQKQRRINGDGSGENEEDDFVDVMLGIEKDSSFGIPFVRDNTKAIILDMFAAG TDTSSVVLDWAMSELIRHPNIMEDVQKEVRDIAGGKLVLSENDTEEMHYLKSVIKETLRL HPPAPLLIPHQSMEKVQIQGYDIPAKTTVMINVFALGRDPLGWEEPEKFWPKRFLNGVSA SIDFKGLDFQFIPFGAGRRGCPGILFAISILELTLANLLNIFDWELPKDMDGEDFDMREG SGITIHRKNDLLLTAKPHYY*

 

>22030834 Aquilegia coerulea|Aquca_085_00010|Aquca_085_00010.1

CYP71 CLUSTER X

MDLQLMSYFSLFFAFLLLLYMSVKVKRGPETRNQNSKLPPGPWKLPFIGHLHHLLGLPHH SLRDLAKKHGPLMLLQLGEVRMLVVSSPRVAKELMKTHDAAFADRPTLLAAEIFSYNYKG IIFSPYGQYWRQLRKICIQELSSAKKVQSWWPVKEEEVSNLIGKISSLTGSPVDLSEILI SLTNDIISREAFGKKCKDKDVFVSLMQEVLRLAGGFDFADLFPSLKFLHGIGGTKLKFLK THRKVDKILEDIITEHRENRKRIETEKVGYEEDLVDVLLRLQEDDDLAIPIEDTNLKAVI LDIFVAGSESSSSTIVWALSEMMRNPRIMEKVQMEVRQILYSKEKVDQSDLNELKYLRSV IKETLRLHPPNVLIPPRTNRERCEIDGYEIPEQTKVIVNAWAIGRDPEFWSNAESFEPER FEDLSIDYRGANFEYIPFGAGRRICPGISLGVANIELALAQLLYHFNWKLPNGVKPAELD

MTEVFGAKIWRKSHLILIPTLHV*

 

>22055551 Aquilegia coerulea|Aquca_019_00015|Aquca_019_00015.1

CYP71 CLUSTER X

QLPLTFTLVIFLFIVVKQFRSGVLNKKAINIPPGPWKLPVIGHLHHLLGHLPHHTLKDLA KKHGPLMFLQLGEVSSITASTPRVAKEILKVNDLIFADRATQFSGKITTYGGIGLILSPY GGHWRQLRKICILELLSAKKVQSFLSIRDEEVANLVETISSTVGSPVNLTQKIFSLTNEI TCRAAFGEKCKEKETFMTLMKELVKLFNGFEIVDLFPSFKFLHMITDLIDVLLRLEEDNE LEFPIENNCIKALILEIFIAGSDTSSVVLEWAFSEIVKHPRIMEKAQSEVRQVLHGKTKV GQSDINELKYLKLIIKETLRLHPPAPLLTPRESRERCEINGYEIPKGTKVIVNAWALGRD AENFKPERFEGRSVDYKGTNYEYIPFGAGKRICPGMSFGVANIELPLAQLLYHFDWKLPN GVKSEDLEMTEIYRGTVGRKYNLYLTPTLYFP*

 

>22037603 Aquilegia coerulea|Aquca_012_00065|Aquca_012_00065.1

CYP71 CLUSTER N

MFQWLLEQYGMQLDPIFISAFSIFLVTLLYTLIRPRTNKLNLPPSPSKLPIIGNLHQLGT LPHRSLQSLARKHGPLMLLHLGQTPALIVSSDDAAKEVIQIQDFNFCNRPRMSFAERLLY SSKDLAFSPYGEYWKQMRKISTQHLLSGHRVESFRTVREEEANIMIDKIHEYCSSASSVV NLSELIYSFTNNVVCRVAMGRKFDAGEGAKKFSELITEFMNLIGVFNVADYIPWLSIINN FNGLNARVRKSSKEMDCFLESVIQDHIDPKKKTNSGVEDFIDVLLGMQNDSTNRVSFARD NIKAVILDMFAAGTDTSAVTLVWAMTELIKHPEIMKEVQAEIREISKGKLHITEDDLGQM HYLKMVIKEALRLHSPASIFVPHESIQDTKLLGYDIPAKTRIFINQWAIANDPMLWDEPE EFRPKRFLNTSIDYQGKDFKFFPFGAGRRGCPGILFATPNMELPLANLLYHFNWSLPNGL KSKDVDVAEEFGIILHKKSPLLLVPTPCGF*

 

>22037615 Aquilegia coerulea|Aquca_012_00086|Aquca_012_00086.1

CYP71 CLUSTER N

MLQWLEEQNNKLNLPPSPSKLPIIGNLHELGTLPHRSLQSLARKHGPLMLLYLGQTPALI VSSADAAKEVIKTQDFNFCNRPRMSFAERLFVSNKDLAFSPYGEYWKQMRKISALHLLSG HRVESFRTIREEEANIMIDKIRECCSSASSAVNLSEIIFSFTNNVVCRVAMGRKFGEDEG AKKFSELIMEFMNLIGVFNVADYIPWFSVVNNFNGLNARVAKNSKEMDCFLESVIQEHID PKKKIKNSGVEDFVDVLLGMENDSTNRVSFARDNIKAVILDMFAAGTDTSAATLVWAMTE LIKHPDIMKEVQAEIREITKGKLHITEDDLGQMHYLKMVIKEALRLHSPVPIFIPHESIQ DTKLLGYDIPAKTRVFINQWAIANDPILWDEPKEFRPRRFLNTSIDYQGKDFKFFPFGAG RRGCPGILFATPNMELPLANLLYHFNWSLPNGLTSKDVDVSEELGIVLRKKSPLLLVPTP

FGF*

 

>22037971 Aquilegia coerulea|Aquca_011_00440|Aquca_011_00440.1

CYP71 CLUSTER C

MTPYISLFLSSLILVTLLFLSIWALKKKNKHGYKPSFPPSPPKLPIIGNLHQLGNLPHRS LQKLSKEYGPLMLMQLGGKPTVVASSAETAREILKTHDLDFCSRPSLAGPKRLSYNFLDF AFVPYGEYWKEMRKICVLELFSTRRVQSFRFVREEEVAHMIKSISASSSGPVNLTEKLFS LTINIISRVAFGKKYQGGGSDVGNFHEIVIEAMNMLGSFTATDFFPYFGWIIDLFTGHSR RLEKCFHAFDNFYQQVIDEHLDPQRKRPEQEDIIDVLVRLQNEQSGAVSLTVSHIKAVLM NVFLGGVDTAAITMVWGMTELARNPKVMKKVQEEIRNCVGNKGMVEESDIDKLEYFKMVV KETLRMHPPSIMLVPRETMNHCKVNGYDIYPKTRVLVNVWAIGRNAEYWENPEEFIPERF TNSSIDFKGQDFEFLPFGSGRRICPAISMGTAMIELGLANLLYHFNWELPSKDDINMDEI AGLTVHKKIPLCLVPIPYHRKSG*

 

>22038021 Aquilegia coerulea|Aquca_011_00443|Aquca_011_00443.1

CYP71 CLUSTER C

MTSYISLFLSSLLLVTILFLSIFAFKKKNKHGSKPSLPPSPPRLTIIGNLHQLGNLPHRS LQKLSKEYGPLMLMQLGSKPTVVISSAETAREVLKTHDLDFCSRPSLAGPKRLSYNFLDI AFVPYGEYWKEMRKICVLELFSAKKVQSFRFVREEEVAHMIKSISASSSSPVNLTEKLFS LKMNHICRVAFGKKNRGRDSDNENFHEMFIEAINLHGSFTATDFFPYFGWIIDVFTGHSR RLEKCFHAFDTFYQQVIDEHLDPQRTKPEQEDIIDVLIRLQNEQSGALNLTVSHIKSILK DIFLGGVDTGASTMVWGMTELARKPEVMKKVQEEIRNCVGNKGMLEESDIDNLEYFKMVV KETFRMHPPTIFLIPRECMNHCKINGYDIYPKTRVLVNVWAIGRSSEYWENPDEFIPERF INSSIDFKGQDFELLPFGSGRRICPAISMGTAMIELGLANLLYHFNWELPSKDDINMDEI AGLTVHKKIPLHLVPIPYNCK*

 

>22038344 Aquilegia coerulea|Aquca_011_00441|Aquca_011_00441.1

CYP71 CLUSTER C

MTSYISLFLSSLLLVTILFLSIFAFKKKNKHGSKPSLPPSPPRLPIIGNLHQLGNLPHRS LQKLSKEYGPLMLMQLGSKPTVVISSAETAREVLKTHDLDFCSRPSLAGPKRLSYNFLDI AFVPYGEYWKEVRKICVLELFSAKKVQSFRFVREEEVAHMIKSISASSSSPVNLTEKLFS LKMNHICRVAFGKKNRGRDSDNENFHEIVIEAMNMLGSFTATDFFPYFGWIIDVFTGHSR RLEKCFHGFDTFYQQVIDEHLDPQRTKPEQEDIIDVLIRLQNEQSGALNLTVSHIKSILK DIFLGGVDTGASTMVWGMTELARKPEVMKKVQEEIRNCVGNKGMVEESDIDNLEYFKMIV KETFRMHPPSIFLIPRECMNHCKINGYDIYPKTRVLVNVWAIGRSSEYWKNPDEFIPERF INSSIDFKGQDFELLPFGSGRRICPAISMGTAMIELGLANLLYHFNWELPSKDDINMDEI AGLTVHKKIPLHLVPIPYNCK*

 

>22037851 Aquilegia coerulea|Aquca_011_00450|Aquca_011_00450.1

CYP71 CLUSTER G

MQQWFTLFNSPFSLSFVLIMSSLFFLSRFLRVWVAGRSIKVPPSPPKLPLIGHLHHLGAL PHHSLRALSQKYGPLMLLHMGYTPTLVVSSAKMGRELMKTHDIVFSNRPITTAAKEFLYS GKDLVFAPHGEYWRQMRRVCVVDLLSVKRVQSFEFVREEEICNMVNKINQACVTNSDVNL SNLIAIITNNIISRVALGRSLEGKSEGAKLAKEVAEQFGVFSVGDMFPSLGWIDELTGLK KRMRKTSTAMHLFLDEVIEEHLMSKKEGVAVDRKDFVDLLLESEKDPTLGVEFTRENLRS VIMDMLVGGTDTTYTTLEWAMAELANHPTAMKKVQEEVRQVIGKTTQVNENDINKLDYFN CVIKETLRLHPALVLSLPRESISSTNIEGYHIPDKTRAIVNLWAIGRDPEIWDKPDEFIP ERFINNPIDFRGKDFEFIPFGGGRRGCPGLTFGVVSVEAILANLLYWFDWELNGSAKELD

MTEAFGLSVHLQQALHLVPKAHLF*

 

>22037984 Aquilegia coerulea|Aquca_011_00449|Aquca_011_00449.1

CYP71 CLUSTER G

MAVTIAVQQWFQQETFFNNPLSLSLVFLFSLFFLSRFLRVWAVGSKSVKVPPSPPKLPLI GHLHHLGSLPHQSLRALSLKYGPLMLLHLGYTPTLVVSSAKMGREIMKTHDVVFSTRPIT TAVKEFLYSGKDVAFAPLVITNNIISRVALGRSLEEKSVGAKLTKDVMEHFGVFSVGDMF PSLGWIDELTGLKRRMRKTSSAMHRFLDEVVEEHLTSKKEGAQADKKDLVDLLLESEKDP TLGVEFTRENLRAVIMDMFVAGTDTTYTTLEWAMAELVNHPVAMKKVQEEVRKVIGNTTM VNESDTSKMDYFNCVIKETLRMHPALVLSLPRVSTSSSVIEGYQIPDKTRVIVNLWAICR DPEVWDKPNEFIPERFMNNLIDFRGKDFEFIPFGAGRRGCPGLTFGLMSVEAILANLLYW FDWELNGGATKIDMTEAFGLSVHLEQPLRLVPKAHLF*

 

>22037906 Aquilegia coerulea|Aquca_011_00456|Aquca_011_00456.1

CYP71 CLUSTER H

MALVPILLQWLDLSKNQQTLFQYSLPFNLLFAFSIGFIIFRLVNGSSSKELNLPPSPPKL PIIGNLHQLGKLHNLHQTFHDLSKKYGPLMFLHTGNTSTLVVSSIEMVREIKINHDIPFA NRPSSTASNMLFYGGINVGFAPYGEYWRQLRKIYVMELLSNKKVQSFKYVREEEAALMIE KISFACSMGTPIDIKELVTSLTNDVVCRCALGRKHGGQGGNYNFGEMANKVGKLLPAFCF GDLFPGLGWMDTLTGLIGRLKKVSGELDNFFDQIIDEHLSQNKHNDPNYNKDFVDLLLEV QNDNLHFTRDYMKAMILDLFVGGTDTTSTTIEWAMMELVKNPNVMKKAQEEVRKVVGKKN KVHDEDIHQMEYLKLVVKETLRLHPAVALNVLESSTITNVQGYNVPAKTAVFINNWSIHR DPKLWDRAEEFIPERFSENPIDFHGKDFKYIPFGTGRRSCPGLLFAIVAVEFAIANLLYW FDWEIPHGEEIDKTESFGLTVSKKIPLLLIPTSHFY*

 

>22038023 Aquilegia coerulea|Aquca_011_00453|Aquca_011_00453.1

CYP71 CLUSTER H

MFGSQWLIYFFYNGNLHQLSKHLHIAIHNLSQKHGPIMMLSLGYFETLVVSSVEMIKEIK HNQDLEFANRPNTTVSKLVHYGGINLLHSPYGDYWRQLRKIYVMELLSNKRIQSFKYIRE EEVALMIKKISLSCSVGGLVNIRELVTGLTNDIICRCALGRKPGEEDGHGNFGELATESV SLFTAFSFGDLFPWLGWMDYLTGLVSRMKKASRELDNFFDQIIDEHLVQSIHSNTDFVDI LLETQKNDINFTRDHVKAVILEIFLGGTETSSTTIEWALAELINNPKLMKKAQEEVRRIV GTEGKVDEEDIHQMGYVKLVIKETLRLHPSAVLIPGQSSTITNVKGYHIPAKTRVLINAW AVQRDPKEWEKPDKFIPERFLNNPLDFKGQDFKYIPFGSGRRGCPGLSFGTAVVEIAIAN LLYWFDWKTPGGEDLDMREGFGITVNRKIPLEVVPISHFSQSMKRGS*

 

>22038135 Aquilegia coerulea|Aquca_011_00451|Aquca_011_00451.1

CYP71 CLUSTER H

MADLVTVLLQWLVLEKHQQTLLLFHYPLLLFVALLFVFSIYIIFRRDKHNLPPSPPKLPI IGNLHQLSKNLHFAIHNLSQKHGPLMMLSLGYCQTLVVSSAEMVREIKLHQEIPFADRPI TTAGKMLIYGGINLVLSPYGEYWRQIRKIFVMELLSSKRVQSFKCLREEDVALMIKKISL SCSLGDPVNIRELVTVLTNDIVCRCALGRKHGGQDGHGNFGELATETVKLFTAFSFGDLF PWLGWVDYFTGLISRMKKASRALDNFFDQIIDEHLLQSKHSNSDYNKDFVDILLEVQKND INFTRDHIKAIIMDSFVAGTDTTSTTIEWAFAELIKNPHVMKKAQEEVRRVVGTKDKVDE EDLHQMGYLKLVIKESLRLHPTAVLIPGQSSIATNVKGYYVPAKTRVLINAWSVQRDPKE WENPDEFIPERFHNNPIDFKGQDFKYIPFGSGRRGCPGISFGMAVVEIAIANLLYWFDWK TPGGEDLDMRESFGITVNKKIPLELVPISFSA*

 

>22038320 Aquilegia coerulea|Aquca_011_00403|Aquca_011_00403.1

CYP71 CLUSTER K

HLHRLGPLPHRSFRDLSEKYGPLMLLQMGFGPTVIVSSAEIAKQIMTTHDVIFANRPATT ASKAFLYGAKDIAFADYGEYWRQMRKICVVDLLSVKRVQSFSLIRGEGIANMVNKIKQSC LMRKEVNLTELIVSYTTNVISRVALVWKIYMFPSLGWIDFLTGYAQNVKMVAKSMDHFLD EVIEDHLKSRNDNDDTRDFVDLLIKYQKDATLGIEITRECIKAVILDMYVGGTDRTNATL EWAMAEIFNHPNVMEKLTKEVRRVVGNKSKVEENDVNQMDYLQCVIKETLRLHRPPTIIV PRIPSKSTTIEGYDIPAQTRVIINTWAIGRDPKIWDKPEEFIPERFIDKPVDLVGQDFDF IPFGGGRRKCPAILFATTSIGSVLANLLYWFNWELSGDAKETSIDMTEAFGLTSHKKHPL

CLIPKPNSF*

 

>22056996 Aquilegia coerulea|Aquca_034_00228|Aquca_034_00228.1

CYP71 CLUSTER K

MVFPQAVLQWFENQQEILLYHFLSTSLFLFFSISSLLWITRVFQPKKLYNLPPSPPKLPI IGHLHRLGPLPHRSFRDLSEKYGPLMLLQMGFCPTVIVSSAEIAKQIMTTHDVIFANRPA TTASKAFLYGAKDIAFADYGEYWRQMRKICVVDLLSVKRVQSFSLIRGEGIANMVNKIKQ SCLMRKEVNLTELIVSYTTNVISRVALGRSLEGDWGKSKYADLPKQMMELFGIFSVEDMF PSLGWIDFLTRYAQNVKMVAKSMDHFLDEVIEDHLKSRNDNDDTRDFVDLLIKYQKDATL GIEITRECIKAVILDMYVGGTDSTNATLEWAMAEIFNHPNVMEKLTKEVRRVVGNKSKVE ENDVNQMDYLQCVIKETLRLHPALTIIVPRIPSKSTTIEGYDIPAQTRVIINAWAIGRDP KIWDKPEESIPERFIDKPVDLVGQDFDFIPFGGGRRKCPAILFATTSIGSVLANLLYWFN

WELS

 

>22060787 Aquilegia coerulea|Aquca_714_00001|Aquca_714_00001.1

CYP71 CLUSTER K

MLHWFENLQKTLIYHGLSSSLVLFFSITLLLWINRAFRAKNSFNFPPSPPKLPIVGHLHR LGPLPHRSFRDLSEKYGPLMLLQMGFGPTVIVSSAEIAKQIMTTHDLIFANRPATTASKA FLYGAKDIAFANYGEYWRQMRKICVVDLLSVKRVQSFSSIRGEGVANMVNKIKQSCLMKN EVNLSELIVSYTTNVISRVALGRSLEGDWGKSKYADLPKQMMELFGIFSVEDMFPSLGWV DYLTGYAQKVKTVAKSMDHFLDEVIEDHLNSRNDDDDTRDFVDLLLKYQKDATLGIEITR ECIKAVILDMYVGGTDSTNATLEWAMAEIFNHPNVMEKLKKEVHQVVGEKFKVCEDDVNK

MDYLQCVIKETLRLHPPLTIIVPRIPSESTTIEGYHIPAQTRVIINAWAIGRDPKMWDKP EEFMPERFIDKPVDLVGQNFDFIPFGGGRRKCPAILFATTSIGSVLANLLYWFNWELPSD ARDAKNVSMTEAFGLTSHKKHPLRLVPIPHAF*

 

>22037796 Aquilegia coerulea|Aquca_011_00407|Aquca_011_00407.1

CYP71

MDISVPARLQWFENQQAILVHHPLSLPLLFFSLFFLLCFNRVWPAKATNLPPSPPKLPII GHLHCLGTLPHRSLQALSEKYGPLMLLQLGQTPALVVSSAAMAKQIMKTHDIIFANRPIT TASKLFLYGCKDITFAPYGEYWRQMRKICILDLLSVKRVQSFSFVRKEEIANMVNDIKQS CSLGRKINLSGLIVSATNNIISRVALGRSWGTEYAELTTQVMDLFGILSMEDVFPSLGWI DVLTGLHRKMKKTSKTMHQFVDEVIEEHVLGRNDDNRKADQKDFVDILLDYEEDPTPTFE FTRENLKAVIIDMFVAGTDTIYTTLEWAMAELVNHPNEMKILQEEIHRVVGDKSEVDENE ISQMDYLSCVIKETLRLHPPLVMVIPRVSSARSDIDGYNIPANTRVIINAWAIARDPKIW DKPNEFIPGRFIKNKVDFRGQDFEFIPFGAGRRGCPGISFGITSIESILASLLYWFDWES PSGNTNEKIDMSEAFGLSVHMKSPLNLVPKFRT*

 

>22038077 Aquilegia coerulea|Aquca_011_00005|Aquca_011_00005.1

CYP71

MKLEIAFFPLACIIILNMFIVVKIISRFKIQKPNSKFPPGPWKLPVIGHLHHVRGLPHRS LWDLAKKHGPLMLLQLGEVPLIVVSSPKVAKEIMKTHDTVFADRPKLLAAKAGSYNYTDI VFAPFGKYWRQLRKICFQELFSMKKVQSMWSIREEEVLNLVEKIKTMAGSPVNLSEKFIS LSNDITSRAAFGKKCKDKEAFLSLVEESMRLAGGFDLADLYPSLKILHGISGTQHKLEII HQKLDKILQDIINEHRQNRMGKRETEKIQGNEEDVVDVLLRLQEDNDLAIAMEDDNIKAV IQDIFVAGSDTSSATVEWALAEMMRNPRVMEKAQTEVRQVLNGKRKVDQSDINKLIYLRL VIKETLRLHPATGLIPPRESREECEIDGYEIPKGTKIIVNAWAIGRDPEFWSNAESFEPE RFQDISIDYKGNNFEYIPFGAGRRICPGLLFGIANIELPLAQLLYHFDWKLPYGLKQKEL DMTEAFGAVVSRKTNLTLIPTIHSSFAVET*

 

>22031252 Aquilegia coerulea|Aquca_017_00419|Aquca_017_00419.1

CYP71AN-LIKE 56% TO CYP71AN1 cottonwood

MRPERRSRGQEKLCLPPSPPTLPIIGNLHQIGLQLHRSIHNLSEKYGPLMFLRLGYLPTL VVSSAEMAREIKVTHDIAFANRPQTTAVKLSLYGCVDVAFCPYGEYWAQVRKISVIELLS TKKVQSFKSVREEEIALMIKKISQWSSIGAQVNVSELATALTNDIVCRCALGRKHGNSNF GDLAGKLLKLQTAITFSDLFPWLGWMDNLTGLMGRIKKISRELDIFYDQVIDEHLIHENK HGDPDYNKDFIDILLQIQKHHTNFTRENIKAIIMDMFIGGTESTSTTIEWAFAELVKNPN VMQKAQEEVRRVVGKKDKVDEEDVHQMHYMKLVIKESMRLHPAVAINVLESSMVTNIRGF HVPANTRLVINNWSIQRDPKQWERPDEFIPERFSCNPVDFKGKDYKFIPFGAGRRICPGI TFAMTVIESAIANLLYWFDWTTLDGEELDMTEGFRVTVTMKTVPLRVIAVSHLS*

 

>22063805 Aquilegia coerulea|Aquca_191_00002|Aquca_191_00002.1

CYP71AN-LIKE

GKSVKVPPSPPKLPLIGHLHHLGSLPHQSLRALSLKYGPLMLLHLGYTPTLVVSSAKMGR EIMKTHDVVFSTRPITTAVKEFLYSGKDVAFAPLGEYWRQMRRVCVIDLLSVKRVQAFQF VREEEIANMVNKINQACLTKSDVNLTDLIAVITNNIISRVALGRSFEEKSVGAKLTKDVM EHFGVFSVGDMFPYLGWIDELTGLKRRMRKTSSEMHRFLDEVVEEHLTSKKEGSQSDKKD LVDVLLEFEKDPTLGVEFTRENLRAVILDIFVAGTDTTYSTLEWAMAELANHPVAMKKVQ EEVQKVIGNTTKVNESDTSKMDYFNCVIKETLRMHPAVVLSLPRVSTSSSVIEGYQIPDK TRVIVNLWAICRDPEVWDKPNEFIPERFMNNPIDFRGKDFEFIPFGAGRRGCPGLTFGLV SVEAILANLLYWFDWELNGGATKIDMTEAFGLAVHVYFSFFLVCKNFNV*

 

>22044326 Aquilegia coerulea|Aquca_1756_00001|Aquca_1756_00001.1

CYP71AN-LIKE

MVSIIKESCSVGSDVTVNVSELVATVVRNFIPRIALGESWGRTTKYADLPKLVAQNLGTI TFEDVLPSLKWLDVLTGLDKRIKDVAQTVEQFLDEVIDDHLKSRKGADEPGDFVDTLLAY QSDPASAIDLTRESLKTIILDMYVGGSDMLNTSSEWVMTEVFNHPSVMKKLQNEIREVVG TKSKLDESDIIRMDYLHCVIKETLRIRPTLALLVPRLSSASVTIEGYHIPANTRVYVNAW AILRDPKIWDRPEEFIPERFIDSPTDFKYNNDFGFIPFGGGRRMCPAVSFATNSLEAVIA NLFYWFDWKLPNDAKEKKLDTTECSGATLHKKYPVVLVPIAHTF*

 

>22045235 Aquilegia coerulea|Aquca_109_00018|Aquca_109_00018.1

CYP71AN-LIKE

MVREIKVTHDIAFANRPQTTAVKLSLYGCSILSIWRVGHNVREEEISIMIQKISQLSSMG ALVNVSELATTLTNDIVCRCALGRKHGNSHFGDLAGKLLKLQTAITFSDRFAWLGWMDNL IGFMGRIKKISRELDISYDHVIDEHLIHENKHDDPDYNKDFIYILLQIQKHHTNFTRENI KAIIMDMFIGETESTSSTIEWAFAELVKNPNVMRKAQEEVRRVVGKKDKVDEEDIHQMHY LKLVIKESLRLHPDVAINVLESSMVTNIRGFHVSANTRLVINNCPIQRDPKQWERPDEFI PERFSCNPVDFKGKDYKFIPFGAGREICPGISFAMTVIESAIANLLYWFDWKTLDGEELD

MTEGFRVTVTMKNRTTSCYCCISFDLNLSSTLYMYILVDSLKITCS*

 

>22045248 Aquilegia coerulea|Aquca_109_00016|Aquca_109_00016.1

CYP71AN-LIKE

MQWVKHFCHKCNGWTWKCTFTKHYLLIIPSPTFLLFPSSLLLSFLLLLVNRRSWGTEKLN LPPSPPTIPIIGNLHQIGLQLHCSIHNLSEKYGPLMFLRLRYLPNSSFCPYGEYWAQVRK ISVIELLSTKKVQSFKSVREEEISIMIQKISQLSSMGAMVNVSELATTLTNDIVCRCALG RKHGNSNFGDLAGKLLKLQTAITFSDLFAWLGWMDNLTGFMGRFKKISRELDIFYDQVID EHLIHENKHDDPDYNKDFIYILLQIQKHHTNFTRENIKAIIMVRSTIEWAFAELVKNPNV

MRKAQEEVRRVVGKKDHQMHYLKLVIKESMRLHPAVAINVLESSMVTNIRGFHVPANTRL

AINN*

 

>22030838 Aquilegia coerulea|Aquca_085_00008|Aquca_085_00008.1

CYP71BC-LIKE 57% TO CYP71BC1 Vitis vinifera

MDLYTSLYLSPLLLLFISILLLKKRNNQGNTPCNPPSPPKLPIIGNLHQLGSLPHRSLQK LSNKYGPIMLMQFGSKPTLIISSADTAREVLKTQDLNFCTRASLVGPKRLSYNFRDFAFT PYGEYWREMRRVCVLELFSSKRVQSFEFVREEEVAYLMKSISEFSSSPLNLTQKLFSLTD RITSRITFGKNNQGRDYDIGKFQEVVYEAMDMLGSFTATDFFPYFGWIIDVFTGFNNRLE KCFTAFDNLYQQVIDEHLDPERNKPEQEDIIDILLGLRTDESGATRLTISHIKGILMNIF LGGIDTSAMTIVWAMTELLRKPEAMKKVQEEIRNVVGKKGKVEASDINHLQYLKMVVKET LRLHAPAILLIPRECMNHCKINGYDIYPKTRVLVNVWAIGRSGEYWENPEDFIPERFMDN DIDFRGQDFDFLPFGSGRRGCPGINMGLATVELGLANLLYCFNWELPNGMNKEDINMDEL AGITVHKKTPLVVVPIKYV*

 

>22038801 Aquilegia coerulea|Aquca_028_00287|Aquca_028_00287.1

CYP71

MLVLKKWNNQDDKPNHPPTPPKLPIIGNLHQLGSLPHHSLRNLANKYGPVMLMHFGRKPT LIISSAEAAREVLKTYDLNFCTRPSLVGTKRLSYDFRDFAFTPYGDYWKDMRKICVVELF SSTRVQSFEFVRSEEVSDIMKSIAKSAPSPINLTEIFFSLTNNITSRVTFGKSYRGRNFD VAKFIEVVYEAMNMLASFSATDFFPYVGWIIDVLTGFNTRLEKFFNEFDGLYQQVIDEHL DPDRKKPEHEDIIDVLLGLRRNENGNTRLTISHIKGLLMNIFLGGIDTSAVTMVWVMAEL IKKPEAMKNVQEEIRNCVGKKGKVEPSDMNQLQYFRMVVKETLRLHPPGVLLLPRECMKH CKINGYDIYPKTRVLLNAWAISRSSEHWENPEEFIPERFMDSSIDFRGQNFELLPFGSGR RGCPGINMGMATIELGLANLLYCFNFELPNKQDINMDEVASITVHKKIPLVVVPTKYVEP

I*

 

>22038629 Aquilegia coerulea|Aquca_028_00103|Aquca_028_00103.1

CYP71

MRQWTCLVVSLQLISFHTLGWIIDVFTGFNNRLEKCFTAFDNLNQQVIDEHLHPKRKKPE QEDIIDVLLGLRMDESGVTQLTISHIKGILMNIFLGGIDTSAMTMVWAMTELLRKPEEIR NVVGKKGKVKASDINHLQYLKMVVKETLRLHAPAILFFFLAIGRSGEYWENPEDFIIPER FMDNDIDFRGQDFDFLPFGSGRRDCPGINMGIATVELGLANLLYCFNWELSKGMNKEDIN IDELVGITVHKKTPLVVVLIKYV*

 

>22039032 Aquilegia coerulea|Aquca_102_00038|Aquca_102_00038.1

CYP71 51% to CYP71AN1 cottonwood

MEHFGVFSVGDMFPYLGWIDELTGLKRRMRKTSSEMHRFLDEVVEEHLTSKKEGSQSDKK DLVDVLLEFEKDPTLGVEFTRENLRAVILDIFVAGTDTTYSTLEWAMAELANHPVAMKKV QEEVQKVIGNTTKVNESDTSKMDYFNCVIKETLRMHPAVVLSLPRVSTSSSVIEGYQIPD KTRVIVNLWAICRDPEVWDKPNEFIPERFMNNPIDFRGKDFEFIPFGAGRRGCPGLTFGL VSVEAILANLLYWFDWELNGGATKIDMTEAFGLAVYLEQPLRLVPKAHLF*

 

>22041511 Aquilegia coerulea|Aquca_077_00039|Aquca_077_00039.1

CYP71 47% TO CYP71AP1   cottonwood

MIEWVEQSLHVPLFVSVVSIFVVILLFKFSARTASKLNLPPSPSKLPIIGNLHQLGSLPH RSFRSLAKKHGPIMLLHLGQSPTLVVSSADAAKEILKTQDLNFSSRPRMNFEDKLVYSNM HIAFLPYGEYWRQVRKICVLQLCTAQRVESFKSVREEEANLMINKIHQSCSSASSSVVDL SETIATFTKDIACRVALGRKFGKDEVVGKNFEKMMSEFMYFISGFNVGDFIPWLSWVNTM TGFDARMVKNFKELDNFFDSVIEEHIEAKKRSKGGVEDFVDVLLNMEKDSSTGVTFGKPN IKAMIMRDPIRSSQTTN*

 

>22036844 Aquilegia coerulea|Aquca_006_00127|Aquca_006_00127.1

CYP71 49% TO CYP71BS1 tomato N-TERM

MQLPITWLSLVLTLVICFYKILKIGNRNRHSKLPPAPWKLPIIGHSHHLLGQLPHHSLSD LAKKHGPLMFLQLAEIPTVIVSSSKVAKEIFKTHDAVFAERPALLAAQIICYDYKCITFS

TYGVI*

 

>22041559 Aquilegia coerulea|Aquca_077_00038|Aquca_077_00038.1

CYP71 57% TO CYP71AQ1 cottonwood

MFLAGSDTTSTALVWAMTELIRHPEIMKEVQMEIREIGKENGCIKEDDLGKMHLMKLVMK ETLRLHIPGPLLIPHETMQETKLLGYDIPAKIRVLINAWAIARDPLLWEEPEEFRPKRFL NSSLDYKGNDFEYIPFGAGRRGCPGILFAIPTVELPLANLLYHFNWTTRSGAPRARDLDV TEGFGIVTYKKYPLVAIATPHFS*

 

>22063863 Aquilegia coerulea|Aquca_074_00068|Aquca_074_00068.1

CYP71AQ

MQWLYQQQAHPNFFYVILFFLFLYLAKRFNRSETNKCKLPPSPTKLPIIGNLHQLHGSLR RALKSLAENNGPIMLLHLGSKPTVVVSSAEIARDVMKTYDHVFSSRPEVKFAKRLTYGKD IAFAPYGEYWRQVRKVCVLQLLSAKKVQSFRFVREEEVALLVNKINDFSLSTSVVNLSNM FVTLANDVVCRVAFGRKYNEGEIGRKFKGMLKEFVYLLGVTNVGDFIPSLAWVNYLNGLN ARVEKNLRDIDSFIDQVVEEHIEKKRRKGVHCNGENEEEDFVDILLGTKEGDNDLEISLA RDSTKAIILDMFAAGTDTTSVFLEWAMSELIRHPSIMQEVQKEVREVVRGKLTIHDSDID EMHYLKSVIKETLRLHPPNSLLVPRESMEKVQIQGYDIPAKTTVIINAFAIGRDPKSWEE PEKFWPKRFLNGNSTSVDFKGQDFQLIPFGAGRRGCPGILFATSIIEFTLANLLNRFDWA LPDGMDGKDLDMEEEYGITVHRKNDLVLTAQQHYY*

 

>22025983 Aquilegia coerulea|Aquca_089_00030|Aquca_089_00030.1

CYP71AQ-LIKE

MFQAWLEQSFHSLFLSFLSIFFVIFLFNITRSRTSKLNLPPSPTKLPIIGNLHQLGSLPH RSLRALSRKYGPLMLLHLGQSPTLIVSSAEGAKEILKTQDLNFSDRPKMNFQDRLVHANY HLAFLPYGEYWRQVRKICVLQLVSAHRVDSFKSIRQDETDHLLNKIRQSCSSSIVNMSDL IYMYICDISCKVILGRKFDSDEGGKQFRKITEEFMYFLGNFNVGDFIPWLAWVNNFTGLN ARMDDNNKAFENFLGGVINEHIQARKTNQNDGDGVQDFVDILLSLENDGSIGVPFGQDNI NALLMDMFIATTDTTAVTFVWVMTELVRHPQIREEVQMEIRKVAKGKTSITEDDLEQMHY

MKMVIKETLRLHTTGPLLIPHQSREDTKVLGYDIPAKTKVIINAWAIAMDPTLWEKPDEF QPKRFLNTSIDFKGNDYQFLPFGAGRRICPGIAFANRTLELPLANLLYHFNWTVPEGAPV DVEETNGIAVYKKNLLLVVAIPYK*

 

>22045149 Aquilegia coerulea|Aquca_043_00114|Aquca_043_00114.1

CYP71AQ-LIKE

MFQLLSEVQSLHPISLSFLSILFVLFLFKLTRSRTGKLNLPPSPWKLPVIGNLHQLGTLP HRSLQSLARKHGPLMLLHFGQSPTLIVSSVEGAKEILKTQDLNFSDRPRMNFQDRLVYAN YHLAFSPYGEYWRQVRKVCVLQLLSQHRVNSFKSVRQEETDCMLSDIRQSISSGSPIVNL SDLIFSFTNDVTCRVTLGRKFGRDEGGKKFFKIIKEFMYFIGAFNIGDFIPSLAWINNFN GLNARMDKNFEELESFLGGVIEEHIQDRKTRKFGSEGVEDFVDVLLGMEKDGSIGVPFAK DNIKALIMDMFLAATDTAAATMTWAMTELVRHPEILKEVQREVREVAKGKTHITEDDAAQMHYMKNVIKETLRVHTPGPLLIPHQSREDTKLQGYDVPAKTRVIVNAWAISRDPTIWEEP DEFRPKRFENSSLDFKGNDFEYLPFGAGRRICPGIAFANPTMELPLANLLYHFDWTLPNG EVPDVEEGLGIVAYKKSPLRVIATPYRV*

 

>22040869 Aquilegia coerulea|Aquca_018_00231|Aquca_018_00231.1

CYP71AQ-LIKE

MFQWAEQSLNAPFFFSIVSIFLVILLFKLSNRSTTATKLNLPPSPSKLPIIGNLHQLSSL PHRSLRSLAKKHGPVMLLHLGQSPTVVVSSADAAREMFKTQDLNFSGRPRMRFQDKLDYS SMHLGFLPYGEYWRQVRKICVLQLLTAQRVESFKSVRAEETHLMIEKIRQSCSSTSCVVD LSETIASLTRDIVCRAVLGRKFDKDAVINMKFDFVSGFDIGDFIPWLSWVNIITGFDAQM

MKIFKALDEFLESVINDHIESKKNSSDGVEDFVDVLLGLGKDSTGVTFGKPNIKAIIMDM FLAGSDTVSTTIVWALTELIRHPEIMKEVQKEIREIGKENLSITEDDLGKMHYLKLVMKE TLRLHVPGPLLIPHESIQDTKLLGYDIPAKTRVLVNAWAIATDPLLWEEPNEFRPKRFLN SSLDYKGNDFEYIPFGAGRRGCPGISFAIPTMELSLANLLFHFDWTLPNGEPRPEDLDIT EGFGIVTYKKDPLVVAATPYI*

 

>22039317 Aquilegia coerulea|Aquca_070_00007|Aquca_070_00007.1

CYP71

MNQLAGLAPHRSLRDLALKYGPVMHLKLGSISTIVVSSAEVAKEIMKTHDLVFASRPKIL SAKVLGYNYTDVALTPYGAYWRQLRKICILELLNTKRVQSYRFVREEELALLVQSITSSC AEPVDLAEKLFNFNHDLTTRITFGKKSDDWFRFKGAVREGTLLAGGFHVGDFFPSLEFVS TLSGMKARIKKNFIELDSILSKVIEEHLMKDEKNEVEHEDLVDVLLRVKKNEELEDLFVG GTENATNTVEWAMSEMMKNPLIMEKAQTEVRTVVGRKPTVQESDLNELTYMKLVIKETLR LHTPLPLLIPRESMETCTINGYEIPAKTRAIINYWAIAMDPLSWKDPEKFEPERFINNSI DFKGMDFEFIPFGAGRRICPGISLGVMNIELSLAALLFHFDWKLPNSMKSEELDMDESFG LTLFKRNSLRLVPTLRFMPSSV*

 

>22039393 Aquilegia coerulea|Aquca_021_00102|Aquca_021_00102.1

CYP71

MQIQLRFPGVLTNSPLNLPPSPSKLPIIGNLHQLGTLPHRSLQSLARKHGPLMLLYLGQT PVLIVSSADAAKEVIKTQDFNFCNRPRISFAERLFCSNKDLAFSSYDERWKEIRKISVLH VFSGHRVESFRTIREEEANFMIGKIYECCSSASSTVNLSDIIFSFTNNVVCRVAMGMKFG DNEGAKKLITEFMNLIGVFNVADFIPWLSMVNNFNGLSSRVEKNAKELDCFLESVIEDHI DRKKKTKNSGDEDFVDVLLGMANDKSNRVYFARDNIKPVILDMFIAGTDTTATTLIWAMT ELMKHPEIMKEDDLGQMHYLKMVIKETLRLHSPAPLFIPHESIQDTKLLGYDIPAKTRVF INQWAIANDPMLWDELEEFRPKRFLNTSIDYQGKDFKFFPFGAGRRGCPGILFATPNMEL PLANLLYHFNCSLPNGVISKDVDVAEELGLLLRKKSPLLLVPTPCGF*

 

>22038723 Aquilegia coerulea|Aquca_028_00167|Aquca_028_00167.1

CYP71

LTRARSGKLNLPPSPWKLPIIGNLHQLGTLPHRSLQSLARKHGPLMLLHFGQSPTLIVSS VEGAKEILKTQDLNFSDRPRMNFQDRLVYANYHLAFSPYGEYWRQVRKVCVLQLLSQHRV NSFKSVRQEETDCMLNDIRQSISSGSPIVNLSDLIFSFTNDVTCRVTLGRKFGRDEGGKK FFKIIKEFMYFIGAFNIGDFIPSLAWINNFNGLNARMDKNFEELESFLGGVIEEHIQDRK TRKFGSEGVEDFVDVLLGMEKDGSIGVPFAKDNIKALIMDMFLAATDTAAATMTWAMTEL VRHPEILKEVQREVRKVAKGKTHITEDDATQMHYMKNVIKETLRVHTPGPLLIPHQSRED TKLQGYDVPAKTRVIVNAWAIARDPTIWEEPDKFRPKRFENSSLDFKGNDFEYLPFGAGR RICPGIAFANPTMELPLANLLYHFDWTLPNGEVPDVEEGLGIVA

 

>22038531 Aquilegia coerulea|Aquca_011_00458|Aquca_011_00458.1

CYP71

MFNHLFTLSLLFFFSAFVLLKLCRVVSQHKTNLMPSPPGLPIIGNFLQLGKLPHQSLRDL SRKYGDLVMLHLGYIPTVIVSSAEMAREIKKTHDVTFAGRPFTAASRMLFYGGTDLAFSP YGEYWRQLRKICVLEILSLKRVQSFKGVREEEVGLMMKNISRACSLGVPVDLSEMVVALS NNIVCRCALGKKMEGKDDDVKFGALSKEFMKLLGSFSFGDFFPGFGWMDVFTGLTRKMKR VSKELDAFLEQIIKEHHTQTKQDDGDDRHDFVDILLRVQKDNTLDITITNNNIKAVILDM FLAGIDTTSTTIEWAMAELLKNPKEMKKAQEEVRRVVGEKSVVEEEDTQHMDYIKNIIKE TLRLHPPAPLLINQSTATANVNGYDILPNTRVFINAWAIQRDPKSWDRPEEFIPERFNNN AIDFRGQDYEFLPFGSGRRGCPGLTFGIAVVEFVVANLIYSFNWELPGGANTVDLDMSEH FGITTNKRLPLNLIPVSASA*

 

>22038584 Aquilegia coerulea|Aquca_028_00018|Aquca_028_00018.1

CYP71

MELEKYQETLLAHPFTLSCLFIFSTIILLWLANRYCTEKLNLPPSPPKLPIIGNLHQLGF LLHRSFHVLSEKYGPLMLLHMGSTPTLVVSSADMAREIKVTNDIVFANRPQTTATKMLIY GCTDFAFAPYGEYWARLRKISVMELLSNKKVQSFRYVRDEEISLMIDKITTLCSVGSPVN VTELLTSLTSDIVCRCALGRKHGGQDGQTNFGDLAGKVLKLLAAFSFGDLLPWFGWIDNI TGLIGSIEKVSRDLDMFYDQIIDEHLIQNKCDDPHYNKDFVDILLQVQKDNINFTRENIK ALLIDMFVGGTETTATTIEWTIAELVKNPSVMQKVQEEVRRVVGKKHKVDEEDIAQMVYL KLVVKESMRLHPAAGINVLESSKITNVKGFQVPAKTRIIMNHWSIQRDSKFWERPDEFIP ERFSNNSLDSSGQDFNYTPFGSGRRICPGRSFALIIVESAIANLLYWFDWKTVGGEQLDM SEAFALTVKLKTPVHLVALSHLSLTTT*

 

>22038915 Aquilegia coerulea|Aquca_028_00301|Aquca_028_00301.1

CYP71

MFYQYPFLFTLLISFFTLISLKLIITGSFSEKLNLPPSPPKLPIIGNLHQLGQLLHRSLH KLSLKYGPLMYLRLGYTPVLVVSSAELIREIKTTHEISFGNRPATTAARMLFYGCVDLVF SPCGEYWRQIRKISASEMMSNKKVHSFKSVRDEEVALLTKKISTSCSVGTSVNISELVTD IVYDIMCRCALGRKLGAQDGHLKEISPNLVKLLVAFSFGDLFPWLGWMDVLTGLIGRIKK VSKELDIFFDHIIDEHLIQNKEGGPDGYNNDFVDTLLQVQMDNINFTRNNIKAIILDLFV GGTETTSSVIEWVMAELMMNPHTMQKAQEEVRRVVGKNNKVEEEDIQHMYYLKLVVMESL RLHPPVALLPMETTTITNVNSYHVPAKTNVVVNIWAIHRDPNLWERPEEFIPERFSNSPI GFNGQDFKYIPFGSGRRMCGGILFSTILLELVIANLLYWFDWRTLGDAELDMTEDYGLTV SKKLPIHLLPVSHFPSTVKTDSLKY*

 

>22038995 Aquilegia coerulea|Aquca_028_00280|Aquca_028_00280.1

CYP71

MAPILLQWLDFAKNQHTLFHHSLPFNLLFAFSISFIIFRLVHGSLFKGLNLPPSPPKLPI IGNLHQLGKLHNLHQTFHHLSQKYGPLMFLHMGKVSTLVVSSIEMVGEIKINHDIPFASR PSSTASNLLFHGRISVGFAPYGEDWRQLRKIYVMELLSKKKVESFKYVREEEAALMIEKI SFACSMGTPIDMKELVTSLTSDIVCRCTLGRKHGGEGGNCNFGEIENKVGKLLQAFCFGD LCPGLGWMDSLTGFIGSLKKVSKELDNFFDQIIDEHLIPNKNNNPTYINQSQTRADLHKF FCRIFIGGTDTTSTTIEWAMTELVKNPNVMKKAQAEVRKVVGKKNKVSDEDIHQMEYLKL VVKETLRLYPAVALNKEEEDEWGRRKKKMNGEEEDEFNHQKNNLKQNLNKLQESDFNWTA KELTCSLEEKPYLYLGLEYTENGPKLTKSILDVRTSKQRYHVPAMTTVFINNWSIHRNPK LWDRAEEFIPERFSENPIDFLGKDFKYIPFGTGRRSCPELVFAVVAVEFAIANLLYWFDW EIPPGEEIDMTETLGLTVSKEIPLRVVPTSHYFS*

 

>22054683 Aquilegia coerulea|Aquca_022_00139|Aquca_022_00139.1

CYP71

MVSMPPRNSVQQSLIILFCSLVQSVLSNPLKYHPPPKLPLIGHLHHLGALPHQSLRDLSL KYGPLMLLHLGYTPTLVVSSAKMGREIMKTHDVVFSNRPITTAVKEFLYSGKDVAFAPLG EYWRQMRRVCVNDLLSVKRVQSFEFVRDEEIANMTNKINQACLRKIDVNLTDLIVVIASN IISRVALGRTLEGKSESAKLLKEMAEQFGVFSVGDMFPSLGWIDELTGLKKRMRRTSIAM HRFLDEVVQEHLMSKKEGVQADRKDLVDLLLEFEKDYTQRVEFTRENLTVIIMDMFVAGT DTTYTTLEWAMAELANHPVAMKKVQEEVRLVIGKTTKVNESDTSKMNYFNCVIKETLRMH PPLVLSLPRVSTSSTNIEGYQISDKTRVIINLWAICRDPAVWDKPNEFIPERFMNSPTDF TGKHFEFIPFGAGRRGCPGLTFGVTSVEAILANLLYWFDWELTGGAIKIDMTEAFGISVN LKQPLLLAPKAHVF*

 

>22049213 Aquilegia coerulea|Aquca_003_00194|Aquca_003_00194.1

CYP71 47% TO CYP71AN1 cottonwood

MPLSQAVLQWFEKHQHETLLQHSLSVPLLLFCSIVFLLWINRGSRSEKSLNLPPSPPKLP IIGHLLYLGKLPHRSFLALSEKYGPIMLLYFGPTPALIVSSAEICKQIMKTHDTIFANRP TSSASKAFVGGDLDVGFAPYGEYWREIRKIFVTDLLTAKRRESFKFVREEEIGKMVSIIK QSCLEGCDVTVDVSELVATVVRNFIPRIALGESWGRTAKYADLPKLVAENLGTITFEDVL PSLKWLDVLTGLDKRIKDVAKTVHQFLDEVIDDHLSSRKGDDEPRDFVDTLLAYQRDPAS AIELTRESLKTIVLDMYVGGIDMLNTSFEWVMTEVFNHPNVMKKLQKEIREVVGTKSKVD ENDITRMDYLHCVIKETLRVHPTLALLIPRLSSASTTIEGYHIPAKTRVYINAWAISRDP KIWDRPEEFIPERFIDNPIDFKSQEFEFTPFGGGRRMCPAVSFATNSLEAVIANLFYWFD WKLPNDAKDMKLDTTEASGATLHKKYPVLLAPIAHTF*

 

>22060611 Aquilegia coerulea|Aquca_056_00070|Aquca_056_00070.1

CYP71 52% TO CYP71AQ1 cottonwood

MTLANAFLLYPFFFLFFVYLVIKFNKPKYKNLPPSPSKLPFIGNLHQVQGSPHHIFRALA QKHGPLMLLQLGNVQTLVVSSADLAQDVMKTYDHVFSSRPVLTFPKRLSYDKDIAFAPYG DYWRQVRKVCSIQLLNAKRVHSFRSLREEEIDLVMQKIEEAAFKNVEVNLSLLSISFTND NVCRVALGRKYNEGERGKKFKSIMKEFTFLLGVPNIGDLIPSLAWVNYLNGLNARLEKNF NDIDSFLDEVIEEHIEKKKVMIDDNDGCENEEDFVDVMLRIEKDCTLGFPFARDSTKAII LDMFAAGTDTSSVSLDWAMSELLREPEIMEEVQKEVRAIAGGKLLLKDHDIEEMHYLKAV IKETIRLHPPLPLLVPRESMEYINLHGYDIPAKTRVMINAYAIARDPLSWEEPEKFWPKR FLQDGSSASVDFKGCDFQFIPFGAGRRGCPGMTFAMSVVELALANLLNRFNWSLPKGMDA KYLNMEEGAGITAYRKNELVLIAKPHY*

 

>22054168 Aquilegia coerulea|Aquca_080_00013|Aquca_080_00013.1

CYP71 45% TO CYP71BE1 Vitis vinifera

MVITQKIVSLTVDIIARAAFGKTCEEKDAFISVVENIVRLTGGFYIADLFPSLTFLETIK

MTHQRMDIAREHKKKGTKTEMTIEGEVQEDLVDVLLRIHEGEELEVPITMDTIKAVTFVR TDTSSTTLEWTFAELLRNPRIMEKAQAEVRKIFRGKATIDQADIDKLDYLRLVIKESLRL HPPPPLLVPRECSKTCEIDGYEIPKGSKVMVNVWVMGRDPENWKDPESFLPKRGPLNLAC QPKTKNFKYIPFGAGRRACPGILFGIANIELPLALRGPCSHDDMIWTLRWQSFGPCLCKP SGPILVSLQTMKI*

 

>22043092 Aquilegia coerulea|Aquca_001_00153|Aquca_001_00153.1

CYP71

MVPSCFFISDMFLAATDTAAATMTWAMTELVRHPEILKEVQREVREVAKGKTTITEHDAA QMHYMKNVIKETLRVHTPGPLLIPHQSREDTKLQGYDVPAKTRVIVNAWAIARDPTIWEE PDKFRPKRFENSSLDFKGNDFEYLPFGAGRRICPGIAFANPTMELPLANLLYHFDWTLPN GEVPNVEEGLGIVAYKKSPLRVTATPYRV*

 

>22038613 Aquilegia coerulea|Aquca_028_00284|Aquca_028_00284.1

CYP71 58% to CYP71AS1 Citrus sinensis

MNQLQYFRMVVKETLRLHPPGVLLLPRECMKHCKINGYDIYPKTRVLLNAWAISRSSEHW ENPEEFIPERFMDSSIDFRGQNFELLPFGSGRRGCPGINMGMATIELGLANLLYCFNFEL PNKQDINMDEVASITVHKKIPLVVVPTKYVEPI*

 

>22060616 Aquilegia coerulea|Aquca_056_00018|Aquca_056_00018.1

CYP71 53% TO CYP71AQ1 cottonwood

MFSAGTDTSSVVLEWAVSELIRHPKIMEEVQKEVRGIARGKLMITETDLDEMHYLKSVIK ETLRLHPPVPLLVPRESMEKVQIQGYDIPAKTTVLINAFVIGRDPKLWDEPEKFWPKRFL NGGSVSVDFKGQDFQLIPFGSGRRGCPGILFATSIIELTLANLLNRFDWAAPEGMDGKDL NMEEESGITVHRKNDLVLSSKQHYRVV*

 

>22042702 Aquilegia coerulea|Aquca_133_00005|Aquca_133_00005.1

CYP71 48% to CYP71AN1 cottonwood

MDVAFCPYGEYWEQVRKISVIELLSTKKVQSFKSVREEEISIMIQKISQLSSMGALVNVS ELATTLTNDIVCRCALGRKHGNSNFGDLAGKLLKLQTTITFSDLFAWLGWMDNLTGFMGR IKKISRELDISYDQVIDGHLIHENKHDDPDYNKGFIYILLQIQKHHTNFTQENIKAIIM (0?)

