239 Arabidopsis sequence accession numbers not including ESTs or GSSs
last modified Jan. 17, 2001.  

The NR section of genbank was searched for P450 hits by TBLASTN using 11 P450 
sequences.  CYP71B9, 705A1, 77A4, 90A1, 96A1, 72A7, 74A, 51A2, 710A1, 97B3, 
711A1.  These represented all the P450 clans in Arabidopsis.  The output from 
each search was scanned for new accession numbers. The first search with 71B9 
did not find all the 71 clan P450s in Arabidopsis, so the CYP77A4 and 705A1 
searches were done to find these missing sequences.  After examining the missed 
accession numbers, it was found that these no longer contained P450 sequences 
for reasons described below.  Once these numbers were deleted from the list the 
71B9 sequence found all full length P450s in the 71 clan.  CYP90A1 found all 
full length members of the CYP85 clan.  It missed CYP87A3P.  This shows that 
some partial sequences and pseudogenes may have been missed by this search 
strategy.  The only way to be sure that all fragments are found is to search 
with a sequence from each of the 45 Arabidopsis families.  That is 34 more 
searches.  I felt the return on such an extensive search was likely to be very 
small, so I have not done it.   I did do five searches with families not found 
in Arabidopsis, CYP80, 92, 99, 719 and 723.  No members of these families were 
found in Arabidopsis.  

20 accession numbers for P450s have been withdrawn for several reasons.
Some of these were preliminary sequences from clones that were completed under 
another accession number.  Some overlapped another accession number and only one 
retained the sequence in the final version.  Some sequences were withdrawn from 
Genbank at the request of the submitter. One was a typo made by me.  A list of 
deleted accession numbers is given here. AC004481, AC004515, AC004665, AC004747,
AC006418, AC007045, AC007127, AC007168, AC007443, AC010926, AC013288, AC024226, 
AC027279 (my typo), AC069299, AC079655, AC079658, AC079672, AC079707, AC079732, 
AL031369.  