DMFIGETESTSSTIEWAFAELVKNPNVMRKA*

 

>22036962 Aquilegia coerulea|Aquca_006_00185|Aquca_006_00185.1

CYP71 57% TO CYP71AQ1 cottonwood

MFLAGSDTTSTALVWAMTELIRHPEIMKEVQMEIREIGKENGCIKEDDLGKMHLMKLVMK ETLRLHIPGPLLIPHETMQETKLLGYDIPAKIRVLINAWAIARDPLLWEEPEEFRPKRFL NSSLDYKGNDFEYIPFGAGRRGCPGILFAIPTVELPLANLLYHFNWTTRSGAPRARDLDV TEGFGIVTYKKYPLVAIATPHFS*

 

>22060678 Aquilegia coerulea|Aquca_056_00088|Aquca_056_00088.1

CYP71 49% TO CYP71BS1   tomato N-TERM

MQLPITWLSLVLTLVICFYKILKIGNRNRHSKLPPAPWKLPIIGHSHHLLGQLPHHSLSD LAKKHGPLMFLQLAEIPTVIVSSSKVAKEIFKTHDAVFAERPALLAAQIICYDYKCITFS

TYGVI*

 

>22039048 Aquilegia coerulea|Aquca_102_00043|Aquca_102_00043.1

CYP72A

MPMKMTKYFKDQGINGPPYKLFYGNLEEIVSLMIKARSKPMELSHRTVPRLLSFENQAIK NYGKMFVSWIGPTPRVNIMDPDMIRDILSNKFGHFSKVKRSNPLGNLLNLGLVAYEGEKW VKHRRIINPAFHQEKLKRMSPTFCACTSDFVSNLEKIVSKGPCEVDVWPHIQHLTSDIIS RAAFGTTYEEGRRIFELQTEMAELTMQLARSIYIPGFRFFPTKRNTRMKEIYREVRRLVR DKINQREKAMKIGEVMTNDDLLGLLMESNMKEIKDNKLAMNIDEVIEECKLFYIAGQETT STLLVWTMISLSMHPEWQQKAREEVSHVFGNKKPDFDGLSNLKIVTMIFNEVLRLYPPVG LLTRVPCKTMKLGDVYLPPDVELGLPVLLIHHDRDLWGDDADEFNPERFSEGISKATKGR LAYFPFSTGPRICVGYGFALVEAKMALAMILQNFAFELSPTYAHAPYTIITIQPQHGAQL

ILRKV*

 

>22023537 Aquilegia coerulea|Aquca_005_00591|Aquca_005_00591.1

CYP72A

MREIITVFFVAILVILCVAWKTFCWIWLNPKLIEKYLREQGIQGHSYKFLYGNAKEMATS AKAAISKPMNLSNQIAPYVLPFYHQTVQKFGKLSLTWVGTTPRVIIMDPDMIKDILSTKF GHFERARRNPLASFLVNGLASYEGEKWVKHRRILNPAFHLKKLKMMMPAFYTSCSEMIIK WQNMVSAESSELDVWPDLQNLTADVISRTAFGSSYEEGRQVFQLQTEQSDLIINAFKSVY IPGFRFLPTERNRRMKEIRREVHTLVKDIIKRREKAMKTGEVWNNDLLGLLMESNFKETK DNDNSKNAGISIDEVVEECKLFYLAGQETTSTLLVWTMILLSKHQDWQEKAREEVLRVFG KKPPDFDGLNHLKIVTMILYEVLRLYPPVVLLLRTTCKKLKLGEVCLPSGVQVAMPTLLV HHDKDFWGENAEEFCPNRFSGGLSKATKNQASFLPFSLGPRICIGQSFALTEAKMAITMI LQHFFFQLSPTYVHAPQYVITLQPQHGAQLNLYRL*

 

>22062537 Aquilegia coerulea|Aquca_016_00004|Aquca_016_00004.1

CYP72A

MMMRKARSKPMDLSHRITPRLLPFEDQAVKTYGKMFVSWIGPTPRVNIMDPEIIREILSN KFGHFAKIRANPLVGLLAKGLVNYDGEKWVKHRRIINPAFHQEKLKMMLPAFYACCSELV EKWEKLVSLEPCEVDVWPYLQNLTADVISRTAFGSSYEEGRRIFELQMEQAKFVIEAARS IYIPGFRFVPTRKNRRMNEIYREVCSLLKVMIEKREKAMKLGEARTDDLLGILMESNYKE IKEGGNAKNLGLSIDEVMEECKLFYFAGQETTSTLLVWTMIVLSMHPEWQVKAREEVHQV FGREKPDFEGLNHLKVVTMILNEVLRLYPPGLMLTRVTYKEMELGNVRLPPQVELAMPIL LVHHDRELWGEDAEEFNPERFSEGISKATKNQVSFFPFGWGPRICIGQAFALTEAKMALA

MILQNFSFELSPTYTHAPFTIVTLQPQYGAQLILHKL*

 

>22062634 Aquilegia coerulea|Aquca_016_00009|Aquca_016_00009.1

CYP72A

MEKVVWVVTVSSAVLAIFLTWNVFCWIWLNPKKLDKYLRKKGVKGPSYRFLHGNLKELVS LTKKAQSRPMERSHRIVQRVLPFHDQFAESYGRMFTTWYGPTLKLNIMKPELLKEIFMNK SGHFVKPRSNPLSKLLVSGLVIYEGKKWAKHRRILNPAFHPEKLKMMSPAFYTTCSNLIS KWQNLDFSEGSCELDVWPDLQNITKDVISRTAFGSSYEEGRRIFQLIDELGTLVFQDLVS LNIPGFRFLPTKRNNRMKKIGREVRNLLRDIVKKREMAINMGEAPKNDLLGVLMESNHNE

MKDDMNSKRVGMTIDEIIDECRLFYFAGQESTSTLLVWTMIVLSMHQDWQEKAREEVMKV FGSSKPDFDGLNQLKIVTMILHEVLRLYPPTPFISRANDKEINLGDVTVPEGVQLALPIL LIHHSRELWGEDAEEFKPERFARGVSEATKNQVSYFPFGWGPRICAGQTFVFVEAKMALS

MILQQFSFELSSTYIHAPYSILTIKPQYGAQLILHKL*

 

>22062676 Aquilegia coerulea|Aquca_016_00002|Aquca_016_00002.1

CYP72A

LKTVYWLWLKPMKMKKYLKKQGIDGPSYKFFYGNLKESEMMKMKARSKPMELSHCIVPRL LPFQNQAVKTYGKMFVSWNGPTPRVNIMDPTLIKEILSTKFCDYTRAKSNPLVQLLAKGV VSYEGDKWVKHRRILNQAFHQEKLKMMLPAFYTCCSELIEEWEKLVSKKTCEVDVWPYLQ NLAADVISRTAFGSSYEEGRRIFELQTEQMQLALETSRSVYIPGFRYVPTKRNQRMKEIY NEVCNLLRVMIKKREQAMKSGEASSDDLLGILMESNFKEQKDDGNSRKTVCMTIDEVVEE CKLFYFAGQETTSTLLVWTMIVLCMNPEWQEKAREEVMRVFGQKTPDFECLNHLKVVTMI FNEVLRLYPPVVMLIRATYKTIELGNIRLPPDVELVLPILLVHHDRELWGEDAEEFNPER FSEGVSKATNNQVSFFPFSWGPKICIGQNFALVEAKMALAMILQKFSFELSPTYAHSPCT FIILQPQYGAPLVLRKL*

 

>22062757 Aquilegia coerulea|Aquca_016_00003|Aquca_016_00003.1

CYP72A

MEVVVLGLFVVFSVLIASWALKTVYLLWLKPMKMKKYLKKQGIDGPSYKLFNGNFKELVM

MRIEARSKPMELSHRIVPRLLPFEDQSVKTYGKMFVSWIGSTPRVNIMDPEMIRDILSNK FGHFAKVKSNPLGELLAKGVVSYQGEKWVKHRRIINPAFHQEKLKVMLPAFYACCSELIE KWEKLISDESCEVDVWPYLQNLTADVISRTAFGSSYEEGRRIFELQTEQAKLVVESGRSI YIPGFRFVPTKRNRRMKEIFREVSTLLREMINNREKAMKFGKASADDLLGILMESNLKEV KDGSNAKNFGMSIDEIIEECKLFYFAGQETTSTLLVWTMIVLSMHPEWQVKAREEVIEVF GRKKPDFEGLNHLKVVTMILNEVLRLYPPVIMLTRVTYKTIELGNIRLPPDVELALPILL VQHDPELWGKDAEEFNPERFSEGVSKATKNQVSFLPFSYGPRFCIGQNFALVEAKMALAM ILQKFSFELSPTYTHAPSTVLILQPQHGAPLILHKL*

 

>22062808 Aquilegia coerulea|Aquca_016_00007|Aquca_016_00007.1

CYP72A

MHGYIYETAIVICECGNMFRTCQFYSSENKMEKVVWVVTVSSAVLAIFLTWNVFCWIWLN PKKLEKYLRKKGVKGPSYRFLHGNLKELVSLTKKAQSRPMERSHRIVQRVLPFHDQFAES YGRMFTTWYGPTLKLNIMKPELLKEIFMNKSGHFLKPRSNPLSKLLVSGLVIYEGKKWAK HRRILNPAFHPEKLKMMSPAFYTTCSNLISKWQNLDFSEGSCELDVWPDLQNITKDVIAR TAFGSSYEEGRRIFQLIDELGTLVFQVAVSLNIPGFRFLPTKRNNRMKKIGREVRNLLRD IVKKREMAINMGEAPKNDLLGVLMESNHNEMKDDMNSKRVGMTIDEIIDECRLFYFAGQE STSTLLVWTMIVLSMHQDWQEKAREEVMKVFGSSKPDFDGLNQLKIVTMILHEVLRLYPP TPFISRANDKEINLGDVTVPEGVQLALPILLIHHSRELWGEDAEEFKPERFARGVSEATK NQVSYFPFGWGPRICAGQTFVFVEAKMVLSMILQQFSFELSSTYIHAPYSILTLKPQYGA

QLILHKL*

 

>22062908 Aquilegia coerulea|Aquca_016_00005|Aquca_016_00005.1

CYP72A

MGLLILVGICVVLVISCVWKVLNWVWLKPKKLEKCLRQQGISGRPYKFLQGNVKDLASMM

MEARSKPMELSHRIAARVIPFTNQGVEKYGKITFDWRGPKVRVNIMDPELIREVFSNKYH GFSKTKVNPYLKLIVTGLVSHDGDTWVKHRRIINPAFHIEKLKLMLPAFHTCCSELVSKW QKLVSGASCELDVWPEFQKLTADVISRAAFGNSYEQGGRIFQLQIQLAGLIMQAMQSVYI PGISWYLPTKQNNKRMKIEGEIQSLLTDMIKKREEAMKIGESCDNDLLGLLLESNLKEKN SKNVGMSINEVIDECKLFYFAGQETTSTLLVWTMIVLSMHLDWQDKARQEVLHLFGKDKP EFEGLNQLKTVTMILYEVLRLYPPVVVVTRTANRNVKIGEIYIPSGVEIGLPTLLLHHSH ELWGEDADKFNPERFSEGISKATKNQVTFMPFGGGPRICIGQTFALLEAKMALVMILQNF SFQLSPTYIHAPCVVLTLQPQHGAQLILQKI*

 

>22030940 Aquilegia coerulea|Aquca_076_00098|Aquca_076_00098.1

CYP72A

MEVLVFITLMVSSSLLLWFALKVFHSLWWKPKSLEKQLKQQGIKGTSYKFLFGDLKDYAR LFKEASSKPMNLTHHIAPRVVPFIHETVKTYGKHSLFWYGTMPTLVIVDPEMIKEVFSNK LGDIQKAPDNPNIKTISQGLSTMEGDKWTKQRKLITPAFHLEKLKGMTPAFITSCTDLIE RWKKSVAPNGSCEMDVWPDIQTFTGDVISRTAFGSNFEEGKKIFELQKEQTVLVMEALQS LYLPGFRFIPTKKNKRRAILNKEINSQLSELIQRKLLGMNHGELGADDLLDMLLQYSNHS SLHAESSDSNNGKMTIDEVIEECKLFYFAGQETSSNWLTWTMIVLAMNPTWQEKAREEVL QICGKSVPSFENLSHFKIVTMILNEMLRLYPPAVSQYRYTVKTTEIGNISIPAGVQLMLP TLVIHHDQEVWGKDAQEFKPERFSEGISKASNKDEGVTFFPFGWGPRICLAHNFAMIEAK

MALAMILQHFSFQLSPLYVHAPHTVITLQPQHGAQIILHGL*

 

>22030961 Aquilegia coerulea|Aquca_076_00112|Aquca_076_00112.1

CYP72A

MEGLLLITSMVFSALLLSLALKVFHSLWLKPKSLEKQLKQQGIKGTSYKFLYGDLKDYAR LFKEASSKPMNLTHHIVPRVMPFINETVKTYGKISLFWLGTKPTLIVVDPEMMKEVLSYK LGHIEKSPRNPQAKVLTMGLSTMEGEKWVKQRKVVSTPFHQEKLKRMAPAFLASCIELIE RWKKSVSPKGSCELDVWPDIQNFTADVISRTAFGSKFDEGKRIFELQREQIILFVEAGQS VYLPGFRFLPTKKNKRRIYLDKEIKENLNDLIQRKLSAMRTGEWGADDLLGMLLQYCNQS PFQDDVSNLKNKRMTIDEVIEECKLFYLAGQETSSTLLTWSMILLAMHPSWQEKAREEVL LICGRRMPSSEDLTHFKIVTMILYEVLRLYPPAVRQSRYTVKKTKIGDITVPAGVQLLLP TLLIHHDHDIWGGRRRRIQTREIFRRNFKGVKRSSRILCIRMGTKDLSGPELCHDRGKDG VGYDSAKLFPSAFTLICPRSSHCYHSSTTTWSSNHFP

 

>22031082 Aquilegia coerulea|Aquca_076_00090|Aquca_076_00090.1

CYP72A

VIISSSLLLWVAVKVFYSLWWKPKSLEKQLKQQGIKGTSYKVLHGDLKDYGRMFKEAWSK PLNLTHSIVPYVIPFFNQIVQTHGKISLFWLGTTPTVIIKDPELMKDVLSNKTIIKPAFH LEKLKGMMPAFSTSCNMLIEKWEKLVSPEGSYELDVWPDIQNFTSDVISRTAFGSNYEEG KTIFELQKEQAVLVLEAFKSVLAPIIYGFLPTKKNKRRMNLDKEIKANLRDLIERKVLAM RNGESGDDELIGMLLQSTNQNDLQAVIEECKLFYFAGQETSATWLTWTMIVLAMHPSWQE KAREEVLHICGKNMPRFENLNNLKIFLFRVSQFSLQALKNLSFPAGVHLILPTLLIHHDP KVWGDDAEEFKPERFSEGISKASKDQVAFFPFGWGARICLGQNFAMIEAKMALAMILQRF TFHLSPSYAHAPYTVITLQPRHGAQIILHRL*

 

>22031127 Aquilegia coerulea|Aquca_076_00096|Aquca_076_00096.1

CYP72A

MNGFLFIALVVSSCLLLRFSVKTFHSLWWKPKRLEKRLKKLGIKGTSYRFLFGDLKDYAR LMDATSYKPLSLNHHISPRVSPFITEAVKTFGKIPLFWFATRPTLIITDPGLVKEVLSGK KLVTPAFHLRKLKAMTPAFLASCTDLIEQWKKFVAPDGSCELDVWPEIQNLTADVISRTA FGSNFEEGKRVFELQKQQMALVMEAVRSVYLPGFRFIPTTKNRRRMYLDKEIKANLRDLV QRKLSAMENGESGADDLLGMLLLNCKQSPLSTDTIDPENDGMTIEEVIEECKLFYFAGQD TTSNLLTKAREEVQQICGKNVPSLENLNHLKIVTMILYEVLRLYPAAVNQWRYIVKETEI GNISLPAGVQLLLSVLLVQRDLEVWGNDAEEFRPDRFSEGIAKAAKDQVAFFAFGWGPRS CLGQNFAMIEARMAMAMILQHFSFELSPSYIHAPHIVITLKPQHGAQIILHAL*

 

>22041785 Aquilegia coerulea|Aquca_015_00205|Aquca_015_00205.1

CYP72A

MEESLFIKLLISLIVLLLLVVVVKTLYSLVWVPKRLDKHIKQQGVKGNSYKFLYGDMKQY VKLMKDAWAKPMNLTHHIAPRVVPFVNNAVQLYGRVSLIWTGKTPRLIILVPELMQEILA DKYGHFQKPPVNALILILTRGLASLEGEKWAKHRKIINPAFQMEKLKGMVPAISTSCYEL VQHWNTLVGAQGFCEVDIWSEFENLTGDIISRTAFGSSFKEGKRIFQLQKEQATLVIEAM LTFYIPGFRFIPTKKNQRRKHLDKEIKSMLRDLIHRKECVMKTEESSSDDLLSLLLQSNH QTKLEDDVSKGLTIDEVIEECKQFYFAGQETTSSLLTWAMVVLAMHRSWQEKAREEVMRV CGENPPNYESINHLKIVTMVLYEVLRLYPPVVEIYRHTYKATKVSNISLPPGVDLTLPIL LIHHDQELWGNDAEDFKPERFAEGVLNASKNNRLAFFPFGWEAKIALATILQHFSFELSP FYTHAPYTVITLQPQHGAQIILHQL*

 

>22044845 Aquilegia coerulea|Aquca_049_00003|Aquca_049_00003.1

CYP72A

MREILLALVFVAAVLLIPWAWKAFSWIWLKPKKLEKCLREQGLKGSSYKFLFGDIKEMID SVKAARTKPMDHSHQIVPRVMPFLHDKVQKYGKTHFTWFGPNPRVNITDPDMIRDILSNK FGHFEKVGSTSLERKLVTGLVGYEGEKWAKHRRIINPAFHLEKLKMMLPAFHTSCHEMVE KWQKLVANESCELDVWPELQNLAADVISRTAFSSSFEEGRRIFQLQSEMATHVMQSSQFM FVPGYRFLPTKKNRRMKEIIQEMRSLLRNMILRREKVMKAGRLQNNDLLGLLLESNFKEM SGNTRNAGITMDEVIDECKLFYLAGQETSATLLVWTMICLSMHQDWQEKAREEVSQVFGS QSPDFEGLNHLNIVPMILNEVLRLYSPAVGLGIRVTYKEMKLGKLVLPPGVQLSMPALFV HHDFELWGEDADKFNPGRFAEGISKATKNKVSFFPFSWGPRICIGQNFALIEAKMAISMI LQHFSFELSPTYVHAPYTVLTLNPQHGAQLILHRV*

 

>22044976 Aquilegia coerulea|Aquca_043_00123|Aquca_043_00123.1

CYP72A

MEEVVLGLVIIFSGLVLTWIWRVLNWIWLEPMKMEKCLRKQGITGLPYKLLYGNMKEISN LRTKVRSKPMEYSHRIVPRILPFINQTIPTYGKTFVSWYGPSPRVSIMDPELIKDILSDK SGTFGKIKQIPILKFLFDGLANHEGEKWVKHRKIINPAFHQEKLKMMLPAFYLSSSDLIS KWEKMVYGGSCEIDVWPDLQNLTADVISRTAFGSSYEEGRRIFQLQTEQAGHVMHMFRFM LIPGYRFLPTKRNRRMKEIHTEIQMLLRNLIKNRENTMKLGEASKDDLLGIMLESNMKEI KAGGSKNVGMSIDDVIEECKLFYFAGQETTSTMLVWTMILLSMHPEWKEKAREEVMQVFK KNKPDYEGLLQLKIVTMIFYEVLRLYPPVVMLLRATYKWTNLGNMELPPGVEISLPTLLI SHDRELWGEDAEEFNPERFSEGISKATKNKVTFFPFGWGPRICIGQTFAIIEAKMALAMI LQNFSFELSKAYVHAPYTVLTLQPQYGAQLIISKLD*

 

>22045084 Aquilegia coerulea|Aquca_043_00126|Aquca_043_00126.1

CYP72A

MVSVLFSLLVVFSVLVCSCAWAVLNWIWLKPMKAEKFLREQGIRGPPYRLGHGNTKEIAT LMEKELSKPMELSNRIVPRLLPFVQQMAELYGKTFVYWEGPTPTVATLDPELLRDIFNNK FGNIEKKRANPLVDLVAEGVERYEGEKWVKHRKIINPAFHIKKLKMMVPAFHACSSEMIS KWQKLVTEDSKEIDVWPDIQNLAADGLSRTAFGSSYEEGRRIFQLQTEQIHLIIESAQSV YIPGLRFLPTKINKRMKETHKEVGTILREMIIKREKALKLGEESKDDLLDILLESNFEEI KHGGNAKNAGMTINEVIEECKLFYLAGQETSSTLLVWTMVLLTMHPKWQEKARAEVLEVF GKRNPDFEGLNQLKIVTMILYEVLRLYPPIPSLARITNKKIKVGEVSLPPGTQIVLPTLL VHHDPELWGEDADEFKPERFFEGIAKATSNRTSFFPFGWGPRICVGQTFALIEVKVALAM ILQNFSFELSPTYTHAPYTIATIQPQYGAQFILHNL*

 

>22054421 Aquilegia coerulea|Aquca_086_00026|Aquca_086_00026.1

CYP72A

MREILLALVLVAALLLIPWAWKAFSWIWLKPKKLEKCLREQGLKGTSYKFLFGDIKEMMD SVKAARTKPMDRSHQIVPRVMPFLHDKVQKYGKTHFTWFGPNPRVNITDPDMIRDILSNK FGHFEKVATPLERKLVTGLVGYEGEKWAKHRRIINPAFHLEKLKMMLPAFHISCHEMVEK WQKLVANESCELDVWPELRNLAADVISRTAFSSSFEEGRRIFQLQNEMATHLMQSSRFMF VPGYRFLLTKKNRRMNEISQEMRSLLLNMILRREKVMKAGRLQNNDLLGLLLESNFKEMS GNTRNAGITIDEVIDECKLFYIAGQETSATLLVWTMICLSMHQDWQEKAREEVSQIFGSQ SPDFEGLNHLKIVPMILNEVLRLYSPAVGLAIRVTYKEMKLGKLVLPPGVQLSMPALLVH HDCELWGEDADKFNPARFAEGISKATKNKVSFFPFSWGPRICIGQNFALIEAKMAISMIL QHFSFELSPTYVHAPYTVLTLNPQHGAQLILHRV*

 

>22054427 Aquilegia coerulea|Aquca_086_00033|Aquca_086_00033.1

CYP72A

MTDILLALVVIATLLLFPWTWKAFSWIWLKPKKLEKCLRDQGLRGSSYKFLFGDIKEMID SIKATRTKPTELTHQIVPHVMPFDHDKVQRYGKTHFTWFGPIPRVNIMEPDMIRDILSNI GHIEKIRFSHIEKKLVIGLFSYEGEKWVKHRRIINPAFHLKKLKMMLPAIHTSCREMVEK WQALVADESCELNVWPDLQNLSADIISRTAFSSNFEEGRRIFQLQTEMTVQLLQDSHLFM FVPGYRFLPTKQNRRIEEISTEMESLLRNMILEREKVMHMNAVKNNDLLGLLMESNFKEM FGNTNNVGITIDEVINECKLFYLAGQETSATLFVWTLICLSMHQDWQEKARQEVLQVFGG QSPDFEGLNHLKIVPMILNEVLRLYPPVITLPVRVTNKEMKLGKLVLPPGVQISIPPLLV QHDHDLWGEDAEKFNPARFAEGISKATKNKVSFFPFSWGPKICIGQNFALIEAKMAISMI LQHFSFELSPTYVHAPHTILTLKPQYGAQLILHKL*

 

>22054429 Aquilegia coerulea|Aquca_086_00023|Aquca_086_00023.1

CYP72A

MREILLALVLVAAILLIPWAWKAFSWIWLKPKKLEKCLREQGLKGTSYKFLFGDIKEMMD SVKAARTKPMDRSHQIVPRVMPFLHDKVQKYGKTHFTWFGPNPRVNITDPDMIRDILSNK FGHFEKVASTPLERKLVTGLVGYEGEKWAKHRRIINPAFHLEKLKMMLPAFHISCHEMVE KWQKLVANESCELDVWPELHNLAADVISRMAFSSSFEEGRKIFQLQSEMATHLMQSSRFM FAPGYRFLPTKKNRKMKEISQEMGSLLQNMILRREKVMKAGRLQNNDLLALLLESNFKEM SGKTRNAGITIDEVIDECKLFYLAGQETSATLLVWTMICLSMHQDWQEKAREEVSQIFGS QSPDFEGLNHLKVVPMIINEVLRLYSPVVGLGIRVTYKEMKLGKLVLPPGVQLSIPALLV HHDCELWGEDADKFNPDRFAEGISKATKNKVSFFPFSWGPRICIGQNFALIEAKMAISMI LQHFSFELSPTYVHAPYTVLTLNPQHGAQLILHRV*

 

>22054401 Aquilegia coerulea|Aquca_086_00045|Aquca_086_00045.1

CYP72A

MVGILSVFLAISAILVISWGWRAFNWVWLKPKKTEKYLREQGIKGYSYKFMYGSTKEMVK TTKEGRSKPMELSHQIVPRVMPYVNATVEKFGKVSFMWFGPTPRLTITDPDMIKDILSNK FGHFGKSKLTPVGRLLVTGLVSYEGQQWVKHRRLINPAFHLEKLKMMLPAFHISCTEIVN KWKKLVSTESCELDVWPDIQNLTADVISRTAFGSSYEEGRRIFQLQTEQAELLKQAFQSI HIPGHRFLPTKRNRRMKEIHRIVRTLLRDIVNKREKAMKTGDEVQNDDLLGLLMESSLKE IKDNGNSKNVGLSIDEVIEECKLFYFAGQETTSTLLVWTMIVLSMHPDWQEKAREEVLQV FGNRSPDFDGLNHLKIVSMILHEVLRLYPSVTMVVRATYKTMKLGEVVLPPGVQIAMPLL LLHHDHELWGKDAEEFNPDRFSEGVSKATKNQVSYFPFGWGPRICIGQNFALMEAKMAIA LILQNFSFELSSTYVHAPFTVITLQPQYGAQLILHKV*

 

>22037501 Aquilegia coerulea|Aquca_012_00077|Aquca_012_00077.1

CYP72A

MGEILPVMLAISAVILVSLAWKAFNWVWLKPKKFEKYLRQQGLRGPSYKFLFGNLLEMVS ATNEATSKPIEFSHQIVPRVLPFLHYSIQKYGKMSFTWSGPYPIVNIMDPDIIRDILSGK YDHCEKDGLPPLFNPLVTGIVTYNGEKWVKHRRIINPAFHVEKLKMMLPAFQTCCCEMVE KWQKLGPEELCELDVWSHLQDLTADVISRTAFSSSFEEGRRIFKLQKELANLIMRAAPFM FIPGFRFLPSKGNKRMREINSEIRLVLRNMIHDREKAMSAGEGCSKDLLGLLMESNLKET IDTGNSKNVGISIDEVIDECKLFYFAGQETTGNLLVWTMILLSTQQDWQEKAREEVMNVF GRRKPDFDGLNHLKIVSMILNEVLRLYPPAYTIADRVSSKEMQVGEHTLPPGTLLGMRTL LVHHDRDLWGEDADEFNPSRFSEGVTKATNNKVSFIPFGWGTRVCVGQTFALNEAKMAIS

MILQHFSFDISPTYVHAPYAVLTLQPQHGAQLILHKLSL*

 

>22054426 Aquilegia coerulea|Aquca_086_00014|Aquca_086_00014.1

CYP72A

MEEVVLGLVIIFSGLVLTWIWRVLNWIWLEPMKMEKCLRKQGITGLPYKLLYGNMKEISS LRTKVRSKPMEHSHRIVPRILPFINQTIQTYGKTFVSWYGPSPRVSIMDPELIKDILSDK SGTFGKIKQIPILKFLFDGLANHEGEKWVKHRKIINPAFHQEKLKMMLPAFYLSSSDLIS KWEKKELTADVLSRTALWFLPTKRNRRMKEIHTEIQMLLRNLIKNRENTMKLGEASKDDL LGIMLESNMKEIKAGGSKNVGMSIDDVIEECKLFYFAGQETTSTMLVWTMILLSMHPEWK EKAREEVMQVFKKNKPDYEGLLQLKIVTMIFYEVLRLYPPVVMLLRATYKWTNLGNMELP PGVEISLPTLLISHDRELWGEDAEEFNPERFSEGISKATKNKVTFFPFGWGPRICIGQTF AIIEAKMALAMILQNFSFELSKAYVHAPYTVLTLQPQYGAQLIISKLD*

 

>22054433 Aquilegia coerulea|Aquca_086_00015|Aquca_086_00015.1

CYP72A

MEEVVLSLVIVFSSLVFTLVYRVLNWVWLEPRKLEKHLRKQGIPGPPYKMLQGNMKEIAS LLLKVRSNPMEHSHRIVRRILPYIHQTVENYGKTFVIWYGPSPRLTIMDPKLIRDILSDK SGQFGKVKQGPIFKYLFDGLVNYEGEKWIKHRKIINPAFHQEKLKMMLPEFYSSCSELIG KWQTMVSDGSCEIDVWPDLQNFSADVISRTAFGSSYEEGRRIFQLQTEQSELVMSMFRYL IIPGFRFLPTKKNRRMNEIYREVNKLLKDIIKKRENAIKLGEASKDDLLGMLLESNMNEI NAGGNKNVGMSIDDVIQECKLFYFAGQETTSTMIVWTMILLSMHPEWEEKAREEVLLVFG KNKPDYEGLCQLKIVTMILHEVLRLYPSVVMLLRATHKRVNLGEMDLPAGLTLSMPTLLI THDREIWGEDAEEFNPERFSEGISKATKNQVTFFPFGWGHRICIGQTFAILEAKMALAMI LQNFSFELSGRYVHAPYSVITLQPQHGAQLILTKI*

 

>22062857 Aquilegia coerulea|Aquca_016_00006|Aquca_016_00006.1

CYP72A 55% TO CYP72A7 Arabidopsis thaliana N-TERM

MIIYEVLRLYSPIAVITRAANNEVKLGEVYIPSEVEIGLPTLLLHHSHELWGEDAEEFNP ERFSDGVLKATKNQFSFIPFGGVQAKMALAMILQNFSFQLSPAYIHAPCTDLTLQPQQQH GAQLILQKFDYFVCTAETIALEQLSAKYPREPNTDR*

 

>22054390 Aquilegia coerulea|Aquca_086_00043|Aquca_086_00043.1

CYP72A

MSEKRTIMAGILSVFLAVFAILVISCAWKALNWVWLKPKKIEKFLREQGIKGYSYKFLYG NTKELASLSTEARSKPMDLSHHIAPRIMPFVDQTVQKFGKLSLIWLGPIPRLLVMDPEMI RDILSNKFGHYGKTRTNPLGRFLVTGVISYEGEKWVKHRRIINPAFHLEKLKMMLPAINT CCNEMIDKWQKLISSESCEVNAWPDLQNLTADVISRTAFGSSYEEGRQVFKLQTEQAKHI IQSLQSIYIPGSRFLPTKRNRRMKEIYTEVRTLIRHIVNKRENALKSGEAQSDDLLGLLV ESNLKEIKNNENSKNVGIAIDEVIEECKLFYLAGQETTSTLLVWTMVVLSMHQVWQEKAR EEVLQVIGKNTPDFDGLSHLKIVTMILYEVLRLYPPVSSLLRATYKNMKLGNVLLPPGVQ LSLPTLLVHLDQELWGEDAKEFNPNRFSEGVSNATKNRVAFFPFGWGPTTCIGQNFALLE AKMAIAMILQHFSFELSSSYVHAPSIIVTVQPQHGAHLILHKL*

 

>22054392 Aquilegia coerulea|Aquca_086_00007|Aquca_086_00007.1

CYP72A

MEEVVLGLVIIFSGLVLTWIWRVLNWIWLEPMKMEKCLRKQGITGLPYKLLYGNMKEISS LRTKVRSKPMEHSHRIVPRILPFINQTIQTYGKTFVSWYGPSPRVSIMDPELIKDILSDK SGTFGKIKQIPILKFLFDGLANHEGEKWVKHRKIINPAFHQEKLKMMLPAFYLSSSDLIS KWEKMVSGGSCEIDVWPDLQNLTADVISRTAFGSSYEEGRRIFQLQTEQAGHVMHMFRFM LIPGYRFLPTKRNRRMKEIHTEIQMLLRNLIKNRENTMKLGEASKDDLLGIMLESNMKEI KAGGSKNVGMSIDDVIEECKLFYFAGQETTSTMLVWTMILLSMHPEWKEKAREEVMQVFK KNKPDYEGLLQLKIVTMIFYEVLRLYPPVVMLLRATYKWTNLGNMELPPGVEISLPTLLI SHDRELWGEDAEEFNPERFSEGISKATKNKVTFFPFGWGPRICIGQTFAIIEAKMALAMI LQNFSFELSKAYVHAPYTVLTLQPQYGAQLIISKLD*

 

>22054395 Aquilegia coerulea|Aquca_086_00008|Aquca_086_00008.1

CYP72A

MEEVVLSLVIVFSSLVFTLVYRVLNWVWLEPRKLEKHLRKQGIPGPPYKMLQGNMKEIAS LLLKVRSNPMEHSHRIVRRILPYIHQTVENYGKTFVIWYGPSPRLTIMDPKLIRDILSDK SGQFGKVKQGPIFKYLFDGLVNYEGEKWIKHRKIINPAFHQEKLKMMLPEFYSSCSELIG KWQTMVSDGSCEIDVWPDLQNFSADVISRTAFGSSYEEGRRIFQLQTEQSELVMSMFRYL IIPGFRFLPTKKNRRMNEIYREVNKLLKDIIKKRENAIKLGEASKDDLLGMLLESNMNEI NAGGNKNVGMSIDDVIQECKLFYFAGQETTSTMIVWTMILLSMHPEWEEKAREEVLLVFG KNKPDYEGLCQLKIVTMILHEVLRLYPSVVMLLRATHKRVNLGEMDLPAGLTLSMPTLLI THDREIWGEDAEEFNPERFSEGISKATKNQVTFFPFGWGHRICIGQTFAILEAKMALAMI LQNFSFELSGRYVHAPYSVITLQPQHGAQLILTKI*

 

>22054372 Aquilegia coerulea|Aquca_086_00010|Aquca_086_00010.1

CYP72A

MIKGNPLGNLLVTGISSYEGDKWAKHRKIINPAFHQEKLKMMLPAFYTSCCEMVDKWLNS IPEGSCELDVWPDLQNVSADVISRTGFGSSYEEGRQIFRLQTEQAGLVVQANQSIYIPGL RFLPTKSNKRMKEIHGEVRALLRDMIQKREKTMRAGEAPTSDLLGLLMEFNFKEIKEGGN SKVGITIDEVIEECKLFYFAGQETTATLLAWTMVALSMHQDWQQKAREEVIQVFGTNKPE YDGLNKLKVVTMILNEILRLYPPAYILMRETYKKVKLGEVILPPGVQLTLAMLLIHHNRE LWGEDADEFNPQRFSGGVSKATKNQVLFFPFGWGPRLCIGQNFSILESKIALAMILQHFS FELSSTYIHAPYTIAVLQPQYGVQLVIRKI*

 

>22054398 Aquilegia coerulea|Aquca_086_00031|Aquca_086_00031.1

CYP72A

MREILQAFVVIAILLLIQWTWKVFNWIWLKPKKLEKCLREQGLKGSSYKFLFGDIKEMID YMNAARTKPMELSHQIVPRVMPFLHDNVQKYGKTHFTWIGPNPRVNIVDPDMIRGILSSK FDHFEKRALTPLEKKLITGLASYNGEKWTNHRRIINPAFHLEKLKMMLPAFHTSCLEMVD KWHKLVANESCELDVWPELQNLATDVISRTAFSSCFEEGRRIFQLHSEMAKHIIRHLYTC HMFVPGYRFLPTKINRRMKELSREMRSILRNMILNREKVMKAGQVQNNNDLLWLLLMESN IQEMFGNTKNVGITIDEIIDECNIFFHAGQDVPSSLLVWTMICLSMHQDWQQKAREEVSQ VFGGQRPEFEGLNNLKIVPMILNEVLRLYPPAVLLQERVTYKEMQVGKFIFPPGVQLSML PLLVHHDSELWGKDAEKFNPARFAEGISKATKNEVSFLPFSWGPRICIGQNFALIEAKMV ISMILQHFTFELSPTYVHAPHLVITLNPKHGAQIILHQI*

 

>22026637 Aquilegia coerulea|Aquca_038_00187|Aquca_038_00187.1

CYP72A

MGEILPFILAISAVILVSLGWKAFNWVWLKPKKFEKYLREQGLRGPSYKFLFGDVLEMVS ATKEATSRPMEFSHQIVPRVLPFLHHSIQKYGKMSFTWSGPYPIVNIMDPDMIRDILSGK YDHCEKDGLPPHFNPLVTGIVTYNGEKWAKHRRIINPAFHVEKLKMMLPAFQTCCCEMIE KWQKLGPEELRQLDVWDHLQDLTADVISRTAFSSSFEEGRRIFQLQKELANLIMQTAQFM FIPGLRYLPTKGNRRIKEIEREMRLVLRNMIHDREKAMSAGEGCSNDLLGLLMESNLKET LDAGNSKNVGISIDEVIDECKLFYFAGQETTGNLLVWTMILLSIHKDWQEKARQEVLNVF GRRKPDFDGLNHLKIVSMILNEVLRLYPPAYIIAHRVSSKEMKVGEHTLPPGTLLGMRTL LVHHDRDLWGEDADEFNPSRFSEGVTNATNNKVSFIPFGWGTRVCIGQTFALNEAKMAIS

MILQHFSFDISPTYVHAPYTVLTLQPQHGAQLILHKL*

 

>22026668 Aquilegia coerulea|Aquca_038_00186|Aquca_038_00186.1

CYP72A

MGEILPLLFAISAIYLVSLAWKAFNWVWLKPKKLEKYLRQQGLRGPSYKFLFGDILEMVS ATKEATSRPMEFSHQIVPRVLPFLHHSIQKYGKMSFTWTGPYPIVNIMDPDMIRDILSGK YEHCEKDGLQPLFKPLVTGIVTYNGEKWAKHRRIINPAFHVEKLKMMLPAFQTCCCEMIE KWQKLSPEELSELNVWDHLQDLTADVISRTAFSSSFEEGRKIFQLQKELAKLIMQAAKFM FIPGFRFRPTKGNRRIKEIEREMRLVLRNMIHDREKAMSAGEGCSNDLLGLLMESNLKET LDAGNSKNVGISIDEVIDECKLFYFAGQETTGNLLVWTMILLSIHKDWQEKAREEVLNVF GRRKPDFDGLNHLKIVSMILNEVLRLYPPAYTIGYRVSSKEMKVGEHTLPPGTLLGIRTL LVHHDRDLWGEDADEFNPTRFSEGLTKATNNKVSFIPFGWGTRVCIGQTFALNEAKMAIS

MILQCFSFDVSPTYVHAPYTVLTLQPQHGAQLILHKLSL*

 

>22054405 Aquilegia coerulea|Aquca_086_00011|Aquca_086_00011.1

CYP72A

MREILLALVLVAALLLIPWAWKAFSWILLKPKKLEKCLREQGLKGTSYKFLFGDIKEMID SVKAARTKPMDRSHKIVPHVMPFLHDKVQKYGKTHFTWFGPNPRVNITDPDMIRDILSNK FGHFEKVASTPLERKLVAGLVGYEGEKWAKHRRIINPAFHLEKLKMMLPAFHTSCHEMVK KWQKLVANESCELDVWPELQNLAADVISRTAFSSSFEEGRRIFQLQSEMATHLMQSSRFM FAPGYRFLPTKKNRRMKEISQERGSLLQNMILRREKVMKAGRLQNNDLLGLLLESNFKEM SGKTRNAGITIDEVIDECNLFYLAGQETSATLLVWTMICLSMHQDWQEKAREEVSQIFGS QSPDFEGLNHLKVVPMIINEVLRLYSPAVGLGIRVTYKEMKLGKLVLPPGVQLSIPALLV HHDCELWGEDADKFNPDRFAEGISKATKNKVSFFPFSWGPRICIGQNFALIEAKMAISMI LQHFSFELSPTYVHAPYTVLTLNPQHGAQLILHRV*

 

>22054411 Aquilegia coerulea|Aquca_086_00006|Aquca_086_00006.1

CYP72A

MREILLALVLVAALLLIPWAWKAFSWILLKPKKLEKCLREQGLKGTSYKFLFGDIKEMID SVKAARTKPMDRSHKIVPHVMPFLHDKVQKYGKTHFTWFGPNPRVNITDPDMIRDILSNK FGHFEKVASTPLERKLVAGLVGYEGEKWVKHRRIINPAFHLEKLKMMLPAFHTSCHEMVK KWQKLQLQSEMATHLMQSSRFMFAPGYRFLPTKKNRRMKEISQERGSLLQNMILRREKVM KAGRLQNNDLLGLLLESNFKEMSGKTRNAGITIDEVIDECNLFYLAGQETSATLLVWTMI CLSMHQDWQEKAREEVSQIFGSQSPDFEGLNHLKVVPMIINEVLRLYSPAVGLGIRVTYK EMKLGKLVLPPGVQLSIPALLVHHDCELWGEDADKFNPDRFAEGISKATKNKVSFFPFSW GPRICIGQNFALIEAKMAISMILQHFSFELSPTYVHAPYTVLTLNPQHGAQLILHRV*

 

>22054378 Aquilegia coerulea|Aquca_086_00019|Aquca_086_00019.1

CYP72A

MREILLALVLVAAILLIPWAWKAFSWIWLKPKKLEKCLREQGLKGTSYKFLFGDIKEMMD SVKAARTKPMDRSHQIVPRVMPFLHDKVQKYGKTHFTWFGPNPRVNITDPDMIRDILSNK FGHFEKLASTPLERKLIPGLVGYEGEKWAKHRRIINPAFHLEKLKMMLPAFHTSCHEMVE KWQKLVANESCELDIWPELQNLAADVISRTAFSSSFEEGRRIFQLQSEMATHLMQSSRFM FAPGYRFLPTKKNRRMKEMSQEMGSLLQNMILRREKVMKAGRLQNNDLLGLLLESNFKEM SGKTRNAGITIDEVIDECKLFYIAGQETSATLLVWTMICLSIHQDWQEKAREEVSQIFGS QSPDFEGLNHLKVVPMIINEVLRLYSPAVGLGIRVTYKEMKLGKLVLPPGVQLSIPALLV HHDCELWGEDADKFNPDRFAEGISKATKNKVSFFPFSWGPRICIGQNFALIEAKMAISMI LQHFSFELSPTYVHAPYIALTLNPQHGAQLILHRV*

 

>22054419 Aquilegia coerulea|Aquca_086_00025|Aquca_086_00025.1

CYP72A

MNNIMDFLPPLFAIFGVVLISLAWKAYNWSWLKPKKMEKYLTEQGLQGSNYKFLYGDIKE IQRLTKEERSKRMENSHQIVPRILPYFHQMVQQYGKLSYIWFGPTPRLIVTDPDMIKEIL SDKSGCFGKIKGNPLGNLLATGILSYEGDKWAKHRKIINPAFHQEKLKMMLPAFYTSCCE

MVDKWLNSIPEGSCELDVWPDLQNVTADVISRTGFGSSYEEGRQIFRLQKEQAGLVVQAN QSIYIPGLRFLPTKSNKRMKEIHGEVRALVRDMILKREKTMRAGEAPTNDLLGLLMESNF KEIKEGGNSKVGITIDEVIEECKLFYFAGQETTATLLAWTMVALSMHQDWQQKAREEVMQ VFGSNKPEYDGLNKLKVVTMILNEILRLYPPACILMRETYKKVKLGEVILPPGVQLTLAM LLIHHNRELWGEDAEEFNPQRFSEGVSKATKNLVLFFPFGWGPRLCIAQNFAILESKMAL AMILQHFSFELSSTYIHAPYTIAVLQPQYGVQLVIRKI*

 

>22054412 Aquilegia coerulea|Aquca_086_00037|Aquca_086_00037.1

CYP72A

MVGFLSVFLAVFAILIISCAWRTLNWVWLKPKKIEKFLREQGIKGYSYKFLYGNTKELAR LSKEARSKPMDLSHHIAPRVMPFVDQTVQKFGKLSLIWFGPIPRLLVMDPEMIRDILSNK FGHFEKTRTNPLGRFLVTGFISYEGEKWVKHRRIINPAFHLEKLKMMLPAFNTCCSQMVD KWRKLVSSESCELDVWPYLQNLTADVISRTAFGSSYEEGRLVFKLQTEQANLFIQSLQSI YISGFRFLPTKRNRRMKEIYKEVKTLVRDIITKREAAMRSGKSQNEDLLGLLLESNLKEI EDNGNSKNVGITIDEVIEECKLFYFAGQETTSTLLVWTMIVLSMHQDWQEKAREEVLQVI GRKTPDFDGLSHLKIVTMILYEVLRLYPPASSLLRATYKNMKLGDILLPPGVQLSLPTLL VHLDQELWGEDAKEFNPNRFSEGVSNATKNQVAFFPFGWGPRICIGQNFALLEAKMAIAM ILQHFSFELSSSYVHAPSIVVQPQHGAHLILHKL*

 

>22054415 Aquilegia coerulea|Aquca_086_00003|Aquca_086_00003.1

CYP72A

MKMNMEELLQTLLVIFGVLLVSWAWKAISWTWFKPKKMEKYLREQGLKGPNYKFLYGDIK EIGRLAKEARSKPMENSHQIAPRVLPYYHQVVQQYGKMSYLWFGPTPRLIVMDTDMIKEI LSDTSGTFGKTKSNPRGPLLITGLVTYEGDKWAKHRKIINPAFHQDKLKMMLPAFYTSCC EMVNKWLNAIPEGSCELDVWPDLQNVTADVISRTGFGSSYEEGRRIFILQSEQAGLVVQG SQSIYIPGMRFLPTKTNNRMKEIYREVQNLLRDMILKRAKAMKAGEAPTSDLLGLLMESN FKEIEEGGNSKVGITIDDVIEECKLFYFAGQETATLLAWTMVVLSMHQDWQRKAREEVMQ VFGSNKPEYDGLNHLKVVTMILNEVLRLYPPAYLIMRETYKKVKLGDVSLPPGVHLALSP LLMHHDHELWGEDANKFNPERFSEGISKATKNKGLFFPFSWGPRFCIGQNFAMLESKMAL AMILQHFSFELSSTYVHAPYTVITLQPQHGVQLVLRKI*

 

>22054418 Aquilegia coerulea|Aquca_086_00002|Aquca_086_00002.1

CYP72A

MEEVVLSLVIVFSSLVFTLVYRVLNWVWLEPRKLEKHLRKQGIPGPPYKMLQGNMKEIAS LLLKVRSNPMEHSHRIVRRILPYIHQMVENYGKTFVIWYGPSPRLTIMDPKLIRDILSDK SGQFGKVKQGPIFKYLFDGLVNYEGEKWIKHRKIINPAFHQEKLKMMLPEFYSSCSELIG KWQTMVSDGSCEIDVWPDLQNFSADVISRTAFGSSYEEGRRIFQLQTEQSELVMSMFRYL IIPGFRFLPTKKNRRMNEIYREVNKLLKDIIKKRENAIKLGEASKDDLLGMLLESNMNEI NAGGNKNVGMSIDDVIQECKLFYFAGQETTSTMIVWTMILLSMHPEWEEKAREEVLLVFG KNKPDYEGLCQLKIVTMILHEVLRLYPSVVMLLRATHKRVNLGEMDLPAGLTLSMPTLLI THDREIWGEDAEEFNPERFSEGISKATKNQVTFFPFGWGHRICIGQTFAILEAKMALAMI LQNFSFELSGRYVHAPYSVITLQPQHGAQLILTKI*

 

>22050942 Aquilegia coerulea|Aquca_058_00090|Aquca_058_00090.1

CYP72

MEKCLRDQGITGPPYQLLYGNTKEILMSMKKEQAKPMEISHHTLSRILPFDHQAVEDYGK SFVSWYGPTPRVNIMDPEVIRDILSDKFGHFGKVQNPFAKVTMQGLFTYEGEKWVKHRRI INPAFHQEKLKMMLPAFTTSCMEVINKWQKLVSEGSFELDVWSDIQNLSADVISRTAFGS SYEEGRRIFQLQTEQAKLIMQLAISIYTYIPGFWFLPTKTNKRIKEIYREVRTLLREIIK KRERGMRFGKTNNADLLGILMESNLKEIENGGSDKNVGMSIDEVIEECKLFYFAGQETTS SLLVWTMIVLSMHPEWQQKAREEVMQVIGKRTPDFEDLNQLKIVTMIIYEVLRLYPPVAA VIRATHKKTNVGKVALPPGVQISLPILFVNHDSTFWGEDVEHFNPERFSGGISKATKNQV SFFPFGWGPRICIGQTFSMIEAKMAVAMILQNFSFKLSATYQHAPYTIITLQPQHGAQLI

LRKL*

 

>22062421 Aquilegia coerulea|Aquca_016_00011|Aquca_016_00011.1

CYP72 58% TO CYP72A7 Arabidopsis thaliana

MESNHNEMKDDMNSKRVGMTIDEIIDECRLFYFAGQESTSTLLVWTMIVLSMHQDWQEKA REEVMKVFGSSKPDFDGLNQLKIVTMILHEVLRLYPPTPFISRANDKEINLGDVTVPEGV QLALPILLIHHSRELWGEDAEEFKPERFARGVSEATKNQVSYFPFGWGPRICAGQTFVFV EAKMALSMILQQFSFELSSTYIHAPYSILTIKPQYGAQLILHKL*

 

>22044795 Aquilegia coerulea|Aquca_049_00002|Aquca_049_00002.1

CYP72 60% TO CYP72A61 Glycine max (soybeans, Fabales)

MLKCFLVRFWQLYNHRLLIEIRVNYKSFCDWQQKAREEVMQVFGSNKPEYDGLNKLKVVT

MILNEILRLYPPAYILMRETYKKVKLGEVILPPGEFNSQRFSEGVSKATRNKVLFFPFGW GPRLCIGQNFAILESKMALAMILQHLSFELSPTYIHAPYTVAILQPQYGVQLVIRKI*

 

>22054156 Aquilegia coerulea|Aquca_116_00006|Aquca_116_00006.1

CYP72 50% TO CYP72C1 Arabidopsis thaliana

MQNFFSCCFSSTSVLPTWACILLSIHTDWQDKARHEVEQVLQGNPPDYESAARLKILNMI VNETLRLYSPQPFSLRIVEKETKLGNLKIPAGTNIEIPFIAVHHDPQEWGEDVDDFNPAR FAEVVAKASKSSRAFMPFSSGTRVCLGMNFSLIEAKLTLAMILQKFSFTISPNYKHSPAC RATTWPVHGAHIIFQNL*

 

>22054370 Aquilegia coerulea|Aquca_086_00017|Aquca_086_00017.1

CYP72 58% TO CYP72A5 Zea mays
NOTE: 1 AA DIFF TO 22054408

MMLPAFYTSCCEMVNKWLNAIPEGSCELDVWPDLQNVTADVISRTGFGSSYEEGRRIFIL QSEQAGLVVQGSQSIYIPGMRFLPTKTNNRMKEIYREVQNLLRDMILKRAKAMKAGEAPT SDLLGLLMESNFKEIEEGGNSKVGITIDDVIEECKLFYFAGQETTATLLAWTMVVLSMHQ DWQQKAREEVMQVFGSNKPEYDGLNHLKVVTMILNEVLRLYPPAYLIMRETYKKVKLGDV SLPPGVHLALSPLLMHHDHELWGEDADKFNPERFSEGISKATKNKGLFFPFSWGPRFCIG QNFAMLESKMALAMILQHFSFELSSTYVHAPYTVITLQPQHGVQLVLRKI*

 

>22054431 Aquilegia coerulea|Aquca_086_00018|Aquca_086_00018.1

CYP72 83% TO 22054370 Aquilegia coerulea
53% TO CYP72A5   Zea mays

MNNIMDFLPTLFAIFGVVLISLAWKAYSWSWLKPKKMEKYLTEQGLKGSNYKFLYGDIKE VQRLTKEERSKRMENSHQIVPRILPYFHQMAQQYGKLSYIWFGPTPRLIVTDPDMIKEIL SDKSGCFGKIKGNPLGNLLVTGISSYEGDKWAKHRKIINPAFHQEKLKMMLPAFYTSCCE

MVDKWLNSIPEGSCELDVWPDLQNVTADVISRTGFGSSYEEGRQIFRLQTEQAGLVVQAN QSMYIPGLRFLPTKSNKRMKEIHGEVRALLRDMIQKREKTMRAGEAPTSDLLGLLMESNF KEIKEGENSKVGITIDEVIEECKLFYFAGQETTATLLAWTMVALSMHQDWQQKAREEVIQ VFGTNKPEYDGLNKLKVVTMILNEILRLYPPAYILMRETYKKVKLGEVILPPGVQLTLAM LLIHHNRELWGEDADEFNPQRFSGGVSKATKNQVLFFPFGWGPRLCIGQNFAILESKMAL AMILQHFSFELSSTYIHAPYTIAVLQPQYGVQLVIRKI*

 

>22054425 Aquilegia coerulea|Aquca_086_00005|Aquca_086_00005.1

CYP72 85% TO 22054370 Aquilegia coerulea
55% TO CYP72A5 Zea mays

MIHKREKTMRAGEAPTSDLLGLLMESNFKEIKEGGNSKVGITIDEVIEECKLFYFAGQET TATLLAWTMVALSMHQDWQQKAREEVIQVFRRNKPEYDGLNKLKVVTMILNEVLRLYPPA YIRMRETYKKVKLGGVILPPGVQLTLAMLLIHHNRELWGEDAEEFNP*

 

>22054408 Aquilegia coerulea|Aquca_086_00009|Aquca_086_00009.1

CYP72 58% TO CYP72A5   Zea mays

MMLPAFYTSCCEMVNKWLNAIPEGSCELDVWPDLQNVTADVISRTGFGSSYEEGRRIFIL QSEQAGLVVQGSQSIYIPGMRFLPTKTNNRMKEIYREVQNLLRDMILKRAKAMKAGEAPT SDLLGLLMESNFKEIEEGGNSKVGITIDDVIEECKLFYFAGQETTATLLAWTMVVLSMHQ DWQQKAREEVMQVFGSNKPEYDGLNHLKVVTMILNEVLRLYPPAYLIMRETYKKVKLGDV ILPPGVHLALSPLLMHHDHELWGEDADKFNPERFSEGISKATKNKGLFFPFSWGPRFCIG QNFAMLESKMALAMILQHFSFELSSTYVHAPYTVITLQPQHGVQLVLRKI*

 

>22024571 Aquilegia coerulea|Aquca_033_00100|Aquca_033_00100.1

new cluster B like CYP72

MMLPGFHASCSEMLNKWQKLVSTESCELDVYPELHNLTIDVISRTIFNCSYAEAKQILEV QRELADLILPTLRFPRIPGLRFLPTKVNRRMKYLDRELHTLIRNIVIKKQKAMKTGEADN NDLLGCLVQSTFKGSEDNKGAENVGISIDEVVQECKFLWLAGKETIGNWLVWTMVVLSMH QDWQQKARDEVLQVFGKSKPGFDRLNQLKVVSMILNEILRLYCPAPGTAKRLTNKKVKLG NAILPPGVYVWPLTVLVHHDHDLWGKDADDFNPNRFSEGVSKATNSKLSFLPFGSGPRTC IGQNLAWISTKIAITMILQHFSFELSPTYIHAPCLVPTVTPQYGAQLIIHKL*

 

>22054369 Aquilegia coerulea|Aquca_086_00004|Aquca_086_00004.1

CYP72 53% TO CYP72A5   Zea mays

MEKYLTEQGLKGSNYKFLYGDIKEVQRLTKEERSKRMENSHQIVPRILPYFHQMAQQYGK LSYIWFGPTPRLIVTDPDMIKEILSDKSGCFGKIKGNPLGNLLVTGISSYEGDKWAKHRK IINPAFHQEKLKMMLPAFYTSCCEMVDKWLNSIPEGSCELDVWPDLQNVTADVISRTGFG SSYEEGRQIFRLQTEQAGLVVQANQSIYIPGLRSG*

 

>22054382 Aquilegia coerulea|Aquca_086_00016|Aquca_086_00016.1

CYP72 47% TO CYP72A5   Zea mays

MKMNMEELLQTLLVIFGVLLVSWAWKAISWTWFKPKKMEKYLREQGLKGPNYKFLHGDIK EIGRLAKEARSKPMENSHQIAPRVLPYYHQVVQQYGKMSYLWFGPTPRLIVMDTDMIKEI LSDTSGTFGKTKSNPRGPLLITGLVTYEGDKWAVLTYF*

 

>22054377 Aquilegia coerulea|Aquca_086_00034|Aquca_086_00034.1

CYP72? N-TERM 40% TO CYP72A61   Glycine max

MEELQKILLTISIIFVISCVWNVFNWIWLKPKKLEKYLRKQGLKGTSYKLFYGDLKGKIP SVVEAYSKPMEHSHQITSRVQPFDHFLFQKYGKLLFHFIS*

 

>22054385 Aquilegia coerulea|Aquca_086_00035|Aquca_086_00035.1

CYP72 49% TO CYP72A5   Zea mays

MLVTIAGYDGEKWTKHRKNLTPAFHLDKLKMMLPASHASCSEMLNRWQKLVLTESCELDV WPELHNLTIDVACRTIFNCSYAEGKRLFQLQRELLDRVVQTLGFTGIPGFSFLPTKENRR

MKYLDRELHTLMRDIVIRKEKTMKTGEAHNNDILGCLVQSTFNRMEDNKGMKKVGISIDD VVQECKFVWLAGKETLGNWLVWTMIVLSMHQDWQQKARDEVLKVFGKSKPDFDRLNQLKI VSMILNEVLRLYSPAPAPGKRLTNKKLKLGNVIMPPGVYLWPLTVFVHHNRDLWGQDADE FNPDRFSEGVSKATKTKLSFFPFGSGPRSCVGQNFAWINAKIAITMILQHFSFELSPTYM HAPCLAPTVAPQYGAQLTIRKL*

 

>22024566 Aquilegia coerulea|Aquca_033_00095|Aquca_033_00095.1

new cluster B like CYP72

MGELQKTLLMISIFILISCVWKFFDWIWLKPKKLEKYLRKQGLKGTSYKLFYGDLKERDL SIQEALSKPMEHSHRIGHRVLPFDHLMFQKYGKVAVTWDGPNPIVVVIDPDMIRDILSSD NFLDVGYNPYEKTLVAVAGYNGKKWTKHRKHLTPAFHLDKLKMMLPGFHASCSEMLNKWQ KLVSTESCELDVYPELHNLTIDVISRTIFNCSYAEAKQILEVQRELADLILPTLRFPRIP GLRFVPTKVNRRMKYLDRELHTLIRNIVIKKQKAMKTGEADNNDLLGCLVQSTFKGSEDN KGAENVGISIDEVVQECKFLWLAGKETIGNWLVWTMVVLSMHQDWQQKARDEVLQVFGKS KPDFDRLNQLKVVSMILNEILRLYCPAPGTAKRLTNKKVKLGNAILPPGVYVWPLTVLVH HDHDLWGKDADDFNPNRFSEGVSKATNSKLSFLPFGSGPRTCIGQNLAWISTKIAITMIL QHFSFELSPTYIHAPCLVPTVTPQYGAQLIIHKL*

 

>22024709 Aquilegia coerulea|Aquca_033_00094|Aquca_033_00094.1

new cluster B like CYP72

MGELQKTLLTISMIILISCVWKFFDWIWLKPKKLEKYLRKQGLKGTSYKLFYGDLKERDL SIQEALSKPMEHSHRIGHRVLPFDHLMFQKYGKVAVTWDGPNPIVVVMDPDMIRDILSSD NFLDVGYNPYEKTLVAVAGYNGKKWTKHRKHLTPAFHLDKLEMMLPGFHASCSEMLNKWQ KLVSTESCELDVYPELHSLTIDVMSQTIFNCSYAEAKQILEVQRELADRILPTLIFPSIP GLRFLPTKENRRMKYLDRELHTLIRNIVIKKQKAMKNGEAHNNDLLGCLVQSTFKGSEDN EDAENVGISIDDVVQECKFLWLAGKETIGNWLVWTMIVLSMHQDWQQKARDEVLQVFGKS KPDFDRLNKLKVVSMILNEILRLYCPAPGTAKRLTNKKVKLGNAILPPGVYVWPLTVLVH HDHDLWGKDADDFNPNRFSEVFRRPPIVNFHFFPLVRGHGLALDKTLHGLILR*

 

>22029075 Aquilegia coerulea|Aquca_113_00008|Aquca_113_00008.1

NEWFAM? 43% TO CYP72A5 Zea mays (maize)
40% TO CYP72A84 Coptis japonica, 40% TO CYP734A11 PEA

MGGFDLVSFCFGYLIIFLLLRKILIATWWNPRKIEQKLRNQGIEGPSYKFLVGSFRELAK

MYSSKAKLDTVVTPIGSQMKHTIIQDLVPHLHLWKEKYGRVFFYWFGPTPRLVVTDPELL KEILHNTQLFLKAIPNPAIYELIGNGLVVAEGELWARHRKILNPFFHIEAIKGYVQTIVN CNNEMITVWKDLIRRDGPELEVNSLFRTLTKDIFARIAFQSNFKRVDRIVELQMEQINIL KQIFGLVYIPGSRFLPTPFNIKNRRLRNELEEIFKELISCRDETNKDNKDLLGLMLSATN NDGNNGHKMSSKEMIDECRTFFLAGFQSTSVLPTWACILLSIHTDWQDKARHEVEQVLQG NPPDYESAARLKILNMIVNETLRLYSPQPFSLRIVEKETKLGNLKIPAGTNIEIPFIAVH HDPQEWGEDVDDFNPARFAEGVAKASKSSRAFMPFSSGTRVCLGMNFSLIEAKLTLAMIL QKFSFTISPNYKHSPACRATTWPVHGAHIIFQNL*

 

>22040956 Aquilegia coerulea|Aquca_018_00195|Aquca_018_00195.1

NEWFAM? 40% TO CYP72A5   Zea mays (maize)

MDGLDNVTFGFGFGLLIIIVLLLRKFLLATWWNPRQIEQQFRNQGIEGPSYKFLIGSFGE LAKIYGNSKAKPADMMVVTPIIGSEMKHTIIQDVLPHIHLWTQKYGRVFLYWFGPSPRLV VTDPELIKEISNNTSSFLKAIAHPAVHDLVGDGLLIAEGDKWSRLRKIMSPFFSIEALKG YVQTIVTSNNDMIKMWKDSIRSDGPELEVLSQFQSLTKDIFARLAFQSNFKKVDHIVKLQ LQQLSILTELFRTPYIPGSRFLPTPSNIKQLMSRRELEKLFRELINSRDKSNKGNDLLGL

MLSATNNDGENGTKMSSKEMIDECKTFFLGGFESTSILPTWACVLLSIHTDWQDKARNEV EQVLQGKPPDYDSLGRLKIINMVLNETLRLYSPGPFIMKTVEKETKLGNLNIPAGINIEI PLIAVHHDPEQWGADVHQFNPARFAEGAAKASKYPRAFMPFTSGARVCIGMNFAMMEAKI TMAMILQKFTFYISPNYKHSPECMATTRPLHGAHIVFHQI*

 

>22035495 Aquilegia coerulea|Aquca_030_00184|Aquca_030_00184.1

CYP73A

MDLMLLQKALIAIFIAIVGAITVSKLRGKRFKLPPGPFPVPIFGNWLQVGDDLNHRNLTD LARKFGEILLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT VYGEHWRKMRRIMTVPFFTNKVVQQYRYGWEDEITRVVEDVKKNPEASTTGIVLRKRLQL

MMYNNMYRIMFDRRFESEEDPLFIKLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLK ICKEVKEKRIQLFKDYFLDERKKLASTKATDNAGLKCAIDHILDAEKKGEINEANVLYIV ENINVAAIETTLWSIEWGIAELVNNPAIQQKLRNELDTMLGPGVQITEPDTYKLPYLQAV VKETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPEHWKNPEEFRPER FLEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLD TTEKGGQFSLHILKHSTIVVKPREVV*

 

>22047773 Aquilegia coerulea|Aquca_007_00096|Aquca_007_00096.1

CYP74A

MASTTSLVFPSLLHSSKKTYSNRRFPYRSISASISEIPSVSVTPSPPPPPPPKVSLSIQK IPGDYGIPIISPIKDRLDYFYFQGRDEYFKSKIQKHKSTVFRANMPPGPTIASNPNVIVL LDAKSFPVLFDNSKVEKKDCFTGTYMPNLELTGGYRVLSYLDPSEPNHAKLKNLMFFLLK SSRNRVMPEFHNTFTEFFNNLDNELETKGKAGFNALNDQASFNFLAKSFYGTNPADTKLG DEGPSLVATWVLLQLSPILSLGLPWFIEDPLLHFFPLPPLLVKSRYQKLYDFFYESSTSI LDEGEKLGISREESCHNLIFTTCFNTFGGMKIFFPNMIKWVGRCGGKLHRQLAQEIRSVV RSNGGKITMAGMEQMPLMKSVVYEAFRIEPPVPLQYGKAKRDLIIESHDSTFEVKEGEML FGFQPFATKDSRIFEKGEEFIADRFIGEEGEKLLKYVLWSNGPETENPTVDNKQCAGKDF VMLVSRLLIVELFLRYDSFEIQVGNSPLGAAVTITSLKRATF*

 

>22048168 Aquilegia coerulea|Aquca_007_00099|Aquca_007_00099.1

CYP74A

MSCSTSEVPETTTTKTYYDSQHPQLFLRKIPGDYGLPFIGPIKDRLDYFYNQGEIEFFRS RERNYKSTVFRVNMPPGPFISSNSKVIVLLDANSFPVLFDTTKVEKKNILDGTFMPSTSF FGGYRPCAFLDPLEPKHAKLKQLFLSLLASLHDKFIPTFQTSLSELFSNIDSQISTNSTA GFNVLSDNMSFDFVFRLFFNINPIDTKLGSDGEGTITNWLALQLAPIATLGLAMLPNCLE DFMLHTFKLPFFPVKSGYKKLYKVIYESSTSIFEEAEKLGLKKDEVCHNLIFLAGFNAFG GMKRLFPTLIKWIGLAGPELHKQLANEVRAVVSSAGRSLTFSGLEQLSLTKSVVYEAIRM EPPVPYQYGKAKEDLTVQSHESTFEIKKGEIIFGYQPFATRDVMVFGGNNNEFVADRFVG EKGEKLLKYVFWSNDRETVNPTVDNKQCPAKDLVVLLSRLMVAELFLRYDTFTIKTGTSF SGSTVTITSLTKAAST*

 

>22048983 Aquilegia coerulea|Aquca_007_00098|Aquca_007_00098.1

CYP74A

MSSSISSSTQDSLDDSPQPNLPLRKIPGTYGLPFFGAIKDRLQFFYYQGRNEFFNTRMSK YNSTIFRINMPPGPFIANNPKVIVLLDAVSFPVVFDLTKVEKKNVLATYSPYFSFFGGYH PCAYQDPSEPTHNKIKQIIFSLISSRHDKFISIFQNSLNELFNNIESQIAATTSADFSTL SNSMAFEFLFRSLYNTDPKDTKLGTEGQSIVTRWLSLQLAPLVTLGLPVIPDFIEDMLLR TIKFPFFPAKSGYKKLYDVIYEASAKTLDEAEQLGLKRDEACHNLIFMSFFNAYGAMTAW YPILIKWIGLGGEKLHKQLSDEIRAVVLSEGGEVTMSGLEKMTLTKSAVYEAFRIEPPVR HQYATAKKDLVVQNHESSFEIKKGELILGYQPFATNDPKIFENPETFKADRFVGEKGEKL LKYVYWSNGRETENATVDNKQCPGKDMSMLLSRLMVVELFLRYDTFGIEVGTSYLGPSVT VKSMTAKATKII*

 

>22057239 Aquilegia coerulea|Aquca_032_00001|Aquca_032_00001.1

CYP74B

MASMNLMIKMSSSSSSSPPSPSITSIPTPTPPSTSLPVRAIPGSYGLPLIGAISDRLKYY WFQGPETFLKKKRESHKSTVFRTNIPPSFPFFLNVNPKMIAVLDCKAFSTLFDMDVVEKK NVLIGDFMPSTSFTGNIRVGVYLDTTEPQHSQVKNFCLDILKRSSNLWTSEFLSNINDMW DKIEKDVEENGSASYLMPLQRSLFRFLVKCIVGADPASSPEVAENGHIMLDKWLALQLIP TQSIPVFQPLVEIFLHSFTYPFALVSGDYGKLYEFVKKQGNETVQRGMTEYGLSQDEAIH NLIFVLGFNAFGGFSVFLPSLINSLGSNNEIQEKLRKEIREIVGSSPLSFELVKKLDLVQ SFVYETLRFKPPVRAQFARARKDFVLDSHDSGFQVKKGELLFGYQPFAMRDPKVFDDPET FIPERFTGEKGKELLNYLYWSNGPQTGSPSTSNKQCAAKDYVVLTSCMLIADMFQRYDSI TATSSAITAIEKAK*

 

>22047915 Aquilegia coerulea|Aquca_007_00100|Aquca_007_00100.1

CYP74

MSSTSDKSSQEPQLPIREIPGDYGLPVIGPIKDHLDYFYNQGEIEFFRSREKKYASTVFR VNMPPGPFIASDSKKDVLDGTFMPVTSFFGGYRPCAFLDPSETKHARLKQLFFSLLASFH GKFILTFQTSLSEIILITWLTLQVAPLGTLGLTTLSKYVEDLLIHTFKLPFFPVKTAGFN VLGGMIRLFLALIKWIGLAGPKLHKQLADEIRDVISTEGGLLTFSTLEKMPLTKWVVYEA IRLGPPIPYQYGKAKEDLTVQNHESTFEIKKDRMIFGGNNNEFVVDRFVGEEGDKLLQYV CWSNGRETDNSTLENKQCPTKDLVVLLSRLMVAELFLRYDTFMVEAVTTILGSIITITST

TKACKKQ*

 

>22041318 Aquilegia coerulea|Aquca_072_00120|Aquca_072_00120.1

CYP75A

MFGLTVTDLFLSVFLFFSAHFIIRSLLSKHKHKLPPGPNGWPVLGALPLLGTMPHVALAE

MSKKYGPVMYLKLGARGMVVASTPDAARAFLKTLDLNFSNRPTDAGSTHLAYNRQDMVFA DYGPKWKLLRKLSNLHMLGGKAIEDWTAVRRIELGYMLQAMYESSHKGEVVVVPEMLALA

MANMIGQVILSRRVFVSKGTESNEFKDMVVELMTSAGLFNIGDFIPSIAWMDMQGIVGRM KNLHKKFDALLDKMFKEHRATRNDRKDKPDFLDVLMNNMNNPGEEKLSDTNIKALLLNLF SAGTDTSSSSIEWALTEMINNPSILRRAHAEMDRVIGRNRRLEESDIPNLPYLQAICKES FRKHPSTPLNLPRVSREPCEVNGYYIPKGTRLSVNIWAIGRDPNVWENPLEFNPDRFLNE KNAKIDPRGNNFELIPFGSGRRICAGVRMGIVLVEYILGTLVHSFDWKLPDGEKLNMDEA FGLALQKAVPLAAVVTSRLLPSAYEV*

 

>22030124 Aquilegia coerulea|Aquca_004_00770|Aquca_004_00770.1

CYP75A

MAFNMFVVTVSGLFLTVILIFIIHFFKGRSLSNYDHKLPPGPKGWPIIGALHLLGTSPHV TLAEMSKKYGPVMYLKLGVRGLLVASTAESAHTFLKTHDLNFSNRPSGAFATHIAYNSQD LVFGKYGKEWKLLRKLSNLHMLSGKAIDDGTNVRRVELGRMLQAMYESSTRGEPVIVKEM LGYAIANILSQVAMSKRVFVAKSTESNEFKDMIAETMKLGGIFTIGDFVPSIAWMDIQGN VKRMKNLSKRFDLLVNKMLKEHIATKHERKETPDLLDALTDHMENNPLAEGEKLTETNIK ALILDLFIAGSDTSLGLIEWALTEMIINPSILSRAQAEMDQVIGRDRRLEESDIPNIPYL QAICKETLRKHPSVALNLRESIEPCELNGYYVPKGTRVSVNIWAIGRDPNVWEDPLEFNP DRFLIEKNEAIDLVSNNFEFIPFGAGRRMCPGYRMGIVLVEYILGTLLHSFDWIVPDGEK LNMEETFGLSLHKTVPLTAIVTPRLLPSAYAVV*

 

>22026440 Aquilegia coerulea|Aquca_053_00083|Aquca_053_00083.1

CYP75A

MTAAIFFLITTTLFFILSSRFAGHHRLPPGPKGWPVIGSLRLLGKMPHVSLAELSKKYGP VMYLKLGAYGMVVASTPDTAREFLKTQDLNFSNRPPFAGSTYLVYNRQDMAFSDYGPKWK LLRKLTSLHMLGGKAIEDLASVRRVELGHMLEDMYESSIQGERVVVSQLCLGTIANLISQ VILSRRVFDTKGTGSKEFKDMVDELMELFGAFDIGDFLPYIAWMDIKGLIKRMKNVNKKF DVLFEKMFKEHRETKHERMEKPDFLDVLMDQMDNPGEEKLTDANIKALLVNMFTAGTDTT TSSIEWALTEMIKNPRILACAQAEMDQVIGKSRRLEESDIPNLPYLQAICKETFRKHPSA PLNLPRVSKEPCEVNGYYIPKGTRLNVNIWAIGRDPNVWEDPLEFNPDRFLREENVKINP SGNDFELIPFGAGRRMCVGAKMGMIMFENILGTMVHSFDWIVPEGEAINMDEAFGLALSK SVPLAVIVIPRLPPSVYGAV*

 

>22053792 Aquilegia coerulea|Aquca_002_00830|Aquca_002_00830.1

CYP75B

MVVSLEVIGLSLSTIFLATIVYILLNNLRNPSRSRLPFPPGPKPWPIIGNLPHLGPVPHH SLAQMARKYGPFMHLRLGYVHVVVAASANVAANFLKIHDANFSSRPPNSGAKYIAYNYQD LVFAPYGPKWRMLRKICSVHLFSAKALDDFRHVRQQEVAVLIRALMKSGSTAFNLGQLLT VCATNALSRVLLGQRVFSDGSGDKKSDEFKEMVVEMMVLAGVFNIGDFVPALEWLDLQGV ASKMKTLHKKFDRFLSKCIEDHKVMIKNGEMAGTGTSKHMDLLSTLIELKENADGEGGKL TDTHIKALLLNLFTAGTDTSASTVEWAIAELIRHPKILAKSLEELDTVVGKDRLVAESDL SQLPYLQAIIKETFRLHPSTPLSLPRMATEDCEIDGYFIPKNTTLLVNVWAISRDPAIWT NPLEFQPERFLPGSEKAHVDIKGNDFEVIPFGAGRRICVGMSLGIRMVSFLTASLVHAFD WVLADGQMAEKLNMEEAYGLTLQRKVPLMVHPQPRLAPHAY*

 

>22043189 Aquilegia coerulea|Aquca_001_00283|Aquca_001_00283.1

too short CYP75A?

MTFGDVDLVKIEDVSKLKYLQAVVKETMKMKPIAPLAIPHMTAKDTTLMGTKVAKGTRIM VNLYALHTNQKIWTEPYKFIPERFMQGDQNEGVTNNKAREQSFLPFSAGMRICAGMDLGK LQFAFSLANLVNALKWSCVEEDKYPDMSEELGFVLLIETPLVAKITARNS*

 

>22051730 Aquilegia coerulea|Aquca_002_01290|Aquca_002_01290.1

CYP76

MIFGSKLPPGPFPLPIVGHLFKLGNKPQESLANLAKIYGSLMTIKLGSVTTIVVSSAIMA KEVLQKHDQTFSGRTVPDAVRILKHHEVSMVWLQPSSQWRNLRKLCTSQMFTNQRLNDSE EIRLKKVKEFINNIRDSAKSRQAIDIGEAVFSVVLNTISNTILSNDITHFNTDSTLDFKA AICGIIEEIGTPNMSDYFPILKSFDLQGIRRRSGSYFEKLDEFFNAIMDQRLQSKEQNAT NDLLETLLQHTQEKGFNLNHVDINSLLKDLL*

 

>22038932 Aquilegia coerulea|Aquca_028_00289|Aquca_028_00289.1

CYP76 51% TO CYP76A3 Petunia

MNFNAIGNAIFSKDIVNPQLNNGTEFFTSTAQTLELVTKSNVADYFPWLRWLDPQGMKKK

MKQLMRRMIGFSSALVKERILDRKNGKRNEKKDFLDVMLDFQGNQLDGESANLSERNISI GIQELLQAATDTSTSTIEWAMTELLRNPEVMRKVEAELNQVVGLKKVEEGDIRNLPYLQA VVKETLRLHPAVPLLVPRSVREDTEFMGYSIPKNTQIFVNVWAIARDPASWDDPLTFKPE RFLSSDVDYKGQHFQFLPFGAGRRMCVGLPFAQNMLHCTIASLIHSFEWSLEDGITPDKI NVEERLGLTLRKADPLKVVLKLRSMQENVAKM*

 

>22055131 Aquilegia coerulea|Aquca_036_00028|Aquca_036_00028.1

CYP76

MLPPGPRGLPMLGNVFQLGWANPHVSFARLASKHGAIMTIRLGMMTTVVISSKDVAREMF KHHDVVLAGRKIYESMKGRKGNEGSLITAQYGSHWRMLRRLCASEFFVTSRLDALKGVRG RCVSNMVRYVQEASEGGANSIDIGRYIFLMSFNLLGNLMFSKDLLDPNSEQGAAFFYHAG KVMELAWKPNVADFLPGLRWLDPQGLRKKTQHHVEQAFNIAGDFIKQRMESKMNGAGGEQ KKDFLNVLLDFQGNGTEEPAFTARTINILVLEMFIAGTDSTSGTIEWALAELIRHPKAMK KVQDELREVVQSYRELEENDLQNLPYLRAVMKETLRLHPPLPFLIPHMAMDSCRMLGYRI PKETQVLVNVWAIGRDPETWKDPSVFTPERFLEMDNVDYKGHNFEYLPFGSGRRMCPAIP LASRVLPLTLGSLLHSFNWVLPDGLKPECMDMTEKMGITLRKAVPLNVIPVPYQGNNSG*

 

>22038948 Aquilegia coerulea|Aquca_028_00156|Aquca_028_00156.1

CYP76

MEWTLAYTIWSCISLGVALLLIREIFLVSDKKQLPPGPPGWPVIGNLLDLGGAPHLSLAS LSKKYGPVIWLRFGAVNTMVVSSADAAMELFKNHDLTFADRKTNEAMRLNGFDQGSISLS EYGPYWRMLRRICSTELFSGKRIKDTETLRANCIEKLKKWICEEGQKKGAVEIARFAALG NFNVILNAALSKDNFLDPQSNEGTEFFGSVSRVEELVGMPNVADFFPFLRWLDPQGVKKK VERALEHPLNIATGFVKERIEWKKGHITSRKDFLDVMLEFQGNEKDGEPTKISEKNINIL IMELFIASTDSTSNTIEWAMAELLRNPNIMRNVQDELDQVVGQNRKVEESDIGKLHYLQA VVKETLRLHPPAPLLVPRRAVKNTVFMGYSIPKETQVLVNVWAIARDPVSWDDPMSFKPE RFLNSSVDFKGQHFQFLPFGAGRRMCAGVMLAERMLHLVLGSLIHSFEWSLEDGITPETM DMSESFGIALRRANPLRAMLKERMCI*

 

>22042616 Aquilegia coerulea|Aquca_063_00028|Aquca_063_00028.1

60% to CYP76G1 Arabidopsis thaliana

MTVRLGTMRTIVISSSDVAREMFKNHDTELAGRKIYEAMRGKEGDSEGSIILAQYGPHWR

MLRRLCTSEFFVKSRLDSTLMLREKCVCGMVRYILEVCEGGTNNAIDIGRYIYLMSFNLI GNLIFSMDLLDPNSRTGAEFFYHAGKIMDLAVKPNIADFFPMLRWLDPQR

xxxxxxxxxxxx

IKGKLEHESN

DDAGANKKDFLDVLLNFRGDGVEEPVMFSPRVINATVMEMFIAGTDTTTSTLEWAMAELL QNPTAMIKVQDELRGVLDINSQGVLGENDMKRLPYLTAVIKETLRLHPPLPCLVPHMAMD TCKMLGYYIPKETQVLVNVWAIGRDPKLWKDPLVFKPERFLEMNMVDFKRHNFEYLPFGS GRRICPAIPLVSLVLPLALGSLLYLFNWVLPNGLKPEDGFPLRW*

 

>22046074 Aquilegia coerulea|Aquca_051_00079|Aquca_051_00079.1

CYP76F

FFYTYMLLFLSFVWLCLITLWPRKTNLPPGPFPLPIVGSLFKLGIKPHQSLAELATIYGP LMTLKLGSVTTIVVSSPAIAKEVLQKNDKIFSNRTIPDALRALDHHKHSMAWLPVSAKWR SIRKISSTQLFTAQRLESNQGLRKQKVEELLEYVEENCKNKLAVDIGQVAFSTVLNLISN TVFSTDITHLDSNYAQEFKALIWGVMEEGGRPNFADYFPVLRSIDPQRIKHRMEGHFRKL DELFDGMIKQRLESRKLDNSPTSSSCSDFLDAILDYKQEDGFQLSDPDIKSLLKDIFAAG TDTTSSTLEWVMTELLCNPEKMAKAQAELKEIIAENKPIDESVIIRLPYLQAVVKETFRM HPPVPLLLPHKAESLVELCGYIVPKNTQVLINVWTMGRDPNVWENPTAFEPERFLNSNTD FKGRDFELIPFGAGRRICPGLPLAYRMVYLMLASLLHAFNWKLEDGLKPEDVDMEENFGI TLQKAIPLRAIPLKK*

 

>22046102 Aquilegia coerulea|Aquca_051_00080|Aquca_051_00080.1

CYP76F

MAKEVLQKNDQAFSSRTIPDAVRALDHHKHSMAWLPVSSKWRSIRKISSTQLFTAQRLES NQGLRKQKVEELLAYVEENCKNKRAVDIGQVAFSTVLNLISNTVFSIDLTHLDSNYAQEF KALIWGVMEEAAKPNFGDYFPILRSLDLQKIKYRVEGHFHKLDELFDGMIKQRLESRKLD NSPSSSCSDFLDAILDYKQEDGFQLSDPDIKSLLKDIFAAGTDTTSSTVEWVMTELLRSP EKMAKAQAELKEIIAENQPIDESDIIRLPYLQAVVKETFRMHPPIPLLLPHKAESLVELC GYIVPKNTQVLINVWTMGRDPNVWENPTAFEPERFLNSNTDFKGRDFELIPFGAGRRICP GLPLAYRMVYLMLASLLHAFNWKLEDGLKPEDVDMEENFGLTLQKAIPLRAVPLKK*

 

>22061870 Aquilegia coerulea|Aquca_008_00203|Aquca_008_00203.1

CYP76F

MTCMFMIKHANMDDEGGNWSYHSNELTNAQTMTKIYKPHPVTDFILFKLGTEPHKSLAEL SKIYGPLMALKLGNVTTIVVSSPTMAKEVLQKNDKAFSSRTIPEAVRVLDNHKHSMIWLP ASSKWRSLRKVSSSQLFTTQRLESNQGLRKKKVEELLSYVGENCKNKCAVGIGQVAFSTI LNLISNTVFSMDLTHLDSNYAQEFKSLVSIIMEEGARPNFVDYFPILRSIDPQRIKYRME GHARKLDEFFDGIIKQRLESRKLSKSPRSSCSDFLDAILDYKQEDGFQLSDPDIRAMLRD IFGAGTDTTSSTVEWAMTELLRNPEKMTKAQSELNEMIDENKPIDEADIVRLPYLQAVVK ETFRMHPPVPLLIPHKAESRVELCGYIVLKNTQVLINVWTMGRDPNIWENPTVFEPERFL KSNMDFKGQDFELIPFGAGRRICPGLPLAYRMLYLMLASLLHAFNWKLEDGLKPEDMDME ERFGLTLQKAIPLKAIPIKR*

 

>22049184 Aquilegia coerulea|Aquca_152_00004|Aquca_152_00004.1

CYP76F

MELFYTYVYLMISFAWLCLITLWRRKNKLPPGPFPLPIVGSLFKLGTKPHKSLAELATIY GPLMTLKLGSVTTIVVSSPAMAKEVLQKNDQAFSSRTIPDAVRALDHHKHSMAWLPVSSK WRSIRKISSTQLFTAQRLESNQGLRKQKVEELLAYVEENCKNKRAVDIGQVAFSTVLNLI SNTVFSIDLTHLDSNYAQEFKALIWGVMEEAAKPNFGDYFPILRSLDLQKIKYRVEGHFH KLDELFDGMIKQRLESRKLDNSPSSSCSDFLDAILDYKQEDSFQLSDPDIKSLLKDIFAA GTDTTSSTVEWVMTELLRSPEKMAKAQAELKEIIAENQPIDESDIIRLPYLQAVVKETFR

MHPPIPLLLPHKAESLVELCGYIVPKNTQVLINVWTMGRDPNVWENPTAFEPERFLNSNT DFKGRDFELIPFGAGRRICPGLPLAYRMVYL

 

>22049188 Aquilegia coerulea|Aquca_152_00001|Aquca_152_00001.1

CYP76F

MTELLCNPEKMAKAQAELKEIIAENKPIDESVIIRLPYLQAVVKETFRMHPPVPLLLPHK AESLVELCGYIVPKNTQVLINVWTMGRDPNVWENPTAFEPERFLNSNTDFKGRDFELIPF GAGRRICPGLPLAYRMVYLMLASLLHAFNWKLEDGLKPEDVDMEENFGITLQKAIPLRAI

PLKK*

 

>22049189 Aquilegia coerulea|Aquca_152_00005|Aquca_152_00005.1

CYP76F

MELFYTYVYLMISFAWLCLITLWRRKNKLPPGPFPLPIVGSLFKLGTKPHKSLAELATIY GPLMTLKLGSVTTIVVSSPAMAKEVLQKNDQAFSSRTIPDAVRALDHHKHSMAWLPVSSK WRSIRKISSTQLFTAQRLESNQGLRKQKVEELLAYVEENCKNKRAVDIGQVAFSTVLNLI SNTVFSIDLTHLDSNYAQEFKALIWGVMEEAAKPNFGDYFPILRSLDLQKIKYRVEGHFH KLDELFDGMIKQRLESRKLDNSPSSSCSDFLDAILDYKQEDGFQLSDPDIKSLLKDIFAA GTDTTSSTVEWVMTELLRSPEKMAKAQAELKEIIAENQPIDESDIIRLPYLQAVVKETFR

MHPPIPLLLPHKAESLVELCGFIVPKNTQVLINVWTMGRDPNVWENPTAFEPERFLNSNT DFKGRDFELIPFGAGRRICPGLPLAYRMVYLMLASLLHAFNWKLEDGLKPEDVDMEENFG LTLQKAIPLRAIPLKK*

 

>22052479 Aquilegia coerulea|Aquca_002_00772|Aquca_002_00772.1

CYP76F

MNYSAFLLWFFCVLTFLSILTTARRILFASKLPPGPFPLPIVGNLFKLAGNNLILHESLA KLAKIYGPLMTLEFGSLTTVVVSSDKMAQQVLQKHDNSFSGRTVPDVLNILGHHEASIIF AQPSPYWRNIRKLCVSQMFSSQRLNSNDQLRLMKVKQGHLINYIRDNAKSRCAVNIGQVV FSTALSIISTNVFSIDLTQSESAQDFKGVVSKIMEEIKRPNLAGCFPLLSSFDLQGIKKR

MLNYFQKLDNIFDRIIDQRLQSKEEINLSNGDVLDALLHHTQDDGSNLSHSSIKSILKDL FIAGTDTTTVTLEWTMAELLRNPDILAKARLELKKTIDKEKAVEESDIAQLPYLQAIVKE TMRLHPAIPLLPHRAEADTDICSFTVPRHAEVLINVWAIGRDPDIWINPISFQPDRFLCS NVDFRGRNFEFIPFGAGRRICPGLPMAYRMVHLTLASLLHTFDWELEAGEMVSEKSELVL QKPGRLCAIPIEA*

 

>22030306 Aquilegia coerulea|Aquca_004_00259|Aquca_004_00259.1

CYP76G 65% TO CYP76G1 Arabidopsis thaliana

MKFELVYLFLALVMYVTWAMLNERRHRRRQELGQLPPGPRGLPVLGNIFQLGWAPHVSFA ELARKHGAIMTIRLGIMRTVVISSNNVAREMFKNHDMVLAGRKIYEAMKGKEGNEGSLIT AQYGSHWRMLRRVCTSEFFVTSRLDAMKGVRGRCVNNMVQYVEEASEGGTNAIDIGKYIF LMSFNLIGNLMFSKDLLDPKSKRGAAFFYHAGKVMYLAGKPNVADFLPLLRWLDPQGIRR KTEYHVERAFNIAGSFIKERMESELNDVGGEKKKDFLNVLLDFQGNGVEEPAMFTARAIN VIILEMFTAGTDTTTSTLEWAMAELIRNPKAMKKVQDELRDVMKSYRELEEKDLENLPYL KAVIKETLRLHPPLPFLFPHMAMDTCKMLGYYIPKETQVLVNVWAIGRDPESWKDPLVFT PERFLEMDSIDYNGRNFEYLPFGSGRRMCPAIPLASRVLPLALGSLLHSFDWVLPDGLKP ENMDMNERMGITLRKALPLKVIPVPYKGKNRQVSA*

 

>22037263 Aquilegia coerulea|Aquca_012_00227|Aquca_012_00227.1

CYP76G

MELAWLIWSSICLLVVSLIQFFRGKTRNVSYGQLPPGPRGWPLVGNLFDLGEVPHQNLLD LGRKYGPVLWLQFGAMNNVIIQSSKAATEMFKNHDLTYSGRTITDAMTACKYHEGSLAVA QYGPYWRTVKRLCITALTINKRVNETISLRRKGIDKMIQWIDEEAKNQGGVQVGHFVFLM NFNLLGNLMLSRDLIDPQSAEGPEFYDAMDNLMKAAGQPNVADFFPFLKWLDPQGVRKKM EDAVGQGIHIVTGFLKERIEDQKSGEQNKRKDFLDVLLEYEGEGEGPCKISERDLVILIL EMFLAGTETTSSTTEWAMTELLRSPEKMNTLCKELEDVVGHNRKIEESDIEELHYLRAVV KETLRLHPPLPFLLPRRAVKDNNFMGYHIPKDTQILVNVWAIGRDPDSWDDPLSFKPERF IGSDIDYQGQHFQLIPFGAGRRICAGVPLANRVLHLALGSLLHCFDWKLDSSVSPDSIDM KERMGITLRKEVPLKAFAKKRNVHYGIN*

 

>22037478 Aquilegia coerulea|Aquca_012_00057|Aquca_012_00057.1

CYP76G

MGWTLAYTIWSCIWLGVVLLLIKEMFLLRYKKQLPPGPPGWPVIGNLFNLHGAPHHSLAS LSKKYGPVLWLRFGFVNTMVISSADAAMELFKNHDLTFADRKSNEVMRVDGFDQGLISLC QYGPYWRMLRRIYATELFSSKRIKATETLRANCVDKLKKWICEEGQKKVAIEIARFVALG SFNVISNATLSKDNIIDPQSKDGTEFFGSINRAIELCGKPNVADFFPFLRWLDPQGIKKN TQGAIVQPLNFATGFLKERIEWQKSHITSRKDFLDLMLEFQGNEKDGEPTKLSEKNISIL ILGLFIASTDTTSTTIEWAMSELLHNPNIMRNVQAELDQVVGKSRKVEESDIGKLQYLQA VVKETLRLHPPVPLLVPRRARKNTVFMGYSIPKDTQLLVNVWAIGRDPVSWDDPLSFNPE RFLNSSVDYKGQHFQFLPFGAGRRMCAGIMLAERMLHLVLGSLIHSFEWSLEDGITPETI DMRERFGITLRKADPLKAMLKERMAQLNPYKQI*

 

>22037567 Aquilegia coerulea|Aquca_012_00225|Aquca_012_00225.1

CYP76G

MELVGFLWSSSICLLAVLLIQFLRGGKARNSSGQLPPGPRGWPLVGNLFDLGEVPHQALL DLKEKYGPVMMLKFGAMNTVIIQSSKAAMEMFKNHDLTYSGRTITDAMTACKYHEGSLAV AQYGPYWRTVKRLCITALTINKRVNETISLRRKSIDKMIQWIEEGAKTQGGVQVGHYVFL

MNFNLLGNLMMSRDLIDPQSNEGPEFLKAMDKIMILAGQPNVANYFPFLKWLDPQRIRKK

MDEALGQGLRIVTGFLKERIENQKLGEGEGQAKISDKNAVSLMLEMFFGGTETTTSTIEW AMTELLRSPETMNKVRRELADVVGPNRRLEESDIEKLHYLQAVVKETLRLHPAIPFLIPR RAVKDNIFMGYHIPKDTQVLVNAWAIGRDQDSWDDPLSFKPERFVASDIDYKGQHFEFIP FGAGRRICPDTIDMKERMGITLRKNVPLKALPKKRSVHYGIN*

 

>22053575 Aquilegia coerulea|Aquca_002_01431|Aquca_002_01431.1

CYP76AG

MEQLNHLLSATISYLSSLTLTTTLAIIASIFAFSILPIVFRRKNWRNSPPGPIGWPILGY LPFLTDRLHEDLFHLAKTYGPLYSLKMGQKPAIVVSSPEITKEILKNKDATFSSRTITEA VRCVTYDATSLVFVPYGARWRLLRKLLTTELFSTRAIELFQPARKTQVHGLLKKLYTAYE TNTAINMADSTFIVSANLISNLTCSKSLFDSNKKEGRELKAMVSEILEVVGAPNVADLIP FLKVFDPQGLKRRVWKVVKKFDDFFEKLIDERLEERKKGIKMNENGRLDMLDVFLDYKSD KKDDELKQFSRVDIKGMLSDMFVAGTDTSSSTVEWGMTEILKRPEVYKKILAELDAVVGK DRFVEENDIPKLTYFLAAVKETFRLHPGVPLLIPRRTNEACEVYGYQVPKHCIVFVNVWG

MARDPKVWPEPLEFKPERFLGTELDVKGQDFELLPFGTGRRSCVGMPLGHRMVHYSLASL LHAFEWNFPSDILDDLTEKVGITLQKAKTLVGIPKPRLNDSVYQ*

 

>22053896 Aquilegia coerulea|Aquca_002_01291|Aquca_002_01291.1

CYP76

MEYTTILLWILVVWVLHVFISARKLFTGKLPPGPFPLPIIGSLFKLGDKPHKSLAQLAKV HGSLMTIKLGSVTTIVVSSASMAKEVLQTNDQHLSGRTVPDAMRILNHHEASMVWSHSSL PQWRSLRKLCASQIFTTQRLNENEGLRLMKVKDLIAFVRDSSKSRHAVNIGQAVFSTTLN IISNIIFSIDLAQFNSESTQDFKAAVWGVLEEAGRPNLADYIPILRPFDPQGVRRRTATY FGKLDNLFDTLIDQRMQSNKEQNVPNDLLDTVLQYTQENGSKLRRLDITSLLKDLFIAGT DTSAGTLEWAMTELLRNPDIMAKARLELKETIDKDKLIEESDIAQLPYLQAVVKETLRLH PPAPLLVPHRAETDVKICGFTVPRHAQVLVNAWTIGRDPETWINPTAFLPDRFLGSKIDF RGRNFEFIPFSAGRRICPGLPLAYRMVHLMLASLLHTFDWELEDGMTPEDINMEAKFGLT LQKAKPLYAIPIEA*

 

>22054391 Aquilegia coerulea|Aquca_086_00056|Aquca_086_00056.1

CYP76

NNQLPPGPFPFPIVGSLFKLGTEPHKSLAELSKIYGPLMALKLGNVTTIVVSSPTMAKEV LQKNDKAFSSRTIPEAVRVLDNHKHSMIWLPASSKWRSLRKVSSSQLFTTQRLESNQGLR KKKVEELLSYVGENCKNKCAVGIGQVAFSTILNLISNTVFSMDLTHLDSNYAQEFKSLVS IIMEEGARPNFVDYFPILRSIDPQRIKYRMEGHARKLDEFFDGIIKQRLESRKLSKSPRS SCSDFLDAILDYKQEDGFQLSDPDIRAMLRDIFAAGTDTTSSTVEWAMTELLRNPEKMTK AQSELNEMIDENKPIDEADIVRLPYLQAVVKETFRMHPPVPLLIPHKAESRVELCGYIVP KNTQVLINVWTMGRDPNIWENPTVFEPERFLKSNMDFKGQDFELIPFGAGRRICPGLPLA YRMLYLMLASLLHAFNWKLEDGLKPEDMDMEERFGLTLQKAIPLKAIPIKR*

 

>22053534 Aquilegia coerulea|Aquca_002_01292|Aquca_002_01292.1

CYP76

MNYSVLLLWFSFVLAFLYVLTTGRRILFASKLPPGPLPLPIVGNLFKLGTNPHDSLAKLA KIYGPLMTLKLGSVTTIVVSSAKTAQKVLQKHDNSFAGRTVPDAMRISGHHEASMVWSKT SLYWRSVRKLCVSQMFTTQRLNSNEQLRLVKVKGLINYIRDRAESRCAVSIGEAVFSTTL SIISTNVFSIDLTQSESAQDFKNVVCRVMEEAGKPNLADFFPLLRPFDPQGIKKRTANYF RKLDNIFDRVIDQRLQSKDKNLSNDVLDTLLHHIQEDGSKLPHINIKSILKDLFIAGTDT TTVTLEWAMAELLCNPDIIEKARLELKQTIDKQKHIEESDIAQLPYLQAIVKETMRLYPS VPLLIPHRAETDIEICGFTVPRHAQVLINAWAIGRDPDTWINPTSFLPDRFLGSNVDFRG RDFEFIPFGAGRRICPGLPLAYRMVHVILASLLHTFDWELEGGMAPEDINMEAKFGLTLQ KAEPLRAIPIEA*

 

>22055458 Aquilegia coerulea|Aquca_019_00062|Aquca_019_00062.1

CYP76 CLUSTER Y

MITWPWHLALWSGICLAVAIHLLTKHRKISRTLLPPGPPGWPIIGNIFDLDSAAHDTLER LSRKYGPVLWLRLGAVNTMVVSSAKAAAEMFKNHDIAFAGRTTNEALRVNSYDEGSMALS QYGSYWRMLRRICTTELFTNNRINGTQGLRMKCVDSMMKWMWDEAQEKGSVEVARFLGLM SFNISSNVMLSKNLVDPQSKQGDEFFESINHAMELCAKPNIADFFPFLRWFDPQGIKKKT ELTLGRTHKFAYSFVEERILERQNGRKSAKKDFLDVLLDFQGNNKDGEPAKISDKNIGLL IFELFAASTDTTTNTVEWALAELLRNPSIMRKLQDEVDQVLGKNKKIDETDIVKLEYLHA VVKETLRLHPPVPLLIPRKAMKDTEFMGYLIPENTQILVNVWAIGRDPASWEDPLSFKPE RFLSSNIDYKGGHYHYIPFGAGRRICVGMPLAQRSVHLALGSLIQSFEWSLEDGTTPENI DMRERLGVALRKTIPLKA

 

>22055550 Aquilegia coerulea|Aquca_019_00059|Aquca_019_00059.1

CYP76 CLUSTER Y

VLLLQSLRGKARQLPPGPRGWPVVGNLFDLGEIPHLTLFKLGEVYGPVLWLRFGVVNTVV IQSTKAAKEMFKNHDLTYSGRTIIEAMKPYNYYERSMGLAQYGPYWRTIKRLCVTEMAVN QRLNQTAFLRRKGIDKMIQWIEEEAHNQGAVHVAHFVFITTFNMFGNILLSRDLINPQSD EGREFFNAMDIWMQGVGQPNVADFFPILRWLDPQGIRKKIEQNMGQAMDIVSGFLKERIE DQASGKQKQEKDFLDTLLEYEGEGDEEPVKISDKGIAILVLELFVAGTETTSSTIEWAMT ELLRSSETMSKVRKELADVVGCNRKIEERDIEELPYLKAVVKETLRLHPPLPFLIPRKVV KDNNFLGYDIPKDTQVFVNAWAIGRDPESWVDPLSFMPERFLDSDINYRGQHFELIPFGA GRRMCPGIPIAHQVLHLALGSLLHCFDWELDQSVNQQKIDMTERMGITLRKEVPLKAIAK

KRNVYYNL*

 

>22055557 Aquilegia coerulea|Aquca_019_00063|Aquca_019_00063.1

CYP76 CLUSTER Y

MEFTFALVVSSGICLAVALFLITATKKKNELGARKLPPGPPGWPIIGNLFDLGVMPHVSL ASLSKRYGPVVWLRLGAVNTMVLSSAEAAMDMFKNHDLTFAGRNITEAMRACSYDEGSMA LGQYGPYWRMLRRICTTELFTNSKINETEHLRMKCIDNMIRWMWDASLEQGSIQLSRFVS LMSFNVISNVMLSEDLVDPQTKGGDEFFTSISRTTEWGGKPNVADFFPLLRWLDPQRIKK NMTRDVGHALDFASAFIKKRIIDRKNNIRNTKMDFLDVMLDFQGNQKDGEPADISEKNIT IMILELFTASTDTTTSTIEWVITELLRNPSVMRTLQAELDQVVGQNKRIEEVNIGDLHYL QAVVKETLRLHPPVPLLVPHRAMEDVIFMGYSVPKNTQIFLNVWAIGRDPSCWDDPLSFK PERFLSSNIDYKGHHFQFIPFGAGRRMCVGLPLAHRMLHLTLGSLIHSFEWALEDSIVPE NMDMRERLGITLRKADPLKVVLKLRLPQENSDAVK*

 

>22055560 Aquilegia coerulea|Aquca_019_00067|Aquca_019_00067.1

CYP76 CLUSTER Y

MEFELVCLFVALVVYVVWAMLNERHHRRREELGQLPPGPRGLPVVGNMFQLGWAPHVSFA ELARKHGAIMTIRLGIMRTVVISSNDVAREMFKNHDMVLAGRKIYESMKGKKGNEGSLIT AQYGSHWRMLRRVCTSEFFVTSRLDAMKGVRGRCVNNMVQYVEEASEGGTNAIDIGRYIF LMSFNLIGNLMFSKDLLDPKSKRGAAFFYHAGKVMDFAGKPNVADFLPMLRWLDPQGIRR KTQYHVERAFNIAGGFIKERMESEMNDVSGEKKKDFLNVLLDFQGNGIEEPAFTARTINV IVLEMFTAGTDTTTSTLEWAMAELIRHPKAMKKVQDELREVVKSYRELEENDLENLPYLK AVIKETLRLHPPLPFLVPHMAMDTCKMLGYYIPKETQVLVNVWAIGRDPESWKDPLVFTP ERFLEMDSIDYKGRNFEYLPFGSGRRMCPAIPLASRVLPLALGSLLHSFDWVLPDGLKPE NMDMSERMGITLRKAVALKAIPVPYNSKVFA*

 

>22055187 Aquilegia coerulea|Aquca_036_00159|Aquca_036_00159.1

CYP76 CLUSTER Y

MAFEVVAGLLLALALCVLWAMIIDWKQHRREELGQLPPGPIGLPVLGNIFQLSWAPHVSF AKLAQTHGSIMTVRLGTMRTIVISSSDVAREMFKNHDTVLAGRKIYEAMRGKEGASEGSI ILAQHGPRWRMLRRLCTSEFFVKSRLDTTLVLREKCVRGMVRYVQEASDGGTNNAIDIGR YIYLMSFNLIGNFMFSKDLLDPNSTTGADFFYHAGKIMDLAAKPNIADFLPMLRWLDPQG IKRKSQFHMGKGIQSCGGFIKERMEESKDDAGEKRNDFLDVLLNFRGDGVEEPAMFSPRI INASVMEMFIAGTDTTTSTLEWAMAELLQNPMAMNKAQDELRGSQGVLAENDMKTLPYLT AVIKETLRLHPPLPFLVPHKAMDTCKMFGYYIPKETQILVNVWAIGRDRKSWKDPLIFKP ERFLEMNMVDYKGHNFEYLPFGSGRRICPAIPLVSLVLPLALGSLMYSFDWVLPNGLKPE NMDMSERLGITLRKAVPLKVLPVPYKGNPICKVST*

 

>22055342 Aquilegia coerulea|Aquca_036_00045|Aquca_036_00045.1

CYP76 CLUSTER Y

MEWTLASTIWSGICLAIALLVIKNKVWSSSKNRPPGPPGWPIIGNFLDLGAAPHQSLASL SRKYGPVLWLRLGATNTMVVSSAEAAMDMFKNHDLAFADRKTNEAMRVHNYYKGSMAFAR YGPYWRMLRRISTTELFTNNRINGTEDLRAKGIEKMTKWMWEETQEKGSVGVARFVALGS FNVIGNVTLTKDNIVDPQLEAGTEFFVSLTRAIELSGLPNVSDFYPFLKWLDPQRIRKNA EKAMAHPLNFASGFVKERLLARAKGQINEKKDFLDVMLEFKGNQKDGEPAQMSEQNINIL LLELFLAATDTSASTIEWAMAELLRNPHVLKNVEDELDQVVGKNAKVTESDIWKLPYLQA VVKETLRLHPPVPLLVPRRCIEDTEYMGYSIPKDTQVLVNVWAIGRDPASWEDPLSFKPE RFLNSNIDYKGQHYQLLPFGAGRRMCVGVMLGQRMLYLSIASLVHTFEWALEDGVTPETM DMREMFGTSLRKAEPLKAVLKLKVAQKE*

 

>22025945 Aquilegia coerulea|Aquca_065_00041|Aquca_065_00041.1

CYP76 CLUSTER Y

MEWYYAFIIWPSVCLVIAFLVISKSKNKGQGQRPPGPPGWPVIGNIFDLGVEPHRSLARL SRKYGPIMWLRFGAKNTLVVSSAEVAMEMFKKHDLTISDRAINECFKLNKYDQVSMGVAP YGTYWRMMRQLFSNNRIKATEKLRTRSMDNMIKWIWNNAQEKGSVEIARFTEIMVFNAIG NAIFSKDIVYPHSEKGKEFFTATAKILEFITKPNVADFFPWMRWLDPQRVKKKVKQLLGI TIGFSFALVKERILDRQIGKRNEEKDFLDVMLDFQGNRMDGEPTKLPEINISIGILHATD TTTDTVEWAMTELLRNPRVMRKAEVELDQVVGRKRKLEEGDIKNLHYLQAVVKETLRLHP VVPFLVPRSVREDMEFMGYLIPKNTQIFVNVWAIARDPTSWDDPISFKPERFLNSDVDYK GRHFQFLPFGAGRRICVGLPFAERMLHLTIGSLIQSFEWALEDGITPEKISVKESFGLAL RKADPLKVVLRPKLHEMQENVAQVQ*

 

>22038630 Aquilegia coerulea|Aquca_028_00150|Aquca_028_00150.1

like 76/80

MEWTLTYTIWSCIWLGVAILFMKEKFLVSDKKLLPPGPPGWPIIGNLLDLGGAPHHSLMS LSKKYGPVIWLRFGAVNTMVVSSADAAMELFKNHDLTFADRKTNEAMKVGGADQGSISLC EYGPYWRMLRRICATELFSGKRIKDTETLRANCTDKLKKWICEEGQKKGSIEIARIVALG SFNVIINATLSKDNIIDPQSKEGTEFVSSINRVTEFFGKPNVADFFPFLRWLDPQGVKKN IERAIVHPLNFATGFVKERILQRQSGHITSRKDFLDVMLEFQGNEKDGEPTKISEENINL LIMELFISSTDSTSNTIEWAMSELLRNPNIMRNVQEELDQVVGQNRKVEESDIGKLHYLQ AVVKETLRLHPPGPLLVPRRARKNTVFMGYSIPKETQVLVNVWAIGRDPVSWDDPLSFKP ERFLNSSVDFKGQHFQFLPFGGGRRICAGILLAERILHLVLGSLIHSFEWSLEDGITPET

MDMMESLGIVLRKADPLRVKVKERMVLMNSVKEI*

 

>22038608 Aquilegia coerulea|Aquca_028_00294|Aquca_028_00294.1

like 76/80

MEWTLSSTIWSGICIAIALLILKNKFFSSSKNRPPGPPGWPIIGNFLDLGAAPHQSLTNL SKKYGPVLWLRLGAVNTMVVSSAEAATDMFKNHDLAFADRKTNEAMRVHNYYQGSMAFAR YGPYWRMLRRISTTELFTNNRINGTENLRAKGIEKMTKWMWEEAQNNGSVQVGRFVALGS FNVIGNVTLTKDNIVDPQLEAGTEFFASLTRAIELSGLPNVSDFYPFLKWLDPQRIRKNA ERAMAHPLNFATGFVKERLLARQNGQINEKKDFLDVMLEFKGNQKDGEPAQMSQQNINIL LLELFLAATDTSASTIEWAMTELLRNPHVLKKVEAELDEVVGRSQKVTENDIWRLPYLQA VVKETLRLHPPVPLLVPRRCIEDTEYMGYSIPKETQVLVNVWAIGRDPASWEDPLSFKPE RFLGSNIDYKGQHYQLLPFGAGRRMCVGVMLAQRMLYLSIGSMVHTFEWALEDGVTPETL DMKEMFGTSLRKAQPLKAKLKLKVSEGLI*

 

>22038947 Aquilegia coerulea|Aquca_028_00274|Aquca_028_00274.1

like 76/80

MEMFQNHDLAFASRKTNEATGAHFYDKGSMALAQYGPYWRMLRRICTTELFTNNRINGTE SLRSNGIDKLTRWLWEEAQKKGSVEVARFIALCTVNIIGNVTLTKDNIVDPELEEGTEFL ASFGLATELSGKPNVADFFPFLRWFDPQNVLKNAKLAIAPPINFVSCFVKERLLERQKGQ INARKDFLDVMLDFKGNQKNGETDAIMSERNISIVILELFMASTDTTTSTIEWAITELLR HPNIMKNVQMELDQVVGPNKNVKENDIGELPYLQAVVKETLRLHPPVPLLIPRKAVEDTE YMGYSIPKGTQIFVNIWAIGRDPDSWEEPLSFKPERFLSSGIDYKGQHFQYLPFGAGRRS CIGIMLAQRMLYLALGSLIHSFEWAFEDGVTPETIDMKEKFGTSLRKADPLNVVLKLKAE

NQDRKI*

 

>22038609 Aquilegia coerulea|Aquca_028_00161|Aquca_028_00161.1

like 76/80

MEWTLAYTIWSCISLGVALLLIREIFLVSDKKQLPPGPPGWPVIGNLLDLGGAPHLSLAS LSKKYGPVIWLRFGAVNTMVVSSADAAMELFKNHDLTFADRKTNEAMRLNGFDQGSISLS EYGPYWRMLRRICSTELFSSKRIKDTETLRANCIEKLKKWICDEGQKKGAVEIARFAALG NFNVILNAALSKDNFLDPQSNEGTEFFGSVSRVEELVGMPNVADFFPFLRWLDPQGVKKK VERALEHPLNIATGFVKERIEWKKGHITSRKDFLDVMLEFQGNEKDGEPTKISEKNINIL IMELFIASTDSTSNTIEWAMAELLRNPNIMRNVQDELDQVVGQNRKVEESDIGKLHYLQA VVKETLRLHPPAPLLVPRRAVKNTVFMGYSIPKETQVLVNVWAIARDPVSWDDPMSFKPE RFLNSSVDFKGQHFQFLPFGAGRRMCAGVMLAERMLHLVLGSLIHSFEWSLEDGITPETM DMSESFGIALRRANPLRAMLKERMCI*

 

>22038632 Aquilegia coerulea|Aquca_028_00153|Aquca_028_00153.1

like 76/80

MEWTLAYTIWSCISLGVVLLLIREIFLVSDKKQLPPGPPGWPVIGNLLDLGGALHLSLAS LSKKYGPVIWLRFGAVNTMVVSSADAAMELFKNHDLTFADRKTNEAMRLNGLYQGSISLS EYGPYWSMLRRICLTELFSSKRITDTETLRANCIEKLKKWICEEGQKKGAVEIARFAALG NFNVILNAALSKDNFLDPQSNEGTEFFRSVSRVEELVGMPNVADFFPFLQWLDPQGVKKK VERALEHPLNIATGFVKERIEWKKGHLTSRKDFLDVMLEFQGKNGEPTKISEKNISILIM ELFIASTDTTSNTIEWAMAELLRNPNIMRNVQDELDQVVGQNRKVEESDIGKLHYLQAVV KETLRLHPPAPFLVPRRARENTIFMGYSIPKETQVLVNVWAIARDPVSWDDPMSFKPERF LNSSVDFKGQHFQFLPFGGGRRICAGILLAERILHLVLGSLIHSFDWSLEDGITPETMDM SESFGIALRRTHPLRAILKERRCR*

 

>22038690 Aquilegia coerulea|Aquca_028_00151|Aquca_028_00151.1

like 76/80

MEWTLAYTIWSCITLGVALLLIRKIFLVSDKKQLPPGPPGWPVIGNLLDLGGAPHHSLMS LSKKYGPVIWLRFGAVNTMVISSADAAMELFKNHDLTFADRKIIEAMKQDGFDQGSIGLS HYGPYWRMLRRICATELFSNKPIKDTETLRANCIDKLKKWIYEESQKKGSVEIARFVALG NFNVIINATLGKDNFLHPQSKEGTEFFRTVSRATEFCGKPNVADFFPFLRWLDPQGVKKK TKQMLVDPLKFASGFVNERILERQKGHKNSRKDFLDVMLEFQGNEKNGEPAKISETNINI LILELFIASTDTTNATTEWAMSELLRNPNIMRNVQAELDQVVGQNRKFEESDIEKLHYLQ AVVKETLRLHPPVPLLVPRCARENTEFMGYTIPKDTQVFVNVWAIGRDPAFWEDPLSFKP ERFLNSSVDFKGQHFQFLPFGAGRRMCAGMMLAERMLHVILGSLIHSFEWSLQDGITPEK LDMRERFGITLRKADPLKVILKERT*

 

>22038712 Aquilegia coerulea|Aquca_028_00251|Aquca_028_00251.1

like 76/80

MEWQWTFVIWTTFVCLVIGLLVLRNKKGQGRRPPGPPGWPIIGNIFDLGADAHQSLAKLS KKYGPIMWLRLGAKNTLVVSSAEVAMEMFKKHDLAFSDRAISECLKADGYHQASMAVAPY GTFWRMMRRMYTVELFTNNRIKATEDFRTRSMDKMIEWMWKEAKEKGSLELARFVEIMNF NAIGNAIFSKDIVNPQLNNRTEFFTSTAQALELLTKPNVADYFPWLRWLDPQGMKKKMKQ LIRRIIGLTSALVKERILDRQNGKRNEKKDFLDVMLDFQGNQLDGESANLSERYISIGIQ ELLQAATDTSTSTIEWAMTELLRNPKVMRKVEAELDQVVGPKKVEEGDLRNLPYLQAVVK ETLRLHPALPLLVPRSVREDTEFMGYSIPKNTQIFVNVWAIARDPASWDDPLTFKPERFL SSDVDYKGQHYQFLPFGSGRRMCVGLPLAQNMLHRTISSLIHSFEWSLEDGITPDKINVE ERMGLSLRKADPLKVVLKLRSVQENVAKMQ*

 

>22045736 Aquilegia coerulea|Aquca_027_00388|Aquca_027_00388.1

CYP77A

MNFSTISMDFSSFSFSTSLCSYFNLSTTALVFFVSVFLVLLSRKAKSKRVKLPPGPPGWP VVGNLFQLARSGKQFFQYVRDLQPKYGPIFSLKLGTRTVIIVTSPELAHEALIEKGQVFA NRPAEHATRAIFSSNKFTVNSAVYGPTWRSLRRNMVQGMLSSTRVKDFRDVRNSAMNRLI TRLQAEAESTDGVVSVLKNVRFAVFCILLDMCFGVGMSEDTIVKIDETLKDVLVTLLPRL DDFLPMLSPFFSKQRKRALEVREEQMQTILPLIEKRRSALLNPGSDETASMTFAYLDTLF DLKIEGRKSVPSEAELVSLCSEFLNGGTDTTATAIEWGMARLIQKPEIQSKLYSEIKSTV GDRTVDEVDVEKMPYLNAFTKELLRKHPPTYFVLSHAVTQPAKLAGYDIPANASVEFFSA AIGEDPKTWSNPKEFDPDRFFTGSEDADITGVTGVKMVPFGVGRRICPGLGIGTTHIKLM IARMVQEFEWSAPPSQDVIDFTETLQFTVVMKTPLQAMMKPRT*

 

>22026327 Aquilegia coerulea|Aquca_122_00018|Aquca_122_00018.1

CYP77A

MASLTSLPSYDHVFFGVIAFLVSVLIVFFSTKTKAKPLKLPPGPPGWPLVGNFFQVARSG KSFFQYVQDMRQKYGPIFTLKMGTRTMIFITSADLVHEALIEKSQIFASRPAETPTRTIF SCDKFTVNSAVYGPVWRSLRRNMVQGMLSTTRLKDFRNVRESAMDKLVDRIRVEAEANNG AVWVLKNARFAVFCILLSMCFGLEMDEKTIEKIDDLLKTVLITLNARLDDYLPILSPFFS KQRKRVMEVREEQLKTLVPFINKRRSALKNPGSDPTAATFAYLDTLFDLTVEGRKSVPSD TELVTLCSELLNGGTDTTATGLEWAIARLIDNPDIQSKLYNEIKSGVGNRKVDEKDVEKM EYLNAFTKELLRKHPPTYFSLTHAVTQPAKLGGYDVPTDATVEIYLPTISDDPTLWSRPE VFNPDRFLSGKEEADITGTRDIKMIPFGAGRRICPGLSMAMIHVNLMVARMVQEFEWSAL PTQNKIDFSVKLEFTTVMKHTLQAVAKPRV*

 

>22041472 Aquilegia coerulea|Aquca_077_00055|Aquca_077_00055.1

CYP77B

MEFIDLLLLFVALSLTFLWVRYWSVTGGGPKNLPPGPPGWPIVGNLLQVCLQRRNFMYIV RDLRTKYGPIFTMQMGQRTLIIVTSADLIHEALVQKGPIFASRPADSPTRLLFSVGKCTI NSAEYGPLWRTLRRNFVTELINPARIRQCAWIREWAMDNHLKRLQKEALETGSVEVMSNC RLTICSILICICFGARISEARIKEIEAVLKDVMLMTTPKLPDFLPIFTPLFRKQLTEARE LRRRQMECLVPLVRSRRVFVEGGRIPSGNPDGLETEMASPIGAAYIDSLFGLEPVGRGRL GEEELVTLCSEVMNAGTDTSATTAEWALLHLVLDQNIQQKLYEEIVNCVGKNGKITEENV ENMTYLGAVVKETFRRHPPSHFVLSHAATKETELGGYTVPADANVEFYTAWVTEDPSVWK DPGEFRPERFLEGDGVGVDVTGSKGVKMMPFGAGRRICPAMTLGTLHVYLLLAKMVQAFK WVPIQGAPPDPSETFAFTVVMKNPLRAVILPR*

 

>22052132 Aquilegia coerulea|Aquca_002_00857|Aquca_002_00857.1

CYP78A

MSSENLLFFLPSSSFELSLCFLLLVAIFGFWLAPGGLAWAISKTHSQVQAKTAIPGPSGF PLLGLVFAFTGSTTHRVLANLAKTFKAIPLMAFSVGFTRFIISSCPDTAKEILNSSSFAD RPVKESAYELLFHRAMGFAPFGEYWRNLRRISATHLFSPKRITGFATFRSEIGEKMINEI KCQMGLNGEVEVKRVLHFGSLNNVMMSVFGTFYDFKQLNGDGFKLEELVSEGYELLGIFN WSDHFPLMGWLDLQGVRKRSRVLVSKVNVFVGKIIEEHRNRRINGVLGQECVGDFVDVLL DLEKEHSLSDSDMIAVLWEMIFRGTDTVAILLEWILARMALHPDIQAKAQSEIDTVVGTN RLVSDSDLPNLPYLQAVVKESLRVHPPGPLLSWARLAIHDVHIGKNFIPAGTTAMVNMWA ITHDESIWSEPNEFKPERFIDEDVSIMGSDLRLAPFGSGRRVCPGKALGMATVQLWLGQL LQSFKWVPSEGGVDLSECLNLSLEMKKPLICKAIPRFA*

 

>22028846 Aquilegia coerulea|Aquca_014_00490|Aquca_014_00490.1

CYP78A

MELGFVSKDSSWWVFTLPAFLGTKTLFDDGFVVVSLFIASMLVALLTWAFSVGGVAWKNG RNQRGSVSIPGPHGLPFFGSLFSLSCGLAHRTLASMATSQAATQLMAFSLGSTPVVVSSD PHTAREILTCPHFADRPIKQSAKMLMFSRAIGFAPNGTYWRLLRRIASSHLFAPKRIAAH EAGRQIDCTIMLKHIAKEQSSYGTVGLRKHLQDAALNNIMGCVFGKRYDVAHDSKELNEL RDMVREGFELLGAFNWSDHLPWLSYFYDPFHINERCAALVPRVRKLVQRIIEEHKNRGSN KMLSDNADFVDVLLSLSGEENLEENDMIAILWEMIFRGTDTTALLTEWVMAELVLNPNIQ AKLQKELDRVVGNKSITDADIANLPYLQAVVKETLRVHPPGPLLSWSRYSTSDMQLSNGM LIPANTTAMVNMWAITHDSNVWSEPLLFKPERFLESDGGVNMDVRGNDLRLAPFGAGRRV CPGKNLGLVTVNLWVAKLVQNFKWTPNQEKLIDLSEVLKLSCEMLNPFSSVVVPRNSSSI

V*

 

>22062807 Aquilegia coerulea|Aquca_016_00126|Aquca_016_00126.1

CYP78A

METKIESLWVLALITKCYNFSSENLISSFFLLLSVWFAMVLIYWAYPGGQAWGKFYWIRK PDTKFIPGPRGLPLFGSMNMMASRVAHQRLASEADRLGAKRLMALSLGETRVIVTSNPNV AKEILNNSVFVDRPAKESAYMLMFNRSIGFANYGVYWRTLRKIAATHLFSPKQINSFESQ RLEIANQMISNFGNEGNVRVRDTLIRASLNNMMCSVFGREYGLGSFSKESEEVSELVQEG YELLGLLNWSDHLPWLARFDPQLIRFRCSKIVSRVNRFVRRIIAEHRAQMTEGKNQDFVD VLLSVEGPDKLSDTDMAAVLWEMIFRGTDTVAILIEWILARMVLHPEIQTKVQKELDEIV GTSRGVRESDIPAMTYLPAVIKEVLRLHPPGPLLSWARLAITDTIIDGKQVPAGTTGMVN

MWAIMRDPEVWCNPLEFEPERFLTKDAEVEFSVLGSDLRLAPFGSGRRSCPGKALGMTTV SFWVASLLHEFEWKSVKESPVDLSEALKLSCEMARPLVVKLQSRRR*

 

>22037721 Aquilegia coerulea|Aquca_011_00168|Aquca_011_00168.1

CYP78A

MKAYLLVNLCLFILCFQANNNLIPWPLFLFLFSFFSFLLFLLNFWLIPGGFAWRNSIKNS PKLKGPIGWPLLGSIPLMGTLAHRKLATFSNSCDAIRLMAISLGNTRVIISSHPETAKEI LCGSAFSDRPIKQSAQLLMFERAIGFAPSGKYWRHLRRIAANHMFSPRRIANLEGIRGSI VDEMMARVLDEMKKSGVVELRGVLQRGALSNILESCIGRCLSVDRDELGLMVKEGYELIK SFNWEDYFTLGLLDFYGVRRRCHKLAVRVNSLVGEIIKVRKKEGVCHGRDDFLSVLLNLP EEDRLSDSDMVAVVWEMIFRGADTVALLLEWVMARMILHPEIQAIAQQELDACVGNDRQV QDSDLPNLPYLQAIVKEVLRMHPPGPLLSWARLAIHDIHIDKFFIPAGTTAMVNMWAITH DESIWKDPWTFRPERFMEHEISVLGSDLRLAPFGAGRRVCPGKALGLATVHLWLARFLHK FSWSPTHPIDLSECLRLSLEMKKPLTCRALVRNCIGVS*

 

>22027240 Aquilegia coerulea|Aquca_045_00209|Aquca_045_00209.1

CYP79A

MTNNTTSTFSSSFLNQWGSGKIYVTGLAGFLLTVTFPTTAFIFLASILIYFIQFRSKLKL RKKKASLPPGPVPWPIVGNIPELVTKKPAFRWIEMLMKEMNTDIACIRLGSTHIIPVKCP IIAREFLKKQDAIFASRPITMGTEYSSRGFLSVAVAPWGDQWKKMRRVVASEVINPARLR WLLEKRTDEADNLVRYVYNQCMSSDQVNSPDVNCGGAVVNVRVATRSYSGNVIRKLMFNK RYFGEGRSDGGPGAEEEEHVGALFTVLSLLYAFSISDYIPRLRCLDLDGHEKIMKAATKI VNRYHDTIIDERIKQWRDEENEFRCPMKEPEDLVDVLISLKDNKGKPILSPDEIKAQSAD LIYASVDNPSNAVEWAMAEMINQPELLLKAVEEIDRVVGKDRLVQESDFPKLNYVKACAR EAFRLHPIAPFNLPHVSNVDTTVAGYFIPKGSHVLLMRTGLGRNPNVWDEPLKFNPERHL NGSTEVELSESELRFISFSTGRRGCVGVSLGSAMTTMLLARLLQGFNWTVPHGESRIDLS ESTHDLFLAKALHAHATPRLPAHMYPKN*

 

>22039312 Aquilegia coerulea|Aquca_160_00002|Aquca_160_00002.1

CYP79A

MNTQIACIRLGRVHVITVTSPEVGQELLLRQDSIFCSRPVHMSTEISAYGYLTVVLTPYG EQWKKMRRIVTSEVLSTQRLRWLQDKRMEEVDHLTRWVYNLCNNDVGGLVKVRTVAQHYC GNVIRKLMINKRYFGEGMVDGGPGPEEIEHVDSLFKILGYINAFSVSDYLPWLRRFDLDG HEKILRNALENIKKYNDPVIDERIHMWRVKKEKKEVQDILDVLILLTDDSIGSPLLTSSE IKAQILELMLAAVDNPSHATEWALAEMINEPKLLQRAVEELDEVVGKGRLVQESDLSNLN FIKACAREAFRLHPVSAFNVPHVSTADTNVAGYFIPKGSHVFISRTGLGRNPKMWKEPLK FKPERHLNPDGSQVVLSDPKLGLLSFSTGRRGCPGVVLGSTMTTMLLATLLHGFTWTMPP SMVSISLAEAEHDLTLSKPLVGLAKPRLAKNVYPTL*

 

>22039313 Aquilegia coerulea|Aquca_160_00001|Aquca_160_00001.1

CYP79A

MVDGGPGPEEIEHVDSLFKILGYINAFSVSDYLPWLRRFDLDGHEKILRNALENIKKYND PVIDERIHMWRVKKEKKEVQDILDVLILLTDDSIGSPLLTSSEIKAQILELMLAAVDNPS HATEWALAEMINEPKLLQRAVEELDEVVGKDRLVQESDLPNLNFIKACAKEAFRLHPVWE FNVPHVSTADTNIAGYFIPKGSHVIISRTGLGRNPKIWEEPLKFKPERHLNPDDSQVVLS DPKLGLLSFSTGRRGCPGVGWAKKPKNRKPNRKNRVKTGQNRVD*

 

>22038847 Aquilegia coerulea|Aquca_028_00119|Aquca_028_00119.1

CYP79A

MVCISHLTYHYTHFMELTNVSSTFSWVFYIALSVVLTLVIHKLKQLLGFRKKHTLPPGPK PLPIIGCLHLMVFNKPAFRWIHKMMDKMNTKIACIRLGKVHVITVTCPEVGQELLVRQDN IFCSRPVHMSTQIPTYGYLTVALTPHGDQWKKMKRVVTSEVLSTQKHSWLHDKRMAEADN LTRYVYNLCNNDGCIVKVRTVAQHYCGNVIRKLMLNKRYFGKGRVDGGPGPEEIEHVDSL FKILGYINAFSISDYLPWLRLFDLDGHEEILRNALECIKKYNDPVIDERIDMWRRNGKKE EKMTEEAQDILDVLIRLTDPSTGAPLLTSSEIKAQILDLMLAAVDNPSHATEWALAEMLN DPKILERAVEELDQVVGRDRLVQESDLPKLNYVKACAREAFRLHPVSAFNVPHVPTADAN VAGYFIPKGSHVLISRISLGRNPKIWKEPLKFKPERHFNPDGSQVNLVDPKLGLLSFSTG RRGCPGVVLGSTMTTMLLATLLHGFTWTTPPSMMSSNLVESEDDLSLSKTLHGFAKPRLP

KNLYPN*

 

>22037622 Aquilegia coerulea|Aquca_259_00001|Aquca_259_00001.1

CYP79A

MAFTKTTSNVSSTNTASTTILSYFHWSILITLLAVLSILVIYKLVNLLLQGNQKKKTLPP GPKSLPIIGCLHYIVGNKPAFRWMHSMMEKMNTQIACIRLGRVHVITVTSPEVGQELLLR QDSIFCSRPVHMSTEISTYGYLTVRTVAQHYCGNVIRKLMINKRYFGEGMVDGGPGPEEI EHVDSLFKILGYINAFSVSDYLPWLRRFDLDGHEKILRNALENIKKYNDPVIDERIHMWR VKKEKKEVQDILDVLILLTDDSIGSPLLTSSEIKAQILELMLAAVDNPSHATEWALAEMI NEPKLLQRAVEELDEVVGKDRLVQESDLSNLNFIKACAREAFRLHPVSAFNVPHVSTADT NVAGYFIPKGSHVFISRTGLGRNPKMWKEPLKFKPERHLNPDGSQVVLSDPKLGLLSFST GRRGCPGVVLGSTMTTMLLATLLHGFTWTMPPSMVSISLAEAEHDLTLSKPLVGLAKPRL

AKNVYPTL*

 

>22057384 Aquilegia coerulea|Aquca_057_00096|Aquca_057_00096.1

CYP79A

MEKMNTQIACIRLGRVHVITVTSPEVGQELLLRQDSIFCSRPVHMSTEISTYGYLTVALT PYGEQWKKMRRIVTSEVLSTQRLRWLQDKRMEEVDHLTRWVYNLCNNDVGGLVKVRTVAQ HYCGNVIRKLMINKRYFGEGMVDGGPGPEEIEHVDSLFKILGYINAFSVSDYLPWLRRFD LDGHEKILRNALENIKKYNDPVIDERIHMWRVKKEKKEVQDILDVLILLTDDSTGSPLLS SSEIKAQILDLMLAAVDNPSHATEWAFAEMINEPKLLQRAVEELDEVVGKDRLVQESDLS NLNFIKACAREAFRLHPVSAFNVPHVSTADTNVAGYFIPKGSHVFISRTGLGRNPKMWKE PLKFKPERHLNPDGSQVVLSDPKLGLLSFSTGRRGCPGVVLGSTMTTMLLATLLHGFTWT

MPPSMVSISLAEAEHDLTLSKPLVGLAKPRLAKNVYPTL*

 

>22037374 Aquilegia coerulea|Aquca_012_00171|Aquca_012_00171.1

CYP79A

MAFTKTSSNVSSTNMAFSSITSSFPWSFLIALLAVLGTLVIHKLLNLLLIGYQKKKTLPP GPKPLPIIGCLHYIVGNKPAFRWIHSMMEKMNTQIACIRLGKVHVITVTCPEVAQEMLVK QDSIFSSRPVHMSTEISTYGYLTVALTPSGEQWKKMKRIVTSEVLSTQRHRWLQDKRMEE TDNLTRWVYNLCNNDEGGIVQVRTVAQHYCGNVIRKLMINKRSFGKGMVDGGPGQEEIEH VDSLFKILGYINAFSISDYLPWLRRFDFDGHEKILRSALENIKKYNDPVIDERIHMWRVN KEKKEAQDILDVLIQLTEDSSTGAPLLTSSEIKAQILDLMLAAVDNPSHATEWALAEMIN EPKLLQRAVEELDEVVGKDRLVQESDLPKLNYIKACAREAFRLHPVSAFNVPHLSTKDTN VAGYFIPKGSNVFISRTSLGRNPNIWEEPLKFKPERHLNPDGSQVVLSDPKLGLLSFSTG RRGCPGVQLGSTMTTMLLATLLHGFTWTVPQPMLSSSISLAEAERDLTLSKPLLGLAKPR

LAKNVYPML*

 

>22059163 Aquilegia coerulea|Aquca_013_00368|Aquca_013_00368.1

CYP80G1

MDLQVALFSLIPIILVCILFFKSKHKNLPPGPHAWPLIGSLPVLFTNTEVPLHITLTNMA HTHGPMMILWLGTQPTLVASTAEAAMEILKTKDRVCSGRHIRMSFRLKHHIKYSLVWSDC TDYWKLLRKIARTEIFSPKMLQAQSHVREQKVGELVEYLRSKEGQVVKLTQFVFGTLLNI LGNVVFSRDVFVYSDDDGNKDGIQNLIREMLMIGAEPNIAEFYPILEELDLQGLKRKCDE RFLRVMKLWKGTVNERKEKRNEETKDMLDVLLANDFNDAQINALFLETFGPGSETSSATI EWVMSELIKNPKEMAKVRKELDEVVGTSTVKESHLPQLPYLQACIKETMRLHPAAPFLLP RRAIEACELMGYTIPKDCQILVNAYAIGRDPHSWTDPLTFRPERFFESDVDYHGGHYQFI PFGSGRRTCVGMPLATRTIPLIVGSLVHTYDWGLPDGKRPEELELKEMLSLSLAIDPSLC

VVPKMRV*

 

>22052738 Aquilegia coerulea|Aquca_002_00420|Aquca_002_00420.1

CYP80G

MEVLSAALVPSIFFFLIIFFILRVKDSRRKDLPPGPRPFPIIGNLLQLGDKPHAEFAKLA QKYGELFTLKLGSQTVVVASSPAAAEEILKTHDRIFSGRYVFQSIRVKEHIENSLVWSEC NENWRLLRKVCRIELFSPKMIESQAYIREVKALDMVRFLRKKEGQVVKIVEVVFGTLVNI FGNLVFSKDVFDLENPSGGSAELKEHLWKLMDIGNSTNPADYFPIMGKFDLFGQRRQVAK VLEEIYDVWGVMLMERRRMKGKKENDFVNVLLDAGLDDQKINALLMEIFGAGTETSSSTI EWAITELTKNPRVMSKLRSELIDAVGEKTVKESDIPHLPYLQAIVKETLRLHPATPLLLP RRALETCKVMNYTIPKECQIMVNAWAIGRDPKTWDDPLTFKPERFINSNVDYKGNDFELI PFGGGRRICPGLPLASQFLSLIVATLVQNFDWSLPQGMNTHVLSMDEKFGLTLQRDQPLL IILKARNSTM*

 

>22044866 Aquilegia coerulea|Aquca_049_00115|Aquca_049_00115.1

CYP80H1

MEQSNLFIFILLLILFVLFLVLHHMRQKFSKYPPGPYPLPILGNFLHLRKTPHISLANLA KVHGPLISLRLGAKLLVVASSQEAATEILKIHERVMSGRPVPLTIEAVSKGLDFFTLIGA TSCTKNWKILRTIVKAELLSTEVVDKTTAAREEKVKELINLLSSKQGKVVNLGDYVFATA ANTVSRLLFSKDCISLENQGMVGGFSKENIKTIVKMASTPNLGDHYAIFNGLDIQGLGKK SVECLGRLYASWNSLIDGRHVSKCGDHVGKDKDFLDVLLANGFSKDQINLILSEMFITGI DTTSTAVEWAMAELIKNQDAMTKLSEELAKEIGGNIIRDSDLPRLPYLNACVKETLRLHP SVAMIPRRAIETCQVMNYTIPKNAEIWVNLWALGRDPTKWEDPLAFKPSRFLQSHLGFMG SHFEYIPFGSGRRMCPGLPLAVRLVPLVLASLVHSFDWYLPENLSPGELNMDAKLGLTLQ RVKPLYLIPRPK*

 

>22060934 Aquilegia coerulea|Aquca_035_00220|Aquca_035_00220.1

CYP80H?