AB005237 (Chr V MJJ3) 90A1
AB005248 (Chr V MXI10) 709A1
AB005249 (Chr V MXM12) 75B1
AB007645 (Chr V K8K14) 81G1
AB007647 (Chr V MJB21) 74A
AB007648 (Chr V MKD15) 86B1
AB007649 (Chr V MLE2) 94B1
AB008097 (Chr IV) 90C1
AB009048 (Chr V K15E6) 85A1
AB010073 (Chr V MFB13) 89A3
AB010077 (Chr V MYH19) 77A8P
AB010692 (Chr V K18I23) 79A2
AB010697 (Chr V MOJ9) 93D1, 712A2
AB011485 (Chr V MXH1) 71B8
AB016885 (Chr V K19M22) 86A1
AB016889 (Chr III MDJ14) 71B15
AB016893 (Chr V MYH9) 78A7
AB017064 (Chr V MDN11) 705A5, 705A10P, 705A11P, 708A2 
AB017065 (Chr V MFC16) 71A17P
AB018112 (Chr V MAB16) 716A1, 716A2
AB019226 (Chr V K24M7) 96A4, 715A1
AB019233 (Chr V MJB24) 71B10, 81F2
AB020744 (Chr V K9E15) 707A3
AB022210 (Chr V K16E1) 71A16, 705A12
AB023038 (Chr III MIE1) 72A7, 72A8, 72A9, 72A10, 72A11, 72A12P, 72A13, 
             72A14, 72A15
AB024024 (Chr V K15C23) 706A3
AB024038 (Chr III MTC11) 71B3, 71B4, 71B16, 71B17, 71B18, 71B19, 71B20,
            71B21, 71B22, 71B23, 71B24, 71B25, 71B26, 86C2
AB025602 (Chr V F14A1) 79A3P, 79A4P
AB025623 (Chr V MJM18) 96A6P
AB026647 (Chr III MJL12) 82G1
AB026661 (Chr V T30G6) 81D1
AB036059 (Chr III F21F14) 78A9
AB046441 (Chr V T15D5) 94D3P
AC000098 (Chr I YUP8H12) 88A3
AC000103 (Chr I F21J9) 86C1
AC001229 (Chr I F5I14) 702A1
AC002304 (Chr I F14J16) 708A1
AC002329 (Chr II F5J6) 51A1 Genbank incorrectly lists this clone as being on Chr IV
AC002340 (Chr II T11J7) 71A12, 71A13
AC002388 (Chr II T13E15) 704A1
AC002391 (Chr II T20D16) 81D6, 81D7, 96A1
AC002409 (Chr II T20B5) 98A3
AC002561 (Chr II T24P15) 712A1
AC002986 (Chr I YUP8H12R) 79C1
AC003105 (Chr II F18A8) 72B1
AC003680 (Chr II F17K2) 76C1, 76C2, 76C3, 76C4, 704A2
AC004077 (Chr II T31E10) 710A1, 710A2
AC004136 (Chr II T8K22) 71B9
AC004146 (Chr I F5A8) 709A2
AC004411 (Chr II F14M4) 709B1, 709B2
AC004484 (Chr II T1D16) 711A1
AC004512 (Chr I T8F5) 96A3
AC005315 (Chr II T9I4) 707A2
AC005397 (Chr II T3F17) 86A8 
AC005405 (Chr V F18A17) 701A3
AC005623 (Chr II T20P8) 705A8, 705A9
AC005700 (Chr II T32F6) 88A4
AC005727 (Chr II F8N16) 710A3, 710A4
AC005819 (Chr II T3A4) 78A6
AC005824 (Chr II F15K20) 94C1
AC005861 (Chr II F23B24) 86A8
AC005897 (Chr II T10J7) 89A4
AC005964 (Chr V T11H3) 71A14, 71A15, 71B11, 71B12, 71B13
AC005967 (Chr II F27D4) 71B6
AC006193 (Chr I F13O11) 89A2, 89A5, 89A6, 89A7
AC006259 (Chr V F21J6) 71B11, 71B12, 71B13, 71B14
AC006341 (Chr I F3O9) 79F1, 79F2
AC006592 (Chr II F14M13) 79B3, 79B4P
AC006931 (Chr II F7D19) 718
AC007018 (Chr II F5G3) 705A6
AC007019 (Chr II F7D8) 96A5
AC007197 (Chr II T22C12) 705A13
AC007202 (Chr I T8K14) 79C1
AC007234 (Chr I F1E22) 702A1
AC007260 (Chr I T30F21) 708A3
AC007296 (Chr I F25C20) 51A2, 71A18, 77B1
AC007323 (Chr I T25K16) 78A8
AC007357 (Chr I F3F19) 71B2, 71B7, 71B27, 71B28, 71B29, 86C3, 86C4