MNLFFLNVLLVLPVFYLILEYTRRKFSNYPPGPYPLPILGNFLNLHKPGHIALANLAKVH GPLMSLRLGTKLLVVGSSQAAATEILKINDRVMCGRRIPQTFEAVGKTFDLVSILGANKC NENWKMLRTMFKTELVSAEATEEKSVLREEKVKVLIDFLSSNKGNVVNIGEVVFTTAANF ISNLLFSKDFISIKDEGKVGAAKEHIREMERLASCFNLEDYYPIFRGLDIQGLGKKALKC IESLNACWDVIIDERQESIKNGAICKDKDFLDALLANGLNKDQINWIFGEILITGVDTSS GAVEWAMAELIKNPEAMTKLREELTKELGGGTIVKDSDLPRLPFLNACVKETLRLHPTVT IVTRRSTETCKVMNYTIPNDSLVWVNLWALGRDPTKWDDPSAFRPSRFLESNLGFMGSNY EYLPFGTGRRMCPGLPLAARLVPLIVASLVHSFDWYLPDNRSPTELDMVEKLGITLQKAE PLLLIPKSKGL*

 

>22054159 Aquilegia coerulea|Aquca_116_00004|Aquca_116_00004.1

CYP80

MAFEVVAGLLLALALCVLWAMIIDWKQHRREELGQLPPGPIGLPVLGNIFQLSWAPHVSF AKLAQTHGSIMTVRLGTMRTIVISSSDVAREMFKNHDTVLAGRKIYEAMRGKEGASEGSI ILAQHGPRWRMLRRLCTSEFFVKSRLDTTLVLREKCVRGMVRYVQEASDGGTNNAIDIGR YIYLMSFNLIGNFMFSKDLLDPNSTTGADIFYHAGKIMDLAAKPNIADFLPMLRWLDPQG IKRKSQFHMEKAFNLVGGFIKERMEESKDDAGEKRNDFLDVLLNFRGDGVEEPAMFSPRI INANVMNDMKTLPYLTAVIKETLRLHPPLPFLVPHKAMDTCKMFGYYIPKETQILVNVWA IGRDRKSWKDPLIFKPERFLEMNMVDYKGHNFEYLPFGSGRRICPAIPLVSLVLPLALGS LLYSFDWVLPNGLKPENMDMSERLGITLRKAVPLKVLPVPYKGNPICKVST*

 

>22056922 Aquilegia coerulea|Aquca_034_00039|Aquca_034_00039.1

CYP80

MEVLSATIVSLIFFFLFIFLILRDSRRKDLPPGPRPAPIIGNLLQLGDKPHAEFAKLAQK YGELFTLKLGSETVVVASSPAAAAEILKTHDKILSGRYVFQSFRVTEHVRNSIVWSECNE TWKLLRKVCRTELFCPKMIESQAYIREAKALDMVRFLRKKEDEVVKIVEVVFGTLVNIFG NLIFSKDVFDLEDPTGGSTELKEHLWKLLDLGNSTNPADYFPIMGKYDLFGHRREVAKVL EQIYDVWGVMLKERRGTKGNKANDFVNVLLNAGLDDQKINALLMEMFGAGTETSASTIEW AITELTKNPRVISKLRSELINVVGDKTVKESNIPHLQYLQAFVKETLRLHPATPLLLPRR ALETCKVMNYTIPKECQIMVNAWAIGRDPKTWDDPLTFKPERFMHSSVDYKGNDFELIPF GGGRRICPGVPLASQFLSLIVATLVQNFDWSLPQGMNIHELTMDEKFGLTLQKDLPLLIV LKARNSIQLQD*

 

>22057005 Aquilegia coerulea|Aquca_034_00038|Aquca_034_00038.1

CYP80

MEIIYVVFIVSLPLYFFLFILRDLCQKNLPPGPYPSPIIGNLLQVGNKPHVQFAKLAKTY GDLFTLKLGFQRVVVASSPAAAIEVLKKHDKILTGRYVFQSIRVKEHIENSLVWSECNEN WRLLRKICRTELFSHKMIESQAHLREAKVLDMVRFLQKKEGEVVKIVEVVFGTLFNIFGN LLFSKDVYDFEDPTGGKAEMKEHFWKLLEIGNATNPADYFPIMGKFDLFGQRREVASVIR QIYDVWGVMLKERRRMKGNENDFVSVLLSAGLDDLKINALLMELFGAGTETSASTIEWAV AELTKNPRVTFNIQSELVNVVGEKTVKESDIPHLPYLQAFVKETLRLHPPTPLLLPRRAL ETCKVMNYTIPKDCQIMVNAWAIGRDPKTWDDPLTFKPERFMNSSVDYRGSDFELIPFGG GRRICPGLPLASRFLNLILATLIQNFDWSLPQGMTANELSMDEKFGLALQKDPPLLIVPK

SRTTSIN*

 

>22038606 Aquilegia coerulea|Aquca_028_00215|Aquca_028_00215.1

CYP81

KPLHRSLVKLSEKYGQILFLRYGFRKVVLISSSSAIEECLTKNDIAFANRPHLIVGEHLG YNWTMFVWAPYGDHWRNLRRITALEVFSSYRLQLFSSVQSEEIRSLVLQLFRDSDCQNFH KVEFKTMFFELVLNILMRMIAGKRYYGENVADTDEAKRFRATVKESFYLIGTPNIADFLP FLRRFDIQGLEKRMVKLGKERDTILQKLSDEHRERKNVTINQVGQEKKTMIDVLLLQQVA DPGYYTDEIIKGIIATLLTAGTDTSSLTMEWAMSLLLNHPESMKKAKDEIDLHVGQERFL EESDLPNLPYLNNIINETLRLYPIAPVVIHESSKDCTVGGFHVPSNTMLLINLWVVHRDP NIWIEPMKFNPERFEGIENDGFKFIPFGSGRRRCPGEGLATRMVGLTLGVLIQCFDWKRV GEEMVSMREGTGLTLPRATPLVAMCKPNPSLKHL

 

>22048173 Aquilegia coerulea|Aquca_007_00785|Aquca_007_00785.1

CYP81

MELLYYLLLILFILFILKVFSQTNKKNLPPSPFALPILGHIHLFKKPLNRRLQTLSNRYG PILFLQFGSRPVLVISSSSLVEECFTKNDLIFANRPSSIAGDHLTYNYTIFVWSPYGYHW RNMRRIATIEIFSAKSLHMSAKIHKEEICHLVSSLFRGSTVGSQHFNLKFMFSQLIFNLM

MRLVAGKRCFEESMDLDEQKRLHILLKEIFFPGVIFELGDFLPILRKIGLYTDQEKCQIM HARRDLFLQNLINEFRRKQIDSSPATIAEDKKIKTTIIEVLLSIQEAEPEQYSDDFIKGI IMTMFVAGTDTSSLTLEWAMSLLLNHPDVLQKACLEINHNVQGRLLEDYDLPKLPYLHCI INETLRLYPAAPLLIPHLSSEECTVGGYNIPRGTILYANIGAIHRDPELWTDPDKFMPER FEGDQTEREMGFKFMPFGVGRRMCPGANLAQRVVALALGTLIQCFEWERVGQDQVEMHET NTGVTIPKANPLVAMCKPYPSMVETISQLSSVN*

 

>22048190 Aquilegia coerulea|Aquca_007_00787|Aquca_007_00787.1

CYP81

MAFLYYFLLTLFILFILKVFSQRNKNLPPSPFALPILGHIHLFKKPLNRTLQTLSNRYGP ILFLQFGSRPILVISSLSLVEECFTKNDIIFANRPFSIAGDHLSYNYTVLASSPYGDHWR NMRRITTIEIFSAKSLQMSAKIRKEEIHRLVNSLFRRFNGGSQHFDLKFMFSQLMFNIMM RLVAGKRCFEEFMDLDEQKRIHVLLKNTFVPIMLLDWGDFLPILRWIGLYKEDKGIIKLH QRRDSFSQNLINEFRRKKTESSTTTLAEDMKKTTIIDALLSIQEAEPEQYSDNFIKGIIL TMFTAGTDTTSLTLEWAMSLLLNHPDVLQKVRSEINHNVQGRLLDDYDLVKLPYLHCVIN ETLRLYPAAPLLVPHSSSKQCTVGGYSIPRGTILFANVGAIHRDPKVWVEPTKFMPERFE GVQSEREMGFKFMPFGVGRRGCPGAGLALRVVTLALGTLIQCFDWERVGQEQVDMEEANT GVTMPKANPLVAMCKPHPSMVNVLSQV*

 

>22048308 Aquilegia coerulea|Aquca_007_00784|Aquca_007_00784.1

CYP81

MHLPISIIFYLQEQMTHGNLPPSPFALPIIGHLYLFKQPLHRTLSKLSNQYGPVMYLRFG SRPVVVISSPSAVEECFTKNDIVFSNRPRVLAGKHLHYNYTALGVTPYGQHWQKLRHIMA KTIFSTNAISMFSDVRGQEVQTLLKQLFHNSKAGPCKVELNSRFWELVVNTTMGMIARKQ YYGNNVVDFEEARRFHDLIKETLDLSGAKLNDLLPLLNLIDFQRLEGRMVNLKNKMDTFL QSLINEHRKVKNTSNEGLRKKVIIDDMLSLQKIEPHYYTDEFIKGIIWTLLMSGIDTSIS PMEWAMSLLLNNPETLNKARAELDAYVGHNRLLDESDLPKLKYLQCIINETLRLYPSAPL LVPRESSDDCTIGAFDIPRGTMLLVNAWAIHRDPNVWKYPKLFKPERFESGTADTEGYKF IPFGSGRRRCPGSIMSMSIVKLTLGSLIQCFEWERISEEKIDMHEGSGITMHKTKPLETV CKPCQSMIHVLNKL*

 

>22038768 Aquilegia coerulea|Aquca_028_00050|Aquca_028_00050.1

CYP81

PPPFPILGHLHLVKKPLHRTLEAVSKRYGPILFLHFGSRPVLLVSTPSIVEECFTKNDVV FANRPNMLAAKHLNYNFTTLPSDNYGSNWHNLRRFTVQEIFCLTRLNVTSSIRREEVQLF VQQLGQKYNESSCRMKKVELKSKFNDLIFNSMTKMLGLKRYYGEDVKAEDLEEAKLFKEI IEETVSLIGSPFIGDYLPMLRWLDFKGAQKKMIRLKNKRDCFLRGVLNEHRRMKANGMSS DEGITTLDVLLSMQETEPDYYTDEKIFGIIMTFLTAGTHAPAMTLEWAMSLLLNHPKALN KARAEIDACVGKGRIIEESDLPKLTYLQMVINETLRLFPPSSLIVPHQSSSECTVGGFDI PQGTMLLVNTWAIHRDPKNWVDPDKFIPERFENGEGDKGFKFTPFGFGRRGCPGTRMAMR

MVGLTLGSLLQCFEWERTFAEEIDMAEGPGITIPKIIPLEAPYQPREIMTNVVAAGL*

 

>22038853 Aquilegia coerulea|Aquca_028_00121|Aquca_028_00121.1

CYP81

MEPKWLYYVSLFSALIALTVFKLFKTRATTSSQKLPPSPPGARPFFGHLHLLENPLHRTL EKLSLTHGPIFSLRLGSRLAIVASSPTSIQECFAKNDANFANRPHSTLHRHLGYDYTALV SANYGDHWRNLRRLCSAEIFSPGRLNMFLFIREEEIMNLMSSLYKMCSGGAFARVELRWK LCELTFNNITRMVAGKRYYGDVGIENKGEAKQFQQLIGAAFKLSGAANAGDYLPFLRWID YAGIEKNMSIISKKMDNFLQGLINERRQCNSNDTMIDHLLSLQQSQPDYYTDDIIKGLVL NTLIGGTNTSETTIEWAMSLLVNHPEVLKKARDEIDTQVGFERLVKEEDLSKLPYLKCIV SETFRMFPPLPLVLPHESSQDCKLGGYDVPRGTIILANAWAVHRDPKVWDEPNNFKPERF EGGLKEVEVQKLLPFGMGRRVCPGAGLGQCVVGSALGCLIQCFEWDRVNAEKVDLVEGTG LAMPRANPLVVVCKPRQVMDKVFKKLKIS*

 

>22045461 Aquilegia coerulea|Aquca_027_00251|Aquca_027_00251.1

CYP81

MEIQYLVASILVALFITYTLLRKKHHQKKLPPSPQSLPIIGHFHLLVNKPIHIAIGNLLQ KYGPILFLRFGFRPVLILSSPTAIKECFTKNDIIFANRPSMLLGKIVDKYEAVAMISYGD TWRNLRRLTTTEIFSTIRLDMSSNIRKEEVSSVIRQMYKGYDGEFKQVELKSIFCKLAFN INAKVFGTKPFFGEEEMADHKKAKDKLDELKSLFLPNEILFGAGDFFPFLKWLDHWTVEK IMLKFHHKRDKFMQDMIDDHRSTRAASSSFSRSNTNEDMKEEMEKKRSLIDVLLSLKETE AEYYTDDIIKGVILVMFATGIETSTTTMEWAMSLLLNHPEVLKKARNEIDFNVGHDRLLN ESDFINLPYLHNIINETLRMCTLQPFLAPHESSEDCTIGGYHIPKGTMLLINQLALHNDP KIWPEPTMFKPERFQKEFGENEGTKWIPFGQGRRACPGEGLGMRIMALMLGSLIQCYDLD LVEGEMVDVSIGERRIMGKAKPLEAMYRPRKPLVDVLSEI*

 

>22062413 Aquilegia coerulea|Aquca_016_00401|Aquca_016_00401.1

CYP81

MGIQYLAVLILVVLFISYKLLHTKHQQKNLPPSPLSLPIIGHLRILKPPIHITIGKLLQK YGPILYIRFGARPVLVLSSPAAIKECFTKNDIIFANRPRLLAGKHLFYNYTVLAMAPYGD LWRNLRRLTTTEIFSTTSLDVSSNVRNEEASAVVREMYKAYSGEFMKVDLKLIFSKLTYN NLIRILGMKPFFVDDEIVNPEKGRDTMNKLESLFVVNGIVAIGDLFPSLKWVDHWRVEKI

MLKLFKKRDKFMQNMINDVRARRLSASSSSSFNTVEDKKERKESKAPIDVLLSLQKSEPA YYTDDIIKGIILMMFDLGTETTASTMQWAMSLLLNHPEVLDKARREIDHIVGYDRLLSES DLHKFPYLHNIINETLRMYTLGPYLPPHESSDDCTIGGYNIPKGTMLLVNQLGLQNDPNV WPEPMMFKPERFEKRIGENENEGIKWIPFGIGRRACPGEGLARRFLGLTLGLLIQCFDWE RVGGQMVDMTVKFEMERGSFHKAKPLAAIYKPRKLLSNVLSQL*

 

>22032911 Aquilegia coerulea|Aquca_042_00015|Aquca_042_00015.1

CYP81

MEVFFYFLLFLSFILFSKFFFTRKTQNLPPTPPSLPVIGHLHLFKKSIHRTLAQLSNKYG PVLYLRFGSRPVLVVSSPSAVEDCFTKNNDIIFANRPRFMMGKLMGHNYTTMVWAPYGPN WQNLRRISAIEILSANRVHSFSDIRFGEIKSMIKRYSRQGYQYRTVEMKSMFFELTLNIM

MKMIAGKVCYGENVEELEEAKRFHGIVKETFALSGASNIGDFLPFLRWFGVKGLEKRVLS CMAKRDKAMQELIEERRILRTTKEENKKQTLIDILLSLQETEPDYYTDEMIRGFTWVMFA AGTDTTAGTMEWAMSLLLNNPEVIKKAQAEIDFHVEQGRPLHESDLNKLPYLHCIINETL RMYPAGPLLVPHESSEDCTVGGFDVSGGTMLLVNMWAIQNDPNLWEEPNKFKPERFEVGE EMVDMSEGSGLSLPKLLPLEANEKINLPLFSF*

 

>22032966 Aquilegia coerulea|Aquca_042_00036|Aquca_042_00036.1

CYP81

MYAFLVFCFIFICKQILYQNTDKTSIPFPVIILHHVLHLVIFKKPLHRSLAKLSEKYGQI VFLGYGFRKVLLISSSSSIEECLTKNDIAFANRPNLIVGEHLGYVLSSYRLELFSSVRSE EVRSLVLPLFRDSDCHKFHKVEFKTLFFELVLNILMRMIAGKRYYGEDDADTDEAKLFRA TVKDSFYLMGTPNIADFLPFLRRFDMQGLEKRMVKTGKERDSVWQRLIDEHRERKNVTTN QGDQEKKTMIDVLLLQQRADPEYYTDEIIKGIIAALLTAGTDTSALTIEWAMSLLLNHPE FLKKAKDEINLHVGNERFLEESDLPNLLYLNNIINETLRLYPIGPVVVHESSEDCTVGGF HVPSNTMLLMNLWDVHRDPNVWVEPMKFNPERFEGIENVNDGFKFIPFGSGRRRCPGEGL ATRMVALTLGSLIQCFEWKRVREEMVNMREGTGITLARANPLVAMCKPNPAMKHIITKI*

 

>22032970 Aquilegia coerulea|Aquca_042_00020|Aquca_042_00020.1

CYP81

MVDMSEGTWGVGVTVSRAQPLEAKCKDTFTLSGASYIGDFFPLLNLIGVGGFKKRLATLN GKKDKAMQDLIEERRSLRRGFTFMVAAGTDTSAGTMEWTMSLLVNNPRVIKKAQAEIDVQ VEKGRLLNESDINKLPYLHCIINETLRMYPGGPLLVPHKSSEDCVVGGFNVPRGTMLLVN VWGIHNDPNLWDEPTKFKPERFEGLEGTRDGFKFMPFGSGRRGCPGEGLAMRIVPLALGA LIQCLDWERVGEEMVDMSEGLGINLPKAQPLEASCRTRSSVLSMISQL*

 

>22033024 Aquilegia coerulea|Aquca_042_00035|Aquca_042_00035.1

CYP81

MIVGKRYYGENLEHLDEAKRFHAIVTESFYLIGIPNLADLLPFLRWFDIQGLEKRMVKLG KDRDSFMQKLIDEHRENKHNATKDDVQEKKTIIHVLLLQQKTDPEYYTDEIIKGIIVALL SAGTDTSSLTMEWAMSLLLNHPEILKKARDEIDKQVGQERFLEESDLPKLPYLNNIINET LRLYPTGPVVTHESGKDCTVGGYHVPSNTMLLMNLWAVHRDPNVWAEPTKFNPERFKGIE KGKDGFKFIPFGSGRRRCPGEGLATRMIGLTLGSLIQCFEWKRVGEEMVDMSEGTGLTLP RANPLFAMCKPNPAMKHMIT*

 

>22032982 Aquilegia coerulea|Aquca_042_00019|Aquca_042_00019.1

CYP81

MEILFYFLLFLSFFLFSKFFLTNKKTKNLPPSPPTLPIIGHLHLFKKPLYRTLANLTNKY GPVLYLRFGVRPVLVVSSPSAVEDCFSKNNDIVFANRPQLLMGKLLGNNFTTMVWAPYGQ NWRNLRRISAIEVLSANRVHSYANIRLDEVKSTIKRLSSKGSDEYRTVEMKSMFFELTLN IMMRMIAGKRYYGEHVEDLEEAKNFQEVVKETFTLSGASNIGDFLPFLNVVGVKGFKKRL

MSVISRKDKAMQELIEERRSLRKSGFNVEEKEKTLIDVLLSLQETEPDYYTDEMIRGFTW VMVAAGTDTSAGTMEWAMSLLVNNPQVIKKAQAEIDANVEKGRLLDESDINKLPYLHCII NETLRMYPAGPLLVPHESSEECVVGGFNVPRGTMLLANIWAIHNDPKVWDEPTKYKPERF EGLEGTRDGFKFMPFGSGRRGCPGEGLAMRVVPLALGALIQCFDWERVGDELVDMSEGLG LTLPKAQPLEAKCRTRSSASNIVSEF*

 

>22033036 Aquilegia coerulea|Aquca_042_00037|Aquca_042_00037.1

CYP81

MDTFFILAFLVLFVIIMFKQIFYQNSTDKPSIPYPLPILGHLHRIIKKPLHRTLAKLSDK YGPILFLRYGFRRVLLISSPSAVEECLTKNDIAFANRPHLIVGEHLGYNCTSLAFASYGD HWRNLRRITALEVLSSFRLQLFSSVRTEEVRSLVLQLFGNSDYQNFRKVEFKTMFFELTL NVLMRMIAGKRYYGENLMGHLDEAKRFQAIVTESFNLIGMPNLADFLPFLRRFDIQGLEK RMVKSGKDRDSFMQKLIDEHRENKHTTTNDNVQEKKTMIHVLLLQQKTDPEYYTDEIIKG IITALLTAGTDTSSLTMAWTFSLLLNHPEFLKKARDEIDVQVGQERFLEESDLPKLPYLN NIINETLRLYPTVPINFHESSKDCTVGGFHVPSNTMLLMNLWAVHRNPNVWVEPTIFNPE RFEGIEKEKDGFKFMPFGSGRRRCPGEGLATRMVGLTLGSLIQCFEWKRVGEEMVNMREG TGITLPRVNPLVAMCKPNPAMKHMITQI*

 

>22033044 Aquilegia coerulea|Aquca_042_00027|Aquca_042_00027.1

CYP81

MEIFSCFILFLSVSLFYNFFILKKTKNLPPSPPSLPIIGHLHLLKKPLHRSLANITDKYG PVLYLWFGFRPVLVISTPSAVEDCFTKNNDIVFANRPRLLVGKIGGDNYTTMAWAPYGPN WRNLRRISASEVLSVNRVQSYSDIRFDEVRSIIKRLSGHGSKYQTVEMKSMFFELTLNIL

MRMIAGKRYYGEHVKDLEEAREFQEIVEETFILSGASNIGDFFPLLNLIGVRGFKKRMMS VIGKKDKAMQELIEERRSLRRSGFKVEEKKKTFIDVLLSLQETEPDYYTDKMIRGFTWVM VAAGTDTSVGTMEWAMSLLVNNPQVIKKAQAEIDVQVEKGRLLNESDINKLPYLHCIINE TLRMYPAGPLLVPHESSEDCVVAGFNVPRGTMLLVNMWGIQNDSKLWDEPSRFKPERFEG LKGTRDGFKFMPFGSGRRGCPGEGLAMRIVPLALGALIQCFDWERIGEEMVDMSEGLGIT LPKAQPLEVKCWTRSSVLNFISQL*

 

>22032866 Aquilegia coerulea|Aquca_042_00032|Aquca_042_00032.1

CYP81

MDFFIILAFLVFFVLMLKHILYQNTDKPSIPFPLPIIGHLHLIKKPLHRTLAKLSDKYGP ILFLRYGFRKVLLISSPSVVEECLTKNDIAFANRPHLIVGEHLGYNCTSLVWASYSDHWR NLRRITALEVLSSYRLQLLSSVRTEEVRSLVQQLFGNSDGQNFHKVEFKTMFFELTLNVL

MRMIAGKRYYGENLEDLDEAKHFRAIVTESFYLIGTPNLADYLPFLRRFDLQQLEKRMVK SGKARDSFMQKLLDESREKKHVATKKDGQEKMTMIDVLLLQQNSDPEYYTDEIIKGIIAT LLTAGTDTSSLTMEWALSLLLNHPEILKMARDEIDKEVGQERFLEESDLPKLPYLNNIIN ETLRLYPTGPVVIHESGKDCTVGGFHFNPERFEGIEKEKEGYKFIPFGSGRRRCPGEGLA TRIIGLTLGTLIQCFEWKRVGKEMVNMSEGTGLTLPRAYPLVAMCRPNPAIKHMITTQI*

 

>22032876 Aquilegia coerulea|Aquca_042_00023|Aquca_042_00023.1

CYP81

MAIFYFLLFLSFFLFFNFFLSKKTKINLPPSPPSLPIIGHLHLLKRPYYRSLAKITDKYG PVLYLRLGSRPVLVVSTPSAVEDCLTKNNDIVFANRPRLLICKLMGNDCTSISTAPYGPN WRNLRRISAMEVLSANRVHSYSAIRFDEIKSMIKRLSGQAFEYHTVEMKSMFFELTLNIM

MKMIAGKKYYGEQVEDLEEAKRFQEMVKDNFLLSGTSFLGDFLPLLNVIGVGRFKKRVIS

MSREKDKAIQELIDERRSLKSSSSFNLEEKNKTVIDVLLSLQETEPDYYTDEMIQAFIWA

MIAAGTDTSAGTMEWAMSLMVNNPHVIKKAQAEIDAYVEKGTLLHESDINKLPYLHCIIK ETLRMYPAGPLLIPHESSEDCVVGGFNVPCNTMLLINAWGIQNDPKLWDEPTKFKPERFE GLEGTKDGFKFIPFGSGRRGCPGEGLAMAVVRLALGSLIQCFDWERIDEKLVDMSEGLGL SLPKAHPLEVRCRTRSSAWGMISQL*

 

>22033060 Aquilegia coerulea|Aquca_042_00024|Aquca_042_00024.1

CYP81

MEIFFYFLLFLSFFLLFNFFFSKKTKINLPPSPPSLPIIGHLHLLKKPLYKSLARITDKY GPILYLWFGSRPVLVVSSPSAVEDCLTKNNDMVFANRPRLLIGKLMGNDYTTMAWAPYGQ NWRNLRRISAMEVLSANRVHSYSAIRFDEIKSMIKRLSNQGSEYLTVEMKSLFFELTLNI

MMRMIAGKKYYGEQVEDLEEAMKFQEIVKETFLLSGNSNIGDFFPLLNVIGVGGFKKRVM ILVEKKDRAMQKLIEERRSLNRSSSFNLEEKKDTVIDDLLSLQKTEPDYYTDEMIQGFIW VMIAAGTDTSAGTMEWAMSLLVNNPHVIKKAQAEIDVHVEKGRLLDESDINKLPYLHCII KETLRMYPAGPLLVPHESSEDCVVGGFNVPRGTMLLANIWWIQNDPKLWDEPTKFKPERF EALEGTRDGFKFMPFGSGRRGCPGEGLAMAVVPLALGALIQCFDWERIGEEMVDMSEGLG LTLPKAQPLVAKCRTRLGNQY*

 

>22049008 Aquilegia coerulea|Aquca_007_00786|Aquca_007_00786.1

CYP81

MAFLYYFLLTLFILFVLKVFSQTNKKLPPSPFALPILGHIHLFRKPLNRTLQTLSNRYGP ILFLQFGSRPILVISSLSLVEECFTKNDIIFANRPFSIAGDHLSYNYTILASSPYGYHWR NMRRITTIEIFSAKSLQMSARIRKEEIHHLVNNLGDFLPILSWIGLYREKKYMIKLHKRR DSFLQNLIDEFRKKKTISSTTTLAEDKKKTTIIETLLSIQEAEPEQYSDNVIKGIILTMF TAGTHTTSLTLEWTMSLLLNHPDVLQKARSEINHNVQGRLLDDYDLVKLPYLHCVINETL RLYPAAPLLVPHSSSKECTVGRYNIPRGTILFTNVGAIHRDPKVWVEPTKFMPERFEGVQ SEREMGFKFMPFGVGRRGCPGAGLALRVVTLALGTLIQCFEWEKVGQEQVEMEEANTGVI

MPKANPLVAMCKPHPSMVDVLSQV*

 

>22049090 Aquilegia coerulea|Aquca_007_00331|Aquca_007_00331.1

CYP81

MLVALDPLSMEFLYYLLLNLFILFIILKVFSQVNKNKNLPPSPFALPILGHIYLYKKPLT RTLQSLSNRYGPILFLQFGSRPVLVISSVSLVEECFTKNDIIFANRPSSIAGDHLTYNYT IFAWSPYGYHWRNIRRITTIEIFSSKSLQMSAKIRKEEICSLVSSLFRRSTGGSSQHFNL KFMFSQLMFNIIMRLVAGKRCFEEFIMDLDEQKRLHTLSKEIFAPGMIFELGDFLPILRK IGYTEEKCQIKIHKSRDSFLQNLINEFRRKQIHSSTTTTGEDKKKKTTIIEALLSIQEAE PEQYSDDFIKGILLLMFTAGVDTSSLTLEWAMSLLLNHPDILQKARSEINHNVHDRLLED YDLAKLPYLHCVINETLRLYPVAPLLVPHFSSEECTVGGYNIPRGTVLYANIGAIHRDPK VWTDPDKFMPERFEGVQGEKEMGFKFMPFGVGRRMCPGANLAMRVVALALGTLIQCFEWE RVGQEQVEMHETNTGVTMPKADPLIAICKPYPSMVETLSQV*

 

>22055377 Aquilegia coerulea|Aquca_019_00041|Aquca_019_00041.1

CYP81

QPPSPPSLPILGHLHLVKKPLHRTLEALSKRYGPILFLRFGSRPVLLISTPSAVEECFTK NDVVFANRPTMLAAKHLNYNFTTLVSASYGPNWRNLRRFTLLEIFSLTRLHKTSSIRREE VQLFLQQLVQNNNSYSKLKKLELKSKFNDLVFNNITKMIGLKRYYGEDVKDEDFEEAKLF KEIMKETVELIGSPYIGDYLPMLRWLDFKGVENKMIKLKKKRDCFLESVIDEHRRMKANG NGEGNTTIDVLLSMQEREPDYYTNEIIHGIIMTLLTTGTHTSAMTLEWAMSLLLNHPKAM NKARAEIDNSIGKDHLIEESDLPKLTYLQNVINETLRLFPPTALIVPHESSAECSVGGFD IPCGTMLLVNTWAIHRDPKQWVEPDKFRPERFENGTGEGFKFIPFGFGRRGCPGTRMAMR

MVGLTLGSLIQCFEWENTDGTEVDMAEGPGVTIPKIIPLEALYRPREILSGLVAGL*

 

>22033081 Aquilegia coerulea|Aquca_042_00021|Aquca_042_00021.1

CYP81 48% TO CYP81Q7   Vitis vinifera

MKQILQRKMEIFFYCLLFLSFFLVYKFFLSKKTKNLPPSPPSLPIIGHFHLLNKSLHRSL AIITDKYGPVLYLWFGFRPVLVASTPSAVEDCFTKNNDIVFANHPRLLASKLMGNDFTIM SWASYGPNWRNQRRISASEVLSANRVHLYSDIRVDEVRSMIKRLSGHGYKYRTVEMKSMF FELTLNIMMRMIAGKRYYGEHVKDLEEAKIFQEIVKDAFIVSGVSNIGDFFPFLNLIGVR EYKKRVMTVNGEKDKAIQKLIEERRSLRSGFAMEEKEKTFIDVLLSLQETEPDYYTDEMI RGFTWVRLSCSAYSLLFLFLHILCCRMSSLEFRNSL*

 

>22033140 Aquilegia coerulea|Aquca_042_00026|Aquca_042_00026.1

CYP81B 57% TO CYP81B1v1   Helianthus tuberosus (Jerusalem artichoke)

MEIIICFLLFLSFFLFHKIFLSKKIKNLPPSPPSVPIIGHLHLLNKSLHRSLATITDKYG PILYLWFGFRRVLVVSTPLAVEDCLTKKNDIVFANRPRLLIGKLMGNDYSDLPWAPYGQN WRNQRRISTSEILSANRVHSYSDIRFDEVRSMIKRLPGHGSNYRTVEMKSMFFELTLNIM

MRMIAGKRYYGEHVKDLEEAKKFQEIVKDTFTLSGASYIGDFFPLLNLIGVGGFKKRLMT LNGKKDKATQDLIEERRSLRSGFTVEEKDKTLIDVLLLLQETEPDYYTDEIIRGFIWVMV AAGTDTSAGTMEWAMSLLVNNPHVIKKAQAEIDVHVEKGRLLDESDINKLPYLHCIIKET LRMYPAGPLLVPHESSEDCVVGGFNVPRGTMLLANIWWIQNDPKLWDEPTKFKPERFEAL EGTRDGFKFMPFGSGRRGCPGEGLAMAVVPLALGALIQCFDWERIGEEMVDMSEGLGLTL PKAQPLVAKCRTRQSVLNLISQL*

 

>22033091 Aquilegia coerulea|Aquca_042_00022|Aquca_042_00022.1

CYP81B? 68% TO CYP81B1v1 Helianthus tuberosus (Jerusalem artichoke)

MEWAMSLLVNNPHVIKKAQTEIDVHVEKGKLLDESDINKLPYLHCIINETLRLYPAGPLL VTHESSEDCVVGGYNIPGGTMLLVNMWGIQNDPNLWDEPTKFKPERFEGLEGARDGFKFM PFGSGRRGCPGEGLAMRVVPLALGALIQCFDWERVGENLVDMTEGVGLTLPKAQPLEAKC RTRSLALDIVSQV*

 

>22033015 Aquilegia coerulea|Aquca_042_00031|Aquca_042_00031.1

CYP81 55% TO CYP81B1v1   Helianthus tuberosus (Jerusalem artichoke)

MKSMFFELTLNNMMRMIAGKKYYGEDAEELKEAKFFKDLVKETISISGASDISDFLPVLK QIGVNGFEKKVLSLKQKRDKYLQELIEEKRKFRSAVKMEKRDERTLLDVLLSLQDTEPEY YTDEMICGMAWVLYASGTETSACTMEWAMSLLLNNPRVLRKAQPEIDNYMEQQDRFLHES DVNNLPYLQAIISETLRMYPPGPLLPHESSEECIVGGYAWDNVIS*

 

>22037623 Aquilegia coerulea|Aquca_259_00002|Aquca_259_00002.1

CYP81

MTLHRHMGYNYTALVSANYGDHWRNLRRLCSAEIFSPGRLNMYRSIREGEIKNLLSGLYK KCTSKGGSFAKVELRWKLCELTFNNITRMVAGKSYYGEIGVEDREEAKKFQQLISAAFKL SGAANAGDYLPFLRWIDYAGIEKNMSLITKKLDTFLQGLINERRQYKSNDTMIDHLLSLQ QSNPKSYTDDIIKGLVLNTLIGGTNTSETTIEWAMSLLVNHPEVLKKARDEIGAHVGFER LVKEEDLSKLPYLKCIVSETFRMFPPLPLVLPHESSQDCTLGGYNVPRGTIILANAWAVH RDPKVWNEPNCFKPERFEGGLIETEAQKILPFGMGRRVCPGAGLGQCVVGSALGCLIQCF EWERVTAEKVDLVEGTGLAMPRANPLVVMCKPRQVMDKFFKNLMM*

 

>22037342 Aquilegia coerulea|Aquca_012_00170|Aquca_012_00170.1

CYP81

MTLSHAIAMEPKWLYYLSLFSVFIGMIVYKLFSHTKTTKSSKLPPSPPGSRLFFGHLHLL ENPLHRTLDKLAQKHGPIFSLRLGSRLAVVASSPSAIEECFTKNDANFANRPHMTLHRHM GYNYTALVSANYGDHWRNLRRLCSVEIFSPGRLNMFLSIREEEIKNLLSGLYKTCTSASG GFTRVELRWKLCELTFNNITRMVAAKRYYGEVGVEDKEEAKRFQQLISSAFKLSGAANAG DYLPFLRWIDYKGIEKNMSIIMKKLDTFLQGLVNERRQCKSNDTMIDHLLLLQESQPESY TDDTIKGLVLNTLIGGTNTSETTIEWAMSLLVNHPEVMQKARDEIETQVGFERLVKEEDL SKLPYLKCIVSETFRMFPPLPLVLPHESSQDCKLGGYDVPRGTIILANAWAVHRDPKVWD EPNCFMPERFDGGLKEIEGQKLLPFGMGRRVCPGAGLGQCVVGSVLGSLIQCFEWERVTA EKVDLIEGTGLAMPRANPLVVMCKPRQVMDKVFQNLTI*

 

>22057611 Aquilegia coerulea|Aquca_057_00095|Aquca_057_00095.1

CYP81

MEPKWLYFFSLSSVLIGMMVYKLFSISHTRATKSLKLPPSPPGARLFFGHLHLLENPLHR TLDKLSQKHGPIFSLRLGSRLAVVASSPSAIEECFTKNDANFANRPHMTLHRHMGYNYTA LVSANYGDHWRNLRRLCSAEIFSPGRLNMYRSIREGEIKNLLSGLYKKCTSKGGSFAKVE LRWKLCELTFNNITRMVAGKSYYGEIGVEDREEAKNFQQLISAAFKLSGAANAGDYLPFL RWIDYAGIEKNMSLITKKLDTFLQGLINERRQYKSNDTMIDHLLSLQQSNPKSYTNDIIK GLVLNTLIGGTNTSETTIEWAMSLLVNHPEVLKKARDEIGAHVGFERLVKEEDLSKLPYL KCIVSETFRMFPPLPLVLPHESSQDCTLGGYNVPRGTIILANAWAVHRDPKVWDEPNCFK PERFEGGLIETEAQKILPFGMGRRVCPGAGLGQSVVGSALGCLIQCFEWERVTAEKVDLV EGTGLAMPRANPLVVMCKPRQVMDKFFKNLMM*

 

>22058225 Aquilegia coerulea|Aquca_083_00010|Aquca_083_00010.1

CYP81

METMYLIVSVLLLILVICNKLLQRKYHHKNLPPSPPSLPIIGHFHLLKQPVHTAIDKLIQ LYGPVLFLWFGFRPVVVLSSPAAIKECFTKNDIIFANRPRLLMGGLTEKYSVIPLAQYGH LWRNLRRVTAIELFSLIRLDMSSNGRKGEARSLIRKMFKNSNGEFMKVELKSVFYKLVFN FLARILGMKPYFGEEEMVDPQMAKDKLDALRSKFSATPAFGLGDFFPFLKWISRWRMGKK TLEWFKKRDQYLQNILDGFRSRASISSKEEKEKKRTIVDVLLSLQETEPELYTDDVIKGI ILVTFVGGSGTSTTTMEWAMSLLLNHPEVLDKARNEIEHNVGCHQLLDESDLVKLPYLRC IISETLRVCPIGAFLAPHESSEDCTIGGYNVPKGTMLLVNQQALYKDPKVWPEPTMFKPE RFEKSKRENEGTKWIGFGQGRRGCPGEALANRTLGLTLGLLIQCFDWERVGGEMVDMTTG DQRLMTKAKPLEAMYRPRKALLNVLSQL*

 

>22058237 Aquilegia coerulea|Aquca_083_00013|Aquca_083_00013.1

CYP81

MDFTNYISIFTIFFILFISFKYILTRKKIPPSPYALPILGHLHLLKKPLHRTFQSLSNQF GPIFFLKLGFRNVLIVSSPSFVEEIFTKNDIAFANRPDFLAGQYLGQNYTHLGWAPYGHH WRNLRRVTTIEIFSSNRITMSSNLRREEIIHSIKEMFLLSSNEWKLIDLKSTFFDLTLNI

MMKIVAGRPCYEDGIDFEDKNRMREMLKDTFVPNVSMNLGDCFKILRRFTFLGLEKNLVK LSRTRAVFLQSLIDERRKKRSSGGELIDGDNKRITVIDGLLSLQETEPDYYSDDTIQGLI

MIMFTAGTDTSAATMEWVMSVLLNHPEVLDKARDEIDSNVDEGCLIDDSDLPNLPYLHCI INETLRLFPAGPLLVPHSSSEECTIGGYKIPRGTMLFVNVWAIHRDPKFWTEPNSFKPER FEGVQGERDGFKFIPFGLGRRGCPGAGLAMKTVALALGMFIQCFEWKKVGAEPVDLTEGS GSTMPKAKPLEAFFRTRPSMK

 

>22033043 Aquilegia coerulea|Aquca_042_00030|Aquca_042_00030.1

CYP81 CLUSTER S

MAFFYFFAVLIVFILILKGFFHRTQNRPPSPFALPILGHLYLLKNPLYKTFTKLSEQYDP ILFLRYGFREVLVVSSSSAIEECLTKNDIAFADRPQLIAGQHLGYNYSSLIWAPYGNHLR NLRRIITLEIFSSVRLQLLSVVRKEEIRYLVLQLFGNSDCKTFHKVEFKTMFFEMMLNIL

MRMIAGKRYYGENVVDLDEAKRFRNIVSESFYLLGTPNFGDFLPFLRRFDVQGLEKRMVK VNKERDIFLQNLLDQGRQATHISSKNDQEKKTMIDVLLSQQKTDPGYYTDEIIKGLIETL LSAGTDTSSSTLEWAMSLLLNHPDILNKAKKEIDMHVGKERLIEESDLPKLGYLNNIINE TLRIYPPGPVLYHESSKDCSVGGFHVPSGTIVQMNVCAVHRDPKLWVEPMQFNPDRFEDE NEGFKFIPFGSGRRKCPGEGLAIRMVGLALGSLIQCFEWKRVGEEMVDMTEGTGLTLPKA NPLVAMCKPNPTLKHLLTRI*

 

>22033082 Aquilegia coerulea|Aquca_042_00018|Aquca_042_00018.1

CYP81 CLUSTER S

MILLIFISIYILYQNNTKPSTPFPLPILGHLHLITKKPYHRTLTKLAEQYGPVILLRYGF RKVLVVSSPSAVEELFTRNDIAFANRPHLIAGKHLGYNYTSLVWSSYGDHWRNLRRFTAL EIFSSYHLQLDSLVRSEEMWSLVLQLFGDSNFKEFHEVELKTKFFELMLNILMRMIAGKR YYGENVMDLDEAKKFRHIVKETFYLIGIPNLSDYLPFLRWFDLQGLEKRMVISSQERDLF IQKLIDDCRERRDSSSKDGHEKKTMIDVLLWQQEADPEYYTDDIIKGLIATMLSAGTDTS AVTMEWAMSLLLNHSEVLKKAREEIDLQVGEERLFQESDLHNLPYLRKIIKETLRLYPAG AIVTHESSKACTVGGLRVPSGTMLQLNLWALHRDPNVWAEPLKFNPERFQGDNEGFDLIP FGSGRRKCPGEGLAMRVVGLALGSLIQCFEWKRVGEELVDMTEGGGVTLPRVNPLVVMCK PRPIMQHILTQFRNQ*

 

>22033174 Aquilegia coerulea|Aquca_042_00033|Aquca_042_00033.1

CYP81 CLUSTER S

MASFIILAFLIFFVIMLKYILYRNTDNPSIPYPLPILGHLHLIIKKPLHRTLAKLSDKYG PILFLRYGFRKVLLVSSPSAVEECLTKNDIAFANRPHLIVGEHLGYNCTSIGFTSYGDHW CNLRRIIALEVLSSYRLQLFSSVRTEEVRSLVLQLFGNSDCQNFRKVEFKTMFFELILNV LMRMIAGKRYYGENLEHLDEAKRFHAIVTESFYLIGIPNFADFLPFLRWFDIQGLEKRMV KSGKDRDSFMQKLIDEHRENKHTATKDDVQEKKTIIHVLLLQQKTDPKYYTDEIIKGIIA ALLTAGTDTSSLTMEWTMSLLLNHPEILKKARAEIDKQVGQERFLEESDLPKLPYLNNII NETLRLYPTGPVVIHESGKDCTVGGFHVPSNTMLLMNFWAVHRDPNVWVEPTKFNPERFE EIEKEKHGFKFIPFGSGRRRCPGEGLATRIIGLTLGTLIQCSEWKRVGEEMVDMSEGTGL TLPRANPLVAMCRPNPAMKHMITTQI*

 

>22033106 Aquilegia coerulea|Aquca_042_00017|Aquca_042_00017.1

CYP81 CLUSTER S

MCIASDTLDPLSLSILIHVGVVANTGSMVVFTIDLTVRSPANLIDLSMILYTNELYCNYG HLHLITKKPYHRTLANLAEQYGPVLLLRYGFRKVLVVSSPSAVEELFTRNDVAFANRPLL IAGKHLGYNHTSLVWSSYGDHWRNLRRFTALEIFSSYRLQLDSCVRSEEMQSLVLQLFGD SNFKEFHEVELKTKFFELMLNILMRMIAGKRYYGENVVDLDEAKQFRHIVKESFYLLGIP NLSDYLPFLRRLDLQGLEKRMVISSQERDSFMQKLIDDHREKRRSTSKDGHTKKTMIDVL LSQQEADPEYYTDNIIKGLIATLLTAGTDTSSVTMEWAMSLLINHPEVLKKVREEIDLQV GEERLFEESDLHNLPYLRKIINETLRLYPAAAIVTHESSKECTVGGLRVPSGTMLQLNLW ALHRDPNVWAEPLKFNPERFQGDNEGFDLIPFGSGRRKCPGEGLAMRVVGLALGSLIQCF EWKRVGEELVDMTEGGGVTLPRVNPLVVMCKPRPIMQHVLTQFTNQ*

 

>22047819 Aquilegia coerulea|Aquca_007_00087|Aquca_007_00087.1

CYP82D

MADLSMLSVWLLTCLAALLACYFILWTSANNKTSSCKPKTAPVVSGGWPIIGHLHMLMGK ELPHILLSKLAGKYGPAFMLRYGSQPVIVVSSLKLAKECFIHNDRALFKRPNSKALKYFT YNQASFGFAPYGPLWVEMRHVSKTNLLSNQRLQMQRHVRASELDAFIKELYQLWTSKSTN QNGTPLLVEMNKWFEELALNVVTRMISGKSNMASKARRDGNEDDNKAKHFKKVVVDATVL TAKLVVSDFFPSLEWVDYLLGDESAIKATAKELDAILATWVEEHIQKRLSPGLEDQEQDF IDLTLSMINETQHQGVDVQTFIKSMCVGMLFGGSDSTSVALTWTLSILMNHRDVLKKAQE EIDQQVGKDRKVDDLDVIKLVYLKAIVKESMRLCLVGPLLERITVEDCEIGGFHVKAGSR VVVNIWKMQHDPELWSDDTCGFRPERFLTTNAKVELRGQNFELIPFGSGSRMCPGVTFAL ELMQLTLARLIHGFELGTPGDMKVDMTETSSVTNYKATPLEILLTPRLNPKLYDC*

 

>22047576 Aquilegia coerulea|Aquca_010_00348|Aquca_010_00348.1

MEAHAGFLLHLWNLIAFIPFFLLLLILGIVKAIVIGPVVLIVITVGVSAVIIGLWPMHVI RTCYCIVKSKKFGTVMKGFLFIILPIPLLLWLPIGIIGSLFTGLGYGFFWPLMATFEAIG EGVPNKFIRCFKDGTWSSILGGCTIVRDFADVSFHSYFSVMDVWLESKTETPTEIKISQI PGCTLAGILGLFVDVPIIIMIVIYKAPFMLFKGWHRLVRDLIGRSGPFLETVCVPFAGLS ILLWPIVVALASLAGIGSSFFLGLYAAVVAYQENSTKRGLLYIIAILSLFDEYTNDFLYL QEGSCFPRPRYREVVDYSVTRPTKRAPGQSEAVRTKQPPVRMPSKQMQALKAVVIWNNFF QACEYTGRELLGAGAIGMKDLEAWQYSKSDIVNIGIPAYTFFMCFLRSIKSGSTGFLMRD NIELTDVNRPEGRVFDWLFEPMSIMKEQIKSLHLTETEELYLYKLSLYCGNRDRVDAWNN GGVPPVDEIRRAQLHAISRRLRGFSAMLSRLPTFRRRFQEVVKALAQEAKQRNNLMDVVR

VLQS

CYP82D

MELLNPVYLTTIFSGVFVLIYFLYIMIRSRRTNAKIRTAPEPAGAWPLIGHLPMLS EPGLPHIVLGDWADKYGPAFTIRFGMHKALVVSSWEVAKECFTTNDKALASRPTSVAIKI

MACNGALFGFAPYGKYWREARKIAILELLSNHRLELLKHVRISEVSTSIKELYQVWQESC NSETGSALVEMKPWFGDLTLNVVVRMVAGKRYFGSSVKLDNGEGKRLQKVVHDFFHLVGL FVVSDAVPFLGAWFDFKGYEKAMKRTAKELDNIMEGWLQEHRRNKLEHGTNVEQDFMYVL LSILDENDKFYGYEADLVNKAICVNMIFGGVDTTTVTLTWALSLLLNNRDILQKAQHEID SIVGKDRLVDESDITKLVYLQAIVKETLRLYPAAPLSAQHLAMEDCTVSGYHVRAGTWLF TNIYKIQRDPRVWSSPSEFQPERFLTTQANVDFRGKHFEFVPFGSGRRSCPGMSFALQVV YLTLARLLQGFDFETPLNATCGHD*

 

>22027792 Aquilegia coerulea|Aquca_014_00614|Aquca_014_00614.1

CYP82D

KNGSVKSRGRASVPEPVGAWPIIGHLRMLQPPILPHILFGSLADKHGPIFALRIGLCKTL VVSDSEVAKECFTTHDRVFATRPNMVVSKIMGYDHAMFGTGPYGPYWREMRKIAILELLS NRRLELLKHVRITEINTSIQELYQLWAAKNKNGKGTVLVEDMKGWFGDLTLNITVRMVAG KRYFGASSKEDKEEARQIQKAVRDFFYLFAMFVVSDAIPFLGWLDIQGHVKAMKRAAIEI DSILGRWLKEHKRKKLDKLRTKAGDFMDVLLSVLQDENLFGREADTVNKATCLNMVVAAT DSNMVTLTWALSLLLNNRNVLKKAQDEIDIHVGKDKYVEESDIEKLVYLQAIVKETLRLY PSAPIIGPHQSMEDCTVSGYHVPKGTRLLVNIWKIQRDPRIWCNPCEFKPERFLSTQANV DVRGQHFEFFPFGSGRRSCPGISFALQVVHLALARLLQGFDFATPLDAPVDMTESIGLTN LKTTPLEVLITPRLRSNLY*

 

>22027903 Aquilegia coerulea|Aquca_014_00612|Aquca_014_00612.1

CYP82D

MNPETREPPEPAGAWPLIGHLHMLLPPQPPHITLGTLSDKYGPIFAIRLGSRKALVINTW ELAKECFTTHDKAFATRPSSVAVKIMAYNFAMFGLGPYGSYWREMRKISILELLSSSRQE LLKHVRISEVDICMKELYQLWEKNSNNGKGAVLVDMKRWFGDLTLNVSIRMVAGKRYFGS SAEEDENEARRLQKAITDFFYLLGMFVVSDAIPFLEGWVDFQGHEKAMKKTAKDVDGILQ KWLEEHKRNKLDGRAKVDEDFMDVLLSTLDEKNCSGYEVDIVNKATCMNMIAAGTDTTMI SLIWTLSLLLNNRHTLKKVQDEIDDHVGKDRCTEESDVHKLVYLQAIIKESFRLYPPVPL SVPHEAIEDCTVSGYYIPAGTRLIANVSKIHRDPRVWPNPSEFQPERFLASQADVDVRGQ HFELIPFGSGRRSCPGTSFALQTVHLALARLLQGFEFQTPQEAPVDMTENPGITNLKTTP LDVLITPRLPSHLY*

 

>22028464 Aquilegia coerulea|Aquca_014_00613|Aquca_014_00613.1

CYP82D

RKRSAKTGGAPEPVGAWPLIGHLHMLQPPQLPHILLGSLADKYGPIFTMQLGLRKALVVS NWEVAKECLATHDKAFATRPKLVASKIMGYDYAMFGIGLYGPYWREMRKIAILELLSNRR LGLLKHVRVSEVNTSMKELYQLWDRNSDNGQRQVLVDMQGWFGDLTLNVSVRIVAGKRYF GASAKVDEKEARELQKGVKDIFRLLGMFVVSDALPFLGWLDFQGHEKAMKKTAKEFDCLM EKWLDEHKQNKLIGGTELDEDFMDVMLSILKDEKLYGYEADVINKATCLNMIIAGTDTTM VTLTWALSLLLNNRHTLKKAQDEIDIHVGKDKYVEETDIEKLVYLQAIVKETLRLYPAAP LNAPHEATEDCTISGYHIPKGTRLLVNLWKIQRDPRIWSNPSEFQPERFLTTQANVDVRG QHFELIPFGSGRRSCPGISFALQVVHLALARLLQGFEFVTPLDAHVDMTESAGLTNLKAT PLEVLITPRLPSHLY*

 

>22046371 Aquilegia coerulea|Aquca_010_00350|Aquca_010_00350.1

CYP82D

MELLTPVYLTTIFSGVFAFASIYFLYIILWRRTSANIRTAPEPAGAWPLIGHLPMLFEPQ IPHIVLGDLADKYGPAFTIRFGLHKALVVSSWEVAKECFTTNDKALASRPTSVAIKIMGC NGALFAFSPYGTYWREARKLAIIELLSNNRLELLKHVRSSEVSTSIKELYQVWKESCNSE TGTALVEMTPWVTDLTLNVVVRMVAGKRYFGSSVKLDNGEGKRLQKAVRDFFHLAGLFVV SDAVPFLGAWFDFKGYEKAMKRTAKELDNIMEGWLQEHKQNKLEHGTNVEQDFMYVLLSI LDGDMFYGYEADFVNKAISLNMIFGGVDTTTVTSTWALSLLLNNREILQKAQNEIDCIVG KDRLVDESDITKLVYLQAIVKETMRLYPAAPLSVQHIAMEDCTVSGYHVPAGTWLLTNIY KIQRDPRVWSSPSEFQPERFLTTQANVDLRGKHFELIPFGSGRRSCPGMSFALQVVHLTL ARLLQGFDIETPLNATVDMTESAGLTNLKATPLQVVISPRLSSGLYN*

 

>22046842 Aquilegia coerulea|Aquca_010_00351|Aquca_010_00351.1

CYP82D

MPVGAWPLLGHLPMLSEPRLPHITLGALADKYGPVFTVRLGLHKAIVINSWEVAKECFTT NDKLFATRPSSVAVKTMGYNYAVFAFGPYGPYWREARKMAILELLSNHRLELLKHVRISE VSTSMKELYQVWQANCNKANGAALVEMKQWFGDLTLNVVVRMVAGKRYFGSSANADDGEG KRLQKGVHDFFHLVGLFVVSDAVPFLGTLLDFQGHEKAMKRTAKELDSILGRWLDEHRRN KLNAGTNLEQDFMYVMLSLLEKDKKFYGYEADVVNKAMCLTMILGGADTTLLTLTWALSL LLNNRHSLIKAQDEIDTNVGRDRVVDESDVGKLVYLQAIVKETLRLYPADPLSAQHLATE DCTIGGYHVPVGTRLVTNIWKIQRDPRIWSNPSEFHPERFLTTQANVDVRGQHFEYIPFG SGRRSCPGISFGLQVIHLGLARVLQGFDFETPLNKPVDMTESAGLTNLKVTPLEVLITPR

LPSNLY*

 

>22046845 Aquilegia coerulea|Aquca_010_00349|Aquca_010_00349.1

CYP82D

MWMDLVLVLQSMELLNPVYLTTIFSGVFVLIYFLYIMIRSRRTNAKIRTAPEPAGAWPLI GHLPMLSEPGLPHIVLGDWADKYGPAFTIRFGMHKALVVSSWEVAKECFTTNDKALASRP TSVAIKIMGCNGALFAFSPYGTYWREARKIAILELLSNHRLELLKHVRISEVSTSIKELY QVWQESCNSETGSALVEMKPWFGDLTLNVVVRMVAGKRYFGSNVKLDNGEGKRLQNVVHD FFHLVGLFVVSDAVPFLGAWFDFKGYEKAMKRTAKELDNIMEGWLQEHRRNKLEHGTNVE QDFMYVLLSILDENDKFYGYEADLVNKAICVNMIFGGVDTTTVTLTWVLSLLLNNRDILQ KAQHEIDSIVGKDRLVDESDITKLVYLQAIVKETLRLYPAAPLSAQHLAMEDCTVSGYHV RAGTWLFTNIYKIQRDPRVWSSPSEFQPERFLSTQANVDFRGKHFEFIPFGSGRRSCPGM SFALQVVYLTLARLLQGFDFETPLNATVDMTESAGLTNLKATPLDVLITPRLASSLY*

 

>22062493 Aquilegia coerulea|Aquca_016_00318|Aquca_016_00318.1

CYP82D

MDSLHQCLGGILGLLIFFLCYLKWKKTTNINCKSAPEPKGAWPMVGHLPMLMGPQILHTA LGALADEYGPVFTIRLGVHKTLVVSSWEIAKECFTINDKVLATRPSSVAVRVMGYNYASF AFAPYGSYWREARKIAILELLSNHRLELLKHVRFSEVSTSIKELYQVWQENCSNSNGFVP AEMKQWFGDLSINVVVRMVAGKRYMGASAKSDDEGRRFQKAIKEFFYYIGLFIVSDALPF LGWLDIQGHEKAMKKTAKELDCILEGWLKEHRQSLLDNGTEVQQDFMYVLLSILEDKKIF GYEADMANKGICLQMIAGATDTTTITLTWALSLLLNNQHTLKKAQEEIDTIVGKDRQVNE LDIEKLVYLQAIVKETLRLYPAAPLSAQHEAMEDCTVAGYHVPAGTRLITNLWKIQQDPH IWSNPSEFKPERFLTTQANVDVRGQHFEYIPFGSGRRSCPGISFGLQVIHLTLARLLQSF DFKTSLDALVDMTESPGLTNIKATPLDVLITPRLPADLY*

 

>22062725 Aquilegia coerulea|Aquca_016_00049|Aquca_016_00049.1

CYP82D 54% TO CYP82S1 Vitis vinifera

VTRQRRKLKPPLLVARLSPKNLIEAVKLLFGGFVYVLRIVGNLSCDVCLALSKEDVFGKS

MHSDLNLYPTWLNFIGKTLERGIWPFGALWASKDVRLEELRWLDPMEVFFSYLFSWKRRR STAKTRAAPEPVGAWPVIGHLHMLLPPQPPHITLGSLADKYGGTFTIRLGLRRALVVTTW EAAKECFTTNDKVFATRPSSVGTKIMGYNYAMFGLGPYGPYWREVRKIAIIELLSNHRLE LLKHVRISEVNTSLKELYQLWTTSDKNEKGSVLVDIQRWFGDLTLNMIIRMVAGKRYFGA SAELDENEARGLQQAIKDLFYLLGIFVVSDAIPFLGWLDFQGHEKAMKRTAIEIDTILGR WLEEHKRNKLDVRTNGDGDFMDVMLSILEDKKLFGCDPDIVNKATCLTMIAAGTDTTMVT LTWAMSLLVNNPHILRKAQDEIDICIGKDKYVEESDIQKLVYLKAIVKETLRLYPAVPLS VPHEAMEDCTVSGYHVPAGTRLIANLYKIQRDPRIWSNPDEFKPERFLTTHANVDVRGKH FEFIPFGSGRRSCPGTSFALQTVHLSLARLLQGFEFQTPHDAPVDMTESPGMTNLKTTPL QVFLNPRLPSHLY*