AC007519 (Chr I F16N3) 96A7, 96A8
AC007651 (Chr I F20D3) 72C1
AC008051 (Chr I F19C14) 79C2, 79C3P, 79C4P, 79C5P
AC009895 (Chr III T21P5) 89A9
AC010155 (Chr I F3M18) 705A24
AC010164 (Chr I F14M2) 76C5, 76C6
AC010795 (Chr I F16M19) 87A3P
AC010797 (Chr III F28J7) 94B2 
AC011560 (Chr III F13M14) 77A6, 77A7
AC011622 (Chr I F24D7) 86A7
AC011664 (Chr III F1C9) 94B2 
AC011765 (Chr I F1M20) 98A8, 98A9
AC012396 (Chr I T9L24) 720A1
AC012561 (Chr I F11F12) 705A25, 705A26P, 705A27
AC013258 (Chr I F9E10) 721A1
AC013428 (Chr III F18K10) 77A6, 77A7
AC016662 (Chr I F2P9) CYP78A10 
AC018722 (Chr II F13D4) 82F1
AC023279 (Chr I F12K21) 94D1
AC023628 (Chr I F6F3) 703A2
AC024609 (Chr I F14P1) 722A1
AC025417 (Chr I T12C24) 87A2
AC025808 (Chr I F18O14) 722A1
AC025814 (Chr I F22H5) 721A1
AC026480 (Chr I F15E12) 96A14P
AC027656 (Chr I F21F23) 78A5
AC051629 (Chr I F6I1) 72C1
AC061957 (Chr I F22L4) 86A4
AC069553 (Chr V F18A12) 94D3P
AC073178 (Chr I F10D13) CYP704B1
AC073943 (Chr I F16M22) 79C2
AC074025 (Chr I F28G11) 81D10
AC079041 (Chr I F5M6) 97A3
AC079279 (Chr I F17J6) 705A25, 705A26P, 705A27
AC079678 (Chr I F9E11) 78A10
AC079730 (Chr I T8L23) CYP96A15
AC079733 (Chr I T8L23) 96A15
AF013293 (Chr IV IG005I10) 86A2 NOT MAPPED
AF044216 (Chr III T03A05) 90B1
AF047719 (Chr V) 701A3
AF047720 (Chr V) 701A3
AF047721 (Chr V) 701A3
AF068574 (Chr IV) 84A1
AF069495 (Chr IV) 79B2
AF069716 (Chr V F6A4) 71A14, 71A15, 714A1, 714A2
AF087932 (Chr IV) 74B2
AF149413 (Chr V T1N24) 701A3
AF155171 (Chr V) CYP75B1
AF172727 (Chr V) 74A
AF184820 (Chr I) 708A3
AF184833 (Chr IV) 81D5
AF184860 (Chr IV) 79B2
AF195115 (Chr IV F5I10) 86A2 same as AF013293
AF241643 (Chr V) 75B1 exon 1
AF241644 (Chr V) 75B1 exon 2
AF241645 (Chr V) 75B1 exon 3
AF241646 (Chr V) 75B1 exon 4
AF241647 (Chr V) 75B1 exon 1 mutant
AF245302 (Chr V) CYP79A2
AF267140 (Chr ?) 84A4
AF271649 (Chr V) 75B1
AF271650 (Chr V) 75B1
AF271651 (Chr V) 75B1
AF275259 (Chr I) 79F2
AL021635 (Chr IV T12H17) 706A1, 706A2
AL021636 (Chr IV F10N7) 82C2, 82C3, 82C4, 96A2
AL021687 (Chr IV T18B16) 707A1
AL021811 (Chr IV F10M6) 96A2
AL022141 (Chr IV F23E13) 84A1, 90C1
AL022224 (Chr IV F1C12) 71A27, 71A28
AL022580 (Chr IV T5K18) 707A1
AL035528 (Chr IV F18A5) 83A1
AL035601 (Chr IV F6G17) 81D2, 81D3, 81D4, 81D5, 81H1, 81D8, 81F1, 81F3, 81F4
AL035602 (Chr IV T29A15) 709B3
AL035708 (Chr IV T5J17) 79B2
AL049607 (Chr IV F11C18) 82C2, 82C3, 82C4
AL049608 (Chr IV T9E8) 71A19, 71A20
AL049659 (Chr III T29H11) 71A21, 71A22, 71A23, 71A24, 71A25, 71A26
AL078620 (Chr IV F23K16) 96A9, 96A10, 96A11, 96A12
AL080283 (Chr IV F3L17) 83A2
AL080318 (Chr IV T4C9) 706A4, 706A5, 706A6, 706A7
AL132958 (Chr III T4D2) 71B5, 71B30P, 71B31, 71B32 and 97C1 
AL132966 (Chr III F4P12) 71B30P, 71B31, 71B32
AL132969 (Chr III F8J2) 76G1