 

>22048503 Aquilegia coerulea|Aquca_007_00086|Aquca_007_00086.1

CYP82D

MADLSMLSVWLLTCLAALLACYFILWTSANNKTSSCKPKTAPVVSGAWPIIGHLHMLMGK ELPHILLSKLAGKYGPAFMLKYGSQPVIVVSSPKLAKECFIHNDRAIFKRPNSQALKYLT YDQASFVLAPYGPLWIEMRHVSKTNLLSNQRLQMQRHLRASEIDASIKELYQLWTSKSTN QNGTPLLVEMNKWFEELALNVVTRMISGKSNMASKARRDGNEDDNKAKHFKKVVVDATVL TAKLVVSDFFPSLEWVDYLLGDESAIKATAKELDAILATWVEEHIQKRLSPGLEDQEQDF IDLTLSMINETQHQGVDVQTFIKSMCVGMLFGGSDTTSVALTWTLSILMNHRDVLKKAQE EIDQQVGKDRKVDDLDVIKLVYLKAIVKESMRLCLVGPLLERITVEDCEIGGFHVKAGSR VVVNIWKMQHDPELWSDNDTCEFRPERFLTTNAKVELRGQNFELIPFGSGSRMCPGVTFA LELMQLTLARLIHGFELGTPGDMKVDMTETSSVTNYKATPLEILLTPRLNPKLYDC*

 

>22028999 Aquilegia coerulea|Aquca_014_00611|Aquca_014_00611.1

CYP82D

MTFNQYLAIICCFFASVVFCSYLFSWTRRKSTAKIRAAPEPVGAWPLIGHLHMLLPPQPP HITLGSLADKYGGTFILRLGLRRALVVNTWEAAKECFTTNDKVFATRPSSVGAKIIGYNY AAFGLGPYGPYWREVRKIAILELLSNHRLELLKHVRVSEVHTSVKELYQLWTTSNKNEKG AVLVDMQRWFGDLTLNMTVRMVAGKRYFGTSAELDENEARRLQQAIKDLFYLLGMFVVSD AIPFLGWLDFQGHEKAMRRTAIEIDSILGRWLEEHKRNKLDGSTKVDGDFMDVMLSILED EKKLFGHEPDIVNKATCLTMIAAGSDTTMVTLIWALSLLLNNRHTLKKAQDEIDIHVGKD KYVEESDIEKLVYLQAIIKETLRLYPAAPLGVHHEAMEDCTVSGYNVPAGTLLIANLYKI QRDPRIWSNPCEFQPERFLTTHANVDVRGQHFELIPFGSGRRSCPGTSFALQTVHLSLAR LLQGFEFQTRHDAPVDMTESPGLTNLKTNPLQVLLTPRLPSHLY*

 

>22048780 Aquilegia coerulea|Aquca_007_00474|Aquca_007_00474.1

CYP82D

MEVVIETLRYLCYFIIFIPVFIFLFLLGFIKVAIFCPFVFLVIAVGHIGVVIGLLPMHLI WTSYCIAKSKKFGPFLKCLLILILPIPIVLWTIVGIVGSVIMGIFYAFIWPVMETFRAIS KDGHRNKLDGTWSNILGACTIVRDFADFSFFSYFSVMNELLEVKGDEKPIELKVLQIPGC VLAAILGLLVDVPIIVLIVMYKAPIMLVKGWKRLFEDLIGRSGPFLEDVCVPFAGLLILF WPFAVIIAIITGILSSFGFGGYASVVAYQENSTKSGLLYVIASVSLFDEYTNDFLYLREG SCFPRPRYHWTDDARSPLLPLKGLHEQIEPVHDKQPTRTPSQKMKALKAGVIWDNFFKGC EHSCKELLSDGVIEVLDLEAWETSKNKIIEIGIPAHTILQCFLYSIKRSSSGFLMRDNVE LTNINRPEGRIFDWLFEPMSIMKEQIKSLHLQEREELYLLKLAVSCGDTQRLQALENAGI PPDNEIRKAQLEGISRRLHGFCLTISRLPTFRRRFCEVVKALLQEVGDRRGRII

 

MEITLFQVLTGLFLSILIFYLQWPGRNKTRKNTKKTDAPEPAGAWPIIGHLHLLGGHEKL

LYRTLGAMADNYGPAFNIRLGSRRAFVVSSWEVAKECFTTNDKALATRPLTAASKLMGYN

YAVFGF

APYSPFWREMRKLATLELLSNRRLDMLKHVHTSEVDMGLKELHSIWTKKNSSGPVLVELK QWFEELTLNGIVRMVAGKRYFGANADYDVNESTRCQKAIAQFFHLIGIFVVSDALPFLWW LDLQGHESAMKKTAKELDSILSGWLEEHHRERLNGRVKTESEKDFIDVMLSLKEDGQLSN FQHDSDTSIKATCLALILGGSDTTASTLTWAVSLLLNNRHVLKKAQEELDLNVGKERQVD DHDIKNLVYLQAIIKETLRLYPAGPLLGPREAMEDCNVAGYNVKAGTRLVVNIWKLQRDP HVWSNPNEFNPERFLTSHVNVDFKAQSFELMPFGSGRRSCPGLSFALQVLHLTLARLLHE FDLDIPDGVPVDLTESPGLTIPKATPLNVFLTPRLDSKLY*

 

>22048790 Aquilegia coerulea|Aquca_007_00476|Aquca_007_00476.1

CYP82D

MDSILQFLPTPVVGFFIFLTTLYFLIMWTKPSSRRESSIGRPAPEASGAWPIIGHLRLLG GSELPHKTLGALADKYGPVFMIRIGVHPALVVSSWEVAKECYTTNDKTFASRPNSTAAEI LGYNYVMFGFAPYGPYWRELRKIMMSELFSTRRLGLLKHVPDSEIKTSIKELYMLCVNHN KTNGPVSIEMKHWFGDLSLNVILRMIVGKRYFGAASDDDESEARRCHKAMRDFMKISGVF IIDDAIPYLRWLDLQGYKKKMNNISKELDCLFQGWLEEKQGKRLSGEAKDEQDFMDVLMS KLEHTKISEYDNDTIIKAACLSLIAGGNDTTMLTLTWILSLLLNNKQVLKRAQEELDNHV GRDRHVDESDIKNLVYLQAIIKEALRIYPAGPLAGARIATEDCTVAGFHVPAGTRLVVNL WKIQRDPLVWSDPSQFLPDRFLTNHVEMDVKGQNYELIPFGAGRRTCPGMAFALQVMPLV

MARLLHGFELTTPMDMPVDMTETAGLTNVKATPLDVIITPRLRPELYGL*

 

>22037608 Aquilegia coerulea|Aquca_012_00167|Aquca_012_00167.1

CYP82D

MLQPPTLPHRLYSSLADKYGPIFALRIGLHKTLVINSWEVAKECFTTHDRVFASRPDMVV AKILGYDYAMFGPNPYGPYWREMRKIAIIELLSNRRLEQLKHVRVMEISTSIQELYQLWE AKSKNGKERVLVDMKEWFGDLTLNISVKMVAGKRYFGASSKEDKEEARQIHKAIRDFAYL FGVFVVSDAIPFLGWFDFKGHVKAMKKSAKQVGCIMDRWLEEHKQKRTATAGDFMDVLLT VLQDKNLFGREADTVNKATCMNMIVGATDTNMVTLTWALSLLLNNRHILKKAQEEIDIHV GKDKQVEESDIEKLVYLQAIVKETLRLYPPAPGPRESTEDCTVSGFYVPKGTQLLINIRK IHRDPRIWSNPNEFQPERFLTTNPNLDFRGQQFEYIPFGSGRRSCPAISFAVLVVHLILA RMLQGFDFATPSDSPVEMIESVGLTNLKATALEVLITPRLASHLY*

 

>22048595 Aquilegia coerulea|Aquca_007_00475|Aquca_007_00475.1

CYP82D

MDFVHQFLTSTPIMVSLLAFLISLCFLIRWLKRPKSSSTSMEAPEAPGAWPIVGHLRVLG GERNLPHQVLGAMADKCGPIFTVRIGMRCALVVCKWEVAKECFTTNDKSFASRPNTSAAK IMGYDYAMMGFAPYGNYWRELRKLIMFELLSGSRLESLKYIQDSEVHMCINELYQKWVIH DKARGPVAVEMKQWFGDLTQNVILRMMTGKRYSVATSASDETESRRVQSGMRDFLRLLGI FIVEDAIPILEWFDLQGYKKEMKNTAKDLDVLYQGWYEEHQRKKLSGEDKGKKSFIDIMT TMLEEEKIADYDNHTITKATVLSVLSGGDTTNLTLTWTLSLLLNNKQIMKKAQDELDVHV GRDRGVKESDIKNLVFLQAIVKEVLRLYPAAPLSGPRVATEDCTVAGYHVPKGRRLIVNT WKIHRDPSVWSDPLEFCPERFLTTHVDMDVKGTQNYELIPFGAGRRACPGISFALQLVPL ALACLLHAFDLTTKTGMQVDMTESAGLTNVKATPLQVVITPRLRPELYGRGW*

 

>22048213 Aquilegia coerulea|Aquca_007_00344|Aquca_007_00344.1

CYP84A

MFMLDQLTHRGLAQLAKQYGGLFHLQSGVLHMVVVSTPEMARQVLQVQDNILPNHPANIA INYLTYDRADMAFAHYGPFWRQMRKLCVMKLFKSWGSVRDEVETTIQALASKAGSPVNIG EMVFGLTRNIIYRAAFGLSSNENQDEFVAILQEFSKLFGAFNIADFFPFLSRLDLQGLNK RLVKARNSLDKFIDNIIDDHMEKNYKNISNAEENDTDMVDDLLSFYSERGKENETNDLQN PLSLTRDNIKAIIMDIMFGGTETVASAIEWIMAELMKSPEDLRRVQQELNEVVGLDRRVQ ESDLDKLTYLKYVVKETLRLHPPIPLLLHETSVDSEVAGYFIPVGSRIMVNAWAIGRDKT AWDDPDLFNPSRYYKENAADFKGNNFEFIPFGSGRRSCPGMQLGLHATELAIAHLVHCFS WELPNGMKPSQLDMMDVFGLTAPRATRLVAVPISRLSYTFF*

 

>22036645 Aquilegia coerulea|Aquca_006_00094|Aquca_006_00094.1

CYP84A

MELVATIQEPLFMLLLFFILPLSFFLGVFVRRRRKLPFPPGPNGLPVIGNMGMADQLTHR GLAQLSKQYGGILHLRLGLLHMVVVSKPEVAREVLQVQDNIFSNRPATYAIRYLTYDRAD

MAFAHYGPFWRQMRKLCVMKLFSRKRAESWASVQDEVESTVRMVVGKSGLPVNIGELVFN CTNNIIYRAAFGSDLLEGQDEFVSILQEFSKLFGAFNIADFFPGLSWVDPQGLNARLTKA RQSLDRFIDKIIDDHLTKKKKTSDQDDTDMVDDLLAFYKEEAKESKLKDPHISINLTREN IKAIIMDVMFGGTETVASAIEWAMSELLKSPEDLKKVQQELNMVVGLDRRVQESDLDKLT YLKCVLKETLRLHPPIPLLLHETSEDAEVAGYYIPARSRVVINAWAIGRDKNAWDEPEVF KPARFLNKGAPDFKGNNFEFIPFGSGRRSCPGMQLGLYALELAVVHLLHCFSWELPDGMK PDELDMNDVFGLTAPRAIRLTAVPRPRLNCLSS*

 

>22048851 Aquilegia coerulea|Aquca_007_00343|Aquca_007_00343.1

CYP84A

MEFTYQSLNLFSTVLFFLFPLLFILGFLVKSRKKVPYPPGPKGLPVVGNMFMLDQCTHRG LAELGKQYGGIVHLQSGVLHMVAVTTPDIAREVLQVNDANFANRPANLNIKYLTYDHADM AFANYGPFWRQMRKLCVMKVFSKKRAESWTSVREEVETAVQAVVAKSGSAINIGELVFSL TRNITYRSAFGSGSNEGQGEFISILQEFSKLFGAFNICDFFPFLTRFDPQGFNKRCAEAR NSLDGFIDNIIDEHIAKKKNKNVTVDSDADTDMVDDLLAFYDETGVGGRTDNSQSTISFT RDNIKALIMDVMFGGTETVASAIEWAMAELLKSPEDLKKAQQELNDVVGLDRRVNEADLS KLTFLKCVVKETLRLHPPIPLLLHETVEYCEVAGYAIPPRSRVLINAWAIGRDKTAWDEP DTFKPSRFEKENAADFKGLNFEFIPFGSGRRSCPGMQLGLYSLELAVAHLVHCFSWELPD GMKPSELDMSDVFGLTAPRAIRLVAVPTPRLQCCL*

 

>22036654 Aquilegia coerulea|Aquca_006_00431|Aquca_006_00431.1

CYP85A 64% to CYP85A1 Arabidopsis thaliana

MAVLILVFLLVLCLCISTALLRWNEMRYRKKGLPPGTMGWPVFGETTEFLKQGPNFMKNQ RARFGNFFKSHLLGSPIVISMDPEVNRYILLNESKGLVPGYPQSMLDILGKNNIAAVHGP AHKSMRGALLNIISPTMIRDQLLPKVDEFMRFHLSNWDGKTVDIQEKTKEMALSSTLKQI GIESYSAALKPEFYKLVQGTISLPIDLPGTNYGCGLQARKNIIGILRNILEERRASPGVQ HDMLGGLMRYEDSGQKLSDEVIMDQIITLLYSGYETVSTTSMMTVKHLHDHPKALQQMRE EHLEIRKRKGPSEPIDWNDYKSMKFTRAVILETMRLATIVNGVLRKTTHDMELNGFFIPK GWRIYVYLREANHDPCLYPEPLTFNPWRWEGRNLEYHNNFMLFGGGTRLCPGKEMGMVEI STFLHYFMTTYRWEEVGGQNLEKFPRVQAPNGLHIKVSNN*

 

>22045521 Aquilegia coerulea|Aquca_027_00290|Aquca_027_00290.1

CYP85A 62% to CYP85A1 Arabidopsis thaliana

MAVLILLVFVVVLGLCISTTLLRWNEMRYRKKGLPPGTMGWPVFGETSEFLKQGPNFMKN QRARFGQFFKSHLLGSPIVVSMDPEVNRYILLNESKGLVPGYPQSMLDILGKNNIAAVHG PAHKSMRGALLNIISPTMIRDQLLPKVDEFMRFHLSNWDGKTVDIQEKTKEMALSSTLKQ IGIESYSAALKPEFYKLVQGTISLPIDLPGTNYGCGLQARKNIIGILRNILEERRASPGV QHDMLGGLMSSGHKLSDEVIMDQIITLMYSGYETVSTTSMMTVKHLHDHPKALQQMREEH LEIRKRKRPGEPIDWNDYKSMKFTRVVILESMRLTTIVNGVLRKTTHDMELNGFFIPKGW RIYVYLREANHDPFLYPEPLTFNPWRWEDRNLEYNDNFMLFGGGTRLCPGKEMGMVEIST FLHYFMTTYRWEEVGGQNLEKFPRVQAPNGLHIKVSNN*

 

>22026938 Aquilegia coerulea|Aquca_045_00011|Aquca_045_00011.1

CYP86A

METLPLFFTIAAATSAYLLWFYILARQLSGPKVWPILGSLPGLVSNRARLHDWIASNLRS TGGAATYQTTTLALPFVARKQSFFTVTCHPKNIEHILRTRFDNYPKGPNWQEAFHDLLGQ GIFNSDGDTWLIQRKTAALEFTTRTLRQAMARWVSRTIKLRLWCILAKAASENSPVDLQD LLLRLTFDNICGLTFGKDPETLSPGLPENPFSNAFDSATEATLQRLLYPGFLWRLKKAFG FGMERSLRKSLEVVENFMNDTITARKERPSDDLLSRFMKKRDVDGNFFPGSVLSRIALNF VLAGRDTSSVALSWFFWLVMTHPEIEANIIREISMVLKDTRGDDREKWVEEPLNFDEADR LTYLKAALAETLRLYPSVPEDFKYVISDDILPDGTYVPAGSSVTYSIYSVGRMKSIWGED CLEFRPERWLSINGDQFETPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLS LVPGHRVEQKMSLTLFMKNGLQVFMHPRKLEEVSTYTT*

 

>22059334 Aquilegia coerulea|Aquca_013_00279|Aquca_013_00279.1

CYP86A

MDTATVLLLFTAIMGYLLWFSFISRSLRGPRVWPVLGSLPGLIENADRMHEWIAENLRAC GGTYQTCICAIPFLARKQGMVTVTCDPKNLEHILKTRFDNYPKGPTWQAVFHDLLGEGIF NSDGDTWLFQRKTAALEFTTRTLRQAMARWVNRAIQLRFCPILKSAQLEGQKIDLQDLLL RLTFDNICGLAFGKDPQTLAPGLPENSFASAFDQATEATLQRFILPESVWKLRRYLGLGL EVNLNQSLKHVDQYLSSVINTRKLELKNHQKTIVHDDLLSRFMKKKETYSDSFLQHVALN FILAGRDTSSVALSWFFWLVTQNPRVEQKILTEICTVLIETRGDDISKWIDEPLMFEEVD RLNYLKAALSETLRLYPSVPEDSKHVVKDDVLPDGTFVPAGSAITYSIYSTGRMKSTWGE DCLEFKPERWLSADEKRFEVQDSFRFVAFNAGPRICLGKDLAYLQMKSIAASVLLRHRLT IAQGHKVEQKMSLTLFMKYGLMVNVHHRDLSAIVESVSKKCDNTAVNFNCNVNGGCYESA GLVVENVKVGVAA*

 

>22030486 Aquilegia coerulea|Aquca_004_00229|Aquca_004_00229.1

CYP86B

MLYPVIHSLRQRKHHGLPIWPFFGMLPSLINGLRTHVYEMTTTVLQNQNWTYKFKGARLT NFDAVVTSDPCNIEYMLKTKFTNFVKGEFSYTHMCDLLGDGIFNVDGDMWRRQRKISSLY FHSVEFRSMMEDSLAKLIHSRLLPILEDFIKQSKSFDLQDLLLRLTFDNVCIITLGVDPG CLRTGLPEIPFAKAFETATDAMMIRFNTPMFLWKAMQHLDLGWERKLKTSIRQVDEFANK ILHTRKNEIYSTLDAKKSSRDRDLLTVFMESKDDEGKLYTDKFLRDICISFILAGRDTSA IALTWFFWLLHQYPRAEEQIFTEICQILGQRENLKMKEDTDSITFMPEEIKKMDYLQATL SETLRLYPSVPIDSKEALEDDMLPNGTKLKKGARVLYSIYTMGRMENLWGKDCKGFKPER WLKDGKFMNESPYKFMAFHAGPRLCLGKDFAYYQMKVIAASIIYRYRVKVVENHPVTYRL SLTYYMKYGLN

 

>22053939 Aquilegia coerulea|Aquca_002_01455|Aquca_002_01455.1

CYP86B

MMNLYNHTSLSSSQFTRDGMFSYRTMFLLSEFQLFEIVVAFVIFVVIHSLRQKKQHGLPV WPFVGMLPSLLVGVHTGIYEWITNLLHRHNGTFLFKGPSFSNLNCVLTCDPRNLEYLLKT KFLNFPKGEYFRNTVQDLLGDGIFSADDETWRRQRKTASIEFHSSQFRNMTAESLIELVH SRLLPVFEDSIKHSTPIDLQDVLLRLTFDNVCMIAFGVDPGCLSPGLPEIPFARAFEEAT EVTVLRFFAPTFIWKARRYLNLGTERKLKRSIRQVHEFANDVIHTRKKELSLEMDNKQLK SDLLTVFMRLEDEEGKPFSDKFLRDICVNFILAGRDTSSVALSWFFWLLEKHPEVEMKIL EEINNIVAQREGNLEFKDVLVFKPHEVKKMDYLQAALSEALRLYPSVPLDHKEVLEDDVF PDGTILKKGSKVIYAIYAMGRMESIWGKDCTKYKPERWLREGRFMSESAYKFTAFNGGPR LCLGKDFAYYQMKFVAASIIYRYQVKVDANQSVVPRLALTMYMKNGLKATLKRREEFELH

NQVKHQS*

 

>22049324 Aquilegia coerulea|Aquca_003_00623|Aquca_003_00623.1

CYP87A

MWSVILFIAALIVICITHWVHRWRNPRCNGILPPGSMGLPIIGETLKFFAPYSSSGVSPF LAEKMNRYGSLFRTSLVGYPVIVSTDAEINHFIFQQEGRLFKSWYMDSFTEIFGGSNVQD VDTFNLKQKLLPELEQTARNYLQLWSNQQSVELKDGISAMIFYLTAKKMISYDEAKSCAK LRENFVDFIKGLISFPVNIPGTIYYKCLQGRKKAIKFLKHTLDERRASPEMHHGDFLDLI IEELKKENSILTERFALDLMFVLLFASFETTSSALTLGMKLLIEHPSVLEELTKEHETII RNRENLSTGITWMEYKSMTFTFMVINEILRLANAAPGLFRKTMKEVKLKGYTIPQGWAVM ISSPPAVHLDPLNYEDPLMFNPWRWENVESTGGSKNLIAFGGGSRFCVGADMAKMQMTVF LHCLVTKYSWTIIKGGEISRAPGLMFPNGVHVQLKNK*

 

>22059876 Aquilegia coerulea|Aquca_013_00399|Aquca_013_00399.1

CYP87A

MWPILCIGAFIVISITHWVHRWRNPKCNGKLPPGSMGLPLLGETLQFFAPNTSSAIPPFI KDRMKRYGPVFRTSLVGRPVVISTDPEINHFIFQQEGHLVQSWYPDTFTEIFGRQNVGSL HGFVYKYLKNLVLSLFGPESLKDKLLPQVELTAHKTLGLWASQGTVELKEATANMIFDLT AKKLISYEYDPAKSSENLRENFVAFIHGLISFPLDIPGTAYHKCLQGRKKAMKMLKDMLE ERRLMPERCQEDFFDFVLIELKKEGTILTEEMALDLMFVLLFASFETTSLALTLAIKLLT DHPHVLKELTEEHETIVRNRENEDAKLTWKEYKSMTYTAQVINEVVRLANIVPGIFRKAM RDIEIKGYTIPAGWAIMVCPPAVHLNPAKYENPLEFNPGRWKGMESNGASKHFMAFGGGM RFCVGTEFTKVQMAVFLHCLVTQYRWTAVKGGNIVRTPGLSFPDGFHIRVSKKNK*

 

>22037526 Aquilegia coerulea|Aquca_012_00230|Aquca_012_00230.1

CYP87A

MFIHAVMVAAILVIVWMTNWVYRWRNPRCNGKLPPGSMGFPLLGESIQFFKPVSSFDIHP FVKDRVKRYGKLFKTSLVGCPVIVSTDPDFSHFIFQEGNSLELWYSDSFMKLIGQHKLTT STGVTHKYLRNMIMDQFGPEKQKEKSLLEMEDMARSTLYSWSKQESVEVKEAVTTMSFGL GSMKICSYDPSKYSENLKDKYTSFIKALICFPFNIPGTLFHKCIKDQRRAISMLKDLLTE RLHSAKKYGDFLDVVVEEMKKDDPLFDVESAAYFVFAVLFASFETVALAITLAINFISDH PSVLQDLMIEHDEILRKRENKDSSLTWNEYKSMTFTSHVIDETLRLANIAPLILRRATKD VQVEGYTIPAGWTVMVCPPALHLNPEKYNDTLAFNPWRWKGQGSNTASKNFMAFGGGMRL CAGAEYAKLQISVLLHFLVTKYRWTKIKGGEVVKAPGIIFPNGFHIQVTERQ*

 

>22033534 Aquilegia coerulea|Aquca_009_00456|Aquca_009_00456.1

CYP87

MSSIALFVVALAIVYITHLVHKWRNPKCNGKLPPGSMGLPLVGETLQLLTSQASFDIHPF VKKRMQRYGPVFKTNLARRPVVISTDPEFSHFLFQQEGNSVELNIWFMESFKKVVEKQNL NVHKYIRTIVLNYFGTEKQKETLLIEMEEIARRNIDTWAKQASVEVKEVTTTMAFGLASK KLLSYDPSKYSESLKDMFTGFLQGLMAFPLNIPGTTFHKCLKDQRKAMSVLKDMVTERLN THASQHGDFLDVIIGEMKKDEPVFDVESATYLVFAILVASFETISLALTLAIKFISEHPT VLKELTDEHENILKNRGNVDSAITWKEYKSMTFTSHVIDETLRLGNINPMMFRKATKDIQ VNGYTIPSGWAIMVCPPAIHLNPEKYRDPLSFNPWRWKGQGSNTASKNFMPFGGGMRLCA GSEYTKLQMSVVLHFLVTKYRWTKIKGGEIKQTLGVVLPNVKQD*

 

>22039024 Aquilegia coerulea|Aquca_102_00048|Aquca_102_00048.1

CYP87

MWSLIGVFAVALIIIFITHWVYRWRNPMPNVKLPPGSMGLPFIGETLQLFASQSSFDIHP FIKKKMNRYGPIFKTNLVCRPIVITTDPEFSHFVFLQEGNSTETYLPFLESSRNAFEKNN

MNIHKYLRNMVLGYFGTEKQKERLLSEMQEMVGRNIAIWSKQPSVELKEVSANMAFGYAT KKLLSYDSTKYSENLKDAFIGFLRGLMAFPLNIPGTAYHKCQKDKKKVMAVLKDMVTERL NASNANQHGDFLDVIIEEMKRDEPVFDIDGATYVVFAILLASFETISLALTLAIKFISED QAVLKELTDEHEKILKNRENIDSAITWNEYKSMTFTSNIIGETLRLGNISQLIFRRATKD IEVNGYTIPSGWGIVVYPPAIHLNPDKYEDPLLFNPWRWKGQGSSTASKNFMPFGGGCRL CAGAGYTKLQMTIVLHLLVTKYRYKLKNKWTKIKGGEVIQRVGVVFPNGLHIKVTENS*

 

>22034093 Aquilegia coerulea|Aquca_009_00457|Aquca_009_00457.1

CYP87

MWFLLMFVVALLIVYMTHLVYRWNNPKCNGTLPPGSMGLPLLGETLQLFSSQSSFNIHPF VKKRMERYGPVFKTNLGCHPIIISTDSEFSHFIFQQEGKSVELNVWFMDSFKRVVEKLNM SVHKYIRNMVLGYFGTEKLKQTLLLEMEEMARRNIDIWSKQASVEVKEVTTTMAFGLASK KLFSYDQSKYSDNLKDMFTGFLQGLIALPLNIPGTAYHKCLKDKNRAMGVLKEMVKERLN SYASDHQEDFLDVIIGEMKGDDPLFDVEGATYLLFGILLASFETISLTLTLAIKFISEDP AVLKELTNEHENILKKRENVDSPITWEEYKSMTFTAHVIDETLRLGNINPMMFRKATRDI ERNGYTIPSGWAILVCPPAIHLNPEKYQDPLTFNPWRWKGQGSSNTVSKNFMPFGGGMRL CAGAEYAKLQMSIVLHFLFTKYRWTKIKGGEIIQTFGVVFPNGLHIKVTENS*

 

>22060410 Aquilegia coerulea|Aquca_044_00115|Aquca_044_00115.1

CYP88A 60% TO CYP88A3 Arabidopsis thaliana

MVMEMVKEEVLIYWLLLVFTVLVGGLMVLVGLLKKANEWFYESKLGDKKFSLPPGDMGWP LIGNMLSFLKAFKSKDPNSFINGYVKRFGKIGIYKSFMFGNPTVLITVPELSKQVLTDSK RFKPGWPQSTYKLMGKKSFLAITDDEHKRLRKLTADPINGHEALSVYLEYIEEAVVSTLE KMPNMGEIEFLTEIRKLAFRIIMYIFVGEGGNAVMEDLEKEYTTLNYGLRAMAINLPGFA YYKALKARKRLDEIFQSVVNERRAKREKHGTPAKKDLMDNLLDIKDENGKNLDDEEIIDI LIMYWNAGHESSAHVTMWATVYLQEHPYIFEKVKAEQEEIAKNRPSTQKGLILKEIKQAG YLSKVIDESLRFLNMSNMVFREAKEDVTINGYLIPKGWKVQVWMRSIHTDPEVYPDPKSF NPSRWDGYIPKAGTFIPFGLGSRFCPGYDLAKLEVFVFLHHFVLNYRLERLNPKCPILYL PHTRPRDNCLARISKSSTSM*

 

>22060511 Aquilegia coerulea|Aquca_044_00114|Aquca_044_00114.1

CYP88A 59% TO CYP88A3 Arabidopsis thaliana

MVMEIVKEEVLSYWLLLVFTVLVGGLLVLVGLLKKANEWFYESKLGDKKFSLPPGDMGWP LIGNMLSFLKAFKSKDPNSFINGYVKRFGKIGIYKSFMFGNPTVLITVPELSKQVLTDSK RFKPGWPQSTYKLMGKKSFLAITDDEHKRLRKLTAGPINGHEALSVYLEYIEEAVVSTLE KMPNMGEIEFLTEIRKLAFRIIMYIFVSEGGNAVMEDLEKEYTTLNYGLRAMAINLPGFA YYKALKARKRLDEIFQSVVNERRAKREKHGTPAKKDLMDSLMDIKDENGKSLDDEEIIDI LIMYLNAGHESSSHVTMWATVYLQEHPYIFEKVKAEQEEIVKNRPSTQKGLTLKEIKQMV YLSQVIDESLRFLNISNMVFREAKEDVTMNGELSHTKRMEGSGLDEEHSHGS*

 

>22060421 Aquilegia coerulea|Aquca_044_00113|Aquca_044_00113.1

CYP88

MEITVLMFTVVIGALLMILLVLLKGANEYIYESKLGDKKFSLPPGDLGWPVIGNMLSFLM AFKSNDPDSFINSYVKRYGRIGIYKSFMFGSPTILVTIPELCKQVLMDEERFPTGWPQTA VELMGKKSFIGISAEEHKRLRKLTSAPVNGHEALSVYLEYIENQVVSTLEKWSNMGEIEY LSQVRKLTFRIIMYVFLSEASEDLMVALEKEYSTLNYGVRAMQINVPGFAYYKALKARKN LVRLLQSVVDERRTRREKCEPPAKKDMMDNLMDCEDENGRKLTDEEIIDVLIMYLNAGHE SSGHTIMWVTVLLEQHPDVFHKAKAEQEEIVRNMPPTQKGVTLKEFRQMEYLNKVIDEVM RFINISLMVFRVASADVNINGYLIPKGWKVQVWLRNVHKDPEVHPDANKFDPSRWDRYPQ KAGTFIPFGMGSRLCPGNDLAKLEIAVYLHHFLLNYRLERVNPNCRIMNLPHRRPTDNCL

GRIKKNSG*

 

>22060533 Aquilegia coerulea|Aquca_044_00116|Aquca_044_00116.1

CYP88 49% TO CYP88D6 (Glycyrrhiza uralensis)

MQHQYRFGRIGIYKSFMFGNPSVLITVPELYKLVFMDDDLSLLFVCIPHDEHKPLRKLMA GLINGQEALSTYLEYIEDAVVSTLEKMPNMGEFEFLTQIRKLTFNIITYIFVSEGGDPAR KGLGMMFQSVLTKKRGIHEKYGTPGKKDMVDNLMIVGDENGETLDDEQIIDILVMYLSAG HESSAHVTMWITVLLQEHPDMFQKAKAEQVEIVKNRSPMQKELTLKEIRQMDYLSKVVDE TLCYINFSLIIFSEATEDVILNGQVQVRMRNVHLDPLVYPDPKKIDPSRWDEHTPKAGAY IPFGLGSRLCPGNDLANLEIFVFLHHFLLNYRLERLNPKCPILYLPHIQGQLIIAWQE*

 

>22041114 Aquilegia coerulea|Aquca_018_00028|Aquca_018_00028.1

CYP89A

MEFSWFSIVVSLSLCFFFKSLFNLIYSNSTKSTAKLPPGPPNIPILTSFQWVRKSFADIE PFLCNLRTQYGPIISLQIGHRKSIFITSHDLAHKALITHGSTFADRPPAPLASRILSANQ HNINSAPYGPVWRLLRRNLTSEILHPSRVKSYGHARKWVLDILKKKIKEDSDSGNKVVCV

MKHFQYAMFCLLVLMCFGDKLDDKKIREIEFVQRDLLLNVGKFNVLSFFPKFGKILFRKR WNLLYKLRSNQENVLLPLIHARKRKENKENNGEEEEVEVQVVTTAYVDTLLNLNIPEQGG RKLNDQEMVSLCSEFLNAGTDTTSTALQWIIANIVKHQDIQVKLLEEIKGVDVNDGDEIK EEDLHKMPYLKAVVLEGLRRHPPGHFVLPHAVTEDIQFDDYVVPKNAAVNFMVAEMGWDP KVWKDPMEFKPERFCGEEVFDITGTREIKMMPFGAGRRICPGLGLALLHLEYFVANLVKE FEWKAEIGDEVDLSEKQEFTTVMKNPLKALISLREG*

 

>22026907 Aquilegia coerulea|Aquca_045_00055|Aquca_045_00055.1

CYP90A

MAFFLLYLSLFLCSSTFFYLLFLRFTLQRRLSLPPGSFGLPIIGETLQLISAYKTENPEP FIDDRVNRYGNLFSTHIFGERTVFSADPEVNRFVLQNEGRLFESSYPTSISNLLGKHSLL LMKGNLHKRMHSLTMSFANSPIIRNDLLVDIDRLIRLNLDSWTNKVFLQDQAKKITFSLT VKQLMSYDPGEWTEQLRKEYLLVIDGFFGLPLPFFFTTYGRAIKARTKVAEALRLIVRER RKEFEENINNRKKDMLNALFLEEGGGISDEEIVDFLVALLVAGYETTSTIMTLAVKFLTE TPLALAQLKKEQEGIRAKKNETESLEWSDYKSMPFTQCVINETLRVSNIISGVFRRATTD VNIKGFTIPKGWKVFASFRAVHLDQDYYKEARTFNPWRWQNENDISEAPSTASSQGNTYT PFGGGPRLCPGYELARVEISVFLHYLVTKYSWEPAEKDKLVFFPTTRTQKNYPINVHRRK

LGHEL*

 

>22046501 Aquilegia coerulea|Aquca_010_00476|Aquca_010_00476.1

CYP90B

MPELVFFFSLAPAILALILLLKLFKRKKKSYNLPPGNMGWPYLGETLGYLKPYCAITTGD FMEQHISRYGKIYKSNLFGYPTIVSVDPELNRYVLQNEGRLFECSYPSSLGGILGKWSML VLVGDMHKNMRMISVNFMSSARLRTHLIQDVETQALLVLKSWQVDKKILAQDEAKKFTFN LIVKNIMSMEPGTPESEKLRREYITFMKGIISAPLNLPGTAYRRALKSRSNILQLIEHNM NERLQKTNGDGKKVEDDDLLGWVLKHSNLTTEQILDLILSMLFAGHETSSVSISLAIYLL QGCLKAVEELREEHIRIAKAKEQAGQRSGLNWEDYKHMEFTQCVINETLRLGNVVRFLHR KTLKDVQYKGYDIPCGWKVLPVFAAVHLDPLNFDQPHAFNPWRWQNGKTSTTTNNFMPFG GGLRLCAGSELAKLEMAIFIHHLVLNYDWDIAEPDQPFAYPFVEFPKGLPIKVYDHQCLT *

 

>22047532 Aquilegia coerulea|Aquca_010_00585|Aquca_010_00585.1

CYP90C

MFWIIGIWVLVAIITGWWWYCWTKKSIFKKIKTSSSSSRQESDHSTYKIPKGNSGWPFIG ETLHFIASGCSSHPVSFMEKRRSLYGKVFKSHLLGIPIIVSTDPDVNKVVLQNNGSTFIP YYPKSVTELLGKSSILQMNGNLQKKVHGFIGGFLKSPQLKARITKEIEKIVFLSMESWND KEIIYMQEETKNITFPVLVKVLMGVDQAEDLEFLKKEFGEFIKGLVCLPIKLPGTRLYKS LKAKENLLKMVKRIVEEKKLKLERIRTEEIDQMDVVEVLLGDIGESVPSDFISGNIIEMM IPGEESVPMLMTLAIKYLSDCPLALQQLMEENMELKRQKNQLNEQDYVWTDYMSLPFTQN VISEALRMANIVNGVWRKALKDVEIKGYLVPKGWGVLASFLSVHMDEENYENPYQFNPWR WQNKQGHVAVNYNSFTPFGGGQRLCPGLEFSRLEVSIFLHHFITSYRWEAEEDYIVNFPT VRMKRKLPIRVAPITT*

 

>22040220 Aquilegia coerulea|Aquca_037_00070|Aquca_037_00070.1

CYP90D

MKNIFIIFFGGILLYRIWSRIRSKTTTPLPLGTLGWPIIGETLEFISSAYSDQPESFMNR RRLKYGKVFKSHLFGSATVISTDAEVSKFILQSDARTFVPSYPSSLTELMGKSSILLING SLQRRVHGLIGAFFKSPNLKAQITGDMEKYLQESMDSWKDDQLIYIQDVAKNITFHVLVK ALISLDPGAEMELLQKHFQEFIAGLMSLPINLPGSQLYRSLQAKKRMVKLVHKILRERRK NCTLSAPKDVVDVLLSDGSKQLTVDLISDNMIDLMIPGEDSVPILMTLAIKYLSSCPRAL HQLMEENMNLRRTKIQLGEPLRWTDYMSLSFTQNVITETLRMGNIIIGVMRKAMKDVEIK GQLIPKGWCVFAYFRSVHLDESTYDWPHQFNPWRWQDKDMGTCNFTPFGGGQRLCPGLDL ARLEASIFLHHLVTQFRWIAEDDSIVHFPTVRMKRKMPIWVIRRRIPTEL*

 

>22038616 Aquilegia coerulea|Aquca_028_00120|Aquca_028_00120.1

CYP92A

METSLIVLALAWLGAVIAFISNKIRKPKKKSPPGPKPWPILGNLHQLGSLPHISLHLLAE KYGDIMQLKYGSRTVVVATSAKMAEEFLKTHDGVLASRPPLASGKYTDYNFKGMIWAPYG PHWKKARKVYLTELFTLKRLDSFEYIRAEERLRFLSGLYAQCENPVVLKNHIKRYTLSSI SRVILRDKYFSDHKTNTSLVSISEFHEMIDEWMVLNGVLNIGDWIPWLRMFDLQGYVKRM KVLRKKFDAFHDYAIADHMAQKDLAGKNFVPKDMADVLLQLSEDDTDPDVKLNMESVKAL VHDLMLGGTDTSGTTTEWAIHEILRHPHVLAKLREELDKVTGGERWVEENDFPQMPYLEA IIKETSRLHPLSPLLAPHFALEDCNVAGYDIAKGTTILINTWSIGRNPIYWDNPDEFMPE RFLQGKEISMSGKDFTLLPFGAGRRKCPGYILGLRIVRTTIANIFHGFNWKLPKGMKHED ICMVERYGLTTCPEVPLTIIPEARLPIHLYK*

 

>22056963 Aquilegia coerulea|Aquca_034_00169|Aquca_034_00169.1

CYP92A

NFNLIGSLPHRSIHDLSKKYGSLMHLKFGSYHVVVASSTEMAKEFLKTHDVIFSDRPQTA AGKYTTYGYSNITWSQYGPYWRQARKICMVEVFSSKRLESFQYIRVEETRALIKGIYNSP GHHISLRNHLYDVNLNIISRIVFGKKYLDEDESQTSIITPNEFKKMLDELFFLNGVLNIG DWIPWTRFMDLQGYVKRMKMLRKKFDLFLEHVIHEHNEKRHGVQNWVANDIVDVLLQLAD DPNHEFKLKKKSVKAFSLDMIGGGTETSAVTVEWAISELLKHPKTFNKATEELDRVIGRE RWVEEKDMPKLPYIEAILIETMRLHPVIPMLLPRLTHENCEIAGYAIPAGTRALVSVWTI GRDPSLWDKPEEYWPERFIGKSIDLKGTDFKLLPFGAGRRMCPGYILGQKVMQLTLANLI HGFSWKLHENMKPVDLNREEVVGFTVRKKVPLEAVVEPRLPPHLYQPSLWTSRVGKHIEL

DA*

 

>22056652 Aquilegia coerulea|Aquca_034_00170|Aquca_034_00170.1

CYP92A

MDGLTWFLYAATGLATLVLLLKVLYLRPRLNLPPGPKPWPIIGNFNLIGSLPHRSIHDLS KIYGPLMQVKFGSFPVVVASSVEIAKQFLKTHDIIFSGRPQTAAGKYTTYNYSDITWSQY GPYWRQARKICIMELFSSKRLESYEYIRVEETLALLNGLYTTSGKPVSVKDHLSDVSLNV ISRIVFGKKYSNEDESKTSIVTPNEFKKMLDELFLLNGVLNIGDWIPWTGFMDFQGYVKR

MKVLSKKFDRFLEHVIDEHNEKRVAVKDWTPKDMVDVLLQLADDPDLEVKLTRTSVKAFS QDIIAGGTESSAVTVEWAISELLKHPNIFEKATEELDRVIGRERWVEEKDMPKLPYIEAV

MKETMRLHPVAPMLVPRRAREDCKIAGYDIPAGTLALVSVWTIGRDPTLWDNPEAFYPER FIGKSIDVKGNDFELLPFGAGRRMCPGYALGLKVIQSTLANLLHGFSWRLPENMKPEDLN

MEEIFGLSTPKKYPLDAVAEPRLPVHLYHGGSVFDEGSLNFT*

 

>22037580 Aquilegia coerulea|Aquca_012_00166|Aquca_012_00166.1

CYP92

MVISKKVRERRNPPKRIPPGPKPWPIVGNLHQLSSLPHKSLHLLAQKYGEIMQLKYGSRT VVVASSPKMAEEFLKTHDNVFASRPPLASGKYTGYNYQDITWAPYGPHWRKGRKIYLTEI FTLKRLDSFESIRVEERLNFLSGIYAESGNPIVLRNHIRRYTLSSISRMVLSDKYFSDHK TDTSLVSISEFHEMIDEWMVLNGVLNIGDWIPWLRNFDLQGYVKRMKAVSDKFDAFYNYV IADHMAKKHLPGKNFVPKEMVDVLLQLSEDDIDPEVKLTLEAVKALVHDLMLGGTDTSGI TIEWTIHEILRHPRVLATLREELDKVIGRERWVQENDFPQMPYLEAIIKETLRLHLPSPM LAPHFALEDCNVAGYDISKETIIFINSWSIGRHPDHWDDPYEFKPERFLQGSEINMTGQD FTLLPFGSGRRGCPGYTLALRLVRTTVGNMFHGFNWIFPEGMRSEDICMVERFGLTTCPE VPISIIPEPRLPIHLYK*

 

>22037584 Aquilegia coerulea|Aquca_012_00169|Aquca_012_00169.1

CYP92

MESSLVPLALACLVAIVFILKKIRNPKRKTPPGPKPWPIVGNLLQLGTLPHMALHEFAKK YGELMQLKYGSRTVLVATSPKMAETFLKTFDSVFASRPPLASGKYTGYDFQDMTWAPYGP HWRKARKIYLTELFTPKRLDSFEYIRVEERRTFLSGLYAQRGNPVVIKNHIRRYTLSSIS RVVLSDKFFSDHKTDTSLVSISEFHEMIDEWMVLNGVLNIGDWIPWLSFFDLQGYVKRMK ILNEKFEVFHNYVIADHMAKKDLAGKDFVPKDMVDVLLQFAEDDTAPDVKLTIDAVKALV HDLMPGGTDTSGVTMEWAIHELLRHPRVLAKLREEIDRVTGGERWVQENDYPEMPYLEAV IKETLRLHPLSPLLAPHFAIEDCNVAGYDIAKGTIVLINTWSIGRHPDHWDDPYEFKPER FLQGKEIGMTGQDFSLLPFGSGRRKCPGYSLGLRLVRTTVANVFHGFNWKFPEGMKPEDI CMVERYGLTTCPEIPASVIPEPRLPIHLYK*

 

>22057495 Aquilegia coerulea|Aquca_057_00097|Aquca_057_00097.1

CYP92

MESSSLVVLTLAFLAAIVFITKKIRNPKKKTPPGPKPWPIVGNLLQLGTLPHMALHEFAK KYGELMQLKYGSRTVLVATSPKMAETFLKTYDSVFASRPPLASGKYTGYNFQDMTWAPYG PHWRKARKIYLTELFTPKRLDSFEYIRVEERRTFLSGIYAQRGKPVVIKNHIRRYTLSSI SRVVLSDKFFSDHKTDTSLVSISEFHEMIDEWMVLNGVLNIGDWIPWLQFFDLQGYVKRM KILNDKFEVFHNYVIADHMKRKNLAGKNFVPKDMVDVLLQFAEDDTDPEVKLTIEAVKAL VHDLMPGGTDTSGVTMEWAIHELLIHPRVLAKLREEIDRVTGGERWVQEDDYPEMPYLEA IIKETLRLHPLSPLLAPHFALEDCNVAGYDIAKETVVLINTWSIGRHPDHWDDPYEFKPE RFLQGKEIGMTGQDFSLLPFGSGRRKCPGYSLGLRLVRTTVANVFHGFNWKFPEGTKAED ICMVERYGLTTCPEVPATVIPEPRLPIHLYK*

 

>22061508 Aquilegia coerulea|Aquca_008_00198|Aquca_008_00198.1

CYP92

MSLLVLTVRATLNLFGNATALKINNHKTTLLVGGMNAQDSQAFTTTMGVGLVKPPITYLG HPLTSTRLSIRDCFPLVERVTKRIHICKNFCASNYSLGPTPLILFFLAFYLRPHHRVNLP PGPKPWPIIGNLNLIGSLPHRSIHELSQVYGPIMQLQFGSFPVVVGSSVEMAKQFLKVND LNFASRPKFSAVKYTTYDYTDIGWAPYGRYWRHVRKMCLTELLNTKKIDSYEYIRVEEGR ALLFGLYASCGNPITLKDHFSDFTLNNITRMILSKKYLDKSKSKELKKIADEWFFLNGGM NIGDSIPWINSLDIQGYVKRMKAFRIKVDPFLEGEVDEHIARRHDHLKNEFVPKDIVDVL LQLADDPNPDLKLSRNNIKSITLDLFAGGVMSPTTIIEWALSELLKHPKLFEKATEELDK VIGRDRWVEEKDLPNLPYIKFIIYETMRMHPGAPMLAPHLARENCKIHGYDIVQGTQVLV NTWSIGRDPTLWDEPNEFCPERFLGRDIDVKGRHFELLPFGSGRRMCPGYSLGLKLIESG LANLLHGFTWKLPNHMMNPYDLNMDEVWGLSVYKKVPLVAVAQPRLPIHLYTNVI*

 

>22061869 Aquilegia coerulea|Aquca_008_00199|Aquca_008_00199.1

CYP92

MEVLLWLLRTATLLAPPILLSWLLRTATLIAPLILFFLAFYLRPHHRVNLPPGPKPWPII GNLNLIGSLPHRSIHELSQVYGPIMQLQFGSFPVVVGSSVEMAKQFLKVNDLNFASRPKF SAVKYTTYDYTDIGWAPYGRYWRHVRKMCLTELLNTKKIDSYEYIRVEEGRALLFGLYAS CGNPITLKDHFSDFTLNNITRMILSKKYLDKSKSKELKKIADEWFFLNGGMNIGDSIPWI NSLDIQGYVKRMKAFRIKVDPFLEGEVDEHIARRHDHLKNEFVPKDIVDVLLQLADDPNP DLKLSRNNIKSITLDLFAGGVMSPTTIIEWALSELLKHPKLFEKATEELDKVIGRDRWVE EKDLPNLPYIKFIIYETMRMHPGAPMLAPHLARENCKIHGYDIVQGTQVLVNTWSIGRDP TLWDEPNEFCPERFLGRDIDVKGRHFELLPFGSGRRMCPGYSLGLKLIESGLANLLHGFT WKLPNHMMNPYDLNMDEVWGLSVYKKVPLVAVAQPRLPIHLYTNVI*

 

>22046039 Aquilegia coerulea|Aquca_051_00019|Aquca_051_00019.1

CYP92

MESSVIVLALACLAALLAFISKKTQNTKKRNPPGPKPWPIIGNLHQLPPLPHISLHLLAK KYGEIMQVKYGSGTVVVASSPKMAEEFLKTHDNVFASRPPLASGKYTGYNFQDMTWTPAG PHWRKARKVYLTEIFTPKRLNSFEYIRVEERQRFLSGLYAKSGNPVLLKNEIRRYTLSSI SRVVLRDKYFSDHKTDTSLVSISEFHEMIDEWMVLNGVINIGDWIPWLRVFDLQGYVKRM KVLRDKFDAFHNYVIADHMAQKDLAGKNFVPKDMVDVLLQLSEDDTDPEVKLSIEAVKAL VHDLMPGGTDTSGTTMEWAIHEILRHPDVLAKLREELDKVTNGGERWVQEDDFPQMPYLE AIIKETLRLHPLSPLLAPHFALEDCNVAGYDIAKGTTVLINTWSIGRHPDHWEDPYEFKP ERFLQGKEISMTGQDFTLLPFGSGRRKCPGYTLGLRLVRTTVANIFHGFNWKLPEGMKSE DICMVERYGLTTCPEVTLSIIPEPRLPIHLYK*

 

>22025237 Aquilegia coerulea|Aquca_020_00536|Aquca_020_00536.1

CYP92A 54% TO CYP92B3 tobacco

MKYGKRNATSTFLLLFFLGLYLLPHRLNHPPGPKPWPIIGNLNLIGPLPYRSIHELSQKY GPIMQLRFGSFPVVVGSSVEMVKHMVWAPYGPYWRHVRKICLTELFNTKRLDSYEYIRVE ERHAFLSGLYTSCGKPITVKDHFSNFTLNNITRIVLGKKLCDESESKKLKNMLDEGSFLN GVLNIGDLIPWINFLDLQGYVKRMKALRNKTDLFLKCELDEHIARRQDHSKEFIPKDIVD ILLQLADDPNPNLKLSRDSIKSITMDLIVGGVESSTITTEWALSELLKQPQKFEQATEEL DRVIGRNRWIEEKDIPKLPYIKSIIYETMRMHPVSPLLAPRLARENCKIYEYDIGQGTQV LVNVWSIGRDPTLWDAPNEFRPERFLGRDIDVGGQHFALLPFGSGRRMCPGYSLGLKLIE SGLANLLHGFTWKLPNHMNPFDLNMDEVWGLTVPRKNPLVAVAQPRLPIHLYTV*

 

>22025263 Aquilegia coerulea|Aquca_020_00534|Aquca_020_00534.1

CYP92A

MENISGILHSGAWLATSLLLLFFLGLYHFAHRLNRPPGPKPWPVIGNLNLISSLPHQSIH ELSQKYGPIMQLYLGSCPVVVGSSVEMAKQFLKIHDQSFAYRPSSSAGKYFHYDYTDMLW APYGPYFRHVRKIWLTQLFNKKTLDSYEYLQVEERQSLLSGLYASCGSPVSLKDHIYNFT LNIITRVVLGKNLGDDSQSKEFKKILDESFVLTGMMNIGDLIPWINFLDLQGYVKKIKAM SIKIDEFLERELDEHIIRRQDHSSPKDMVHVLLQHADDPNPELKLSRNKIKSLTKDLLGA GPETVSATIEWAMSELLKHPEHFTKATEELDRVIGRDRWVEEKDIPNLPYIKSIIFETMR

MHPAAPMLAPHFAHENRKIHGYDIVQGTQVLVNVWSIGRDPTLWDAPNEFRPERFIGRNI DVKGQHFELLPFGSGRRMCPGYSLGLKLVESGLANILHGFTWKLPSEMKPQDLNMDEVWG LTVPRKVPLIAIAQPRLPVYVYSM*

 

>22025346 Aquilegia coerulea|Aquca_020_00537|Aquca_020_00537.1

CYP92A

MNIGDSIPWINALDIQGYVKRMKAFRIKVDPFLEAEVDEHIARRHDHLKNEFVPKDIVDV LLQLVVDPNPDFKLSRNNIKSITLDLFAGGVTSPTTIIEWALSELLKHPKLFKKATEELD RVIGRERWVEEKDLPNLPYIKFIIYETMRMHPGAPMLAPHLARENCKIHGYDIVQGTQVL VNMWSIGRDPTVWDEPNEFCPERFLGRDIDVKGRHFELLPFGSGRRMCPGYSLGLKLIES GLANLLHGFT*

 

>22038644 Aquilegia coerulea|Aquca_028_00100|Aquca_028_00100.1

CYP93A

KICTSELLNGRTLDQLYSIRREEILRFLRVMLHKSSDAEGTVNVSSELLKLMTNIISRMM

MSKSWSSEYEIQTEEIIILLHEVEELTTMLDLSDCIWLCRHLDLQGIMKRSKNVDQKLDA NEKVEGGRLKHLLDILLDVAENNNAEFKLTRENIKAVILDLFVAGTDTSAKTMEWALTEL INHPHIFQKAREEIDSVVGKNRLVEESDIPNLPYLQAIVKETLRLHPAGPLLARRASEDC KVGEYDIPKNTRLLVNVWAIGRDAKHWENPLEFCPNRFLTEEGSVKSQLDVRGHYYHLLP FGSGKRGCPGISLALRIVQTTLAIIIQCFDLRVVDEKESTVDMIEAPGLLLTRAHPLRCV PVARLNVLPLM*

 

>22038717 Aquilegia coerulea|Aquca_028_00099|Aquca_028_00099.1

CYP93A

IIIWTSRRGARLPPSPLALPIIGHLHLIAPIPHQQLHKLSNKYGPLIHVLIGSIPCVVAG TAETAKKEFLKNHELTFSDRPFIAASDYITYGSAVLTFASYGPLYRFRRKICTSELLNGR TLDQLYSVRHEEIRRFLRMMLHKSDTEVTVNVSSELLKLMTNLISRMMMSKSWSSESEIE TEEIIILLHEVEELSAMLDLSDCIWFCRHLDLQGVMKRSKNVHLKLDAFLEKIIKEQEEI RTKRNDKIEGGHVKHLLDILLDVAENNSAEFKLTRENIKAVILDLFLASTDTSSKTMEWA FAELINHPHIFQKAREEIDSVVGKNRLVEESDIPNLPYLQAIVKETLRLHPPGPLLARRA SEDCKVGEYDIPKNTTLLVNVWAIGRDAKHWENPLEFCPNRFLTEEGSVQSQLDVRGHHY HLLSFGSGKRGCPGISLALRSVQTTLAIIIQCFDLTVAGGNGATVDMSEAPGILLTRAHP LRCVPVVRLNVLPLM*

 

>22038777 Aquilegia coerulea|Aquca_028_00106|Aquca_028_00106.1

CYP93A

MVGSDFLNFTVYGIIFAISAVAVIIWRSRRRVRLPPSPLALPIIGHLHLLGPILHQNFYK LSNQYGPLIYLLLGSVPCVIASTAETAKEFLKTHELAFSGRPFLDAVDYITYGTADFTFA QYGPYWRFMRKLCTSELLNGRTLDQLYYVRREEIRRFLAVMLQKSDAEETVSVSGELLTL

MNNIISRMMMSKRSSESENETAEIRILVNEVAEISGTLNLSDCIWFCRYFDLQGIKKRTE DVHVRLDAIIEKIIKDQRELRNQNSEGGRVKHLLDILLDVAEDDNAEFQLTCENIKSFIL DVFVAGSDTSAKTTEWALAELINHPDIFEKAREEIDSVIGKNRLVEESDIQNLPYLQAIV KETLRLHSTGPLLVRRASEDCKVGEYDIPKNTRLFVNVWAIGRDAEHWENPLEFRPNRFI TEEGSLKSQLDVRGHQYQLLPFGSGRRGCPGISLALRSVQTTLASIIQCFEFKVGDGKGA TLDMTEGPGLTLPRAHPLVCVPVARLNILPLL*

 

>22038812 Aquilegia coerulea|Aquca_028_00233|Aquca_028_00233.1

CYP93A

MKKLCMSELLGGRTIDKLLPVRREEIKLFLKMMSHKSDSAETVNVSAELTMLMNNILTRM

MLSKRCSESENDAEEVKSLVNEVTELGGKFNLSDYIWFLRNIDLQGYKKRSEDVHIRYDA

MIEKIIKEHEEVKSKQIEKGERDDVVKDLLDILLDLAEDDELEFKLTRENIKAFILDLFA GTDTSASTTEWALSELINHPDIFEKARAEIDYVVGKNRLVEESDIQNLPYLQAIVKETLR LHPTGPLVVRKSSEDCRVGEYDIPKNTRLFVNVWAIGRDPKHWENPLEFRPTRFTTGDKI DVRGQQFQFLPFGSGKRGCPGVTLALQVVQTTLASLIQCFEFRMEDGKSATLDMTEGPGL TLPRANPLLCVPNARFNLVPLHIVD*

 

>22038921 Aquilegia coerulea|Aquca_028_00232|Aquca_028_00232.1

CYP93A

MIMESDLLNFTLCSIIVIITTSVAILMSSRGTGRLPPSPVKLPIIGHLHLLGPIPHQAFY KLSNKYGPLIYLLLGSVPCVVASTAETAKEFLKTHELSFSGRPFLTAVDKLTYGSADFTF AQYGPYWRFMKKLCMSELLGGRTIDKLLPVRREEIKRFLKLILQRSDSEETVNVSAELTT LMNNIISRMMLSKRCSESENDAEEVKTLVQEVAELGGKFNLSDFIWFLRNIDLQGCKKRS EDVHVRYDAMIEKIIKEHEEVKSKQKESSEDGVKDLLHILLDAAEDDKAEIKLTRENIKA FILDLFVAGTDTSASTTEWALSELINHPDIFENAREEIDNVVGKNRLVEESDIQNLPYLQ AIMKETLRLHPTGPLVVRKSSEDCRVGEYDIPKNTRLFVNVWAIGRDPKHWEDPLEFRPT RFTTGEKIDVRGQHFHLLPFGSGRRGCPGATLALQVVQTTLASIIQCFEFRMEDGKSATV DMTEGPGLTLPRANPLLCVPNARFNLLPLV*

 

>22033514 Aquilegia coerulea|Aquca_009_00210|Aquca_009_00210.1

CYP93A

MCGILLLISATIAIIWRSQGGNRLPPSPLALPIIGHLHLLSPIPHQAFHKLSTKYGPLIY LLLGSVPCVLASTAETAKEFLKTHELSFSDRPFSAAVDYLTYGSADFSFAPYGPYWKFMK KICMSELLGGRTLDQLLPVRREEIRRLLMKMIRKSDSEDTVDVGGELITLANNIISRMMM NKRCSESEKEAEDVRSLVHEVAELTGTFNLSDYIWFCRNIDLQGLRKRFEDLHVRFDAMA EKIMKEHEEVRGEKNERGNEGDRVKDLLDILLDVAEDDKAELKLTRENIKAFILDIFAAG TDTTAITIEWALAELINQPDIFDKAREEIDSVVGKSRLVEESDIQNLPYLQAIVKETLRL HPTAPLIVRESTEDCKIGEYNIPKKTRLFVNVWAIGRDPKHWDNPLEFRPNRFLTEGSGK SQLDVRGQHFHLLPFGSGRRGCPATTLALQVVQTTLASMIQCFKFKLGDGKGTTVDMTEA PGLTLPRAHPLVCVPVARFNLLPLI*

 

>22048630 Aquilegia coerulea|Aquca_007_00722|Aquca_007_00722.1

CYP93H1

MEMAFEILFYIILIFSLSSIFGRKFLSAKSQKCISNRLPPGPKGLPIIGHLHLLNNTPHQ TFHNLCSRYGPFIHVRLGSVFCIVASSAEYAKETLVTNGLAFASRSVNIASDLLTYGSAG FGFAPYGPQWKFMKKLVTTELLSDKNMTQLKYVRSDEASQLVQLLLDNATSGTVVNVSNE VTMLSNNIISRMMWNIRCSGEDEDGKEIISIIRECTEILAQFNLSDFIPFLGKIDLQGVR KRAMNIHLRYDAILEIIIKKRHEERRKNKERNMQDAGGDNGDDHNSKNFLNILLDAMEDE NAKTPVTIENIKALMFDFLNAGTDTSATVVEWSLSELINHPTIMAKARQEIDTIVGKDRL VQESDLPNLPYLQAIFKESLRLHPPVTLFGRESIQDCKIGGYDIPAKTVLFLNIWSINRD PNYWKTPLEFRPERFMPHSDQKEGDDNEYLLEYRGQHFNYLPFGAGRRGCPGMSLAALIS PRVLALLIQCFDWKIACNDKGVAPKLVDLTERPGLTVPKLHPLMLIPSVRLNPFPISLD*

 

>22048256 Aquilegia coerulea|Aquca_007_00720|Aquca_007_00720.1

CYP93H

MILKILFYISIFVLTTLLGRKFWSPKTQKCVTRLPPSPKELPIIGHLHLLNNTPHQTFHN LCARYGPLIHLRLGSVICIIASTPELAKELLITNGHTFASRPVNIAINLLTYNSVDFVFA PYGSYWKFMKKIVASELLGDQTLAQLKDIRFDEASQLIHFLLNKARTGTIVNLSQEVTKV SNNIITRMMWNIRCSGEDEQAKEIRNLVRDSMEILAQFNLSDFIGILRNIDLQGIRKRAK NIHLRSDALLEAIMKKREEVRNEKKEKTNMSFVGGDHKINDFLNILLDTLEDEESKIRLT RENIKAFMFDILTAGTDTSGIVVEWAMSELINHPTILQKAIEEIDSVVGKNRLVKESDIQ DLPYLQAIFKETLRLHPPIPIFDRESTEDCNIAGYDIPAKTILFINNCSICRDPKNWKNP LEFQPERFMSGSEGDDNQNLVDVKGQHFILLPFGTGRRGCPGMSLVVHLVPTIMALLIQC FDWKPACNDNGVTPKVVDMTERPGFTVPKAYPLMVMPSTRLNPFPISP*

 

>22054383 Aquilegia coerulea|Aquca_086_00030|Aquca_086_00030.1

CYP93

PTVWSSKTQKRLTGLPPSPKEIPFIGHLHLLNNTPHQTFHNLCSHYGPLIHLRLGSVLCI IASTPELAKELLITNGITFASRPVNIAISLLTYNSAGFGFAPYGPYWKFMKKIVTSNLLG DQTLTKLKDIRFEETSQLIHFLLDKARNETTVNLSQEVTKVSNNIISRMMWNIKCSGEDD QAKEIRTLIRDSTEILAQFNLSDFIGFLWYIDLQGIRKRAKNIHLRYDVLLENIMKKREE VRNENKEKINDFLNILLDTMEDDESKIRLTRENIKAFMFDFLTAGTDTSGIVVEWAMSEL INHPTILEKAIEEIDSVVGKNRLVKESDIQNLPYLLAIFKETLRLHPPIPIFERESTENC NIAGYDIPAKTILFINNWSICRDPKNWKNPLQFQPERFMSGCESGNDDLNLVDVRGQHFN FLPFGTGRRGCPGMQLAVRLVPTIMGLLIQCFDWKLACRDSDSRVTPKLVDMTERPGLTV PKAHPLMVVPCTRLNPFPISL*

 

>22049024 Aquilegia coerulea|Aquca_007_00721|Aquca_007_00721.1

CYP93 58% TO CYP93H1 Aquilegia formosa x Aquilegia pubescens

MIFKVLFSIIIFVLSAVLELLITNERTFASRPINIAINLLTYNSAGFGFAPYGPYWKFMK KIVTSELLGDQTLAQLKDIRFDEASQLIHFHLNKAKTRTVVNLSQEVTKEDEQAKEIRSL VRDSTEILAQFNSSYFIGFLRNIDLQGIRKRAKNIHLRYDALIETIMKKREEDEESKICL TRENIKGFMFDLLTTGTDTSGIVVEWAMSELINYPTILEKTIEEIDLVVEENRLVKE*

 

>22038805 Aquilegia coerulea|Aquca_028_00079|Aquca_028_00079.1

CYP93 54% to CYP93A4 Populus trichocarpa

MLDLSDCIWFCRHLDLQGIMKRSKNAHKKLDALLEKIIKEQEGIRTKKNEKVQGGHLKHL LDILLDVPENNNAEFKLTRENIKAVIL (0?)