AL132979 (Chr III T3A5) 90B1
AL133315 (Chr III T8P19) CYP94B3
AL133421 (Chr V F13G24) CYP75B1
AL138642 (chr III F21F14) 78A9
AL161471 (Chr IV) CYP86A2 (Chr IV)
AL161533 (Chr IV) CYP706A4, CYP706A5, CYP706A6, CYP706A7
AL161536 (Chr IV) CYP71A19, CYP71A20
AL161537 (Chr IV) CYP83A1 
AL161540 (Chr IV) CYP97B3
AL161541 (Chr IV) CYP702A2, CYP702A3, CYP702A4P, CYP702A5, CYP702A6
         CYP702A7P (inside another gene), CYP705A1, CYP705A2, CYP705A3
         CYP705A4, CYP74B2 
AL161550 (Chr IV) CYP707A1
AL161552 (Chr IV) CYP71A27, CYP71A28
AL161557 (Chr IV) CYP706A1, CYP706A2
AL161571 (Chr IV) CYP709B3
AL161579 (Chr IV) CYP83A2
AL161580 (Chr IV) CYP82C2, CYP82C3, CYP82C4, CYP96A2
AL161589 (Chr IV) CYP84A1, CYP90C1
AL161591 (Chr IV) CYP81D2, CYP81D3, CYP81D4, CYP81D5, CYP81D8,CYP81H1
         CYP81F1,CYP81F3, CYP81F4
AL161595 (Chr IV) CYP96A9, CYP96A10, CYP96A11, CYP96A12
AL161596 (Chr IV) CYP79B2
AL162875 (Chr V T32M21) 77A4, 77A9
AL162972 (Chr V T1E3) 77A4
AL162973 (Chr V F9G14) 96A13
AL163817 (Chr V F18O22) 724A1
AL163972 (Chr III T5P19) 94D2
AL353865 (Chr III T10D17) 71B38
AL353992 (Chr III F14D17) 708A4
AL353995 (Chr V F12B17) 81K1, 81K2
AL357612 (Chr V T22D6) 86B2
AL358732 (Chr III T27I15) 76C7, 76C8P
AL392174 (Chr V F8L15) 86B2
AP000383 (Chr III MAL21) 705A14P, 705A15, 705A16, 705A17P, 705A18, 705A19, 
           705A20, 705A21, 705A22, 705A23
AP000414 (Chr III MIE15) 77A5P
AP000419 (Chr III MVI11) 707A4
AP000601 (Chr III MJL14) 86C2 N-terminal
AP001298 (Chr III F20C19) 71B33, 71B34, 71B35, 71B36, 71B37
AP001304 (Chr III MFD22) 705A28, 705A29P, 705A30, 705A31P, 705A32, 705A33
AP001307 (Chr III MMM17) 90D1
AP001314 (Chr III T6J22) 702A8
AP002033 (Chr III F1M23) 705A34
AP002057 (Chr III T19N8) 81D11
AP002060 (Chr III T20F20) 85A2
D78596 (Chr II) 73A5
D78597 (Chr II) 73A5
D78598 (Chr IV) 83A2
D78599 (Chr IV) 83A1
D78600 (Chr II) 76C1
D78601 (Chr III) 71B5
D78602 (Chr III) 71B3
D78603 (Chr III) 71B4
D78604 (Chr II) 71B6
D78605 (Chr I) 71B2
D78606 (Chr V) 81D1
D78607 (Chr IV) 81F1
U18929 (Chr IV) 83A1
U31288 (Chr III) 71A21 extreme C-term of P450 at end of 
       another gene see AL049659
U37235 (Chr II) 73A5
U38416 (Chr IV) 84A1
U61231 (Chr I) 89A2
U69134 (Chr IV) 83A1
U71080 (Chr II) 73A5
U71081 (Chr II) 73A5
U93215 (Chr II T6B20) 73A5
X87367 (Chr V) 90A1
X87368 (Chr V) 90A1
X90458 (Chr V) 86A1
X92510 (Chr V) 74A 
X94366 (Chr IV) 705A4
X97864 (Chr I) 71B7
Y09581 (Chr I) 86A4
Y12636 (Chr V) 74A
Z17399 (Chr II) 86A8 C-term fragment at end of sequence on minus strand
Z97337 (Chr IV FCA2) 97B3
Z97338 (Chr IV FCA3) 702A2, 702A3, 702A4P, 702A5, 702A6, 702A7P, 705A1, 
          705A2, 705A3, 705A4
Z97339 (Chr IV FCA4) 74B2
Z99707 (Chr IV AP21) 81D2, 81D3, 81D4, 81D5, 81H1
Z99708 (Chr IV AP22) 90C1

P450 sequences by chromosome

Chromosome I (56 P450S)
51A2, 71A18, 71B2, 71B7, 71B27, 71B28, 71B29, 72C1, 76C5, 76C6, 77B1, 78A5, 
78A8, 78A10, 79C1, 79C2, 79C3P, 79C4P, 79C5P, 79F1, 79F2, 81D10, 86A4, 86A7, 
86C1, 86C3, 86C4, 87A2, 87A3P, 88A3, 89A2, 89A5, 89A6, 89A7, 94D1, 96A3, 96A7, 
96A8, 96A14P, 96A15, 97A3, 98A8, 98A9, 702A1, 703A2, 704B1, 705A24, 705A25, 
705A26P, 705A27, 708A1, 708A3, 709A2, 720A1, 721A1, 722A1 

Chromosome II (40 P450S)
51A1, 71A12, 71A13, 71B6, 71B9, 72B1, 73A5, 76C1, 76C2, 76C3, 76C4, 78A6, 
79B3, 79B4P, 81D6, 81D7, 82F1, 86A8, 88A4, 89A4, 94C1, 96A1, 96A5, 98A3, 
704A1, 704A2, 705A6, 705A8, 705A9, 705A13, 707A2, 709B1, 709B2, 710A1, 710A2, 
710A3, 710A4, 711A1, 712A1, 718A1 (note 51A1 is on F5J6 that maps to Chr II, but 
the Genbank entry says it is on Chr IV)

Chromosome III (77 P450s)
71A21, 71A22, 71A23, 71A24, 71A25, 71A26, 71B3, 71B4, 71B5, 71B15, 71B16, 71B17, 
71B18, 71B19, 71B20, 71B21, 71B22, 71B23, 71B24, 71B25, 71B26, 71B30P, 71B31, 
71B32, 71B33, 71B34, 71B35, 71B36, 71B37, 71B38, 72A7, 72A8, 72A9, 72A10, 72A11, 
72A12P, 72A13, 72A14, 72A15, 76C7, 76C8P, 76G1, 77A5P, 77A6, 77A7, 78A9, 81D11, 
82G1, 85A2, 86C2, 89A9, 90B1, 90D1, 94B2, 94B3, 94D2, 97C1, 702A8, 705A14P, 
705A15, 705A16, 705A17P, 705A18, 705A19, 705A20, 705A21, 705A22, 705A23, 705A28, 
705A29P, 705A30, 705A31P, 705A32, 705A33, 705A34, 707A4, 708A4

Chromosome IV (47 P450s)
71A19, 71A20, 71A27, 71A28, 74B2, 79B2, 81D2, 81D3, 81D4, 81D5, 81D8, 
81F1, 81F3, 81F4, 81H1, 82C2, 82C3, 82C4, 83A1, 83A2, 84A1, 86A2, 90C1, 
96A2, 96A9, 96A10, 96A11, 96A12, 97B3, 702A2, 702A3, 702A4P, 702A5, 702A6, 702A7P, 
705A1, 705A2, 705A3, 705A4, 706A1, 706A2, 706A4, 706A5, 706A6, 706A7, 707A1, 
709B3

Chromosome V (53 P450s)
71A14, 71A15, 71A16, 17A17P, 71B8, 71B10, 71B11, 71B12, 71B13, 71B14, 74A, 
75B1, 77A4, 77A8P, 77A9, 78A7, 79A2, 79A3P, 79A4P, 81D1, 81F2, 81G1, 81K1, 81K2, 
84A4, 85A1, 86A1, 86B1, 86B2, 89A3, 90A1, 93D1, 94B1, 94D3P, 96A4, 96A6P, 96A13, 
701A3, 705A5, 705A10P, 705A11P, 705A12, 706A3, 707A3, 708A2, 709A1, 712A2, 
714A1, 714A2, 715A1, 716A1, 716A2, 724A1

note 705A7 is discontinued due to being a chimera.  It is replaced by 705A30 and
705A32.  CYP84A4 is not in Genbank yet but is is available at MIPS as Sequence AT5g04330 extracted from sa_e_22 Fragment (39390-38758,40295-39468(C))

Total is 273 named P450 genes

On Jan. 28, 2000 TIGR deposited 14905 entries from their Landsberg erecta data.
These genomic sequences are from a different strain to identify polymorphisms.
These GSS accession numbers start with AQ.  At least 48 of these sequences are 
P450s and they match 25 different Arabidopsis P450s and two match a Deinococcus 
radiodurans bacterial P450 at 44% identity.  This clone may be a contamination of 
the genomic library.  It does not resemble any other plant P450 at this high level.