XXXXXXXXXXXXXXXXXXX

NFINHPHIFQKAREEIDSVVGKNRLVEESDIPN LPYLQATVKETLRLHPPDCKVGEYDIPKNTKLLVNVWIIGRDAKHWEHPLEFCPNRFIIE EGSLKSQLDVRGHQYQLLPFGSGKRGCPGISLALRSVQTTLANIIQCFELRVASGNGATV DMSEAPGLLLTRAHPLIFVPVARFNLSPLI*

 

>22035286 Aquilegia coerulea|Aquca_009_00226|Aquca_009_00226.1

CYP712/CYP93

MANSNQFDDDHEIVKYILLFLVVRLLLACYMNRRLKPRTKLPPSPLRLPFLGHLYLLGPL LHQSFQYLSKKYGPLVHLHLGTLGPVVLASSPSMAKEFLKTHELNFASRPRLLGSEYTGG SPGFTFTPYGPYWKFVKKICVTELFSNKKLNYFSKIRCEEVQFFLVSLLEKSRLHEPVDM DVALTALTNNIICRMAMSTRCSSSTNEAEECRKIVEELILVAGKLNLVHILGVFGSFDLF GYGKRLGEVNERYMVMAERIMKTHEEKRRDHQAGGWNDQEDEDDLMDILLKISEDDKAEM KLSRHDIKAFLQDIFAAGTETSSVALQWALAELINNPHVFKKARDEIESVVGTSRLVQES DIPDLPYIQAIVKETLRLHPSAPVILRECNRDCTIAGYDILEKTKIFVNIWAIARDPKYW DNPLEFRPERFLKHDGIGSTPTLVDVNHLQFQLQPFGNGRRSCPGAPLALHVMHVTIASM IQCFDWKIINTHEPDVGKQVGLVDMKEKPGFTLRMATPMQCIPLKHCAPFDLDASN*

 

>22032276 Aquilegia coerulea|Aquca_017_00652|Aquca_017_00652.1

CYP94A

MINLEGLVFFLLFILAFIYLVKSKYSRPKLSPFEPRSYPLIGASLDIYAHRYQLNQWFAE ILSKSSTGTFVLRRPVGSVQNIITANPANVQHILKTQFSLYPKGDFFNTTLSDFLGTGIF NADGSNWKFQRQVSSHEFNTKSLRKFVETAVETELFDRLIPILSEAAANNSVLDLQDILQ RFAFDNICKIAFGFDPGYLSPSLPKEDFATAFEDAVRISSERFNAPLPVIWKLKKLFNIG SEKQLKQAISTVREFAQNIVSEKKQELHENSSLESTDLLSRILNSGHSDDDFVIDMVISF IVAGRDTTSAALTWYFWLISCNSHVEKALLEEIREKPSASIYDEVKDMVYTHASLCESMR LYPPVPSDTKEAAGDDILPDGTVVKKGMRVTYHPYSMGRMENLWGQDWADFKPERWLKMD EIEGKWNFVAKDPYTYPVFQAGPRICLGKEMAFLQMKRVVAGVLRRFRVVPVMEEGFQPV FMSYLTSKMKDGFPVRIETRELGAITMS*

 

>22044776 Aquilegia coerulea|Aquca_049_00038|Aquca_049_00038.1

CYP94A

MLLLGVIATFFLFGLLFFFLFFFSIIYLSTSSESSSLDNRKLPRSYPLIGSYFAVFANRN QRHQWLTEVIRHSPTGTFALHRTFGELQIFTANPANVQHILKTHFNLYPKGDLSNTIFSD FLGSGIFNVDGDNWKLQRQISSHEFNTKSIRKFVQTVVETELSDRLLPILASAATTESVI DLQNVLERFTFDNICKIAFGFDPEFLLPSMPPTKFAVAFELATMSSSNRFISMFPAIWKV KRALDIGSEKCVRQAISQVREFAQSMVKKKKHELNETDDLLSRLLNSCLLSETLVTDMVI SFILAGRDTTSAALTWFFWLVSNNSQVEKEILREIREKSESPNYDEVKDMAYIHASLCES

MRLFPPVAADTKVAASDDILPDGTFVKKGTRVTYHIYAMGRMEKLWGVDWPEYRPERWLE KDTVTGKWIFIPKDAYVYPVFQAGPRICLGKDMAFLQMKKIVAGVVRHFRVVPTIEKGSE PVYNAFLTSKMIGGFQVRIERRDD*

 

>22038349 Aquilegia coerulea|Aquca_011_00189|Aquca_011_00189.1

CYP94B

FVFYGGGVHVHSNKLYSTSRYGPPSHPLIGCLIAFYENRYRLLDWYTDLLAQSPTQTIVV ERLGAPRTIVTANPENVEYMLKTNFNNFPKGKPFTELLGDLLGSGIFNVDGKSWRTQRKL ASHGFTTNSLREFVVTALEEEVETRLLPTLEKAMESNEVIDLQDLLRRFAFNIVCKFSLG IDPGSSNDTTSMQLIHPLAKAFDMAAMISARRGAEPVFLVWKIKRYLNISSERELKEEID HIHEAIMEIIKNKKKAINEEKGENASDLLAQLILAGHDEDYIRDMVISFIMAGKDTTSAA

MTWLFWLLSLHPHIENNLRKEVTRVSNGNERFLDYERLKEMEFSKACLCEAMRLYPPVAW DSKYAGVDDILPDGTLVRAGDRVTYFPYGMGRMESLWGKDRLEFKPDRWFIEPDKEENGE LKNVCPYKFPVFQAGPRVCLGKDMAFLQMKYVVASVLNRFEIRPVGSDQPVFVPLLTAHM AGGLKVRVQPRSGT*

 

>22029474 Aquilegia coerulea|Aquca_004_00067|Aquca_004_00067.1

CYP94C

MKYSFAYLFFTFTIFFSLFSLLLFFLRVNFWCNCDICSNYLSAKWVLDFNNLCDWYTHLL RKSPTHTIHIHVLNNIITTNPDNVEYMLKTNFDNYPKGKPFSSILGDLLGRGIFNVDGDS WKFQRKMASLELGSVSIRSYAFEVVTNEITLRLIPLLSSIANKDYHNGNGGVLDLQDVFR RFAFDSICRFSFGIDPGCLKLSLPMSDLAVAFDLASKLSAERALSLSPFIWKFKRLFMFG SEKKLKEAISMVNVLADEVINQRRRLGFANHQDLLSRFMASVNDDKYLKDIVISFLLAGR DTVASGLTSFFWLLSQYPEVESAILAESNRVMKPSQEIVSFEQLREMPYLQACLYECMRL FPPVQFDSKFAQEDDVLPDGTFVKKGTRVTYHPYAMGRMEEIWGLNAHEFKPERWLIDGN FVAQSPFKYPVFQAGLRVCLGKEMALMEMKCVVLSLIKQFRIIPTEPGMALRFAPGLTAT IRGGLPIRVLDRKNIPLPST*

 

>22041385 Aquilegia coerulea|Aquca_072_00176|Aquca_072_00176.1

CYP94C

MEQLSSLQTFLCFLFFIFTIFISLIFFFRLKFFCKCDVCTCYLTSSWSKHFNNLCDWYTH LLKNSPNSTIHIHLLNNIITANPSNVEYILKTKFDNFPKGKMFSMILGDFLGQGIFNVDG ELWKFQKKMASLELNTVSLRYYAFEIAANEINNRLVPLLQLAADKKDFSMDLQDVFRRFT FDNICRFTFGLDPGCLKLSLPMSNFAVAFDLASKLSAERALLPSPYIWKIKRWFNIGSEK KLKDAIKLINVLADEIIRQRRSMMDYDNNHDLLSRFMTTVNNDKYLRDIIISFILAGRDT VASALTCFFWILAKYPNVESAILDESDHVMGPSQYVASFEQLHEMNYLQAALYESMRLYP PVQFDSKFAQERDILPDGTLVKRGTRVTYHPYAMGRMEEIWGSDCLEFKPERWLKNRLFS PVNAYKYPVFQAGIRVCIGKEMALLEMKSVVVALIRQFKMAPAEPNTGIRFAPGLTAALI GGHRVIVKERKKGK*

 

>22063526 Aquilegia coerulea|Aquca_025_00346|Aquca_025_00346.1

CYP94D

MANKSSKKKKAITYSFTTYPILGNLPDFLINRHRFLDWVTYILSNKPTNTLTFRRPGKIQ GVITANPLNVEYMLKTNFENYPKGDRFIILLKGFLGRGIFNSDGDLWKIQRKVASFEFST KSLRTFVIDNVRLELQARLIPLLIRASRMNKVIDIQDLLERFAFDNVCKVAFNEDPACLG GDGTSGSEFMRAFEDAATLSAGRFMYAFPLIWILKKIFNIGSEKRLRESSKIVHEFAEKI IKARIQDKEITQKSDLLSRFIATNDENSTNSLEFLRDIVISFILAGRDTTSSALSWFFWL LSSRPDIERNILEEITAIRTSSGKCIGDTFELDELRQMHYLHAAISEAMRLYPPVAVDTK ACLKDDVMPDGTFVGEGWFVTYSAFSMGRMEKIWGKDCNEYVPERWLENNGTFRPESPFK YPAFHAGPRMCLGKDMAYIQMKSIAASVIEKFEMDVVDKTTCPHHVLSLTLRMKDGLMVK VKERSNSVIDS*

 

>22035287 Aquilegia coerulea|Aquca_009_00365|Aquca_009_00365.1

CYP94F

MEFFYNLTLSTSICTIATIILFIFFFFFVNRAKTRTPIPSSYPLVGNIIALLLNYHRFHD WVTDMISTTPSNTLQVNGLLNIPNGICTANPLNIEHLLRSNFSNYIKGSRFHDFLHDILG DGIFIVDSDLWLTQRKIASYEFNTRSLRSFIDETVQFEISYRLLPLLEIASEKNEIIDLQ DVLKRFAFDNICKLAFGDDPACLDLDQKSIHSSSSFVNAFDEAVEICFSRSLSPIHLIWK IKRYMNVGSEKRLKEAVKVINDYAMKIIRNREEMSSNTDHHQDLLSRFMCCSDDNFESRD LNQKRKFLRDIIISFVLAGKDSTSTALTWFFWVISANPDCISRIYTELTQLPQIRSGVFN YEDLKKLNYLHAAISESLRLFPPVPINSRLSVNNDVLPDGTHVKAGWFADYSAYAIGRME SVWGPDCKEFKPDRWLDKDGVFQPLDQFRFPVFHAGPRICLGREMAYMQMKSIAASVIYG FEIEAVDGGGDVEKMKNPPYMLSLVLKMKGGLPVSLKRRR*

 

>22046754 Aquilegia coerulea|Aquca_010_00225|Aquca_010_00225.1

CYP96P

MDFQWFCQFERWPEFVLAILSFFSIRWYVNHNNSVFMRWPVLDILPSLLQNVHRVHEWTV EISNMVGSTIVGRGPIFGRSEMLFTCDPRNVEYMVRTNFSNYPKGSEFLETFDLIGEGIF NIDFEAWHAQRRMAHTLFTSKEFRSYIANINRNLVQNALVPLLTHSSKNSSVLDFEDVFL RYAFDSIFTVIFGKSSNCLALNATSNEFSNAIDDGTEAMFFRNVIPSPLWKVLRFFRMGT ERKLAEAQKTIDFHLKEYISEKKDELSKGIEGKDLLAAYMKMQAQKEELSSKGDKYLRDT ALSFLFAGRDSSGTSLTWFFWLLSKSPRVEEIILEELRSVYLKKNANSENSHKLKGPWVF DADELKGLVYLHAALSEVLRLYPPLPMNRKISVKEDILPDGTVMKPGTKILFSMYAMARM EWVWGKDCAEFKPERWIDADGKLSHDPMSKFFVFNAGPRTCIGKDMAFTQMKLAAAAVLF NFHVEVVEGQEVLPKPSLVLHTRNGLLVRVKERENLY*

 

>22026861 Aquilegia coerulea|Aquca_038_00166|Aquca_038_00166.1

CYP96P?

MELHPALHLLGYHLIKRWPEVCLAFFCFIFIWSYIKHQNDVLVFWPIFDCLPSILKNRHR IHDWSVELANSVGNTIVGKGPIFARLHLVYTCDPLNVEYIAKTNFPKGSEHHEIMDVIGN GIFNVDYEHWHAQRKMANRTFMSKEFRSYIAKTTRKVVENSLLPLLSQVAIQSCVVDLED IFMRLTFDSVFMVIFGRNPNCLSIDFPRNELAQAIDNMAEVLTYRHVLPSSWWKLCRWFQ IGPEKKFVEARKIIDRSLESYILLKKNDLHKGDEQDNDMITSFILSQERDNNDLLPKGDA FLKDNGLSFLFAGKDSSSTGLAWFFWLMTRNPSVKDIIIEELRHVREKNKDKDDGLKAKM PYVFTAEDLKGLVYLHASLCESLRLYPPVPATYRGVEKEDVLPDGTALKPGMKILISMYA LGRMASVWGKDCLEYRPERWIDENGKLNPVPLTKFFTFFAGPRNCIGKDMAFTQMKLVIG AVLFNFHIEHVEGHVVRPKPSMVLHMQNGLKVRIRKRISE*

 

>22046580 Aquilegia coerulea|Aquca_010_00224|Aquca_010_00224.1

CYP96P?

MDFLYVLSLFFHFKKLWPELLLACFSFFAIRWYVNHKRNVFITRYPILDLLPSLLQNLDR VHDWTVDVSNFLGCTLVGSLPFYRSQFYRYGSVDILYTCNPRNVEYMVKTNFSNYPKGVE FLEVFNLIGNGIFNVDFEPWHAQRRMAHSLLTSKEFRNYISNVNQNLVQNALLPLLTLSA KKSSVVDLENVFLRYAFDSIFTVIFGKSSNCLSLNGKSNAFEKAIDDGTEATFFRNIMPA PLWKLMRFLRVGTEKQLAEAQETIDFHLSQYISTKRDELLNGNNDQKDLLATYMKSEALK DSLSSDKNDKFLKDTAFSFLFAGRDTSGTSLTWFFWLIAKTPRVEEKILEELNSVFTKKR NCENNLNVQGPWVFDSEDLKGLVYLHAALCETLRLYPPIPLNRKSSLNKDVLPDGTVVKP RTLILFSMYAMARMEWVWGKDCSEFKPERWIDADGKLSHENMSKFFVFNRGPRTCVGKDM AFTQIKLAAAAVIFNFHVEVVEGHEVVPKPSLALHTKNGLLVKLKERVHVY*

 

>22039696 Aquilegia coerulea|Aquca_021_00215|Aquca_021_00215.1

CYP96P?

MIEKLSLNPILTSFDHHLMQWPELYLAVICLILSIIWYSKTKNDYYMHWPIVGVLPSILR NAHRMHDWSVETCRALGCTIRARGPTFCRWELLFTCDPRNVEYILKTNVTNFPKGEEYLE AFDVLGDGLFNVDSELWQIQRSMARKAFASNDFRGTICRLSKKVVEEELVPLLSNAARES SVVDLDDIFMRFTFHTTIIVIFGRDPKSLSAGVKDHELANALDAVLEAIFRRHVNPRIWW KLCRLLRVGEERKLVKAWKAIDIHMAHYISLKKAEAITGSEQADLMATYVNFQKESKDFS SNDKFLRDTALTFLLGGRDTTGTTLTWFFHALSNNPHVEAKVLEELKNVACKDSNVELGQ RANTPWVFNSEDLKRLVYLHAALCEAMRLYPSPSLNRKGVLREDVLPDGTVVKPGLMVIT STYAMARMECVWGKDCSEFKPERWIDEHGKLSKEPMTKFFTFGAGPRICLGKEMAFTLMK AAVAAVLFNFQVEVIEGQTVCPKASLVLRMKNGLMAKIKERVS*

 

>22046092 Aquilegia coerulea|Aquca_051_00045|Aquca_051_00045.1

CYP96P?

MHLQSITFLLKPHLHTWSGISFLSFICLISMILYLMMSKTKGVTYWPILGVLPCLVQNAH RIHDYCVDISNTHGLTKLAKGPFLDILYTCDPRNLEYITKTNFPNYPKGQEYNKTFEIFG DGLFNTDFDLWHGQRKLAGKAFASNNYSRMVSSLSKKVVEDELVPLLSKFVENSSTVDLE GIFMNCTFDVAFFSIFGRNPKCLSRHSPEHEFAKAMDDASEAIFFRHVTPHLLWRLCRWL KIGKEKKHHNAWETIDKYMAHYIALKKEELLQGGQERSDLLSSYIYFQKEKQEFTSGGDK FLRDSALALLFAARDTTGASLSWFFYSVLSNPAVEEKILDEMKNAKKSNSENDITTKKPW IFNSEDVKGLVYLHATCCETFRLYPTLPLNRKEALHEDVLPDGTMVRPKMMIITSTFAMA RMKSLWGNDCLEFKPERWLTEDGQLSNEPMDKFYTFSAGPRMCPGKDFAFTLLKSVATSL LFNFQFELVKGHKVYPKPSLVLQMKNGLLVQVKRRVS*

 

>22057559 Aquilegia coerulea|Aquca_057_00040|Aquca_057_00040.1

CYP96

MVPSATSSSSSDQSADDLSYLASLIFDQTWMAVESSLCETHFDSFETFKTGLRGLCEQAV RSRNAAGNNNPVTDALHSYFPPPPDKVTIGCWNGFEGWLGASDGERFRALCIPWCSMIME LHPPLHLLEYHLIERWPQVCLANEVLVLWPILDCLPSILKNRHRIHDWTVELANSVGNTI VGKGPIFAPLRLVYTCDPLNVEYIAKTNFPKGAEHYEIMDVIGNGIFNVDYQHWHAQRKM ANKTFMSKEFRSYIAKTTRKVVEDSLLPLLSQVAIQSRVADLEDIFMRLTFDSVFMVIFG RNPNCLSIDFPCNELAQAIDDMAEVLTYRHVLPSSWWKLCRWFMIGPEKKFVEARKIIDH SLESYILLKKDDLNKEEQDNDMITSFALHQEMDNNDLIPKGNAFLRDNGLSFLFAGKDSS STALAWFFWLMTRNPSVEANIIEELRHVREKNKDKDDGLKAKKPYVFSVEDLKGLVYLHA SLCESLRLYPPVPATYRGVEKEDVLPDGTTLKPGMKILISMYALGRMESVWGKDCLEYRP ERWIDENGKLNPVPLTKFFTFFAGPRNCIGKDMAFTQMKIVIGAVLFNFHVELVEGHAVR PKPSMVLHMQNGLKVRIRKRIAE*

 

>22057506 Aquilegia coerulea|Aquca_057_00043|Aquca_057_00043.1

CYP96

RWPELCLAFFCFIFIRWYLKHKNEVLVHWPILEFIPSILKNQHRIHEWSVELFNSVGSTI VARGPIFARLNLVYTGDLRNAEYITKSNFSNFPKGADYVEIFDVIGNGIFNMEYEHWHAQ RKLANTTLMSKEFRSYVAKATLNLVESSLLPFLRIQSSVIDLEDIFLRFTFDSIFTVIFG RNPNSLSIDLPCNELSQAIDDVTEAITYRHILPTSGWKFCRWLNIGPEKKLAKAWKTIDR YLEHYILLKKDDLREGVQENDMVTSFIMLQEKEINNDLIPKGNAFLRDNGLSFLFAGRDS SSTALAWFFWLIAMNPYVESKILEELRNVHAKNINKDNDLKAKKPYVFAFEDIKGLVYLH ASLCESLRLYPPLPVTHRGVQKEDVLPDGTMVKPGWKILISMFAMGRMESVWGKDCLEYK PERWIDENGKLNPILLTKFFTFFAGPRNCVGKDMAFTQMKLVIGAVLFNFQVELVEGHSV RPKPTMVLHMQDGLKVRIRERSA*

 

>22057438 Aquilegia coerulea|Aquca_057_00042|Aquca_057_00042.1

CYP96

MIYLAIICFLSLTWWYRKCKSEVITYWPILADLPSLLQNAHRVNDWLVEVANMYGSTKLL RGPFFAPMDYLLTCDPRNFDHIFKTNFSNYPKGQGYNKVFDILGDGVFNSDFDRWHGQRS LDRTAFMSNKSMISTLCKKMVEEELVPLLSSFVKISSAVDLEDIFLRYTFDLIFVAIFGR SPKCLSKDFPVHEFARAMDDALEAIFYRHVTHSLWWKLCRYLRVGKEKRHQNAWKTIDRL

MAQYISLKKEDLLKEGHQQTDLLSSYIQFQKEKNKYSSDGDKFLRDSVLGHLSAGRDTTG AALSWFFYMILRHPIVEAKILEELNDIYTKSSNFENEQIPKRPWVFNPGDLKGLVYFHAA LCEALRLHPAVPINRKEALREDVLPDGTKVKPGTTIILSVYAMARLECIWGKDCLEYKPE RWIDENGKFRQEHMDKLFAFGSGPRICIGKDIGLTMVKTAVAAIVFNFHIELVKGHNVYP KPSLVLNMKDGMMVQVKPRFA*

 

>22057512 Aquilegia coerulea|Aquca_057_00047|Aquca_057_00047.1

CYP96

MVLLQTWSGMTYLSIICFFSLALYLKSKNKVITYWPIVGVLPCLFQNAHRVHDWTVDIAN TYGLTKLERGPFFARLELLFTCDPHNVEYITKTNFSNYPKGQEYNKVFRILGDGLFNSDF ELWRGLRNLARTAFVSNNFSSMVSSLSKKVVEDELVPLLSGLAKTSSSIDLEDIFLSYTF DLIFIAIFGRNPKCLCRNSSNHEFVKAMDDGLEAVFLRHVTPPFWWKLCRFLMIGEEKKL QNAWETIDRFMAQYIELKKQDLLQGQQEQADLLSTYISFQKEGKKFSSGGDKFLRDSALT LLFAGRDTTGSALSWFFYSVLTNPIVETNIMEELINVYIKKSSFGNAEKAKFPFVFDSED LKGLVYLHASLCEVLRLYPSVPINRKAVLREDVLPDGTKVKPGMTIIISMYAMARMESIW GKDCFEFKPERWIADNGKFKSDNMNKFFTFGSGPRTCVGRDFAFTIMKSAAAAILFNFRM EVVKGHVVYPRPSLVLRMKNGLSVNIKPRFE*

 

>22057420 Aquilegia coerulea|Aquca_057_00045|Aquca_057_00045.1

CYP96

MGSGFCTSISLSKALIYCTLNIDMQSIPHLPKLYLHTWSGIIFLAFICLISMILYLTCRT KVVTYWPILGVLPCLIQNAHRMHDYCVEISNTHGLTKLLKGPFLEILYTCDPRNLEYITK TNFPNYPKGQEYNKAFEMLGDGLFNSDFDLWHGQRKLAGKAFASNNFSRMVSSLSKKVVE HELVPLLSKNPKCLSKLSPENKFAKAMDDALESIFFRHVTPPLWWKLCRWLKIGEEKKHH NAWETIDQSMAHYIAMKKEELLQGEQERSDLLSSYIYFQNEKQEFTSGGDKFLRDSVLTL LFAARDTTGAAMSWFFYSVLTNPVVEEKILKELNKVKESNFENEAKKPWIFNSEDLKGLV YLHATCCETLRLYPSLPLNRKEALCEDVLPDGTVVRPKMMIIMSPFAMARMKCLWGNECM EFKPERWITEDGQLSNEHLDKFHTFGAGPRVCIEEAGWQSICIEQFFTHGV*

 

>22057586 Aquilegia coerulea|Aquca_057_00046|Aquca_057_00046.1

CYP96

MHLQSIIFLLKLHLYTWSGTIFLAFICLISMILYLMTYKTKAITYWPILGVLPCLVQNAH RMHDYCVDIAITHGLTKLAKGPFLDILYTCDPQNLEYITKTNFPNYPKGQEYNKVFEMLG DGLFNSDFDLWHRQRKLAGKAFASNNFSRMVSNLSKKIVEEELVPLLSKLVDNTSTVDLE ETFMNYAFDVAFFSIFGRNPKCLSRHSQETKFAKSMGDALEAIFFRHVTPPLWWRLCRWL KIGEEKKHHKAWEAIDQSMAHYIALKKEELLKGGQEGSDLLSSYIYFQNEKQEFTSGGDK FLRDSALTLLFAARDTTGASLSWFFYSVLSNPSVEAKILDELKNAKESSSENDITAKKPW IFNSEDLKGLVYLHAACCETLRLYPSLPLNRKEALREDVLPDGTVVRPKMMIITSTFAMA RMKCLWGNDCMEFKPERWITEDGQLSNEPMDKFYTFGAGPRVCLGKDFAFTLLKSVAASL LFNFKFELVKGHKVYPKASIVLQMKNGLLVQVQRRVF*

 

>22057596 Aquilegia coerulea|Aquca_057_00044|Aquca_057_00044.1

CYP96

MIYLAIFCLLSIAWWYRKCKNDVITYWPILADLPSLICNAHRINDWLVEVANMYGLTKLL RGAFFARVDYLLTCDPRNFEYITKTNVSNYPKGQEYNKVFDILGTGVFNSDFDLWHGQRT LARSAFTSNNLLSLVASLCEKVAKDDLFPLLSGLVKTSSPVDLEDIFLRYTFDIICVTIF GRNPKCLSKDLPNHELAKAMDDALQVIFFRHVTPSFWWKLCRWLRIGNEKKLHNAWETVD RLMTQYISLKKEDLLQGGQEQNDLLSSYIYFQKEKKKYSYEGDKFLRDSVLGQLSAGRDA TGAALSWFFYMILKNPVVEAKIIEELNGIYMQHSSFANEQKAKRPWVFNSGDLKGLVYLH AAMCESLRLNPGVPINRKEVLREDILPDGTVVKPGMTIIMSLYAMGRMESVWGKDCMEYK PERWINENGKFRQEHMDKFFAFGSGPRLCIGKDIGVTMIKSAVANILFNFHVELVKGHHV YPKSSLVLNMKNGMMVEVKPRVA*

 

>22057618 Aquilegia coerulea|Aquca_057_00041|Aquca_057_00041.1

CYP96

MSVEIHPALYWYEYHLFKRCSQLCLAFFCFIFIRWYLKHKNEVLVRWPILDLLPSILKNQ HRMQDWSVELANSVGSSVVARGPIFARLNLVLTFDVRNAEYITKTKFSNFPKGADYIEIF DIIGSGIFNMENEYWHAQRKLANTTFMSKEFRSYVAKTTLDVVENSLLPFLSIQSSVIDL EDIFLRFTFDSIFTVIFGRNPNSLSLDLPCNELAQAIDVVTEAIYYRHIVPTSWWKLYRW LMIGSEKKLANAWKIIDHYLEHYVLLKRDDLHKGVQENDMITSFILFLFAGRDSSSTALA WFFWLVERNPYVESKILEELRHVHANKKDKDVALKARRPYVFTAEDLKGLVYLHASLCES LRLYPPLPITHRGVQKEDVLPDGTKVKPGWKILISMYAMGRSESVWGKDCLEYKPERWID ENGKLNPIPLTKFFTFFAGPRNCIGKDMAFTQMKLVIGAVLFNFHVELVEGHTVRAKSSI VLHMQDGLKVRLRERITQE*

 

>22027333 Aquilegia coerulea|Aquca_014_00472|Aquca_014_00472.1

CYP96 CLUSTER A

MEFIGYPEMIFATVCSLILHYLNSKTALTNWPLIGMLPSLLLNLHRLHDWATDILSKSGC TFVFKGPWFTNMNNIVVTSDPANMRHIFITNFSNYPKGAEYYEFFDIMGDGIFNADLDSW KTQRKMALQFLNHKKFQSYLEQYSFNKVENGLIPVLEHVLEQNLVLDLQDLFKRYTFDTA TIFLTGTDPCSLTTEYNKWRPYINALDDAEEAVLYRHAIPVNCWKLQRWLGIGKEKKLIN AKEILDQFIAQCIKTKRASQHQKRENKEQEEKSIDLMTLYMEEFCVSDKFLRDTMMNFMA AGRGTSAALTWFFWLVSKNPAVETKLIEELKSTKKSAEKEGSKILKMFDTEELKGLVYLH GAFCEALRLFPSVPFEHKRPLQPDILPSGHKVDSKTKILPLLYSMGRMEEVWGKDCLEFR PERWISEEGGIKYVPSYKFMAFNAGPRTCLGKEIVFTQMRSVAATLLYNYQVEVVEGHSI SLKNSIILNMNHGMNTRIKRRL*

 

>22027783 Aquilegia coerulea|Aquca_014_00473|Aquca_014_00473.1

CYP96 CLUSTER A

MMKIMDYIGYPEMILAVVCFIYLHHMNSKSILTNWPFIGMLPSLLLNHHRLHDFATDILS RSACTFVFKGPWFTNMTNIVVTTDPANMRHIFNTNFSNYPKGAEFNEFFDILGDGIFNAD LDSWKTQRKMAHQFIIHKKFQSFLEQTSVDKVKNGLIPVLEHVLEHNLAVDLQDLFKRFT FDTTLILLSGIDPCSLGIELQKFPFVDALDDAEEAIFYRHIIPVNLWKLQRFLGIGKEKK LIKAREHIDQFIVQCISKKRELQHEKMNKEQEENGVDLLTSYMEQDDGSNSVTFYRDTVL NLMVAGRSTLSSALAWFFWLVSNNPIVEAKIVEELKSKANLPKNVYTKVRMFGMEDLKGL VYLHGAFCETLRLFPSVPFEHKRPMNPEMLPSGHKVDTKTKIIPHLYSMGRMEMIWGKDC LEFKPERWITEEGGIKYVPSYKFMAFNAGPRTCLGKEIAFTQMRMVAATILYNYKVKVVE GHRISPKNSIILYMNHGMKVKIGRRV*

 

>22027348 Aquilegia coerulea|Aquca_014_00471|Aquca_014_00471.1

CYP96 CLUSTER A

MEFIGYPEMIFATVCFLFLHYLNSKTALTNWPLVGMLPALLLNIHRLHDWATGILSKSGC TFEFKGPWFTNMDTIVVTSDPANMRHIFITNFSNYPKGAEFNEFFDILGDGIFNADLESW KTQRKMALHLLNHKKFQSYLEQYSFDKVENGLIPVLEHVLEQNLALDLQDLFKRYTFDTT TILLTGTDPCSLTTEFNKWPYVYALDDAEEAVFNRHVIPVNCWKFERWLGIGKEKELSKA KEILDQFIAQCIKTKRASQHQKRENIEQEEKGINLMNLYMEEFSVSDKFLRDTMVNFMVA GRGTSAALTWFFWLVSKNPAVETKLIEELKRTRNSAEKEGSKKLKMFDMEELKGLVYLHG AFCEALRLFPSVPFEHKRPLQPDILPSGHKVDSKTKILPMIYSMGRMEQVWGKDCLEFKP ERWISEEGGIKHVPSYKFMTFNTGPRTCLGKEIVFTQMRSVAATLLYNYQVEVVEGHSIS LKKSVILHMNHGMNIRIKRRF*

 

>22027586 Aquilegia coerulea|Aquca_014_00474|Aquca_014_00474.1

CYP96 CLUSTER A

MEFIGYPEMIFAAVCFLSLHHLRSKTLPTNWPFLGMLPSLVVNLNRVHDWCTEYLVRNGC TFVFEGPWFTNMNHIVVTSDPANMRHIFNTNFSNYPKGAEFNEFFDILGDGIFNADLDSW KTQRKLAHHFINDKKFQSFLEQTSVVKVESGLIPVLDHVCEQNLVVDLQDLLKRFTFDTT LILLSGIDPCCLAIEFDKFPYVDALDDAEEAIFHRHVIPVNLWKLQRFLGIGKEKKLSEA KETLDQFIARCISTKRELQCDKVKSKEEEKNGVDLLTAYMEQDDGSKSDMFFRDTVLNFL VAGRSTLSAALTWFFWLVSNNPIVEAKLIEELKKAISPENEDKKVKMFDTEDLKGLVYLH GAFCEVLRLFPSVPFEHKTPLHPDILPSGHKVDSETKILPMLYSMGRMEVVWGKDCLDFK PERWITEEGGIKYVPSYKFMAFNSGPRTCLGKEIAFTQMRMVAATILYNYQIEIVEGHPI SPKNSIILYMKHGMKVRIGRRV*

 

>22058754 Aquilegia coerulea|Aquca_013_00770|Aquca_013_00770.1

CYP96 CLUSTER B

KRSKKQALYHGPFLGSIPSLVWNSHRLPEWTSQVFMSLGRGNGSYFIRGPAFSNINFLVT CHPQNIEYILKTNFSNFPKEAESKEILDVLGDGLGNVDDQSWMSQRKLAHKCIKSTNFRG FVTSTSQRVVAQALVPLLAHVADNNSVIDLQDICTRFAFECNMSTSFGRGEGYLSSELPA NELSVALDNIHKALIFRHIVPSFLWKFLRFLNVGSEGAYAKAWKKIDQLFREYGPFLMDA RLNENFLRDSMLGILLAGKDLIGSGLTFFFWLIANSPYAEEKILEELKIVDKKNKQEDED GAGKKWPILFDSNDLNGLVYLRSAICESLRLYPAVPIIKKSIAKNDILPDGSVVKAGMQI FLSFYAEGQMPWIWGEDSMKFKPERWMDEEGKLRHDLMPKFYAFNAGPRTCLCMATTFTE

MKVVVAAVLFNFIFLLVEDRPISLRPYVNLNMKDGLSVKISSKRTM*

 

>22058887 Aquilegia coerulea|Aquca_013_00768|Aquca_013_00768.1

CYP96 CLUSTER B

ISFHIKRSKNQAVYHWPFLGSIPSLVSNSHRLPEWTSQVFMSLGRGNGSYFIRGPAISNF NFLVTCHPQNIEYILKTNFSNFPKGEESKEIFDVLGDGLGNADGQSWLSQRKLAHKYINS TDFRGFVASTSQRVVAQALVQLLAHVADNNSVVDLQDICTRFAFECNMSTSFGRGEGYLS SQLPTNELSQALDDIHEALIFRHILPKFLWKFLRFLNVGREGDYAKGWKKIDQLFEEYIS QKKECLNKGAEMKDLLSIYIKYLDEPLRNDKFLMDARLNKKFLRDTMLGMFLAEKDAIAS GLTFLFWLIVNTPYAEETILEELKIIAKKDKQEDEDGLGAKWPILFDSNDLNGLVYLHAA ICESLRLCPSVPIIKKAIVKDDILPDGSVVKPGMQIFLSFYAEGQMSWIWGKDSMEFKPE RWIDDKGKLRHDLMSKFYAFNAGPRTCLGMTTTFTEMKVVVASVLFNFNVRLVEDHPISL RPYVNLNMKDGLSVRISKRTM*

 

>22056713 Aquilegia coerulea|Aquca_034_00208|Aquca_034_00208.1

CYP97A

MAAANVTVAAAKVPSLQINSRSSKFKPNSVSLPKLNKSVGLHRYSFITCASSNGREPEDS AKAERLLEEKNRAELAARIASGEFTVEQSGFLPQLKSALSKLGVPKEFLEFLSNSRKDQL EIPQAKGALSALRGEPFFIPLYALFLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNSKA YSKGILGEILDFVMGKGLIPADGEIWRVRRRAIVPALHQKYVTAMIGLFADATDRLCKKL DHAAADGEDVEMESLFSRLTLDVIGKALFNYEFDSLTNDTGIVEAVYTVLREAEDRSVAP IPVWDIPVWKDISPRQRKVTAALKLINDTLNDLIAICKRMVEEEELQFHEEYMNEQDPSI LHFLLASGDDVSSKQLRDDLMTMLIAGHETSAAVLTWTFYLLSKEPSVMAKLQNEVDSAL GDRFPTIEDMKKLKYTTRVINESLRLYPQPPVLIRRSMEDDVLGKYPIRRGEDIFISVWN LHHCPNHWIDAEKFNPERWPLDGPNPNEVNQNFSYLPFGGGPRKCVGDMFATFENIVAIA

MLVRRFNFQLALGAPPVEMTTGATIHTTQGLKMTVTRRMRTPIIPKLEKKVLEADGDRPL KTPSPTVVASMSSYDGDQQGQISAAHS*

 

>22029694 Aquilegia coerulea|Aquca_004_00605|Aquca_004_00605.1

CYP97B

MASSSIVLQLPVIVNGSYSLPKARNSHLTISTSFSFRNKWSQIKCQSTSTEEPKTKRNVL DNASNILTNLLSGGNLGSMPIAEGAVSDLFSRPLFFALYDWFIEHGSVYKLAFGPKAFVV VSDPIVARYILRENAFSYDKGVLADILEPIMGKGLIPADLDTWKLRRRVISPAFHTLFLK AMVKVFTDCSERTISKFEKRFETNESGTIELDLEAEFSSLALDIIGLSVFNYDFGSVTKE SPVIKAVYGTLFEAEHRSTFYIPYWKLPLARWIVPRQRKFQYDLKVINDCLDGLIRNAKE TRQETDVEKLQQRDYSNLKDASLLRFLVDMRGADVDDRQNPSKMRKAQEEIDSVLGQGRT TYECIKELVYIRLIVVEALRLYPQPPLLIRRSLKSDVLPGGYKGDKEGYKVPAGTDIFVS VYNLHRSPYYWDRPNEFEPERFLVSKTSEVEGWAGFDPDRSPGAMYPNEIIADFAFLPFG GGPRKCVGDQFALMESTVALAMLLQKFDVELKGSPESVELVTGATIHTKNGLWCKLRKRP

TSP*

 

>22035008 Aquilegia coerulea|Aquca_009_01071|Aquca_009_01071.1

CYP97C

MTTSLSLTSLSSFTNSNQVILHKSITHYSKTSSHSLSIKSSLKNDSSSSSTTDKKSSSSS SSSSSSSNGSWVSPDWLTSLTQSLTKGNDDSGIPIASAKLDDVSDLLGGALFLPLFKWMN EYGPIYRLAAGPRNFVVVSDPAIAKHVLRNYGKYAKGLVAEVSEFLFGSGFAIAEGQLWT VRRRAVVPSLHKKYLSVIVDRVFCKCAERLVEKLRPDAVSGAPVNMEAKFSQLTLDVIGL SLFNYNFDSLNADSPVIDAVYTALKEAEARSTDLLPYWKINLLCKIIPRQIKAEKSVAVI RRTVEELITKCKAIVEAEGEQIDGEEYVNDKDPSILRFLLASREEVSSLQLRDDLLSMLV AGHETTGSVLTWTLYLLSKNPSSLMKAQEEVDRILQGRLPTYDDIKELKFLTRCINESMR LYPHPPVLIRRAQVPDVLPGNYKVNSGQDIMISVYNIHRSPQVWDRAEEFVPERFDLESP VPNESNTDFRYIPFSGGPRKCVGDQFAMMEAIVALAVFLKHLNFELVPDQNISMTTGATI HTTNGLYMKLSERKAQHSFASSSIKPATTVETENSKPTKLTGMEKEIIKAGNGPKPVRGQ SVTVHCTGFGKDGDLGQKFWSTKDPGQKPFTFKIGQGEVIKGWDEGVIGMQVGEVARIRC SPDYAYGPDGFPAWGIQPNSDLIFEIEVLSIGNNLDKFVRNFIPS*

 

>22027880 Aquilegia coerulea|Aquca_014_00935|Aquca_014_00935.1

CYP98A

MAPLFLGFAIIFISLLVTYQLYQKLRFKLPPGPRPWPIVGNLYDIKPVRFRCFAEWAQTY GPIMSVWFGSILNVVVSNSELAKQVLKEKDQQLADRHRSRSAAKFSRDGTDLIWADYGPH YVKVRKVCTLELFTPKRIEALRPIREDEVTAMVESIFKDCTKPENNGKSLVVKNYLSAVA FNNITRLAFGKRFVNSEGVMDKQGVEFKAIVANGLKLGASLAMAEHIPWLRWMFPLEEEA FAKHGARRDLLTRAIMEEHTVARQKSGGAKQHFVDALLTLQDKYDLSDDTVIGLLWDMIT AGMDTTAISVEWAMAELIKNPRVQQKAQEEMDRVIGFERVIAETDFSSLPYLQCIAKEAL RLHPPTPLMLPHKASANVKVGGYDIPKGSNVHVNVWAVGRDPAVWKEASEFRPERFMEED IDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMLAHLLHHFVWSPSEGVKAEEIDMAENP GLVTYMKTPVQAVAIPRLPPHLYKRVAVDM*

 

>22034145 Aquilegia coerulea|Aquca_009_00081|Aquca_009_00081.1

CYP98A

MALLLLLTSLAIFFFIFIFLSHSIIQRLRFELPPGPKPKPIVGNLYDIQPVRFRYFLELS KTYGPIISVWIGSTLNVVVMNWELAKQVLKDKDQQLADRYRNRSSERFSKGGQDLIWADY GPHYVKVRKVCTVELFTPKRLEALKPIREDEVTAMVESIFKDCSSPVLSNADNYGKSIKV RDYLAPVAFNNITRLSFGKRFVNSEGLSDEQGLELKQIVDNGVKIGASLSIAEHIPWLRW

MFPVDQAAYDSHAARRDRLTRAIMEEHTLARQQNGAKQHFVDALLTLQEKYDLSDDTIIG LLWDMITAGMDTTVITTEWAMAELVRNPRVQEKAQEELDRVIGIDRVMTEADISNLHYLQ CVAKEALRLHPPTPLMLPHKANANVKIGGYDIPKGSNIHVNVWAIGRDPAVWKEPLEFRP ERFMEEDIDMKGHDFRLLPFGAGRRVCPGAQLAITLVTSMLGHLLHHFSWTPPPGVKPEE

MDMTENPGLVTYMRTPVQAIPTRRLPSQLYKRLPA*

 

>22046367 Aquilegia coerulea|Aquca_010_00330|Aquca_010_00330.1

CYP701A

MAHLIKAFLLQFPLQAFPITIVLGLLLLIFLKHIHKKSPRISSPPVVPGLPLIGNLLELK DKKPHKTFTRWAEIYGPIYTIKTGASTVVVLNATDVVKEAFVTRFSSISTRKLSNALRIL TSDKCMVATSDYNEFHKTTKRYLLSGLLGANAQKRFRGHRDTMMNNMVQKLHTHAKDKPL EALNVRKIVINELFGLALKQALGRDLESPIYVEELGTSLSRDDIFEVLVVDPLMGAIDVD WRDFFPYLKWIPNKSLEMKINSMDRRRTTVMNALIGQQKKRIASGEVLDSFLDFLSSEGK FISEEQLKMLIWEPIIETSDTTLVTTEWAMYELAKKKSCQDHLYREIQSVCGSEKITEEH LSKLPYLSAVFHETLRRHSPVPIIPLRYAHEDTQLGGYHIPAGSEIAINIYGCNMDKKQW NEPEKWLPERFLSSKYDPTDMYKTMAFGGGKRVCAGSQQAITISCMAIATFVQEFEWTLK EGQKEDVDTVGLTTHRLHPLQAFVTSRVMQ*

 

>22045186 Aquilegia coerulea|Aquca_111_00018|Aquca_111_00018.1

CYP703A

MDFEALDSASTTLIWYTLYFLLLTTILLYLTVRNDHGRKVIRLPPGPPRWPIFGNLLQLG PLPHRDFANFCEKYGPLVYLRLGSVDAITTNDPDMIREILLRQDDIFASRPKTLAAVHLA YGCGDVALAPLGPHWKRMRRICMEHLLTTRRLESFTEQRAQETQHLVQDVWSKTQAGEVV NLRQLLGAFSMNNVTRMLLGKQYFGVESAGPDEAMEFMNVTHELFWLLGIIYLGDYLPVW RWFDPFGCEKKMRSVEKRIDEFHMKIIREHKKGQSQNAKGKIRDFVDVLLSLPGEDGADH

MDDTDIKALIQDMIAAATDTSSVTNEWAMAEVIKHPQVLLKIQEELDSVVGRNRMVTESD LPQLNYLKCVVRETFRMHPAGPFLIPHESIRDTQINGYHIPAKTRVFINTHALGRNKHIW GNDLNIFRPERHELADGSRVEVSHGADFKILPFSAGKRKCPGAPLGLAFVLMALATLFHC FDWIPPPNEDIDTTEAYGMTMPKVKPLRASAKPRLPAHMYI*

 

>22058530 Aquilegia coerulea|Aquca_013_00518|Aquca_013_00518.1

CYP704A

MDFFSIFITIISTLLIILLFSFCSLALVIFSGKSLNNPQYPPVMGTVFDQLFYFHKLYDY QTDIARKYRTFRLLAPSQSELYTTDPRNIEHILKTNFDKYSKGEYNQAIVRDLFGYGIFA VDGDMWRQQRKVSSFEFSTRVLRDFSCNCFRRNAAKLAGIISEFAVTGSIFDIQELLSRC SLDSIFKVGFGVDLNCLEGSNKEGTMFIKALDDSNESVYWRYADLFWMVKRYLNIGSEAI LKKNIKVMDNFVYDLIKSKRELLSVQSDYVKEDILSRFLVASEENPSNKNDKYLRDIILN FILAGKDSTANTLSWFFYMLCKHPLIQEKIVQEITDVIEGKNNDTKIEGFAMNLVDTMLD KMPYLHATLTETLRLYPAVPVDGKCADMDDILPDGYRLKKGDGVYYIAYTMGRMTYIWGE DAEVFRPERWLNNGVFQPESSFKFVAFHAGPRICLGKDFAYRQMKIIAMVLLTFFRFKLA DEDIRVTYRTMFTLQIKGGLHIKAVPRVVGNRN*

 

>22059572 Aquilegia coerulea|Aquca_013_00516|Aquca_013_00516.1

CYP704A

MDPLSFIFLAITPLLVGLITVFLLVTASAIVFLIIHVKELITQEKDQPPIAGSIFYQLIY FNTLFDYQTYLSRKYRNYRLITPTHSDIYTADPVNVEYILKTNFSNYTKGQYNYGIMKDL FGDGIFAVDGEKWRHQRKLASYEFSTKVLRDFSSAVFRKNAAKLVAKISEVASFNKPVDL QDLLMKSTLDSIFKVGFGIELNSLSGTDEFGNQFTKAFDDSNVIVYWRFVDPFWKLKRFL NIGAEASLKKNIQIIDDFVFQAIRSKREQMKSENGNKVKEDILSRFIIESANDPEHMTDR YLRDIILNFIIAGKDTSANTLTWFFYMLCKNPLIQEKVSQEVREATNVEDATSINRFAER LTEEALDKMQYLHAALSETLRLYPAVPVDGKSSEDDDVLPNGLKVKKGDGMNYMPYAMGR

MTYIWGEDAEEFRPERWIENGMFRPESYFKFTAFQAGPRICLGKEFAYRQMKILASILLH FFKFKLVDQKKEATYRTMFTLHMDQGLHLFAVPRTN*

 

>22059737 Aquilegia coerulea|Aquca_013_00515|Aquca_013_00515.1

CYP704A

TTLAVLLTLYIVKIITGRLAKKEYHPIAGTVFHQLLNFSRLHHYMTDLARKYRTYRLVGP FHSEVYTSDPANVEYILKTNFPIYVKGWYNYTIQKDLLGDGIFTVDGEKWRQQRKMFSYE FSTKVLRDFSSLVFRKNAAKLAQIVLEGSNKPMDIQDLFMKSTLDSIFKVTFGVELDSMC QSSEEGTRFANAFDESSALTLRRYVDIFWKIKRFLGVRPEATLKKNIDIIDGFVYKLISS KIRDVSNLQKDSSMKKDDILSRFLDLNETDPKYLRDIVLNFIIAGKDTTATTLSWFLYML CKHPHIQEKATKAKEDTPFHEFAESVTEGALEKMHYLHAALTETLRLYPAVPVDAKICSS DDILPDGFKVKKGDLVAYQPYAMGRMEIIWGDDAEDIRPERWLDNDGVFHSESPFKFTAF QMKIFSAVLLGCFMFKLNDPNKTVNYRTMINLHIDGGLHLRAIPHTPIDTKYLLNVH*

 

>22058522 Aquilegia coerulea|Aquca_013_00545|Aquca_013_00545.1

CYP704A

MASMMFLNNPFVVVTIVLTVFIVPYTIKMFRKRSSKMTTQKKRYHPIAGTIFDQLMNFSR LHHYMTDLATKYKSYRLLSPFRNELFTTEPANIEYILKTNFANYGKGLYNYTLLKDLLGD GIFTVDGEKWRHQRKIASYEFSTKVLRDFSSSVFRKNAANLAQIISQAATSNYMIDIQDL LLKSTMDSIFEVGFGVKLETLSGSKEEGASFTKAFDDCSALTLWRYVDISWKIKKFFNIG SEAVIRKNLAIIDNFVYKIIHTKTKQRSESRDKALEKKEDILSRFLEVDESDPKFLRDIT LSFLLAGKDTTAVALSWFLYMLCKHPHIQEKIAQEVREATNTNDNTSFEDFIVSIDDKAL DKMQYLHASLSETLRLYPSVAVDSKICFSDDTLPDGFSVNKGDIISYQIYAMGRMKFLWG DNAEEFRPERWLDDDGVFQHESPFKFTAFQAGPRICLGKEFAYRQMKIFSALLVGCFLFK LGDEKKIVNYRTMMTLQIDGGLHLRAFHRLKI*

 

>22060232 Aquilegia coerulea|Aquca_013_00546|Aquca_013_00546.1

CYP704A

MASMEFFYKPFFVVMIVITVFIVPYTIKQFIKRPSKMTTHKKRYHPIAGTFLNQLLNFSR LHHYMTDLATKHKSYRLLNPFRSELYTTEPANIEYILKTNFVNYGKGSHNYTLLKDLLGD GIFTVDGEKWRHQRKIASYEFSTKVLRDFSSSVFRKNAANLAQIISQAATSNYVIDIQDL LLKSTMDSIFEVGFGVKLETLSGSKEESFSKAFDDCSALTLWRYVDISWKIKKFFNIGSE ALIRKNLAIIDDFVYKIIHTKTKQRSESRDKTLEKKEDILSRFLEVDESDPKFLRDIILS FLIAGKDTTAVALSWFLYMLCKYPHIQEKIAQEIGEATNTNDNTPYNDFIASIDDKALDK

MQYLHAALTETLRLYPPLPVDPKICFSDDTLPDGFSLNKGDQICYQPYAMGRMKFVWGDN AEEFRPERWLDDNGIFQPESPFKFTAFQAGPRICLGKEFAYRQMKIFSALLVRCFLFKLG DEKKIVNYRTMLTLQIDGGLHLRASHRLKI*

 

>22057795 Aquilegia coerulea|Aquca_099_00008|Aquca_099_00008.1

CYP704A

MDSISTTISTLPTALAVLLVLITVTVVVRKLTDKKKYHPVGGTVFNQLLNFKRLHHYMTD LAGKHKTYRLLSPFRSEIYTSDPANVEYILKSNFPNYGKGWYNYVILKDLLGDGIFTVDG DKWKHQRKVSSYEFSTKVLRDFSSAVFRRNAERLASIISDAGNANKSVDIQDLFMKSTMD SIFKVGFGVELDSIYGSNEGTIFANAFNDSSALTLWRYVDLLWMVKKYLNVGFEATLRKN LEVIDSFIYKLIRTKIEKVSNSDDDSSVKKEDIMSRFLDLNETDPKYLRDIVLNFLNAGR DTTATTLSWFIYMLCKHPDIQEKIAQEVKDATQVKDNTSFSEFSANVTTEDVLDKMQYLH AALSETLRLYPAVPVDAKICFSDDTLPDGFSVKKGDMVSYQPYAMGRMKFIWGEDAEEFR PERWLDKDGTFHNESPFKFTAFQAGPRICLGKEFAYRQMKIYAALLLRCFMFKLEDEKKP VNYRTMLNLHIDGPLKVRAYHRIDLNKGVEA*

 

>22036647 Aquilegia coerulea|Aquca_006_00306|Aquca_006_00306.1

CYP704B

MEDKTLSSVYPSLYEFPMTITMFVCMVIPAWFIIHRWNQRNEKGPKTWPLLGASIEQFLN YDRMHDWLVEYFSVTKTVKVPMPFTSYTYIADPANVEHVLKTNFANYPKGETYHSYMEVL LGDGIFNSDGEHWRRQRKTASLEFASRNLKEFSTIVFREYALKLSSILGQASLDNKEVDM QELLMRLTLDSICKVGFGVEIGTLAPHLPNNSFAKSFDTAQIIVTLRFINPLWRIKKFFN VGSEALLDQSIKTIDDFTYSVIRKRKAEIKEARATNENDNKIKHDILSRFIELSENPENN LNDKSLRDVVLNFVIAGRDTTATTLSWAIYMIMTHPQVADKLYSELKDFEEEKAKQENVS LLPYNPEDAESFNERVTKYASLLTYDSLGKLLYLHAVVTETLRLYPAVPQDPKGILEDDV LPDGTKVRAGGMVTYVPYSMGRMEYNWGPDAAQFKPERWLKDGFFQNASPFKFTAFQAGP RICLGKDSAYLQMKMTLAILCRFFEFKLVPKHQVKYRMMTTLSMQYGLQLGVVRRS*

 

>22058627 Aquilegia coerulea|Aquca_013_00652|Aquca_013_00652.1

CYP706J

DDNEQKGKLPLPPGPRGLPFVGNLLSLNPELHTYFANLVQTYGPIYKLQLGGKLGIVVSS PSVAKEILKDHDIIFANRDAPIAGKQVAYHDRDIVWNPYGPEWRMLRKICVREMLGNASL DAVYTLRHREVRRMVRTVYSKRSSPINIGEEMFLTVMNVITSMMWGGTIKGDEGTSLGAE FRQVVTLGRFDLQGIQGKTRPLFARFDQIFETIIEQRLKMEEGERRGIKDFLQLMLQLVK DEADAKTPFTMLHLKALLMDMVLAGTETTSNSVEWAIAELMNKPETMKIAQAELENVVGK DNIVEESHLPKLAYLQMVMKEVLRLHPALPLLVPHCPVSSCDIGGYMVPKGSTIFINVWA IHRDPTIWVNPSEFDPERFSGGKWDFSGNDFNYFPFGSGRRICAGIPMAERIVMYELATL LHSFNWKLEDGMKKIDLTEKFGIVLKKATPLVAVPTPRSSCAALYA*

 

>22058658 Aquilegia coerulea|Aquca_013_00651|Aquca_013_00651.1

CYP706J

MICEAWSWSREGFNQKDEYMTKAALIFSILLIVNTLYTWLIKNSSKGLAPLPPGPRGFPL VGNLPFLEPDLNRYFADLAKIYGPIFKVQLGSRLCIVLSSPSIAKEVLKDHDATFANHDA PAMGLASSYGGVDMFWSPYGEHWRMLRKISVTELLSNKRIESLYGIRQREGRKLVQTIES

MVGIPIVIHDYVNATLFDILSGMLWSGSLVGEEKKQITSDFRRYSQRLVNLCGEPNISDV FPFLAIFDLQGKGNKMKKLVLWFDKIFDQVIEKRLEMKTVINMDFLQVLLQCRDQVDQKK TPLTITHIKALLQDMMLAGTKTSSTTLEWAFAELMQKPHLMKKAQDELDQVVGQDNIVEE SHLPKLPYINALVKETLRLHPAAPLLVPRCPSESCVIGGFLVPKGTKILLNAWAIQRDPE YWDNPLEFRPERFMNSTSDCDYKGTNFSFIPFGSGRRVCVGVPLAEKMIPYLLAKLLHSF QWKMEEGAKLDMLEAFGLELVKKIPLVMIPISRKCFI*

 

>22059142 Aquilegia coerulea|Aquca_013_00653|Aquca_013_00653.1

CYP706J

MAITYYQEKLAHLSSDLWSWWSDRSNQQDKITTALITFFTVTLLVIWYTWIIKKGKLSLP PGPRGLPLFGNLLSLDPELHTYFAKLAQTYGPIYKLQLGGKLGIVISSPSVAKEVLKDHD ITFANRDVPAAGRTVAYQGRDIVWNPYGPEWRMLRKICVREMLGNASLDAVYTLRNREVR RMVRNVYSKIGSPINVGEEMFLTVMNVITSMMWGGTIKGDEGTASLGAEFRQVVGEITDL LGKPNLSDFFPALRRFDLQGIQSKIGGLFARFDQIFETIIEQRLKMEEGERKETKDFLQL

MLQLVKDEADAKTPFTMVHVKALLMDMVVGGTDTTSNSVEWAIAELMNKPETMKIAQAEL ESVVGRDNVVEESHLPKLPYLQMVMKEVLRVHPALPLLVPHCPISSCDIGGYRVPKGSRV FINAWAIHRDPTLWVNPSEFDPERFSGGKWDFSGNDFNYFPFGSGRRICAGIPMAERMFM FELATLLHSFNWKLEDGVKKIDLTEKFGIVLKKATPLVAVPTPRSSCAALYA*

 

>22059502 Aquilegia coerulea|Aquca_013_00650|Aquca_013_00650.1

CYP706J

LIAITWWNLMKKNSRKEIAPLPPGPWGLPLIGYLPFLDPELHSCFAQLSLKYGPIMKVYL GSKLCIIFSSPDVAKEVLKEQDVNFADRDIPAAAFVSAYGAVDIAFAPYGEHWRMMRKVC VRELLSYGRLEALYGLRRREVRDMVQRVYIKIGSSIDIGEYAFLAMFNVITSMMWGNTLD GEERRRVTSKFREGKERRMKEVVKYFDQIFDFVINERRKMETQEEDEALKSKDKENKDFL QVLLQLIDQGDQKTSITITHLKALFVNMTVGGTKTTSTTVEWAMTELLKQPEIMQKAREE LDQVVGLNNVVEENHLSKLPYLDAIVKEVFRLHPVGPLLIPRRARESCIVGGYLIPKGAV IFVNTYAIQRDSKYWTDPLEFRPERFLNPNVKWDYNGNDVRYLPFGSGRRICVGIPIAEK VAPYLLASLLHSFDWKLPEGTKLDLSDQFGFELKKKTPLFAVPTPRLLHSTLYNH*

 

>22060059 Aquilegia coerulea|Aquca_013_00638|Aquca_013_00638.1

CYP706

MITNLVSKIMDVVTGGWLWWWDGTSIESKVVRLIFTMFIMVLVICWCKLVSNSCRKWELP QPPGPRGLPLVGNLPFLEADLQRYFTKLAQVYGPILKIRMGNKICVVLSSPSLVKEVLRD HDAIFAYRDPPIAGMAVTYGGLDIAWSPHGPMWRMLRKVLVGEMLSNTNLEACYGLRQQE VLQKMKDLYTKIGTPVNIGQEVFLMTSNVILSMLWGGTLHGKVRSSVGSEFQQVVGEIVE LLGKPNVSDIFPVLARFDLQRIEHRAKELLSWLDKIFNSVIEQKQKKDEAASKTTYQQNK NKDFLQVLLELKEQQDAKTPLTILQLKGLFMDIVVGGTDTTSATLEWAIAEMMQRPVLMK KAQAELEEVVGMNNMVEDSHLSRLHFLDAVVKETLRLHPALPLLVPHRSSKSCTIGGYTV PKGASVFFNVWAMQRDPALWENPLAFHPERFLGDDKKCDYKGNDFHFLPFGSGRRICAGI PLAERMLKYVLASLLHSFEWRLPEGSKLDFAEKFGLVLKKATPVVAIPTPRLLNLDLYY*

 

>22060390 Aquilegia coerulea|Aquca_044_00086|Aquca_044_00086.1

CYP706 CLUSTER A

MASLNARTELYNSFLSGRPWYSEGSNRNDQIIILVAAVSLIITVIMWYTWMMKNLMRRMK YPLPPGPWGLPLVGNLPFVDFELHCYSAKMAKTYGPIFKLKLGSKLFVVVSSASLAKEVL KDYDTTFANRDTPSAMVTITYGGSGMIWTPYGLPWRTLRMICVQQILNKTSLDAVSMLRR REFRRMVKLVYEKVGSPINVAERMFFTSLSSIMSMLWGGALKDDEISSTLIEFKQATVEA IALMGATNLSDFFPILAKLDIQGIERRAQKVFLWFDRILESIVKERIKLNQSDGRQGNKD FLDILLELKDNKDSKTPITTTNIKALLQDLVLVATDTTATTVEWAMAEIMNHPEILKKIR EELASVVGNEDIVQESHVPKLTYLDAVIKETFRLHSIVPFLVPRRPSESCVIGGYTVPKD SKILVNAWALQRDPEVWENPLEFQPDRFLGGTTKWDYSGNNYNFLPFGSGRRMCAGVSLV ERTLPYALASLLHSFEWKLPIGVHLDLSATMTITLRKKTPLIAIPTARLSDPKLYL*

 

>22060516 Aquilegia coerulea|Aquca_044_00087|Aquca_044_00087.1

CYP706 CLUSTER A

MASLNLNSVILAAWSWSREACSSHNEIVSITLTSLFVVITLIMWYAWMMKNSKKTMKYPL PPGPRGLPLVGNLPFIDRDVYRYFAKMTDIYGPIFKLKIGSKLYVVIGSTSLAKEVLKDF DTTFANRDTPSAIVTLSYGGSGLIWTSYGSHWRTLRMICVQHILNKTSLDALYILRRRQL RRTVKFLYSKIGSPIDVADQMFFTSLNTIISMLWGGTVKDDEMSSAGKEFQQAIVEAIAL

MGETNISDFFPLLARFDIQGIAHRAQTLFMWFDRILDSIINERIKLNQAGGKNEKSDFLD ILLELKDSGDTKIQITIANIKALFLDLVVAGTDTTATTVEWAMAEIMNHPEIMKKLQEEL VTVVGENGMVEESHIPQLTYLEAVIKETFRFHSVVPFLVPRRPSESCIVGGYTIPKGTQI LVNARALQIDPEMWENPLEFQPDRFLKSTTKWDYSGNNFNFLPFGSGRRMCAGSSLVERT VPYALASLLHSFNWRLPEGVALDFSDKMTLTLKKMIPLIAIPTPRLSNPELYL*

 

>22037340 Aquilegia coerulea|Aquca_012_00226|Aquca_012_00226.1

CYP706

MSKALSWCLETSKDEYRAVLILSLLLIVITWWILKIRSRKEKASLPPGPWGLPIIGNLPF LDPQLHRYFDKLSIKYGPILKVQLGSKLAMVLNSPEIAKEVLKDHDANFADRDVPAAGFV ASYGALDIVYAPYGDHWRMMRKVCVRELLSPGRLKALYTVRGREVQEMVNKVHSKIGQSI DIGEHVFLGMFNILTSMMWGNTLEGVERVRVTTNYRKVAKKLVALSAEANISDLFPVLAR FDLQGKERRMKEILGWFDQIYEFVINKRRKMESQQDPESKHKDIENQDFLDVLLQLIDQG GQKTQLTITHIKALFLDITLAGTKSTSSTVEWALTELLKQPEIMKRAQEELDQVVGLNNR VEEIHLSKLPYLDAIVKEVFRLYPTAALLIPRVPRESCIIGGYLIPRGSKIFVNVWAMQR DPKYWSDPLEFRPERFLNSTNDWNYDGNDFRYLPFGSGRRICVGIPIAEKMVSYLLASLL HSFNWELPQGTKLDLAEEFGFVLSKKIPLLAVPSPRLLDYKLYD*

 

>22037360 Aquilegia coerulea|Aquca_012_00114|Aquca_012_00114.1

CYP706 48% TO CYP706J1   Vitis vinifera N-TERM

MPKKNPPLPPGPCGLPLVRNIFSLDQYNLHKCLAKLSETYGPVMKIRLGTRFCIVINSAT IAKEVHKDHDNIFANRDITAAASAASWAGTDIVWSPHGDHWRMLRKICVQDLLNSTRLDA LYDLRREIRSMVNTIYSKTFNSIDIGDHIFHNRSLVH*

 

>22024233 Aquilegia coerulea|Aquca_005_00063|Aquca_005_00063.1

CYP706?

MISKALYEYTTIPVLILSVTLIFFTLYEYGIKKWRKEKVPLPPGPRGLPIVGNLPFLDRN LHTYFAKLAETYGPIFKLQLGSRLCVVWNSASIVKEAQEHDIIFASRDVLAVAIPATYGG TDMIWSPYGEHWRMLRKTCVRELLNNTRLDALYGLRRKEVQDMVKDIYSKNGNSINIGEY ILVTMFRLITSMLWGGTELEMENKDSLISEFVKVIHEISEVHGQPNVSDFFPVLARFDLQ GLGSKSKKFSLWLDRLLEIVINQREKSSNSNIKQDDFLQVLLKLKDQQDNKTTFSRTDLK TLLEDMMLAATKTSSTAIEWAMTELIKHPEIMLKVQDEIKEVVGMSNMVEESHLLKLNYL NAVVKEAMRLHPVIPLLMRSPSASVILGGYLVPKGTKILVNVWAIQRDPQYWDDPLMFKP DRFLNSENGYDNKGTNFSYLPFGTGRRVCVGIPMAEKMVPYLLASLLHSFDWKLPDAMEL DLSETFGLELAKRIPLLVIPTPRLSGALYTF*

 

>22038798 Aquilegia coerulea|Aquca_028_00014|Aquca_028_00014.1

CYP706?

MIPNAFWQPRSNLKDVYISLIAVITVIIWYHFVFKKPKKNPPLPPGPWGLPLVGNIFSLD QSNLHKCLAKLSETYGPIMKIRLGTRLCIVINSATIAKEVHKDHDNIFANRDRTAAASAA SWGGTDIVWSPHGDHWRMLRKICVKELLNSTRLDALYDHRRREIRTMVNTIYSKTSNSID IGDLIFHTMYKVMANMMWGGTPEGGEMANFTEKFRDALEKIVPILLAPNITDLFPVLAKF DIQGLAQQARMMCMWFDSEFDTIIDQRLGNEDKEEMKDFLQVLLHLKDDGDLKTHFTTTD IKALLLNLLAAGTKSSVATVEWAMTELLREPKFMKKAQEEIDEVVGVNNILEEAHCSKLH YLNAIVNETLRLHPGVPLSFPKCPSESCTVSGYMIPKGTKILVNIWAIQRDITYWKNPLE FQPDRFLGSECEWGYNGKNPNYIPFGSGRRICVGIPLAERMVPYLLASLLHSFNWKLPEG TKIDLSDTFGLELKKRTPLIAIPLPRLSDKRLYI*

 

>22039001 Aquilegia coerulea|Aquca_102_00017|Aquca_102_00017.1

CYP706?

MASEGLSMWSDWSNYKHEYTRPAICILSAAVLILLTWYSLLTKKSRNKKVPLPPGPQGLP IVGILPFLDPNLHTYFDKLAKTYGPIFKVQLGRKLCIVLSSPSVVQEVHKDHDLIFANRD VTALGFAASYDGMDMVWSPYGQNWRMLRKICVQELLSHGRLEALYDLRRREVQKMVKQIY SNAGRPIDIGEYILATMFHLITSVLWGGTLEKEDRERVILEFGKAMDEFFKLLGTPNVSD FFPVLAKFDIQGFERKMKKICKWLDQLFDYVIDQRLRMRSGEDLNNDGKVKDFLQVLLQL KDQGDHSTTFTITHVKTLLLDMLVAATKSSSTSIEWVMTELIKHPEIMKKVQEEIEEVVG INNIVEESYIPKLNYLHAVLKEVMRLHPVAPLLIPRRPSESCTVGSYMVPEGTKIFVNVW AIHRDPECWENPLEFKPERFLNTGNDFDFKSTNFSYMPFGYGRRKCIGIPMAERMVPYLL ASMLHSFDWKLPDATKLDLSETLGLELTKTIPLVAIPTPRSSERNKLYT*

 

>22038715 Aquilegia coerulea|Aquca_028_00295|Aquca_028_00295.1

CYP706?

MKIRLGTRLCIIINSASIAKQVHKDHDTIFANRDITATASAAFWGGTGLVLSPHGEHWRM LRKICTRELLNGCRLDAQYDHRRREVRTMVNQIYTKINTSIDIGDQIFQTKYNLMADMLW GGMPEREVEMKLLLDQFRKDLHKALPLLIVPNISDLFPILAKFDIQGLARRANKLGMSFG KVFNFIIDQRLRRRDEEEKKDFLQVLIHLKDYGDEKTPFTKTTIIALLLDLLVAGTKSSS AVVEWAMTELLMKPKLMKKAQEEIDEVVGMNSVLEEGHCSKLNYINAIVKETLRLHPIAP ILIPKYTSKSCTIGGYNVPKGTKIIVNAWAIQRDSTYWNNPLEFQPERFLGPDCEWGYNG ENQNYIPFGSGRRVCVGISLAERMVPYLLASLLHSFNWKLQEGTQLDFSETFGLELTKTI PLIAIPSPRLSDQILYS*

 

>22026814 Aquilegia coerulea|Aquca_038_00069|Aquca_038_00069.1

CYP706?

MVSSNQGDYYTNAVVTFFIALSVILWFNWVFKKPKKKNPPLPPGPRGLPLIGNLLSLEPN LPSCLAKLSKPYGPIIKIKIGTRLCIVINSASVAKEVLKDHDTIFANRDISAVAYAGSFG GTDLVWSPLGDHWRMLRKICVRELLSSSRLDALYDHRRKEVRDMVNKIYLENCKPLNIGD QIFLAMFSVMSNMMWGGTLQGEEKKRFTAEFREVLESLIPLIMAPNISDLFPVLAMFDIQ GLARKMKNINKWFAAKFDFVIDRRLGMKDQDENKDFLQVLLQFKEYGDQKTPFTTTHIKG LFLDMLGAGTKSSSSTVEWAMSELLIQPELLRKAQEELEQVVGIDNIVEESHCSKLHFLN AIVKETLRLHPVGPLLVPRCPTESCIIGGYMVPKGAKIFVNGWAIQRDPACWDKPLEFKP ERFLGSDNEYDFIGSKHSYIPFGSGRRVCVGIPMAERMIPYLLASLLHSFNWKMPEGTTV DLSETFGLELRKTIPLIAIPTPRLSNQKLYM*

 

>22042715 Aquilegia coerulea|Aquca_200_00001|Aquca_200_00001.1

CYP706?

MSKALSWCLETSKDEYRAVLILSLLLIVITWWILKIRSRKEKASLPPGPWGLPIIGNLPF LDPQLHRYFDKLSIKYGPILKVQLGSKLAMVLNSPEIAKEVLKDHDANFADRDVPAAGFV ASYGALDIVYAPYGDHWRMMRKVCVRELLSPGRLKALYTVRGREVQEMVNKVHSKIGQSI DIGEHVFLGMFNILTSMMWGNTLEGVERVRVTTNYRKVAKKLVALSAEANISDLFPVLAR FDLQGKERRMKEILGWFDQIYEFVINKRRKMESQQDPESKHKDIENQDFLDVLLQLIDQG GQKTQLTITHIKALFLDITLAGTKSTSSTVEWALTELLKQPEIMKRAQEELDQVVGLNNR VEEIHLSKLPYLDAIVKEVFRLYPTAALLIPRVPRESCIIGGYLIPRGSKIFVNVWAMQR DPKYWSDPLEFRPERFLNSTNDWNYDGNDFRYLPFGSGRRICVGIPIAEKMVSYLLASLL HSFNWELPQGTKLDLAEEFGFVLSKKIPLLAVPSPRLLDYKLYD*

 

>22024426 Aquilegia coerulea|Aquca_005_00554|Aquca_005_00554.1

CYP707A

MVSLILCFFFSFLALFLLHRMFKSSSNSAMKKLPLPPGTIGWPYIGETFQLYSQNPNVFF TSKQKRYGSIFKTHILGCPCVMVSSPEAAKFVLVTKSHLFKPTFPASKERMLGRQALFFH QGDYHSKLRKLVLRAFMPEAIKNIVSQVDNLAVHSLQSWDGQLINTFQEMKTYAFNVALM SIFGKDEILYREELKRCYYVLERGYNSMPINLPGTLFNKSMKARKELAQILARILSTRRQ RKEETTDLLGSFMGDGEGLTDEQIADNVIGVIFAARDTTASVLTWIVKYLGENPSILQAV TEEQQSISGGDKLLNWADIKNMPITSRVIQETLRVASILSFTFREAVEDVEYEGYLIPKG WKVLPLFRNIHHSADIFPDPEKFDPSRFEVAPKPNTYMPFGNGTHACPGNELAKLEILVL LHHLTTKYRWSMVGPQTSIQYGPFALPQNGLPIRLSRKT*

 

>22047946 Aquilegia coerulea|Aquca_007_00653|Aquca_007_00653.1

CYP707A

MEMGGFPFYLVLSLPVLLTCILMSINKRKTKQRPKLPPGSMGLPYIGETYKLYSRNPNVF FSTKEKRYGKIFKTNLLGCPSVMLTSPEAARFVLVTHAHLFKPTYPKCKEQLIGPSALFF HQGDYHTRLRKFVQGSLSLEAIRNLVSDIETIAISALESWSGGHIVNTYEEMKKFSFNIG IFTIFGRLDAKYKEELKENYLILDKGYNSFPSILPGTLYKNAVLARKRLSQTLSEIICQR KERRLEEKDLLGRLMNATDEKGDILTEDQISDNIIGVFFAARDTTASVLTWILKYLHDDP TLLEAVKVEQEAIYEQNDKGSRPLTWAQTREMPLTYKVIQESLRMASIVSFTFREAVADV EYQGYLIPKGWKVLPLFRSIHHNPDFFTDPESFNPSRFEVAPKPNTFLPFGNGVHACPGN ELAKLEMFIVVHHLVTKFRWEVVESKSGIQYNPFPVPQGGLRAKFWKKSSSNNGN*

 

>22041719 Aquilegia coerulea|Aquca_015_00062|Aquca_015_00062.1

CYP707A 58% TO CYP707A1 Arabidopsis thaliana

MERGGLLLYILLVLSTFFSYIFLNKNKIKPRKRAKLPPGSMGWPYIGETLQLYSQDPNIF FTTKQQRYGEIFKSHILGCPCVMLASPEAARFVLVTHAHLFKPTYPKSKEQIIGPSALFF HEGDYHTKIRKLVQGSLSLEVLRNLVPDIETIAISALESWAGGHIINTFHEMKEFSFDVG ILAIFGHLDTYYKEALKKNYCMVDKGYNSFPNTIPGTLYNKAVLARKRLSQLVSEIICDR REKRLDKKDLLGCLMQYKDEKGQILTDNQIADNIIGVLFAAQDTTASALTWILKFLHDNS KLLEAVKAEQKVIYESNEDGSKSLTWSQTRSMILTHRAILESLRMSSIISFTFREAVADV EYKGYLIPKGWKVMPLFRNIHHNAEFFSDPDKFDPLRFEHQNRILLCHSAMECMHALEMS LPSWRCLSLFTIWSPISDGKWWDRKMGFSIAHSQSHRMDCQPDFGIKQSATKDNKSVHDS

CTSDSS*

 

>22033648 Aquilegia coerulea|Aquca_009_00942|Aquca_009_00942.1

CYP707A 60% TO CYP707A1 Arabidopsis thaliana

MIFDYLHPTHKNLPPGSMGWPYLGETLKLYTENPNTFFTNRLKRYGNIFKTHILGCPCVM ISSPEAAKIVLVSQAHLFRPTYPPSKQKMIGHEAIFFQQGDYHSRLRKIVQSTLLPSSIK HSVTDIEQLVLKLLPSWENRTINTLNEMKRFTLDVAMLLAFGNESELETEAFKHMYHCLD KGYNSMPIDLPGTNFRKAMKARKLINDTLRRIIELRRRTMKQSGGQLGALLGSNDILSDS QISDNIIGLIFAARDTTASVMTWILKYLHDNVKLSNDVAREQESIRRRITTENRKLEWED ARRMPLTRRVIQEALRTASVLSFTFREAVGDVEFEGYFIPKGWKVLPLFRTIHHSPDFFP LPDKFDPSRFEVPPRPNTYMPFGNGVHSCPGSELAKLEILILIHHLITTYRWEIVGEEPD EIQYSPFPVPKQGLPISVTRYLKKHMT*

 

>22049341 Aquilegia coerulea|Aquca_003_00106|Aquca_003_00106.1

CYP707A

MQLFYAILFFISFLLLSLMCLLFKRGNLKDKRLPPGSMGWPYIGETLKLYTQNPNTFFST RQKGYGDIFKTHILGCPCVMISSPEAAKIVLVSQANLFKPTYPPSKEMMIGPEAIFFHQG DYHSRLKKLVQASFLPSAIRGSVSEIEKIVLRLVSSWENTTINTLNEMKKFAFDVAIISA FGGRSDLETEGIKHLYNCLEKGYNSMPLDLPGTPFRKAKKARKLLNERIKKMIKRRRESQ KKGGGLLGVLLESKDHKFNNLSDSQVADNIIGVIFAAHDTTASVLTWILKYLHDNKEVLE AVTREQEKIRWAVKEENRGLRWDDTRRMPLTNRVIQETLRAASVLSFTFREAVQDVELQG YLIPKGWKVLPLFRSIHHCADFFPQPEKFDPSRFEVPPRPNTFLPFGNGVHSCPGSELAK LEILILLHHLTTMYRWEVVGNEDGIQYGPFPVPKKGLPLKITARSKKTISAKIN*

 

>22036469 Aquilegia coerulea|Aquca_006_00404|Aquca_006_00404.1

CYP709-like

MGGLDLLSLVFGLVISLLLLRKFLLVVWWIPRNIEKQFRNQGIKGPSYKFIVGSFGELAK IYGSKAKPDEVVPPIAIGSQIKHTLIQDLLPHLHLWIKKYGKVFLYWYGPSPRVVVTDPE LIKEMLNNTKSFIKAIPHPAIYDLVGDGLLFAEGEIWARHRKIISPFFTIEALKGYVQTC ISSNNEMIKRWNDLILSDGPEFEVHHEFRMLTKDIIARTAFPSNFKQVDRIVELQIKQMS

MLTQALRTFYIPGSRFLPTPFNIESWMLRRELEKMFRELIKSRDKSSKDNDLLGLMLSAT NNEHDKGNKMSPKELMDECRIFFVAGFETTSLLVTWAFVLMGIHTEWQDKARHEVEQVLQ GKPPDYDSLARLKIVNMILNETLRLYSPAPFIMKTVEKETKLGDLTIPAGIDLEIPLIAV HHDSQQWGNDVDQFNPARFSEGVVKASKHPMAFMPFTSGARVCIGMNFAMMEAKITLVMM LQKFSFVISPNYKHSPDCLVTTSPVHGAHIIFRKI*

 

>22038934 Aquilegia coerulea|Aquca_028_00015|Aquca_028_00015.1

CYP710A

MDSTTLWSKIALVIPYFFSLLAFFVLLEQINYWKKKRSLPGPLLVYPILGNVISLIKKPT KFWESQALTAKSSHHGLSANYVVGCFIVYVQKAELSHKIFSNVRPDAFNLIAHPYGKKIF GEHNLIYMTALSTYMTLKQNIILEHLKNWEKLASQNLTVPIELRLLCRDINLETSQTVFV GPYLSSKARADFNIDYILFNVGLMNMPIDLPCSGFRKAKLAVKRLIDILTDCAKECKSQL KSGKEPSCLIDFWMQEILNEMDSMPQSGINQYPPHSSDIDIGSYLFDFLFAAQDASTSSL LWAITLLDQHPAVLAKVREEVGRIWSPETNTLITAEQLREMKYTQAVAREIIRYRTPAAM VPHIAREDFPLTESYTIPKGTIVFPSVLDSSLQGFIDPEQFDPDRFSEERQEDKIYKRNY LGFGIGAHQCIGQRYALNHLVLFIAMFTSLFDFKRHKSDSCDEIIYVPTTCPKDNCLVYL SRSCTPYPSFVS*

 

>22057517 Aquilegia coerulea|Aquca_057_00099|Aquca_057_00099.1

CYP710A

MDFMNLFPYIFSLIVFYIFIEQITYIKKKQSLPGPFLIYPFLGNIISLIKNPTTFWETQA TSAKSSSVGVSANYIIGRFIVFIQNTELSHKIFANVRPDAFHLIGHPFGKKLFGEHNLIY

MTGQEHKDLRRRIAPNFTPKALSTYIVLQQNIILHHIKKWESLSSQTIPIELRFLCRDMN LDTSQTVFVGPYLSSKAREEFNRDYNLFNVGLMNLPIDLPGFGFRKARLAVNRLINVLAD CVRDSKSALIAGKEPNCLIDFWMQESVSNSGDTSSHSSDIEMGSYLFDFLFAAQDASTSS LLWAITLLDQHQDVLSKIRNEVGSIWSPESNALITAEQLREMKYTEAVAREVIRYRTPAT

MVPHIAGEDFPLTESYTIPKGTIVFPSVFESSFQGFTDPDRFDPDRFSKERQEDLIYKRN YLAFGAGAHQCVGQRYAVNQLVLFLAMFTSLIDFKRHRSDGCDDIIYVPTICPKDNCLVS LSKRFSSYPSF*

 

>22037517 Aquilegia coerulea|Aquca_012_00108|Aquca_012_00108.1

CYP710A 66% to CYP710A1 Arabidopsis thaliana

MFIVYVQKAELSHKIFSNVRPDAFNLISHPYGKKKLTSQNLSVPIELRLLCRDINLETSQ TVFVGPYLSSKARADFNKDYILFNVGLMNMPIDLPGTGFRKAKFAVKRLIEILTDCAKEC KSQLKSGKEPSCLIDFWMQEILNEIDSMPQSGVNQYPPHSSDIDIGSYLFDFLFAAQDAS TSSLLWAIMLLDQHPAVLAKVREEVGRIWSPESNTLITAEQLREMKYTQAVAREIIRYRT PAAMVPHIAREDFPLTESYTIPKGTIVFPSVSDSSLQGFIDPEQFDPDRFSEKRQEDKIY KRNYLGFGIGAHQCIGQQYALNHLVLFIAMFTLLFDFKRHKSDGCDEIIYVPTTCPNPSF *

 

>22024888 Aquilegia coerulea|Aquca_020_00447|Aquca_020_00447.1

CYP711A

MTWESGARWFTEVGISIAIAPMFFTSLAILASVLVYFYAPYWGVRKVPGPPTTPLLGHLP LLAKYGPDVFTVLAKRYGSIFRFHMGRQPLVIIADPELCREVGIKKFKDVPNRSIPSPIS ASPLHQKGLFFTRDTRWSIMRNTIISLYQPSHLSSQLPMMQSVMDSLTSNLQNSAEEDIL FSNLSLRMATDIIGQSAFGFDFGLSKQSSDNSSINTSDGSSDHIDDEVSDFIKQHIYSTT KLKMDLSGSFSIIVGLLLPILQEPFRQILKRLPWTTDWKVDQTNEKLTRRLDEIVAKRSN DHGDRRQSKDFLSLVLNARESQKAAKDIFTSDYISALAYEHLLAGSATTSFTLSSILYLV AGHPEVEQKLLQEIDEFGPNDLTPTAQDLQHKFPYVDQVIKEAMRFYTVSPLVARETSKQ VEIGGYVLPKGTWVWLALGVLAKDPKQFPEPNKFKPERFDPNCDEEKQRHPYANIPFGIG PRACIGMKFAIQELRLAMVHLYQRYSFRHSPNMEKPLALDYGIVLNFKHGVKLRVTKRT*

 

>22030783 Aquilegia coerulea|Aquca_004_00639|Aquca_004_00639.1

CYP714

MKKIQSKVVKKPNQQISHNYNSIVFPYFELWRKDYGSIFTYSTGNMQHLYVGDPVLVKEI SMNTSLDLGKPSFLQKERRPLFGQGILTSNGAKWAHQRKVIAPQLYMDKVKGMIKLMGDS AMSLVTLWESKIDSEGGIREIKVDEDLRNFSADIISKACFGSSYSKGQEIFQKLRGLQNV

MSKQGLFLGVPGLRFLPTTSNRELWKLEKEVNSLILKVVNERKEAKSENDLLQMLLEGAN NNDEVSLDSIDGFIVDNCKNIYFAGHETTATSASWILILLASHPEWQTRVRDEVVEICGG SLPDFNMLRKMKLLTMVIQEALRLYPPAPFVTRELFQSTKFGDLLVPKGVHLWFPIICLH QDPEIWGPEAQKFNPDRFSHGIGKACKIPQVYIPFGTGPRTCAGQNFAMVEMKIVISLIL SKFSFSLSPDYSHTPAFNLVIEPQNGVDLFMKKM*

 

>22055629 Aquilegia coerulea|Aquca_019_00064|Aquca_019_00064.1

CYP714

MEIITDFKMIFFALFLISFSTLFLYFYVKLWLNPRRIRKKLRTQGINGPEPSFLYGNLPD IKKIQISTALKIDGKDSVNVLDNYLSVVHPYIEQWRRQYGDIFMYSTGHRVHLCVSCPEI VKDICLQKLELGKPSYIFQELSPIFGNGIIGSNGQWWAKQKKIIAPEFFMEKVKSWENQI ASNGGVADIKVDDDLRDLSADVISRACFGSSYGMGNEIFKTLGALKEIITRKNYIFGIPS FSYLPTKMNREIWKLEKKVKSSVLKIIKQRTKDPMSSKDLLMTILKNANSGQLPPGASNQ FIVDNCKNFYFAGHDTTATAVRWILVLLASYPEWQMHARAEVVEVCGDKLPNADSIGKMK

MLTMVIKECLRLYPPSVFVARETMEELKLGNLKIPKGTHVWVPIPAMHRDTRIWGQDVNE FRPERFKNGISGACNFPIAYMPFGMGPRTCLGQHLAMVELKIILSLILLKFSFSLSPKYK HFPQTRMLVEPGYGVYLLIKKI*

 

>22059358 Aquilegia coerulea|Aquca_013_00331|Aquca_013_00331.1

CYP715A

MGFVHQFLQLITLGMVVSFIFILWKILSSWWISPYKAYQKLQNNGFTGPTPSFPLGNTKD

MRRSNSSSSSSSQSFNFTNDIHSIVFPYFVRWRKSFGKVFIYWLGTQPFLYIGEPEFLKQ

MASGIMGKNWGKPKVFKHDRKPMFGNGLVMLEGDDWAHHRHVITPAFSSANLKGMMSLMV ESTKNMLDHWSTLIASGEPEIDVEKEVIRTAAEIIAKTSFGMDDQKGREVFDKLRAMQVL LFQSNRMVGVPFSKLMYLRKTLHARKLGKEIDQLLLSIITSRKVSLGEPQQDLLGLLLAD NYIDGHLEKKLTNHELVDECKTFFFGGHETTALALIWTLLLLALHPEWQNQLRDEIKEVT EDRPLDYNMLARLKKMGWVMNEVLRLYSPAPNAQRQTRGDIQVGDKSIPSGTNIWIDVVG

MHHDPELWGDDVYDFKPERFKDSLHGGCKHKMGYLPFGFGGRMCVGRNLSMMEYRIVLTL VLRKFSFSLSPNYVHSPAIMLSLRPSQGLPLIFQHL*

 

>22039022 Aquilegia coerulea|Aquca_102_00046|Aquca_102_00046.1

CYP716

MEINFTTLSMVIFLIALTFKLFRNKSLSSIDPSKLPPGRTGWPIIGESLDFLGTGRSGHP EKFINDRMHTFSSQIFRTSLFYESIAVFCGPMGNKFLFSNENKLVTSWWPRSLYKIVPSQ PVANSPEAMSMRKLLLRFLKPETLHSFVGAMDCVAKQHLKTCWENKSQVLVYPLAKSYTF ALAWKLFVSIDDPIEVAKLSDAFSVVLCGVISIPIDLPGTSLNKSIRAANFIRKHLHEVI KKRKIDLENKKASPTQDILSHMVLTCDDNGQFLSEADIADKILVLILAGHDTASAAITFL IKYLAELPHIYNEVRKEQMEIVKSKAPGELLNSEDIKMMKYSWNVACEVMRLAPPVQGTF REAMTDFTYQGHTIPKGWKLYWSGNTTHRNAKYFPDPERFDPSRFEGNGPAPYTYVPFGG GPRMCPGIEYAKLDILVFMHNIVTKFKWEKIYPDEKIVIDPLPIPAKGLPIRLQPQVY*

 

>22046082 Aquilegia coerulea|Aquca_051_00097|Aquca_051_00097.1

CYP716

MELIIVVLFSLLLLLLPLTIFFTHWLLFSSKPKTQTVNHTSSVSVLPPGKMGWPLIGENL EYILMGRKGTPEKFIEDRMNKYSSQVFKTSLLGEKMAIFCGSKGNKFLFSNEFTLVQSWW PHSFDVIFPDLKTSIKEESKKMKAFLPKFLKPNSLQKYIGTMDLIAKEHLNMYWDQKDSV TVLPLVKKYMFSLACRLFLSIENVDYIAMFNDQFETVSAGILSLPINFPGTAYNRAIKAS

MFVRKKLLEIIKQRKIDVEQNKSSTQDLLSEMLNSPDEDGLFANEVDVTSKFSAMVIASY DAPGRALTFVMKYLAELPHVYDKVLEEQTEIAMSKGKEVLLNWEDIQQMRYSWNVVNEAL RFVPPLQGSFREAITDFTFEGFFIPKGWKIYWNAYSTHANPNYFPDPKRFDPSRFEGKGP APFTFVPFGGGPRMCPGMHLARVELLVFIHNLVTRFRWEKMIPNEKFTVDPQPRPANGLP

VRLLPHKS*

 

>22046920 Aquilegia coerulea|Aquca_010_00419|Aquca_010_00419.1

CYP716

MELLVLISLLLLPVTIFFIHLWLLFSSKMKTQTVNHTSSVSALPPGRMGWPLIGENLECI LMGGKGTPEKFIEDRMNKYSSQVFKTSLLGEKMAIFCGSKGNKFLFSNEFTLVQSWWPHS FDVIFPDLKTSIKEESKKMKAFLPKFLKPNSLQKYIGTMDLIAKEHLNMYWDQKDSVTVL PLVKKYMFSLACRLFLSIENVDYIAMFNDQFETVSAGILSLPINFPGTAYNRAIKASMFV RKKLLEIIKQRKIDVEQNKSSTQDLLSEMLNSPDEDGVFADEVDVTSKFSAMVIASYDAP GRALTFVMKYLAELPHVYDNVLKEQTEIAKSKGREELLNWEDIQQMRYSWNVVNEALRFV PLLQGSFREAITDFSFEGFSIPKGWKIYWNAYSTHTNANYFPNPERFDPSRFEGKGPAPF TFVPFGGGPRMCPGMQLARLELLVFIHNLVTRFRWEKMIPNEKFTVDPQPRPANGLPVRL

LPHKS*

 

>22050877 Aquilegia coerulea|Aquca_031_00017|Aquca_031_00017.1

CYP716

MELINSFSMLYLIALFISLPLIMFLVSRNKSRSSIESLNFPPGRKGWPIIGETLDFLSMG RRGIPERFINDRMQEFASPVFKTSLFGETVVVICGPAGNKFLFSNEGTLVTPWLPDSCKK IMLFNPQASHNEDAKILRKLLQNFLKPEALFRYIGKMDYISKQHIKTHWDNKKEVLVSPL AKIYTFTVVCKSFLSIDDPVQVATLSAHFRVLLSGLVSIPIDLPGTTFNKAIKASNVIRK FILEMIQERKVAMEENKVSATQDILSHMLLTSDDNGKFMSEMEIVDKIIPMLVGAHDTTT AAITFVVKYLAELPHIYNAVRKEQMEILESKKEGELLNSEDIQKMKYTWNVAREVMRLTP PAQGSFKEAISDFTYEGFSIPKGWKLYASAISTHKDAKHFPDPETFDPVRFEGSGPNPYT YIPFGGGPRMCPGIEYARLEILIFMHNVVTKFKWEKVFPDEKLCYDPMPMPSKGLPITLH

PE*

 

>22040838 Aquilegia coerulea|Aquca_018_00232|Aquca_018_00232.1

CYP716

MELYSFSMLYLIPLFISAPLIMFLVARNKAQSSIVTLNFPPGRKGWPIIGETLDFLDMSR RGVPNKFISDRIQEFSSPVFRTSLFGETVVIVCGPAANKFLFSNEGRFVTPWLPDSCKKI

MLSNPQASHNEHAKILRKFLQNFLKPDALPRYIGNMDYISKQHIKTHWNNKKEVLVSPLA KIYTITLVCKLFLSMDDPVQVATLSDHFRVLLAGLVSIPIDIPGTTFNKAIKASNVIRQL ILEMILKRKLDMAENKMSGTPDILSDMLLTSNDNGKFMSEMDIVDKIIPMLVGAHDTTTA AITFTIKFLAELPHIYNAVRKEQMEILKSKKEGELLNSEDIQKMKYTWNVAREVMRLTPP AQGSFKEAIADFTYEGYSIPKGWKLYLSAISTHKDAKHFPDPESFDPQRFEGNRPNPYTY IPFGGGPRMCPGVEYARLEILIFMHNVVTKFKWEKVLPDEKLCYDPMPMPSKGLPIRLHP

Q*

 

>22055217 Aquilegia coerulea|Aquca_036_00158|Aquca_036_00158.1

CYP716 55% TO CYP716E1 Poptr

MFPHGNMGWPIIGETLEFLKLGRKGIPEKFINDRMQKFSSKLFMSLDDHVEAAKFYDHFA VLLAGLISIPIDLPGTSLHKAIRASNILRKYIAEIVRQRKLDIAERVESVPQDILSHMLL TSDENGQFLNDMEIADRIVGLLVAGHDTVSAAITFIVKYLAELPHIYEEVQNEQREILRS KPKGELLNWEDISRMKYSWNVAREAMRLASPAQGFFREAITNFTYAGFSIQKGWKIYWST YSTHKDPNYFPNPETFDPSRFEGNGPAPYTYIPFGGGPHMCPGNVYARLVILVFMHNVVT RFKWEKIFADERIIIDPLPKPAKGLPIRLQPQCT*

 

>22044590 Aquilegia coerulea|Aquca_049_00199|Aquca_049_00199.1

CYP716 44% TO CYP716Q1 ortholog potato

MEYLLYIFLGVCGFAYLVFRFNIDRTKPPLPPGSLGWPLVGETFELQRLNQSGKPDDFHN QRARKYNKDIYKTSILGEKSIFICGAAGNKFVFTSEKTLVLTWWPLSLKKLFGTAFFTAP YDEAVRTRKLVTGFLQQEVMHQLVERFDKTCRNCMQRDWIGQNKVKAFSLIKKYAFSIAC VMFTSMDDPDWETKMLEEFNSLIGGVFQLPIYFPGTRHYKAVKSGAFIRQELVKVIEKKR TMTDSKSRTDKDLISHLIEAQYENGKSLSDMEIVDNILLLMDAGHDTSTSTMMMLMKYLA ETPDSYHKVLQEQREIAMQKKPGELLNKDDIQKMKYSWNVVKEVLRLAPPLPGTFRKAIV DFTYKGYSVPKGWMVAWNTNSTHKDAEHFPDPEKFDPVRFDRDKLTPYTFVPFGGGPRMC PGNEFAKLEILVFLHHLVQEFRWELEFPDEIICADPMPTSYQGLPVYLYQHH*

 

>22044718 Aquilegia coerulea|Aquca_049_00200|Aquca_049_00200.1

CYP716

MEYLLYIFLGVCGFAYLVFRFNIDRTKPPLPPGSLGWPLVGETFELQRLNQSGKPDDFHN QRARKYNKDIYKTSILGEKSIFICGAAGNKFVFTSEKTLVLTWWPLSLKKLFGTAFFTAP YDEAVRTRKLVTGFLQQEVMHQLVERFDKTCRNCMQRDWIGQNKVKAFSLIKKYAFSIAC DMFTSMDDPDWETKMLEEFNSLLGGVFQLPIYFPGTRHYKAVKSGVFIRQELIKVIEKKR AMKDSKSRTDKDLISHLIEARYENGKLLSDIEIVDNVLLLMDAGHDTSTSTMMMLMKYLA ETPDCYHEVLQEQREIAMQKKPGELLNKDDIQKMKYSWNVVKEVLRLAPPIQGTFRKAKV DFTYKGYSVPKGWMVSWNTNSTHKDAEHFPDPEKFDPVRFNRDKLTPYTFVPFGGGPRMC PGNEFAKLEILVFLHHLVQEFRWELEFPDEIIGVDPMPTSYKGLPVYLYQHH*

 

>22037685 Aquilegia coerulea|Aquca_011_00579|Aquca_011_00579.1

CYP716

MEVILLSIFCCLVILFISLPLLLFLITRKNRTHSSLKYPPGRMGWPIIGENLKFGSCGLR GVPEQFILERMQKFSSKIFKTSLLGEKVAVVCGQAGNKFVFSNENKLVRLWFPRTVDQIF PYSTETSSHTETLILRKLLPGFINADALQRYAGIIDSTAKHHLQTHWANNKEVIAYPLVK KFVFSVACKLFMSIDDPVQVAELFDPFAVLGAGIFSLPINLPGTPLNKAIKSSKGLRTKF QAIIRQRKLDLLKKSSTPQPQDILSHMLLACDEQGQFLDESSILAKIIGLLLGSLDSLSS AISFTIKYLAEYPHFYNEVLKEQKAILNSKKGESLKWEDIQKMKYSWNVASEVMRLAPPF QGTFREAITDINYEGFLIPQGWKVHWNVYSTHKDAKYFPDPEKFDPSRFEGNGPAPYTYV PFGGGPRMCPGNEYARVVILTFMHNIVTKFKWETILPNEKIIAKPMPKPAKGLPIRLQTQ

CL*

 

>22037735 Aquilegia coerulea|Aquca_011_00585|Aquca_011_00585.1

CYP716

ILYGYLYPVLLHCCLLIVFVLFQYISLGVASMELILLSIFCCLVTLFISLPLLLFLITRN NRTHSSLKYPPGRMGWPIIGESLKFGSCGLRGVPEKFTLERMQKFSSKIFKTSLLGEKVA VVCGPAGNKFVFSNENKLVRLWFPSSVDKIFPYSKHTSSHTETLILRKLLPGFINADALK RYAGIIDSTAKHHLQSHWANNKEVIAYPLVKKFVFSVACKLFLSIDDPVQVAELSDPFAV LGAGIFSIPINLPGTALNKAIKASNGLRTKFQEIITQRKLDLIKKRSSSQPQDILSHMLS ACDEHGQFLDESSILSKTIGLLLGSLDTLSSAITCAIKYLAEHPHSILSLGFKCKQKAIL NSKNGETLKWEDIQKMKYSWNVASEVMRLIPPFQGTFREAITDINYEGFLIPQGWKVHWN VYSTHKDAKYFPDPDKFDPSRFDGNGPAPYTYVPFGGGPRMCPGNEYARVVILTFMHNIV TKFKWETILPYEKIIANPMPKPAKGLPIRLQTQCS*

 

>22037776 Aquilegia coerulea|Aquca_011_00583|Aquca_011_00583.1

CYP716

MEVILLSIFCCLVTLFISLPLLLFLITRNNRTHSSLKYPPGRMGWPIIGESLKFGSCGLR GVPEKFTLERMQKFSSKIFKTSLLGEKVAVVCGPAGNKFVFSNENKLVRLWFPSSVDKIF PYSKHTSSHTETLILRKLLPGFINADALKRYAGIIDSTAKHHLQSHWANNKEVIAYPLVK KFVFSVACKLFLSIDDPVQVAELSDPFAVLGAGIFSIPINLPGTALNKAIKASNGLRTKF QEIIRQRKLDLIKKRSSSQPQDILSHMLSACDEHGQFLDESSILSKTIGLLLGSLDTLSS AITFAIKYLAEHPHFYTEVLREQKAILNSKNGETLKWEDIQKMKYSWNVASEVMRLTPPF QGTFREAITDINYEGFLIPQGWKVHWNVYSTHKDAKYFPDPDKFDPSRFDGNGPAPYTYV PFGGGPRMCPGNEYARVVILTFIHNIVTKFKWETILPYEKIIANPMPKPAKGLPIRLQAQ

C*

 

>22037955 Aquilegia coerulea|Aquca_011_00594|Aquca_011_00594.1

CYP716

MELILLSIFCCLVTLFISLPLLLFLITRNNRTHSSLKYPPGRMGWPIIGESLKFGSCGLR GVPEKFTLERMQKFSSKIFKTSLLGEKVAVVCGPAGNKFVFSNENKLVRLWFPSSVDKIF PYSKHTSSHTETLILRKLLPGFINADALKRYAGIIDSTAKHHLQSHWANNKEVIAYPLVK KFVFSVACKLFLSIDDPVQVAELSDPFAVLGAGIFSIPINLPGTALNKAIKASNGLRTKF QEIITQRKLDLIKKRSSSQPQDILSHMLSACDEHGQFLDESSILSKTIGLLLGSLDTLSS AITFAIKYLAEHPHFYTEVLREQKAILNSKNGETLKWEDIQKMKYSWNVASEVMRLTPPF QGTFREAITDINYEGFLIPQGWKVHWNVYSTHKDAKYFPDPDKFDPSRFDGNGPAPYTYV PFGGGPRMCPGNEYARVVILTFIHNIVTKFKWETILPYEKIIANPMPKPAKGLPIRLQTQ

CS*

 

>22038182 Aquilegia coerulea|Aquca_011_00584|Aquca_011_00584.1

CYP716

MELISMSIIFSLVALFFSLPLLFFLTRKRNKSQLPPGKTGWPFIGETLSFHKSGLTGVPP RFVQDRMQMFSPRIFKTSLLGEKMAVLCGPDGNKFLFSNENKLVKVWYPSSVMKIFPPSV KHSSDEEIVRFRKTLASYVNADALQRYAGIIDSITKQHLKTHWENNKEVIAAHLIKKYTF SVACKAFLGIDDPVHLEKLSGPFDLMAIGIKSLPINLPGTSLNKAIKASAAVRKDLLEHI KKRKVDLMVNKSSVPQDVLSHMLLTMHEHGEDEKAVSVKSFGLLFGSLDTVSAAIIFVIK YLAELPHIYNEVLREQKEVLSSMTGEFLKWEDIQKMKYSWSVASEVIRLIPPIQGTFREA ITDLTYAGFSVPKGWKLYWSLHSTHRDAKYFPDPDKFDPSRFEGNGPAPYTYVPFGSGPR

MCPGREFTRVVIVTFMHNIITKFKWEKILPDEKVIVNPIPTPVKGLPLRLEKHNIGNYQ*

 

>22038352 Aquilegia coerulea|Aquca_011_00593|Aquca_011_00593.1

CYP716

MELISMSIIFSLVALFFSLPLLFFLTRKRNKSQLPPGKTGWPFIGETLSFHKSGLTGVPP RFVQDRMQMFSPRIFKTSLLGEKMAVLCGPDGNKFLFSNENKLVKVWYPSSVMKIFPPSP SVKHSSDEEIVRFRKTLASYVNADALQRYAGIIDSITKQHLKTHWENNKEVIAAHLIKKY TFSVVCKAFLGIDDPVHLEKLSGPFDLMAIGIKSLPINLPGTSLNKAIKASAAVRKDLLE HIKKRKVDLMVNKSSVPQDVLSHMLLTMHEHGEDEKAVSVKSFGLLFGSLDTVSAAITFV IKYLAELPHIYNEVLREQKEVLSSMTGEFLKWEDIQKMKYSWSVASEVIRLIPPVQGTFR EAITDLTYAGFSVPKGWKLYWSLHSTHRDAKYFPDPDKFNPSRFEGNGPAPYTYVPFGSG PRMCPGREFTRVVIVTFMHNIITKFKWEKILPDEKVIVNPIPTPVKGLPLRLEKHNIGNY

Q*

 

>22038495 Aquilegia coerulea|Aquca_011_00589|Aquca_011_00589.1

CYP716

MEQISLSWLITLVALFLFLPLILLSTRNKANTSNNFPPGKTGWPIIGESLEFLNTGRRGV PEKFIHDRMQKFSSHIFRTSLLGEPAAVLCGPTGNKFLYSNENKLVQAWWPSSVYKIFPS TGQSSSSEEAIKMRKMLLSFFKPEALQRYVETMDTIAKQHLKNEWENRKEVMVFPLSKGY TFALACKLFMSIDDPIQLARFADPFAILASGVIAIPINLPGTSFNKAIKASELIRKDLHK IIKQRKIELAEKRASPMQDVLSHMLSTSDENGTFMSEMDIADKILGLLIGGHDTASAAIT FVMKFLAELPHIYNDVHKEQMEILKSKGSRELLKWEDIQKMKYSWNVACEVMRLAPPLQG GFREALADFTYNGFSIPKGWKLYWSTNSTHKNSTYFPNPENFDPSRYEGNGPAPYTYVPF GGGPRMCPGKEYARLEILVFMHNVVTKFKWEKILPDENIVVNPMPVPAKGLPIRLEPQVC *

 

>22054157 Aquilegia coerulea|Aquca_116_00005|Aquca_116_00005.1

CYP716

MFPHGNMGWPIIGETLEFLKLGRKGIPEKFINDRMQKFSSKVFKTSLFGETMVVLCGPEG NKFLFSNENTLVKGWVPGSIRKIIPSAGNVSTNEGAIKMRKKLQTSFKLETLQKFIGKMD LAAKEHLTTHWDNKKEVLVFPLAKNYGFSLVCQLFMSLDDHVEAAKFYDHFAVLLAGLIS IPIDLPGTSLHKAIGASNILRKYIAEIVRQRKLDIAERVESVPQDILSHMLLTSDENGQF LNDMEIADRIVGLLVAGHDTVSAAITFIVKYLAELPHIYEEVQNEQREILRSKPKGELLN WEDISRMKYSWNVAREAMRLASPAQGFFREAITNFTYAGFSIQKGWKIYWSTYSTHKDPN YFPNPETFDPSRFEGNGPAPYTYIPFGGGPHMCPGNVYARLVILVFMHNVVTRFKWEKIF ADERIIIDPLPKPAKGLPIRLQPQCT*

 

>22037540 Aquilegia coerulea|Aquca_012_00076|Aquca_012_00076.1

CYP716

MGWPIIGESLRFYHCGLRGAPEKFIQDRMQKFSPKIFKTSLVAESVAVVCGPAGNKFVFT NENKLVRLWFPKTVDKIFPSSTHVSRHEETRIFRKLLPGFVNAEALQRYAGIIDSVAKHH LRTHWDNKKEVIVYPLVEKYTFSLACKLFLSIDNPVQVAKLSDPFAVLASGVYSLPINLP GTALYKAIKASNDLQKKIHEIVRERKVALMKNMSSTPNDILSHMLLTCNEHKEYFLDDTS ITSKTIGLLLASLDTTSSAITCVIKYLAEHPHIYNEVLREQKEILNFKNGESLKWEDIQK

MKYSWNVAREVMRLAPPFQGTFREAISDITYEGFFIPQGWKVHWNAYTTHKDARYFPNPE NFDPSRFEGNGPALTHMSHLEEGLECVQAMNMLEW*

 

>22027117 Aquilegia coerulea|Aquca_045_00213|Aquca_045_00213.1

new cluster A like 716/718

MDLEFLFVVEAEMSFIKGSQLLSFVASFLDMAFLALIAICIISFVFFLVILKKDGRGKNV PKGSLGLPLVGETISFLRAQNQDNGMEWIYERVSKYGPMFKTSLMGAPTVIIIGQAGNKF VLGSDDEVFAAKQPITISAISGKHHLFELTGNRYKFIKAAMVSFLKPESLQNYLAHMDDL IAENLHKETKYIDTLKAVDAMKRITFDVACTTLFGIDDEMTKKALLSDFTIAFKAIWSIP VNLPGTGFRKGINARTRIINRMLPIIKKKKEELAKGILNARSDVISCLLAIRDENQEPVT DIEVLDNFIMLMIASHDTAAILLSQIILKLAKDRKIYDTIREEQMGIINERQGGSNNLTW SEIQKMKYTWRVAQELMRITPPVFGSFRKAAKDTSFGGYDIPKGWQVLWVACATHLNNDI FDNPTTFDPSRFDSPAKPVPPYTYIPFGAGPRMCIGNEFGRVETLIVIHHLVTKFEWSQV YPNETITRRPMPYPSMGLPIKLKPITPSSKN*

 

>22038565 Aquilegia coerulea|Aquca_028_00283|Aquca_028_00283.1

new cluster A like 716/718

GKNLPSGYVGLPIIGESISFLRSVKQDQGDEWILERISKYGPIFKTSILGSPTLVITGQA GNKFVFGSDYDILATKQPKTISAIGGKLQLSNLSKNRYLLIKAAMVSFLKPETLQHRVKD IDDVVMTNLLRETKGKETIKAVDLMKLITFDISCTILFGIFDEPIKEGAILDLKIAFKAY WSIPLNFPGTTFKKGLNARARIIQTVLPIIKKKREDLKNGIITPKSDVIACLLAIGNENE EPISEMEIIDNFITLMIVSHDTSAILASLMVWKLARDKKLYSNIREEQMAILSERQAGEE TLSWSEIQKMKYTWRIAQEMMRIVPPAFGSFREVVKDTNFGGYDIPKGWQVFWVSCGTHM SKEIFEDPANFDPSRFESSSKPIRPYTYIPFGAGAHMCIGNEFARVETLVIIHHFVTKFD WSQINPDEIITRQPMPYPSW*

 

>22054900 Aquilegia coerulea|Aquca_022_00067|Aquca_022_00067.1

new cluster A like 716/718

MVNTMLESFSSMSPVALFAITILSSVFLILIFKKDYYRGYNLPGGSLGFPFIGESISFLR AQLQDRGDEWIHERVLKYGPVFKTHMMGSPTFVITGQPGNKFVFGADYDIMSAKPPKTLA IVAGEYSLSDLPKPRYLLVKAGMVSFLKAESLQHHVKHMDRLIKASLLRETKNQDVVQAV QFMKNLTFEVACCVLFGVDDEVVIKGLMSDFAVAFKAFWSIPINLPGTNYTRGLAARKRI VEKILPIIKRKKEELANGTLSPRNDVIACFLSIGGENVVPLTDLEIIDNFIFLMIASHDT AANLSSMMIWKLARDKKIYEKIREEQMGILSQRQSGDETLTWIEVNKMRYTWSVAQELMR VIPPLFGNFRTTTADTTFAGYDLPKGWQVFWVACETHMDKNFFEDPTTFDPSRFESKKPI PPCTYIPFGAGMHQCIGNEYARVKTLTIIHHLVTRFEWSQVNPEEKIARQPLPYPSTGLP

IKLKSRNA*

 

>22027183 Aquilegia coerulea|Aquca_045_00211|Aquca_045_00211.1

new cluster A like 716/718

DHTAKNVPKGSLGLPLIGETLSFIRAQNQDHGMEWIYERVSKYGPVFKTSLMGSPTVIIT GQAGNKFVLSSDEEVLVAKQPATISAISGKHTIFELTGARYKLIKGAMVSFLKPESLQNY VRHMDDLIAKNILAETKDKDTLKAVDMMKRITFDVACTTIFGIEDKMTKKALLSDSTIAF KAIWSIPVNIPGTSFLKGIEARGRIINRMLPIIKKKKEELIKGTISPRSDVISCLLALKE ENQEPITEQEILDNFIMLMFASHDTSTILLSLMILKLAKDPKVYKKIREEQMSILSERQK GDEKLTWNEIQKMKYTWRVAQELMRIIPPVFGSFRTVVKDTGFAGYDIPKGWQVFWVACG THMNKNIFDDPNAFEPSRFESPSKPIPPYTYIPFGAGTHMCIGNEFGRVETLALIHHLVT KFEWSQMNPDEDITRQPMPYPSMGLPIKLKPIVLEGKS*

 

>22027064 Aquilegia coerulea|Aquca_045_00214|Aquca_045_00214.1

new cluster A like 716/718

MESLLSHIQPYFESQLPFLAVVIATILALFGGYYKFKISPLLGKKLPPGAQGFPLIGESI GFLKAQKNDKTKEWLDKRLSQYGPIFKTSLMGSPVVVLTGQAGNKFIFSANDAIASNQPV SVARIIGAHSIFELQGKRHKLVRGAMMNFLRPESIQRFVGEMDSIIKEQLLQELKGKDSV HVVTMMKKVTFKVTCSLLFGLPEGKEKDALLEDFTIALKGTWAIPIDFPGTIFRQAVQAR DRITIVITKLVRRRKKEMEEGIGKSREDIISSFLLLRDADESLLEDEIVDNIVSLIIASH DTAAIVLTLLLRHLARDTHVYDTVLAEHKEIIKTTEGKDGKLKWNDVQKMKYTWRVAQEL

MRVTPPVFGNFKKTTKDTSFGGFDIPKGWQLFWVACATHMDEKIFQEPEKFDPSRFENPS KSVLPYTYVPFGAGPRGCPGVDFARIEMLLIIHHLITNYRWTEMIPNEALTREPMPYPAM GLPIKLHPRTDTINCT*

 

>22054911 Aquilegia coerulea|Aquca_022_00049|Aquca_022_00049.1

CYP718A

MGLPWIGETYEFYKAQRNNKVFEEFVEPRRTKYGNIFKTRLMGSPTVVVNGAFANRFFLS NEFKLVVSSWPSASVQLMGPNSIMEKQGDQHRRIRGIVSSSLTCNGLESLVPKICSSVEM HLKRHWQGLGTISLFRSTKMLTFSIVFECLLGIRVEHGMLEMFERVLEGVFAIPVDCPGT TFWRAKRARMEIEEMLLNIIRKKRKEIEESPGLEEKEGVLLSGLVVGLIQGEISEAEVVD NVVLLVFAAHDTTSFAIAMVCRMLAHHPRCYARLLQEHMEIKSSKNVGETLTLEDTKKMK YTWQVARESIRLFPPIFGSFRKAIVDIEYEGFIIPKGWKVLWTTYGSHYNEEHFTDPQTF KPSRFDEPIAPYVYVPFGGGPRICAGYQLAKFNILIFLHYMVTLYDWSLIHPDEPITMDP LPFPCHGMPIKISPKL*

 

>22042895 Aquilegia coerulea|Aquca_001_00277|Aquca_001_00277.1

CYP719A6?

MEVSLWLVSVTLAIVLVIKIFIRMYMSAYSSFSQMKWPTGPKKLPIIGNLHQLGGDVLHV ALAKLSNVHGSVMTVWIGAWRPTIVVSEIDKAWEVLVNKSSDYAARDMPEITKFASASWH TIATSDAGTFWQTVRKGLQSGAMAPLNIAAQSQFQERDMKRLIQAMTDEAAKKNNILKPL DHIKKNTMRLLSRLIFGQSFDDDKFIESMHYELDDLIRIGGYAHLAEAFYYAKYLPSHKK AEREAYLVKCRVEELVRPLLTSNPPTNSYLYFLLSQNFPEEVIIFCVFEVYLLGVDSTSS TTTWALAYLIREEAVQEKLYQDIKMTIGDVDLVKIEDVSKLKYLQAVVKETMRMKPIAPL AIPHMTAKDTTLMGTKVAKGTRIMVNLYALHTNQKIWTEPYKFIPERFMQGDQNEGVTNN KAREQSFLPFSAGMRICAGMDLGKLQFAFSLANLVNALKWSCVEEDRYPDMSEELGFVLL

MKTPLVAKITARNS*

 

>22043379 Aquilegia coerulea|Aquca_001_00288|Aquca_001_00288.1

CYP719A6?

MEVSLWLVSVTLAIVLVIKIFILMYMSAYSSFSQMKWPTGPKKLPIIGNMHQLGGDALHV ALAKLSNVHGSVMTVWIGAWRPTIVVSEIDKAWEVLVNKSSDYAARDMPENTKFASASWH TIATSDAGTFWQTVHKGLQSGAMAPLNIAAQCQFQERDMKRLIQAMTDEAAKKNNILKPL DHIKKNTMRLLSRLIFGQSFDDDKFIESMHYELDDLIRIGGYAHLTEAFYYAKYLPSHKK AEREAYLVKCRVEELVRPLLTSNPPTNSYLYFLLSQNFPEEVIIFCVFEVYLLGVDSTSS TTTWALAYLIREEAVQEKLYQDIKMTIGDVDLVKIEDVSKLKYLQAVVKETMRMKPIAPL AIPHMTAKDTTLMGTKVAKGTRIMVNLYALHTNQKIWTEPYKFIPERFMQGDQNEGVTNN KAREQSFLPFSAGMRICAGMDLGKLQFAFSLANLVNALKWSCVEEDRYPDMSEELGFVLL

MKTPLVAKITARNS*

 

>22025022 Aquilegia coerulea|Aquca_020_00479|Aquca_020_00479.1

CYP719A7

MEVVSLWLVSATLAFVLAITILIRKFTSSSSSSFSQMKWPTGPKKLPIIGNLHQLGGDVL HVALAKLAKVHGSVMTVWIGTWRPIIVISDIDRAWEVLVNKSSDYGARDMPEITKIASAS WHTISTSDAGAFWQTVRKGLQSGAMGPLNIAAQAQFQERDMKRLIQALTDEAATNNNIVK PLDHIKKNTVRLLTRLIFGQTFDDDKFVESMHFEIDDIIRISGYAQLAEAFYYAKYLPSH KKAEREAYLVKCRVEELVRPLLSSNPPTNSYLYFLLSQNFSEEVIIFCIFELYLLGVDST SSTTTWALAYLICEKAVQEKLYQDNRMTLGDVDLVKIEDVNKLKYLQAVVKETMRMKPIA PLAIPHKTAKETTLMGTKVAKGTRIMVNIYALHHNQNIWTEPYNFMPERFLQGEDGSATN KAMEQSFLPFSAGMRICAGMDLGKLQFAFALANLVNAFKWSCAEEGKFPDMSEELSFVLL

MKTPLEAKITARKF*

 

>22054907 Aquilegia coerulea|Aquca_022_00105|Aquca_022_00105.1

CYP719A

MEVSLWLVSATFAILLALATLIQKSKSSSSFPEMKWPSGPKKLPIIGNLHQLGGDVLHVA LAKLAKVHGGVMTVWIGSWRSIIVISDVDKAWEVLVNKSSDYGARDLTEITKSVTASWRT ISTSDVGALWQTLRKGLQNGALGPLNIAAQTQFQEGDMKRLIQAMTDEAAKNNNIVKPLE HIKKNTVRLLTRLIFGQTFDDDKFVESMHYDVDDVIRIGGYARLAEAFYYAKYLPSHRKA VREAYLVKSRVEDLVRPLLSSNPPTNSYLYFLLSQNFPEEVIIFSIFELYILAVDSTSST TTWALAYMVREQAVQEKLYQDTRMTLGDVDLVKIEDVSKLKYLQAVVKETMRMKPIAPLA IPHKAAKDTTLMGIKVAKGTQIMVNLYALHHNENIWTEAYKFIPERFMQGEDTSATNRAL EQSFLPFGAGMRICGGMDLGKLQFAFVLANLVNAFKWSCVEEGMLPDMSEELSFVLLMKT PLEAKITIRNS*

 

>22032981 Aquilegia coerulea|Aquca_042_00188|Aquca_042_00188.1

CYP719A

MEVSLWLVSVTLAIVLVIKLFIRMYMSAYSSFSQMKWPTGPKKLPIIGNLHQLGGDVLHV ALAKLSNVHGSVMTVWIGAWRPTIVVSEIDKAWEVLVNRSSDYAARDMPEITKFASASWH TIATSDAGTFWQTVRKGLQSGAMAPLNIAAQCQFQERDMKRLIQAMTDEAAKKNNILKPL DHIKKNTMRLLSRLIFGQSFDDDKFIESMHYELDDLIRIGGYAHLAEAFYYAKYLPSHKK AEREAYLVKCRVEELVRPLLTSNPPTNSYLYFLLSQNFPEEVIIFCVFEVYLLGVDSTSS TTTWALAYLIREEAVQEKLYQDIKMTIGDVDLVKIEDVSKLKYLQAVVKETMRMKPIAPL AIPHMTAKDTTLMGTKVAKGTRIMVNLYALHTNQKIWTEPYKFIPERFMQGDQNEGVTNN KAREQSFLPFSAGMRICAGMDLGKLQFAFSLANLVNALKWSCVEEDKYPDMSEELGFVLL

MKTPLVAKITARIS*

 

>22041917 Aquilegia coerulea|Aquca_015_00066|Aquca_015_00066.1

CYP719A

MEGWLWALTVILLGGLMTIFNDFWKKLCLKSEVVNWPPGPRKLPIIGNLHQLNNGGELVH VNLAKLAQKHGSMMTVWFGSWRPTIVCSNRELAWEALVNKASDFSSRTLPYMSKLTSADW HTLATSNVGPYWQKLHKGLHNTTLNLHIMSAQTHLQEADVSNMLSSLQIEASSNDGVVKP LPHFRRLTIQLIGRFCFGPQFNDDIFANGLDDAIEEVIRLSGHAGLAHVFEFLRYIPGLS LPFEEASKLKHRIEQLFQPYIANHKFSFQPSYLHFLLSQNFSEEIVIFNLFEMFMFAVDS TSATTAWALAFLIHDQQIQQKLYEEVQRETGSEALQAEKVDKLHYLHAVVKETMRMRPIA PLAVPHRAVRDSKLMGTKIVEGTPVMVNLYAMHHDPSIWVEPYRFMPDRFMASSVDKDSE SDLRNMERSFLPFGAGRRTCAGMDLAKLQVAFTLASLIKTFHWSSVAEDQLPDLSEDLTF VLMMKTPLIARIISR*

 

>22037548 Aquilegia coerulea|Aquca_012_00087|Aquca_012_00087.1

CYP719A

MEGWIWALTVILLGGLMTIFYDFWKNLYFKSDVMNWPPGPKKLPIIGNLHQLNSGGELVH VNLAKLAQEHGSMMTVWFGSSGPTIIVSNHELAWEVLVNKASDFSSRTLPYMSKLTSADW QTLATSNLGPYWQKLRKGLHNTTLNPHTMSAQTRLQEADVSNMLTSLRIEASSNDGVVKP LLHFRRLTIQLIGRLCFGPQFNDDIFVNSLDDAIEEVIRLSGHARLVDVFELSRYIPGLN LRFEEASRLKHKIEQLFLPYIANHKFSFQTCYLHFLLSQNFSKEIIIFNLFEMFLLAVDS TSTATAWALTFLIHDQQIQQKLYEEVQRETGSEALQAEKVNKLLYLHAVVKETMRMRPIA PLAVPHRAVRDSKLMGTKIVEGTPVMVNLYAVHHDPSIWVEPYRFMPDRFMTSSVDKGAE SDVSLVRNMERSFLPFGAGRRICAGMDLAKLQVAFTLASLINNFHWSSVAEDQLPDLSED LTFVLRMKTPLMARIISRSS*

 

>22042896 Aquilegia coerulea|Aquca_001_00284|Aquca_001_00284.1

CYP719A 74% to CYP719A1 Coptis japonica (Japanese goldthread, Ranunculales)

MEVSLWLVSVTLAIVLVIKIFIRMYMSAYSSFSQMKWPTGPKKLPIIGNLHQLGGDVLHV ALAKLSNVHGSVMTVWIGAWRPTIVVSEIDKAWEVLVNKSSDYAARDMPEITKFASSSWH TIATSDAGTFWQTVRKGLQSGAMAPLNIAAQCQFQERDMKRLIQAITDEAAKKNNILKPL DHTKKNTMRLLSRLIFGQSFDDDKFIESMHYDRAR*

 

>22061036 Aquilegia coerulea|Aquca_035_00027|Aquca_035_00027.1

CYP720A

FPPGRRGWPVVGDSINWYNAVAGSHPPRFVEEQVKRYGRIFSCNLLGKRAVVSADPTFNR FIMQNEGKLFQSSYPKSFRDLVGKNGVITVQGEQQRKLHGIASNMMRLEKLKFHFLKDIQ VVMIQTLDNFNNNQVILLQDMAMNLMVTQLLGVSSDSDINEMAQLFSDFVDGCLSVPINL PGFPYHTGMKARQKIIKKIDKTIEIRRQQPASEVGINGVLGRLLEEDSLPDDTVADFIIN LLFAGNETTAKTMLFAVYFLTQCPMALKQLMAEHAGLQRNCDEGTLTWEDYKSMPFTQCV IDETLRIGGIAIWLMREAKEDVEYEGFLIPKGCFVVPFLSAVHLDENFHKEALTFNPWRW

MDPENQEKRNWRSSPFYAPFGGGARFCPGAELARLQIALFLHFFVTRYRQVWTQLKEDHM SFFPSARLVNGFEIRITRTEQ*

 

>22047741 Aquilegia coerulea|Aquca_007_00163|Aquca_007_00163.1

CYP721A

MHLLFPLIFFLVLLFIILRFTYKLIWVPLRIQKHFNKQGIQGPSYRPIFGNSVEIRDIIK EAQAKSIQPITNEILHRVTPHYYKWSKMYGKTFLYWFGSTPRLAITDPDMIKEVLLNQSG SYEKIEFNPLSKPLFADGLVGLMGEKWARHRKITSQAFNMERVKAWIPDMVVSTLNMLEK WEQGKDEFEMEVHKELHNLSADIISRTAFGSSFEEGKQVFLLQEEQMHLVSLALRSVYIP GFRFLPTKKNKTRWRLEKETRESLRKLIKKNGETCENSKNLLGLLMLANKNEKEETEKLG VEEIIDECKTFYFAGKDTTANFVTWAILLLSMHQEWQSMARDEIIRVCKHNELPTAENLN NLKIISLILNETLRLYPPAVMVMRKTRKNTKLGTLDVPAGAQLYLAMTAVHHDPRIWGED ADKFNPMRFESTTKHLGAFFPFGLGPRVCVGQNLALVEAKVILAIIISRYLFRVSPSYVH APMQFLTLQPQYGVHILFTKM*

 

>22046335 Aquilegia coerulea|Aquca_010_00544|Aquca_010_00544.1

CYP722A

KPTAKIPPGSLGLPLIGETLEFFAANNSNKGIYHFVQTRRLRYGNCFKTRILGEIHVFVS GTKSAKAVLGNDFGNFTKRYVRSMAELVGDQSLLCVSQQQHQLIRNQLSHLVSTESISNF IKHFDQMVVNTLTNWKHRDVVIVLQDALKITFNGMCKLLMSLEDSDELEKLQDDVAQICE AMLAFPLKLPGSRFYKGLKARRRVIDTLQRLMNTRRQGLEKYDFLQSLLEENKSPCHDAP

MLTDTQIQENVLTLIIAGQVTTASAMTWMVKYLDENQEIQDTLRARFLTVLCIRQMFILQ HQQQKLSFKIPPGSSLTLEDLNEMPYAYKVVKESLRLASIVAWFPRIALKDCEVEGFKIK KGWIVNIDARAIHLDPILYHDPTKFNPCRFDDELKPYSFLAFGTGARTCLGMNLAKAMIT VFLHRLITTYRWKVIDSDTNLEKRALFARLKSGCPVSVMPLAPK*

 

>22023488 Aquilegia coerulea|Aquca_005_00345|Aquca_005_00345.1

CYP724B

MAMVIGGIFSVCYVFLVGFVGLVLSLIIYHFLPLLLINLGSSSSSNSLVVPKGNFGWPLL GETLAFLKPHTSNSLGSFLQHHCSRYGKVFKSHLFFSPAIVSCDQELNYFILQNEDKLFQ CSYPNSIHGVLGKSSMLVVVGETHKRLRSLALTLVTSTKLSPDYLNDIESTAIQILASWK GKHQVTFCEEARKFTFNVIVKQVLGLTPEDPQTTKILEDFLAFMKGLISFPLYIPGTPYA RAVQARTRISTTVKALVEERRRSIGENKSNKKGDFLEILLSVNNLSEDEKVSFVLDALLG GYETTSLLMAIAVQCLGQSPLALEQLKKEHHNIRSLKKKDEYLNWEDYKKMEFTQNVINE ALRCGNIVKFVHRKAIKDVRFKEYLIPLGWKVLPVFSAVHLDQSLHDDALQFHPWRWETQ GQTAKKFTPFGGGPRFCPGSELAKVETAFFLYHLVLNYRWKAEGPDQSMAYPYVEFPRGL PLKLDPIVSESSA*

 

>22038396 Aquilegia coerulea|Aquca_011_00417|Aquca_011_00417.1

CYP724B

MVGILLLLAVLLGLALAFMASSFLFAKKQPKNIPPGSMGWPLLGETLGYLKPHQSNSIGT FLQDHCSRYGKVFKSHLFCCPTIVSCDYELNMFILQNEEKLFQCSYPKAIHGILGQLSLL VVVGDVHKKLRSFAVSFASTCKGRPDYFHNIEKLAILTMEPWKTRKEIIFCHEAKKFTFN LILKQILSMDLDDPLASKILEDFTFFMEGLISLPLNLPGSRYAKALKARERISTTVRSII EEREKRGADHKKGDFLDVLLSNEGLSYEGKSSILVDLLLGGYETTSILMSMVVYFLGTSP HALDKLKEEHQAIRASKKEKLLNGDDYKKMEFTQNVISEALRCGNVVKFLHRKALQDVNF KGYFIPSGWKVLPVLTAVNLDPSLHSNASEFNPWRWNGQSMTKNMIPFGGGPRLCPGLEL AKVETSFFLHHLVLKYRWSAKEIDHPLAHPYVEFKSGLPLEIEPLKMNERRQAL*

 

>22038940 Aquilegia coerulea|Aquca_028_00027|Aquca_028_00027.1

CYP728B

FTLSYISLPGPDCSLLLSCSTMYYIALFFTLLLTILCLQRKARNSSKNLPPGSLGFPFIG QSFALLRALRTNTAEKWLEERAERYGPISKLTLFGTKTVFIHGQAANKFKLLGKKNLLEL SGEDHKRVRGALMAFLKPEALKQYVGKMDGEIREHLKMYWEGKQNVTVLPLMKTLTFNIM CSLIFGLERGTRRENFICWFQHMLEGLWSVPVDLPFTRFNRSIQASSKIQSMLMDIIHEK RSSAKQHNSPPQDLITSLLSMCADNAPLLSDKEIVANVMFILIAGQDTSAVLLTFLVRQL ANDPVVYAAILKEQEEIAKSKTSTELLTWEDLTKMKYTWRAALEILRIFPPVFAGFRRTR KDIEFGGYLIPKGWQVLWAANMTHMNDSIFPEPSKFEPSRFENQVLIPPYCFVAFGGGPR ICPGYEFARIETLVTVHYLVTRFTWELHYKDNKFIRDPTPIPTQGLPIQIERKNRF*

 

>22041532 Aquilegia coerulea|Aquca_077_00031|Aquca_077_00031.1

CYP728B4

MYYFAFFFTLLVCLLPIFLFLKKTRILSNRLPPGPLGIPFIGQSLSLLRAMRANTGEKWF EDRAEKYGPISKLTLFGNPTVFIHGQAANKFIFTSGGLNNKQPKPVSTILGERNLMELSG EDHKRVRGALMTFLKPEVLKQSVGKIDQEVREHFEAYWQGKDTVTVMPLMKNLTFNIMCA LLFGLEQGEKREKFVKIFEQMVEGLWSIPLNLPFTRFNRSIQASSRIQNMIMDIIHERRS GRHEANTYQDLILSLLSLQASDNATFLSDQEIVDSIRIIMVAGHDTSSILLTFLIRHLAN DPVVYSAIVKEQEEIAKSKTSGELLTWEDLTKMKYTWRAALEMLRIVPPAFAMFRRTLRD IEFGGYLIPKGWQVFSAANMTHRDESIFPEPSKFDPNRFENQASIPPYCYVGFGAGPRIC PGYEFARIETLVAMHYLVTRFKWKLCGNNNNYKRDPTPIPTQGLPIQIEQINKLQNH*

 

>22041555 Aquilegia coerulea|Aquca_077_00032|Aquca_077_00032.1

CYP728B

MYYMALFFTLLSFLPIFFILKKRRSSNKLPPGSLGISIIGQSLSFFRAMKANTDEKWFED RVNKFGPISKLTLFGTPTVFIHGQAANKFVFTRKKNLTQVSDEDHKRLRGALTAFLKPDV LKQYVGNMDAEIRKHFEMHWQGKETVTVLPLMKTLTINIMCTLLFNLEHGARREKFVKWF EQMVGGLWSIPVNLPFTHFNRSIQATSRIQNMIMDIIHEKRSRTEEAYPHKDLVASLLSL RGDDNAALLTDQEIVDNVRTVMFAGHDTSSVLLTFFIRHLANDPVAYGAILKEQEEIATS KSSEELLTWNDITKMKYTWRTALEILRIVPPVFAGFRRTRKDTEFGGYLIPKGWQVIWAA NMTHMNDSIFPEPTKFDPSRFENQASIPPYCYVAFGGGQRICPGYEFARIEILVTIHYLV TRYTWKLCCKDNKFSRNPVPIPTQGLPIQIEQKN

 

>22041560 Aquilegia coerulea|Aquca_077_00033|Aquca_077_00033.1

CYP728B

MYYLVLFFTLLSFIPIFIILTKRRSSNRLPPGSLGIPIIGQSLGLLRAMKANTAEKWIED RVKKYGPVSKLTLFGAPTVLIPGQAANKFIFTSDSNTLNNQQTKPIQILLGKRNLLGLSG DDHKRIRGALMTFLKPEALKQYVGKMDGEIKEHFKMYWQGKEKVTVMPLMKTLSFNIICS LLFGLEAGARRQKFVIWFGQMMDGMWSVPVNLPLTPFNRGIRASSKIQNMVMDIIQEKRL ALEKQEVSPHQDLITSLLTIRGEDGTALLSEREMVDNIMLIMTAGYDTSSILMTFMVRLL ANDPVVYAAVLKEQEDISKSKASGELLTWDDLTKMKYTWRVALETLRIIPPAFGGFRRTS KDVEYGGYLIPKGWQIFWVANMTHMNESIFPEPKKFVPERFENQASVPPYCYVAFGAGPR ICPGYEFARIETLVAMHHLVTRFTWKLCGKDNNFSRDLMPVPTQGLPILISQKNIS*

 

>22041544 Aquilegia coerulea|Aquca_077_00027|Aquca_077_00027.1

CYP728B

MELTLFITLLLCLFPIFLLFIKIKRKSSNRLPPGPLGIPMIGQSFGLLRAMRANTAEKWI EDRVKKYGPVSKLTLFGTPTVIIHGQAANKFAFTSDTLSNQQPQSIQTLLGERNLLALSG KDHKRVRDAIVAFLKPEVLKQYIRMMDGEMTKHLEMYWEGKQNLTVLPVMKTLTFNIICS LLFGLEPGARREKFLESFQYMIEGMWSVPVNLPFTRYNRSIRASSTIRSMVRDIIGERRL ALGKGHASPDQDLITSLLSIHGEAKEEMLSENEIVDNVMLVMTAGYDTSSVLITFMVRLM ATDPIVYAAVLREQEEIAKSKNPGDFITWEDLNKMKYTWRVALEILRISPPVFGGFRKTL KDIEFGGYLIPKGWQVFWAANMTHMNESIFPDPSKFDPKRFENQSAIPPYCFVAFGGGQR ICPGYEFAKIEILVAMHYLVTRFTWKLCGKDNKFSRDPMPVPTEGLPIQIKAKKIL*

 

>22041545 Aquilegia coerulea|Aquca_077_00030|Aquca_077_00030.1

CYP728B

MSYLALFFTLLSLLPIFLLIKIKRSSNSCRLPPGSLGIPVIGQTFGFLRAMKANRAEKWL QDRVDKNGAVSKLTLFGIPTVIIHGQAANKFTFTSDTLLSEQPKSFAKLVGKRNLLLLNG EDHRRVRGVIMPFLKPEVLKQYVGKMDGEIRNHIDVYWQSKQEVTVMPLMKILTFNVMSS LLFGLEPGARRETFLESFQYVLEGILAIPVNIPFTVFHRSKQASSRVKSMIIDLIHEKRL ALEKKEVLPHQDLITSLLSIHGEGNEALFSEQEIVENVMLFMMAGYDTSSSLLTLMIRLL AIDPAVHAAVLEEQEEITKSKRSEEPITWEDLTKMKYTWRVALEVLRITPPVFGGMRKTL KDIEFGGYLIPKGWQVLWAANMTQMDESIFPDPSKFDPKRFENQASVPPYSFVAFGGGPR LCPGNEFARIEILVLMHYLVTGFTWKLSDKVNNFTRNPFPVPTKGLPIRIQRKSLL*

 

>22041550 Aquilegia coerulea|Aquca_077_00028|Aquca_077_00028.1

CYP728B

MDLLVFFTLLCLFSISLFLIKIRRKPSNRLPPGSLGIPIIGQSFSFLRAMRENTAEKWLE ERVQKYGSISKVTLFGTPTVIIHGQAGNKFIFTSDTLTNQQPTSIRKLLGTRNLMELSGE DHKRVRGAVMSFLKPEVLKRYVGKMDTEMKKHLDMYWQGKEKVAVLPLMKTLTFDIICSL LFDLDLGTRRNDFLEAFQYVIEGLLSVPLNIPFTSLNRGIRASTKIKSMVRDIICEKRLA IEKQEAIPDQDLITSLLSIQGEDNEALLSENEIVDNVILVMSAGYDTSSVLITFMVRLMA TDPVVYAGILKEQEEIAKSKTAIDSITWEDLSKMKYTWRVALEIMRITPPVFGAFRKTLK DAEFGGYLIPKGWQILWAANMTHMDESIFPEPSKFDPKRFENQASIPPYCFLAFGGGPRI CPGYEFARIETLVAIHYLVTRYTWKLCGIDNNFSRTPMPVFPQGLPIQIEQKKTTV*

 

>22037393 Aquilegia coerulea|Aquca_012_00055|Aquca_012_00055.1

CYP728B

MKANTAEKWLEDRVKKYGPVSKLTLFGIPTVFIHGQAANKFVFTSNILNTKQPISIQTLL GKRILTEVSDEDHKRIRGALMTFLKPEVLKQYVGKMDGEIKKHFEMHWQGKETVTVLPLM KTLTFNLLCSLLFNLEHGARREKLTKWFEQLLQGFLSVPVNLPFTRFNRSIQATSRIQNM VMNIIHEKKSIKQEAYPHKDLIASLLSLRGNDNATLLSDQEIVDNVRAVMFAGHDSSSVV LTFLIRHLANDPVVYAAILKEQEEIATSKNSEELLTWEDLAKMKYTWRAALEILRIFPPI FAGFRRTREDSEFGGYLIPKGWQVVWAANMTHMNDSIFPEPSKFDPSRFENQASIPPYCY VAFGGGQRICPGNEFARIQILVTIHYLVTQYTWKLCCEDNKFSRHPIPTPTQGLPIQIEQ

KNRL*

 

>22058176 Aquilegia coerulea|Aquca_079_00010|Aquca_079_00010.1

CYP728B

MYYLVLFITLLSFLPIFFILKKIRSTTRLPPGSLGIPIIGQSLSFLRAMKANTAGKWCED RVKKYGPISKLTLFGTPTVFIHGQAANKFVFTNDTLNSQQPKSFRTLFGKRNLLELSGKD HKHVRGALMAFLKPEVLKQYVGKMDGEVRKHFEMHWQGKETVTVLPLMKTLTFNILWSLL FNLEHGARRKKFAMLFEQMVQGLWSIPINLPFTRFNRSIQATSRIQNIIMDVIQEKRSRK QEAYPHKDLIATLVSLRGDDNTILLSDQEIVDNVRTVMVAGHETSAGLLTLCIRHLANDP VVYAAILKEQQEIATSKTSEEPLTWDDLAKMKYTWRAALEILRIVPPIFGAFRRTLKDTE FGGYLIPKGWQVFWAANMTHMNDSIFSEPSKFDPSRFENQASIPPYCYVAFGAGPRICPG YEFTRIEILVTMHYLVTQYTWKLCCKDDNLSRDPMVIPTQGLPIQIEQKNRL*

 

>22037461 Aquilegia coerulea|Aquca_012_00060|Aquca_012_00060.1

CYP728G 62% to CYP728G1 Vitis vinifera (grapevine)  

MESLLSHFDFNLPFQAVVIATILALFGGYYKFKISPLLGKKLPPGSQGFPLIGESISFVK AQKKDKTKEWLDKRLLKYGPIFKTSLMGAPVVVLTGQAGNKFIFSANDAITNNLPASVAK IIGAHSIFELQGKRHKLVRGAMMNFLRPESIQRFVGEMDSIIKEQLLQELKGKDTVHVVT

MMKKVTFKVTCSMLFGLPDGKEKDALLEDFTITLKGSWAIPLDFPGTIFRKALQARERIN TVITEFVRRRKKEMEESEGRSREDIISCFLLLRDADESLLEVEIVDNIVSLIKASHDTAA IVLTLLLRHLARDTHVYDTVLEEHKEIIKTTEGKVEKLGWNDVQKMKYTWRVAQELMRVT PPVFGNVKKTTKDISYGGFDIPKGWQLFWVACATHMDEKIFPEPEKFDPSRFENPTKSVL PYTYLPFGAGPRDCPGVDFARIEMLLIIHHLITNYKWTEMIPNEALTREPMPYPAMGLPI KLHPRRDTINST*

 

>22030310 Aquilegia coerulea|Aquca_004_00206|Aquca_004_00206.1

CYP728H 56% to CYP728H1 soybean

DYRGYNLPGGSLGFPLIGESISFLRAQLQDRGDEWIHERVLKHGPVFKTHMMGSPTFVIT GQPGNKFVFGADYDIMSAKPPKTLAIVAGEYSLSDLPKPRYLLVKQGMVSFLKAESLQHH VKHMDRLIKASLLRETKNRDVVQAVQFMKNLTFEVACCVLFGVDDEVIIKGLMSDFAVAF KAFWSIPINLPGTNYTRGLAARKRIVEKILPIIKKKKEELANGTLSPRNDVIACFLSIGG ENVVPLSDLEIIDNFIFLMIASHDTAANLSSMMIWKLARDKQIYDKIREEHLGILAQRQG GDETLTWVEVNKMKYTWSVAQELMRVIPPLFGNFRTTTADTSFAGFDLPKGWQVFWVACE THMDKNFFEDPTTFDPSRFEAKKPIPPCTYIPFGAGMHQCIGNEYARVKTLTIVHHLVTR FEWSQVNPNEKIARQPLPYPSTGLPIKLISKPAL*

 

>22030061 Aquilegia coerulea|Aquca_004_00235|Aquca_004_00235.1

CYP728H 55% TO CYP728H1   soybean

MVNSLVESFMDMPPLVLVAITIASSLFLYLLFKKDYRGYNLPGGSLGFPLIGESISFLRA QLQDRGDQWIHDRVLKHGPVFKTHMMGSPTFVITGQPGNKFVFGADYDIMSAKPPKTLAI VAGEYSLSDLPKPRYLLVKQGMVSFLKAESLQHHVKHMDRLIKASLLRESKDRDVVQAVQ FMKNLTFEVACCVLFGVDDEVIIKGLMSDFAVAFKAFWSIPINLPGTNYTRGLAARKRIV AKILPIIQKKKEELANGTLSPRNDVIACFLSIGGENVVPLSDLEIIDNFIFLMIASHDTA ANLSSMMIWKLARDKEIYNKIREEQLSILAQRQGGDETLTWIEVNKMKYTWSVAQELMRV IPPLFGNFRTTTADTTFAGYDLPKGWQVFWVACETHMDKNFFEDPTTFDPSRFEAKKPIP PCTYIPFGAGMHQCIGNEYARVKTLTIVHHLVTRFEWSQVNPNEKISRQPLPYPSTGLPI

KLVSKPAVL*

 

>22030762 Aquilegia coerulea|Aquca_004_00234|Aquca_004_00234.1

CYP728-like

MVNSLLDSFLSMSPLVLVAVTIVSSLFLYVLFKKDYRGYNLPGGSLGFPLIGESISFLRA QLQDRGDEWIHERVLKHGPVFKTHMMGSPTFVITGQPGNKFVFGADYDIMSAKPPKTLAI VAGEYSLSDLPKPRYLLVKQGMVSFLKAESLQHHVKHMDRLIKASLLRETKDRDVVQAVQ FMKNLTFEVACCVLFGVDDEVVIKGLMSDFAVAFKAFWSVPINLPGTNYTRGLAARKRIV EKILPIIQKKKEELANGTLSPRNDVIACFLSIGGENVVPLSDLEIIDNFIFLMIASHDTA ANLSSMMIWKLARDKQIYDKIREEHLDILAQRQGGDEILTWVEVNKMKYTWSVAQELMRV IPPLFGNFRTTTADTSFAGYDLPKGWQVFWVACETHMDKNFFENPTTFDPSRFEAKKPIP PCTYIPFGAGMHQCIGNEYARVKTLTIVHHLVTRFEWSQVNPDEKIARQPLPYPSTGLPI

KLKSKAAQ*

 

>22063831 Aquilegia coerulea|Aquca_074_00092|Aquca_074_00092.1

CYP729

MEIIQQWWLAVVFGVLPLLVWLFWSWNELRFITPHRAHHSGSNKLPPGSMGLPFVGEMLT FLWYFKIVGQPDEFIESKRRRYGDGVGMYRTHLFGSPAIIGCSPAFNKFVFQSHDLFPLK WPSIELLGHNSLVGVSGKPHTRLRTYVTNAINKPDALRKVCKMVQPQIVSSLRSWVDKGK VKALVEVKKVTFENIGNMFVSFKPGPKLDMLDKLFIGLVGGVRAQPSNIPGTAYYHAVQC RKKLTAVFRKELEKRKLTSNLVSEEKNDLMEGLMNMRDEEGKILGDEEVLDNIVSLVIAG YESTSLASTMALYYIAKSPHVLEKLREENMALARKDEFITSEKLALLKYTNKVVDETIRM ANIAPFIFRYAKDDVKYQGHKIPKDWRIILWIRYLHTDPNNFNDPMNFNPDRWDVPAKPG TYQVFGGGPRICPGNMLAKIQIAIFIHHLVTGYKWELINPDAKMMYLPHPKPVDGVEISF

STI*

 

>22063884 Aquilegia coerulea|Aquca_074_00072|Aquca_074_00072.1

CYP729

HSSSTKLPPGHMGLPFIGELLTFLWYFKIVSRPDDFINSKRERYGNGVGLYRTYLFGSPS IIGCSPAFNKFVLQADDLFANKWPSEELSGHNSLVVVDGKAHTRLRTYVINSINRPDALK KIAIMVQPRIISSLCSWAEKGRVKGLDEVKKVTFENICNMFVSFKPGPMLDRMDQHFKGL LAGIRAQPVEILGTAYYHGLQCRKKLMAIFREELEQRHKKTSEDKNDLMEGLMRIRDEEG KLLGDEEVLDNILGLVVAGYQSTSLASMWALYYLAKHPNVVQKLREENLAINKTGEFITT EDIARLKYTNKVIEETIRMANIAAFIFRTVQKDVDYKGYKIPKGWNVILWIRYLHTDPKN FEDPMSFNPDRWDKSPKAGTYQVLGGGPRICAGNMLARIQLAILLHHLVTGYKWELINPE AKIMYLPHPRPVDGVEIAYSAL*

 

>22063933 Aquilegia coerulea|Aquca_074_00071|Aquca_074_00071.1

CYP729

MDYYTQSWWLGVVFGVVPLLAWTVWSWNELWFITLKRKAHSSSTKLPPGHMGLPFIGELL TFLWYFKIVSRPDDFINSKRERYGNGVGLYRTYLFGSPSIIGCSPDFNKFVLQADDLFAN KWHSEELFGHNSLVVVDGKAHTRLRTYVINSINRPDALKKIAIMVQPRIISSLCSWAEKG RVKGLDEVKKVTFENICNMFVSFKPGPMLDRMDQHFKGLLAGIRAQPVEIPGTAYYHGLQ CRKKLMAIFREELEQRHKKTSEDKNDLMEGLMRIRDEEGKLLGDEEVLDNILGLVVAGYQ STSLASMWALYYLAKHPNVVQKLREENLAINKTGEFITTEDIARLKYTNKVIEETIRMAN IAAFIFRMVKKDVDYKGYKIPKGWNVILWIRYLHTDPKNFEDPMSFNPDRWDKSPKAGTY QVFGGGPRICAGNMLARIQLAILLHHLVTCYKWELINPEAKIMYLPHPRPVDGVEIAFSA L*

 

>22063937 Aquilegia coerulea|Aquca_074_00090|Aquca_074_00090.1

CYP729

MGLPFIGELLTFLWYFKIVGQPDEFIESKRRRYGDGVGMYRTYLFGSPAIIGCSPEFNKF VFQSHDLFPVKWPTIELFGHNSLAGVSGKPHTRLRTYVSNAINKPDALRKVCKLVQPHIV SSLRSWADKGKVKALDEVKKVTFENIGNMFVSFKPGPMFDVLDKLIVALVEGVRAQPLKI PGTAYYHAFQCRKKLAAVFREELEKRKRTSNLVSEKKSDLMEGLMNMTDEEGKLLSDEEV LDNIVTLVIAAYDSTALAITMALYYIAKSPHVLKRLRVVDETIRMANVNPFTFRYAKDDV NYQGFKIPKNWQIMLWIRYLHTDPKNFDDPMNFNPDRWDVPAKPGTYQVFGGGARICPGS

MLAKMQIAIFIHHLVIGYKWELKNPNAKIMYLPNPKPVDGVEISFSTL*

 

>22029977 Aquilegia coerulea|Aquca_004_00679|Aquca_004_00679.1

CYP729

MSSGSYIALKRKAHSSSTKLPPGHMGLPFIGELLTFLWYFKIVSRPDDFINSKLERYGNG VGLYRTYLFGSPSIIGCSPAFNKFVLQANDLFANKWSSEELFGHNSLVVVDGKAHTRLRT YVINSINKPDALKKIAIMVQPRIISSLCSWAEKGRVKGLDEVKKVTFENICNMFVSFKPG PMLDRMDQHFKGLLAGIRAQPVEIPGTSYYHGLQCRKKLMAIFREELEQRHKKTSEDKND LMEGLMRIRDEEGKLLGDEEVLDNILGLVVAGYQSTALASMWALYYLAKHPNVVQKLREE NLAINKTGEFITTEDIAKLKYTNKVIEETIRMANIAAFIFRTVKKRCYKIPKGWNVILWI RYLHTDPKNFKDPMSFNPDRWDKSPKAGTYQVYGGGARICAGNMLARIQLAILLHLLVTG YKWELINPEAKIIYLPYPRPVDGVEIAFSAL*

 

>22023077 Aquilegia coerulea|Aquca_023_00108|Aquca_023_00108.1

CYP733A

MELSSLLILVIIVLGLSTVLLLHSWFGSRTLGRIPGSMGLPIVGESFSFLSDFSSPSGIY SFMNKRQERYGKVFKSSVLGRFTVFMTGREAAKKLLAGTDGMVSLNLFYTGKQVLGPTSL LQTTGEAHKRLRRLIAEPLSIDALKKYFQFINTVAVDTLDQWPGRTVYVLEEASTFTLKV IGNMIMSLEPSGEEQEKFRANFKVISSCFASLPFKIPGSAFYRGIQARDRMYTMLDSIIS QRRSGNNFQMDFLQSLLKKHSKEQAGDDGEDKLTDTQLKDNILTLLVAGHDTTTAALTWL IKFLGENPTILENLREEHKGIQESRGGGSSLTWLEVSHMPYTNKVVSETLRRATILPWYS RKAAQNFEIDGYQIKKGWSVNLDVVSIHHDPEIFPDPEKFDPSRFDEPLKPFSFLGFGSG QRMCPGINLAKLEISVFIHHLVCKYKWRPLESDESVQPTLVRMPKNKYPIIVEQF*

 

>22043292 Aquilegia coerulea|Aquca_001_00765|Aquca_001_00765.1

CYP734A

MVMMELCWFWLFVLSSILLLFVFKVLGFLWLRPKRIVEHFSKQGITGPPYHFFLGNIKEL VGLMLKASSQPMPLSHNILPRVFSFYHHWKKIYGATFLVWFGPTPRITVADPDLIREIFG SKSEFYEKNESHPLVRQLEGDGLLSLKGEKWAHHRKIITPTFHMENLKMLIPVMGKSAVE

MMDKWSDMAGSGDLDIDVSDWFQTLTEDVITRTAFGSSYEDGKAVFRLQAQQMMLAAEAF SKVFIPGYRFIPTKKNRCSWNLDKQIKKSLIKLIEQRNNANDSEQMSKGCPEDLLGLMIK ASKKEKKSNSCTSSITVQDIVEECKSFFFAGKQTTSNLLTWTTILLAMHPEWQDLAREEV LKVCGSRDIPTKDDVVKLKTLSMILNESLRLYPPAVATIRRAKADVDLGSYKIPRGTEVL IPIIAVHHDIELWGRDATEFNPARFSEGVARAAKHPMSFIPFGLGARTCIGQNLAILQAK LAIAIILQRFTFRLSSSYQHAPTVLMLLYPQYGAPITFQCLKDPTNPRDHDS*

 

>22056216 Aquilegia coerulea|Aquca_026_00287|Aquca_026_00287.1

CYP735A

MVVLLGLLVILLCFFIRLAYTTLSCYWLTPRRIKKVMQKQGVYGPKPRLLVGNLIDVASL VSMATAKDMDSIHHDIVSRLLPHYVLWSKQYGKRFIYWVGNEPRICLTETDVIRELLSSK YTNLCGKSWLQQQNSKHFIGRGLLMANGEDWYHQRHIVAPAFMADKLKSHVGYMVECTKQ

MLQSLKSKVESGTTEVEIGDYMSQLTADIISRTEFDSSYEKGKRIFDLLTSLQTLCAQSS RRLCLPGSRFFPSKYNREIKSLKMEVERLLMEIIQSKKDCAEIGRSTSYGNDLLGMLLAE TQKKRANGFNFNLQLLMDECKTFFFAGHETTALLLTWTIMLLATNPSWQDKIRAELSQVC KGETPSPEQLSKLTVLNMVINESLRLYPPASLLPRMAFEDIKLGELEIPKGLSIWIPVLA VHHSKELWGEDVHKFKPERFAGIGKSYAPGLNFMPFAAGPRNCVGQAFALMESKIILAML ISRFSFTISPNYRHAPIIVLTLKPKHGVQICLKPLHP*

 

>22038841 Aquilegia coerulea|Aquca_028_00104|Aquca_028_00104.1

CYP736A

MELARNVVIFFSVLAGLFSFFFHLLSLRIKNGIKRRLPPSPWGLPILGHFHMLGDLPHRN LHRLAKKYGPIMSIRLGQVPTIVISSSEWAELILKTHDVVFASRPKNQAADWTLYGQRDL VFAQYGSYWRNIRKLCTIELLSRSKAELFKPMRREELLNLVELMKNASDSQSTIDVSAKV ESLVEDMTYRMVLGFKDDRFNIRPSIQEHVVLVGAFNLADYFPCLRVLDLQGLGRRMKAC HNVLDEFLEKFIDEHLRDAKELQVQHHRDFIDVMLSLMESNNTREMHLELDHIKAILMNM LAAGMDSSSTAIEWVIIELIKHPRVMKLVQEELETVVGLDRMVEESDLIKLSYLKLVIME SMRIHPINPMLVPHESTDDITINGYFIAKKSIVLINIWAIGRDPNVWSSNAEEFYPERFV DMNIDIHGQNFQFIPFGSGRRKCPGLHLGFTVVHHVVAQMVHCFNFELPNGMLPHDLDMT DKFGLTLKRANHLVAIPTYRLRN*

 

>22049896 Aquilegia coerulea|Aquca_003_00032|Aquca_003_00032.1

CYP736A

MLLFFFLALAWIWSKNYSKRLPPSPLALPILGHLYFWFWPDFLPRTLLKLSKKYGLMYLR IGAVPIIVVSSPDITELLMKTQDPAIACKPTAQISKYMFYGGKGIASAKYYEPYWRVGRK VSIIHLLANSKFDLFKPVRRYEVGHLIAFLKKEPEDRQVVDISSKVTLLIENIIYKMIFG GRNISKSLKFKKTWREGMRLGAAFNLAGYMPYIGAFDLQVQLHICAIICSNQPCFFRLTC RWKDLSTVIDEYLEKIINEVEQETTETKEHFRSFINVLISLMKSDNTNEEKLDRDQVKAI ILELIVASIDTTVATIEWTLSELLRNPLVLKRVQEELANVIGLDCQQVEEIDLAKLDYLE KVMKESLRLHPVAGIILRKATEDISIKNFNIPKKMLFVVNSWALGRDPAVWPEKTEEFYP ERFINIDIDIRGRDKKLLPFGAGRKRCPGMEPGLRITKLVLAQLVHCFDWELPDGMSPRD LDMKEKLGITVSRANPLLAVPTFFFL*

 

>22052661 Aquilegia coerulea|Aquca_002_01136|Aquca_002_01136.1

CYP736A

MEGFAHLTTFNWIGILLSLLLALAWLLSKNNSRSSPPGPLGLPIIGTLHLLGDLPHQTMR KLSQKYGPIMKLQIGNVPVVVVSTVEAAELFLKTNDKIISSKPTAQVSKYMSYGSKGIVS AEYGPYWRNIRKLCIVHLLSVSKVDSFRPIRKEELRHLIKDLREAAKDREGMTRRWKIVS KLMDEFLDKIVDDYEQNPTEQEEHHGGFIDILLSLMKSNNTQEDRLDRTEVKATSLEILA AAMDTAIISIEWVFSELLRHPQVMEKVQEELANVIGLDRLVEEIDLAKLNYLDMVIKESM RLHPPTGLMWRKPIEDMRVNNFYIPKKTWICINTHAISRDPVAWPENPEEFHPERFLNTK IDLRGHDMQLIPFGSGRRKCPGLELGLRTVQLVLAQLVHCFNWELPDGMSPVDVDMKEAY GLTISRATPLLVRPTYRLHIHNI*

 

>22054013 Aquilegia coerulea|Aquca_002_01135|Aquca_002_01135.1

CYP736A

MESFAYLTTFNWVGILLSLFLAFAWLWSKNNNSKSSPPGPLGLPIIGTLHLLGDLPPRAM RKLSQKYGPIMKLRIGRVPVVVVSTPEAAELFLKTNDKIISSKPTAQVSKYMSYGSKGIV STEYGPYWRNIRKLCTVHLLSVSKIDSFRPTREEEVRHLIKDLREAAKSREVVDIGKKLG LAVEEMTYRMIFGDHRKHITESFKFKPCVQESLKLAGAFNFADFLPFIGIFDPQGMTRRW KIVSKLMDEFLEKIIDEYEQNPTEQEEHHGGFIDILLSLMKSNNTQENKLDKTEVKANAL EILAAGIDTSAISVEWVFSELLRHPQVMEKVQEELTNVIGLDQLVEETDLAKLNYLNMVI KESMRIHPINGIMWRKSIEDMTINNFYIPKGTWICINIHAINRDPVAWPENPEEFHPERF VNTDIDFRGHDMQLLPFGSGRRKCAGMELGLRTVQLVLAQLVHCFNWELPDGLSPADVDM KEVYGLTITRATPLLVRPTYRLRVHNS*

 

>22053814 Aquilegia coerulea|Aquca_002_01134|Aquca_002_01134.1

CYP736A

MIFGDRKISFKFKPSIQESLWLAGAFNLADFIPFLGAFDPQGMTHRWKHVRKIMDQCLEK IINEYEQNTIEQQDCLGGFTNVLLSLMKADSNTQELKLDRSQVKAITLEILAAAMDTSAS TVEWALSELLRHPRAMKNFKKKEADLEKLDYLNMVVKETMRLHPVTAIYLRESTDDIAIN NFHIPKKTWIMINNWAISRDPVAWAEKTEEFYPERFINANLDVRGQDMKLLPFGSGRRKC AGMELGIKTVQLVLAQVLHCFTLELPDGMSPRDVNMKDIFGLTVPRADHLLVVPNYLLHI

TNI*

 

>22056044 Aquilegia coerulea|Aquca_026_00266|Aquca_026_00266.1

CYP736 54% TO CYP736A1 Pyrus communis (pear)

MIIFALLLVGLYSFYYLLPLSLRSKNGQVLPPSPLGLPLLGHLHMLGEFPHRNLARLAKK YGPIMFIRLGLVPAVVVTSPEAAELFLKTHDVVFASRPKIQVADCLSYGQKNLGFAQYGP YWRSIRKLCTIELLSSSKIELFKPLRREALFNCVKAMKNASESRSVVDVTVKIESVIEDS TYRMICGSKDERFNIMPSLREGLKLGGTFNVGDFIPCLGAFDLQGLTARMKACNVVLDGF LETIIDEHVRDAKKLQGQHRDFIDVMLSLMEFNNTRELHLDRDHIKAIVLDMLAAAMDTS STAIEWVIAELLKNPRVMKLVQEELENVVGLERMVEETDLIKLSYLKLVIMESMRIHPVA PLLIPHESTEDITINGYFIPKKCRVLINTWAIGRDPNVWSSNAEEFYPERFIGTTIDIQG HEFQFLPFGSGRRKCPGLQLGMIVVQIVVAQLVHCFNLELPEGMSPNDLDMSEKFGLTLP RAKHLLAIPTYRLRNSL*

 

>22056239 Aquilegia coerulea|Aquca_026_00269|Aquca_026_00269.1

CYP736 54% TO CYP736A1 Pyrus communis (pear)

MESWLVVVFFAVLTGLYSIFYLLSSSYKKGLHHRLLPPGPLGLPLLGHLHLLGELPHRNL QRLAKKYGPIMTLRLGLIPTMVVSSPEWAELFLKTHDMVFASRPKSQAAEYMSYGQKNLV FSQYGSYWRNIRKLCTLELLSNSKIELFKSMRSEELSNFIELIKNASESRSIIDITAKVE SLLEDMTYRMVFGFKDDKFNIKSCLQEVVMLTGTFNVSDYIPSLKALDLQGLGRRMKACS KVLDKFLEAIIDEHVRDAKELHGQHRDFIDVLLSLMESNNTRELYLDRDNIKAIMIDMLA AAMDTSSTAIEWVIAELLKHPHVMKLVQEELENIVGLDRMVDETDLTKLSYLKMVIMETM RIHPVAPLLIPHESTEDVTINGYFIPKKSRVIINAWAIGRDPNVWSSNAEEFYPERFIDT NIDVQGRDYQFLPFGSGRRKCPGIQLGMTVVQLVVAQLLHCFNLELPEGMSPDDLDMNEK FGLTLPRSNHLRAVPTYRLRMNL*

 

>22062442 Aquilegia coerulea|Aquca_016_00204|Aquca_016_00204.1

CYP736

MVVSSPEYAELFFKTHDTVFASRPKLQIIQCIWYGQKGVIFLCTIELLSSSKIEAFKSMR VEEVLKILKSIKSASESQSMIDVSAKVQSLLENMTYRMIFGFKDDRFSSIKPTIQEALEL VGAFNVADCIPWLRAFDLQGLHRDFIDVMLSLMASDNTRDIHLDQENMNAILLDDIIAAA

MDTKSMSIEWIITELVRHPGVMKLVQEELETIVGLDRLVEETDLIKLSYLKIVIMESMRL HPSAPLLLPHESTEDITINGYLIPKESRVVINTYAIGRDTKVWSSNAEEFYPERFSGTNI DVQGHDFQLLPFGSGRRKCLGIQLAMVVAQLVHCFNLELSNGMSPDDLDITEKFGATLPR ANHLMAMASYRLLYFVTVVGQR*

 

>22051773 Aquilegia coerulea|Aquca_002_01133|Aquca_002_01133.1

CYP736

MLGFRQIPMFSWVGLLSIVCVGILSLIYILHTFFRNKSSSLQLPPGPFGLPIIGHVHHML GDLPHHNLHKLSQKYGSIMQLRLGHVPTVVVSSPEAAELFLKTHDTNFASRPQNLGGDTG GMGSAQYGPYWRNLRKLCSIHLLSMSKVDSFKSLRKDKVRDLVRNINKASSAESAEGGGV VDMSNQVGLVIENITYGMIFGVDYINKGYNIKECIRDAEILAGAFNLADYITFLRPFDLQ GLTKRTKDVIKNLDDMLEKIIVEHEHDMIGQQKDHRDFIDVMLSLMKPEKDNEEKLDRGT VKALTLDMLAGAMDTTITAIDWVLAELVRHPQVMKKIQEELVNEVGLNRMVEESDLVKLA YMEMVVKETLRLHPVAPLLIPHESIEDISIKGYHIAKRSRIIVNVWSVGRDPNAWSNNPE EFYPERFMNTDIDVRGHDLQLIPFGAGRRKCPGIELGLRQVQFVLAQLVHCFNWELPDGM SPRDLDMKEKFGVTVRRAIPLLLVPTYRLHVNNI*

 

>22055675 Aquilegia coerulea|Aquca_026_00285|Aquca_026_00285.1

CYP736 56% TO CYP736A1 Pyrus communis (pear)

MESWFAVIFFAVLAGLYFFFHLLTVLLRPKNGYPGKLPPGPVGLPLLGHLHMLGDHPPRN LQRLAKEYGPIMFIRLGLIPTMVVSSAKAAELFLKTHDAIFASRPTLQVADLISYGQKNL IFAKYGSYWRNIRKLCTIELLSSSKIEMFKPMRREEVLGFVQSVKIASDSQSMIDVSLKI QSLIDGMTYRMIFGFKDHRFNIKSSIQESVALAGAFNLADYIPFFRALDFQGLGRRMKAC HKVLDEFLEKIIDEHERDDKYLQGEHKDFIHVMLSLMKSNNTRELHLDRDNIKAIILDMI GAAMDTSSTAIEWVIAELLKNPRVMKLVQEELENVIGLERMVKETDLIKLSYLKMVIMES

MRIHPVAPLLIPHQSIEDITVDGYFIPNKSIVLINAWAIGRDPNVWSSNVDEFYPERFIG TTIDVQGHDFQLLPFGSGRRKCPGMQLGLTVAQLVLAQLVHCFNLALPDGMSPEDLDMTE KFGLTLPRANHLMAIPTYRLRMNL*

 

>22055775 Aquilegia coerulea|Aquca_026_00284|Aquca_026_00284.1

CYP736

MQTEPIRTENKHPRVMQLVQQELENVVQPPKNGRLPPGPLGLPLIGHLHMLGELPHRPLR RLAKKYGPIMSIRLGSIPTMVVSSPEWAELFLKTHDTVFASRPKLQVADCISYGQKNMGM AEYELLSSSKIQSFMPTRREELFNFVKSMKIASDSQSMIDVGAKTQSLVEQMAFRMIFGF KDGRFNFMSSIQELLELGGAFNVGDYIPWLKALDIQGLVRRMKACSKVIDGFLETIIDEH VQDTKELQGQHMDFVHVMLSLMESNNTRELHLDRDHIKAIMIDILAAAMDTSSTAIEWVI AELLKHPRVMKLVQEELENIVGLERLVEETDLNNLSYLKMVVMESMRIHPVAPLLIPHES IEDITINGYFIPKKSRVLINTWAIGRDPNVWSSNAEEFYPERFIGTSINVQGHDFQFLPF GSGRRMCPGLQLGMTVVQLVLAQLVHCFHLELPNGMSPDDLDMTERFGLTLPRANQPIAL

VSTYNVNL*

 

>22037530 Aquilegia coerulea|Aquca_012_00271|Aquca_012_00271.1

CYP736 CLUSTER Z

SSACLACLWSLWYLFRSLKARKGKNGLLGLPPGPMGLPLLGHLHMLGDHPHRNLQKMAEK YGPIMFLKLGVVPTVVVSSPEWAELFLKIHDTNFASRPQMQALKFMSYGQKNLAFAQYGP YWRNIRKLCTIELLNSSKVESFRPMRREVLSNFIKSIVHTGKLGGPINVSAMVESLIQEM TYRMIFGSKNDRFDFKAALQEGLKLVGVFNLADYIPYIGALDLQGLGRRMKAISKVLDGY LEKIIDEHEHDAKKLKGQHRDFIDVMLSLMKSNNNTRELHIERDNIKAIVLDIFAAAMDS SSIAIVWAISELQKHPRVMKLVQEELERVVGLERMVEETDLDKLCYLKLVVMESLRLHPA PILVPHESIEDITLNGYFIPKKSTVIINNWAIGRDPNAWSSNSEEFHPERFIGTDIDIQG HNFQYLPFGSGRRKCPGMNLGMTVVQLVLAQMIHCFNLELPDGMSPDNLDMTETFGIAMP KTKHLMAIPTYRLCINLPLDV*

 

>22057700 Aquilegia coerulea|Aquca_068_00086|Aquca_068_00086.1

CYP736 CLUSTER Z

MLKKKRNNKRLINLPPGPKGLPILGNLLMLGEFPHRDLLRLSEEHGSIMYLRLGFIPTIV VSSPEAAELFLKTYDLIFASRPFNEAAKYISYERKGLSFSEYGPYWRNVRKLCTLELLST LKIESFKAMRREELGSFIESLKEASRAHLEVNLSAKVLALSTDMSCMMVFGKKYIHNDNK IGFHAVVQEGMQLAAIFNIADYIPYIGALDIQGLAKRMKAVSKVFDDMFEKIIDEHVHAG DKGHQRDFVDVMLSFMESKENEFQIDRSNIKAIILDMLVGSMDTSSTAIEWAFAELLKHP YVMKKVQQELERVVGLDKMVEESDLMSLEYLDMVVKESLRLHPVAPLLIPHESTEDCTVN GYYIPKKSRIIVNTWAIGRDPKVWDNPEKFIPERFIGSSIEYKGRDFQFLPFGSGRRGCP GMQLGLTMIKLVVAQLIHCFDWELPNGMLCTDLNMDEEFGLTMPRAKPLLVIPAYRLSN*

 

>22055940 Aquilegia coerulea|Aquca_026_00268|Aquca_026_00268.1

CYP736A 55% TO CYP736A1   Pyrus communis (pear) NEAR N-TERM

MAKKYGPIMSILLGLVPTIIVTSPEYAEVFLKIHDLNFASRPIIYAANYVSYRQKNLVFP QYGPYWRNICKLCTIELHSSSKIEFFKPIRREELVNFVESMNVAAKSGSVIDVSAKIESV

IEDITN*

 

>22056107 Aquilegia coerulea|Aquca_026_00267|Aquca_026_00267.1

CYP736 60% TO CYP736A1 Pyrus communis (pear)

MLNIADYIPYVGILDVQIFKDTSSTAIEWVIAELLKHPRVMKLVHKELESLLGLHRMVEE TDLSKLSYLKMVIMETMRIHPVAPLLIPHESIEDTTINGYFIRTNNAEEFYPGRFIGTNI DVQGHNFAFLLFGSGRRKCPRLQLGMTVVQLVVAQLVHCFSLELPEGMSPDDLDMTEKFG LTLPRANHLMAIPTYRLSALQ*

 

>22038811 Aquilegia coerulea|Aquca_028_00044|Aquca_028_00044.1

CYP749A almost the same as 22038725

ITTTTKILLSCFLFFYLLASLIKFFYTAWWKPIQIQKLLQAQGINGPSYRFFHGNTKDVL NMTKEALKSSLPNSSNDILPRVQPHIHLWTKLYGRTFLSWHGYRAELFVTEPDLIKDVLN NKPGVYMKSSPEKYILNMLGNGLVRTDGKNWFRQRKLANQAFHTENLNNMVPTMVCSVEE

MLEKWRDYEGKEIDVLKEFGVLTSDVLSKTAFGSSYLEGQKIFQMLSKLTSFVTSNAFKI DLPVIGKLLSYYQDQEADKVEKEIKESFMEIIRKRKEKKDTGELDDYGSDYLGMLINASE EDDDEKRISIDDMIDECKTFYFAGNETTMVFLTWVMFLLAIHTDWQDKARKEVLELFGEK HPSTKDNNMAKMKTMTMIMNETLRLYPPALSLRRIAPCQVRLGDILVPPYVHIVIPPLVS HCDPQIWGEDVHLFRPDRFAEGVTKAAKNTNAYLPFGMGSRVCVGSNFATIEVKLALSMI LQRYAFTLSPSYVHSPFQSITTHPQYGVQIVLHSL*

 

>22038725 Aquilegia coerulea|Aquca_028_00046|Aquca_028_00046.1

CYP749A almost the same as 22038811

MDAASITTTIILLSCSLFIYLLASLIKFFYTAWWKPIQIQKLLQAQGINGPSYRFFHGNT KDVLNMTKEALKSSLPNSSNDILPRVQPHIHLWTKLYGRTFLSWHGYRAELFVTEPDLIK DVLNNKPGVYMKSSPEKYILNMLGNGLVRTDGKNWFRQRKLANQAFHTENLNNMVPTMVC SVEEMLEKWRDYEGKEIDVLKEFGVLTSDVLSKTAFGSSYLEGQKIFQMLSKLTSFVTSN AFKIDLPVIGKLLSYYQDQEADKVEKEIKESFMEIIRKRKEKKDTGELDDYGSDYLGMLI NASEEDDDEKRISIDDMIDECKTFYFAGNETTMVFLTWVMFLLAIHTDWQDKARKEVLEL FGEKHPSTKDNNMAKMKTMTMIMNETLRLYPPALSLRRIAPCQVRLGDILVPPYVHIVIP PLVSHCDPQIWGEDVHLFRPDRFAEGVTKAAKNTNAYLPFGMGSRVCVGSNFATIEVKLA LSMILQRYAFTLSPSYVHSPFQSITTHPQYGVQIVLHSL*

 

>22036256 Aquilegia coerulea|Aquca_006_00399|Aquca_006_00399.1

CYP749A

MGMEALIVLILASLSLYFLLRLIKFFYKVWWYPKVLQKLLSSQGIKGPSYQLLHGSTKEA LKMTRESMKSPMKLTHNILPRVQPHIHLWTKLYGRNFLSWHGYQAQLVVTEPDLIKEVLT NKTGVYQKVRPDDIAKNLFGDGLVMAQGTKWSKQRKLATHAFHIENLKGMVPTMIGSVEN

MLQRWEYHESKEIEVLKEFRILTSDVIAKTAFGSNYLEGQKTFDMLTKLTSIVAGNTLKI GLPLIRKFLKSNDSREAEKLKHDIRKSFEQIIIRRKEKFETFEADGYGSDYFGLLLTANQ SNDENKRISIDDVIDECKTFYFAGHETTMSLLTWTMFLLAIHTDWQEKARKEVFDIFGEK HPHTEDNSFAKMKTMTMIINETLRLYPPAPLVRRTVTCQTRLGEILLPQGIEVVVPNLVS HGDPQIWGEDVHFFKPDRFAEGVTKAAKNTSAYMPFGMGPRICVGSNFASIEVKLTLSMI LQRYAFTLSPSYVHSPFLHIFVCPQHGVQLNFHAL*

 

>22036737 Aquilegia coerulea|Aquca_006_00400|Aquca_006_00400.1

CYP749A

MEKVEIQMLKYYMLTIRFKQSCYFTESENETCLSRIVYVQGMAPTIVSSVNNMLERWGYH EKKEIEVLEEFRILTSDIISKTAFGSNYLEGQKIFDMLTKLTSIIAANDLKVKLPLIGNF

MKSSDGILAEKLEHRIRESFIQIIERRKEKIQTEESNGYGSDYLQLLVNANQDNDENKRI SIDDMIDECKTFYFAGHETTMSLLTWTMFLLAIHTDWQEKARKEIFDIYGDKKPNTEDLN IAKMKTMTMIISETLRLYPPVLTLRRTVASEVKLGDILLPPGIEIVIPPLVSHSDPHIWG EDVHLFKPERFSEGVINAAKNTNAYLPFGMGPRICVGLNFATIEVKLTLSMILQRYAFTL SPSYVHSPVQHMFIRPRHGAQIIFHKL*

 

>22036623 Aquilegia coerulea|Aquca_006_00401|Aquca_006_00401.1

CYP749A

MKSPMPTLSNDVLPRVQPHIHLWTKLYGRNFLGWHGYRAELFVTKPDLIKEVLNNKNGLF IKAHPDKYTFKLLGNGLVIAEGKNWNRQRKLANHAFHIENLKNMVPTMAGSVENMLEKWG YHEGKEIEALEEFRVLTSDVITKTAFGSNYLEGEKIFDMLTKLTSILNANVFNIELPVIG KFLNYKSDNELEKVEKEIKESFMQIIRKRKEKKNTGELDDYGSDYLGLLINANQENDEEK RISIDDMIDECKTFYFAGQETTMGLLTWAMLLLATHTEWQEKARKEVFDIFGEKHPNTEN SSMAKMKIMTMIMNETLRLYPPALNLRRTVSCEVRLGEILLPPNINIIIPPLVSHNDPQI WGEDVHLFRPDRFAEGVTKAAKNTNAYLPFGMGPRNCVGSNFATIEVKVALSMILQRYAF TLSPTYMHSPIQYITVRPQHGVQIILHPL*

 

>22033487 Aquilegia coerulea|Aquca_110_00053|Aquca_110_00053.1

CYP749A

MNSQGIKGPSYKFLHGNTKQVFNMTRNCLRSPMKLTNCIFPRVQPHLHLWTKTYGLNFLI WHGSIPQLSLNQPDLIKEVLNNGNELLYPKPEPYPYLKKLLGDGLATIRGGKKWSKKRKL VNHAFHGENLKNMMPKMVSCIENMLQRWEHLDGKEIEVLEEFRVLTSDVISKTAFGSNYI EGREIFGMLTKLMSIMAANTNKIKLPIIGKFVKSSDEREADKLALKIRESFVEIIRRRQE QIPNGELTGYGSDFLGLLVDANRDSDEDKRISVDDIIDECKTFYTAGHETTMVLLTWTMF LLAIHSDWQEKARKEVFAIFGEKPPNVEENSIAKLKTMTMIVNESLRLYPPVLVLRRITD HQVRLKDILLPPNMEIQISPLLCHSDPQFWGEDVHLFKPDRFMEGVANAAKTTNVYLPFG IGPRMCVGMNFATIEAKLALSMILKRYSFTLSPSYVHSPIQHVTTRPQHGVQIILHAL*

 

>22037368 Aquilegia coerulea|Aquca_012_00154|Aquca_012_00154.1

CYP749A

MLSVVAYIAILIPSFLLIQFFYKAWWKPIRIQKRMRAQGIKGPSYNFLHGNTKEVQDMKI EATKTTLPTLSNEILPRVQPHIYLWTKLYGRNFLSWHGDRAELHVTEPDLIKEVLLNKNG VYKKSVGEKYMHKVMGDGLGIAEGKKWMTQRKLANHAFQIEKLKHMVPTIVGSVQNMLEK WSYHEGKEIDVHEEFRILTSDVLSKTAFGSSYVEGQKIFEKLGRLLSLVTANNLRVDLPI IGKLLNYYTNSEADELEKEIRESFMQIIRKRIEKKDSGELNYYGSDYLGLLVAANQETDE EKKVTIDTLIDECKTAYFAGQDTTMALLSWVIFVLAIHTDWQEKARKEVFDLFGDKHPTT SDNNLAKMKIMTMIVNETFRLYPPALTLRRLVPCEVRLGKILLPPQSHIVIPTLVGHTDP QIWGEDVHVFRPDRFAEGVAKAATNTNVFLPFGMGPRICVAQNFAGTEAKLALSMILQRY SFSLSPSYVHCPIQSFSVFPQQGIPIIIHKL*

 

>22037381 Aquilegia coerulea|Aquca_012_00153|Aquca_012_00153.1

CYP749A17

MVSVVAYIAILIPSFLLIQFFYKAWWKPIRIQNRMRAQGIKGPSYNFLHGNTKEVQDMKI EATKTTLPTLSNEILPRVQPHIYLWTKLYGRNFLSWHGDRAELHVTEPDLIKEVLLNKNG VYKKSVGEKYMHKVMGDGLGIAEGKKWMTQRKLANHAFQIEKLKHMVPTIVGSVQNMLEK WSYHEGKEIDVHEEFRILTSDVLSKTAFGSSYVEGQKIFEKLGRLLSLVTANNLRVDLPI IGKLLNYYTNSEADELEKEIRESFMQIIRKRIEKKDSGELNYYGSDYLGLLVAANQETDE EKKVTIDTLIDECKTAYFAGQDTTMALLSWVIFVLAIHTDWQEKARKEVFDLFGDKHPTT SDNNLAKMKIMTMIVNETFRLYPPALTLRRLVPCEVRLGKILLPPQSHIVIPTLVGHTDP QIWGEDVHVFRPDRFAEGVAKAATNTNVFLPFGMGPRICVAQNFAGTEAKLALSMILQRY SFSLSPSYVHCPIQSFSVFPQQGIPIIIHKL*

 

>22037403 Aquilegia coerulea|Aquca_012_00150|Aquca_012_00150.1

CYP749A

MLSVVAYIAILIPSFLLIQFFYKAWWKPIRIQKRMRAQGIKGPSYNFLHGNTKEVQDMKI EATKTTLPTLSNEILPRVQPHIYLWTKLYGRNFLSWHGDRPELHVTEPDLIKEVLLNKNG VYKKSVGEKYMHKVMGDGLGIAEGKKWMTQRKLANHAFQIEKLKHMVPTIVGSVQNMLEK WSYHEGKEIDVHEEFRILTSDVLSKTAFGSSYVEGQKIFEKLGRLLSLLLNYYTNSEADE LEKEIRESFMQIIRKRIEKKDSGELNYYGSDYLGLLVAANQETDEEKKVTIDTLIDECKT AYFAGQDTTMALLSWVIFVLAIHTDWQEKARKEVFDLFDDKHPTTSDNNLAKMKIMTMIV NETFRLYPPALTLRRLVPCEVRLGKILLPPQSHIVIPTLVGHTDPQIWGEDVHVFRPDRF AEGVAKAATKTNVFLPFGMGPRICVAQNFAGTEAKLALSMILQRYSFSLSPSYVHCPIQS FSVFPQQGIPIIIHKL*

 

>22037454 Aquilegia coerulea|Aquca_012_00149|Aquca_012_00149.1

CYP749A

MQHMVPTIVGSVQNMLEKWSYHEGKEIDVHEEFRILTSDVLSKTAFGSSYVEGQKIFEKL GRLLSLVTANNLRVDLPIIGKLLNYYTNSEADELEKEIRESFMQIIRKRIEKKDSGELNY YGSDYLGLLVAANQETDEEKKVTIDTLIDECKTAYFAGQDTTMALLSWVIFVLAIHTDWQ EKARKEVFDLFDDKHPTTSDNNLAKMKIMTMIVNETFRLYPPALTLRRLVPCEVRLGKIL LPPQSHIVIPTLVGHTDPQIWGEDVHVFRPDRFAEGVAKAATNTNVFLPFGMGPRICVAQ NFAGTEAKLALSMILQRYSFSLSPSYVHCPIQSFSVFPQQGIPIIIHKL*

 

>22036321 Aquilegia coerulea|Aquca_006_00402|Aquca_006_00402.1

CYP749-LIKE 48% TO CYP749A1v1 Populus trichocarpA

MIHIYGEKMFIFSGQIDLRKESPRLLKTPINAYLPFGMGPRNCVGSNFATIEVKLAFSMI LQRYAFTLSPSYFTTHPQHGVQIVLHAL*

 

>22037341 Aquilegia coerulea|Aquca_012_00148|Aquca_012_00148.1

CYP749 46% TO CYP749A1v1 Populus trichocarpA C-HELIX REGION

MKIEATKTTLPTLSNEILPRVQPHIYLWTKLYGRNFLSWHGDRAELHVTEPDLIKEVLLN KNGVYKKSVGEKYMHKVMGDGLGIAEGKKWMTQRKLANHAFQIEKLKVCLLL*