AQ961078 LERFJ05TR LERA Arabidopsis thaliana genomic clone LERFJ05
96% to 51A1

AQ961077 LERFJ05TF LERA Arabidopsis thaliana genomic clone LERFJ05
99% to 51A1

AQ966708 LERIL68TFB LERG Arabidopsis thaliana genomic clone LERIL68
100% to 71A19

AQ968500 LERJC87TF LERG Arabidopsis thaliana genomic clone LERJC87
97% to 71A24

AQ968501 LERJC87TR LERG Arabidopsis thaliana genomic clone LERJC87
96% to 71A24

AQ968537 LERJD18TR LERG Arabidopsis thaliana genomic clone LERJD18
97% identical to 71A26 N-terminal

AQ957646 LERAQ88TF LERA Arabidopsis thaliana genomic clone LERAQ88
99% to 71B3

AQ957647 LERAQ88TR LERA Arabidopsis thaliana genomic clone LERAQ88
100% to 71B3

AQ963043 LERGJ13TR LERG Arabidopsis thaliana genomic clone LERGJ13
98% to 71B4

AQ956837 LERAM36TF LERA Arabidopsis thaliana genomic clone LERAM36
100% to 71B7 0ver 225 amino acids

AQ956838 LERAM36TR LERA Arabidopsis thaliana genomic clone LERAM36
100% to 71B7

AQ968000 LERIW96TR LERG Arabidopsis thaliana genomic clone LERIW96
100% to 71B23

AQ967999 LERIW96TF LERG Arabidopsis thaliana genomic clone LERIW96
100% to 71B23

AQ962171 LERGD74TF LERG Arabidopsis thaliana genomic clone LERGD74
93% to 76C3 N-terminal

AQ962172 LERGD74TR LERG Arabidopsis thaliana genomic clone LERGD74
92% to 76C3

AQ968833 LERJF09TR LERG Arabidopsis thaliana genomic clone LERJF09
100% to 78A8

AQ968883 LERJF37TF LERG Arabidopsis thaliana genomic clone LERJF37
100% to 78A8

AQ968884 LERJF37TR LERG Arabidopsis thaliana genomic clone LERJF37
100% to 78A8

AQ960047 LERFB09TF LERA Arabidopsis thaliana genomic clone LERFB09
100% to 79B2

AQ960048 LERFB09TR LERA Arabidopsis thaliana genomic clone LERFB09
98% to 79B2

AQ956517 LERAK44TR LERA Arabidopsis thaliana genomic clone LERAK44
100% to 79C1

AQ956516 LERAK44TF LERA Arabidopsis thaliana genomic clone LERAK44
98% to 79C1

AQ958944 LEREG05TR LERE Arabidopsis thaliana genomic clone LEREG05
100% to 79C1

AQ958943 LEREG05TF LERE Arabidopsis thaliana genomic clone LEREG05
98% to 79C1

AQ969559 LERJO25TR LERG Arabidopsis thaliana genomic clone LERJO25
99% to 81D2

AQ969558 LERJO25TF LERG Arabidopsis thaliana genomic clone LERJO25
97% to 81D2

AQ959582 LEREL64TR LERE Arabidopsis thaliana genomic clone LEREL64
1 difference with 81G1 96%

AQ956256 LERAI92TF LERA Arabidopsis thaliana genomic clone LERAI92
99% to 82C2

AQ956257 LERAI92TR LERA Arabidopsis thaliana genomic clone LERAI92
100% to 82C2

AQ968189 LERIW66TF LERG Arabidopsis thaliana genomic clone LERIW66
100% to 83A2

AQ968190 LERIW66TR LERG Arabidopsis thaliana genomic clone LERIW66
97% to 83A2

AQ964979 LERGZ64TR LERG Arabidopsis thaliana genomic clone LERGZ64
100% to 96A11

AQ964978 LERGZ64TF LERG Arabidopsis thaliana genomic clone LERGZ64
100% to 96A11

AQ960246 LERFB51TF LERA Arabidopsis thaliana genomic clone LERFB51
100% to 98A3 N-terminal

AQ960247 LERFB51TR LERA Arabidopsis thaliana genomic clone LERFB51
100% to 98A3

AQ960228 LERFB40TR LERA Arabidopsis thaliana genomic clone LERFB40
99% to 705A3

AQ960227 LERFB40TF LERA Arabidopsis thaliana genomic clone LERFB40
95% to 705A3

AQ965033 LERGZ92TR LERG Arabidopsis thaliana genomic clone LERGZ92
98% to 705A4 (two extra amino acids, check intron boundary)
TRNHIKSI--DLLFAGTEN
TRNHIKSI  DLLFAGTEN
TRNHIKSIIADLLFAGTEN

AQ965032 LERGZ92TF LERG Arabidopsis thaliana genomic clone LERGZ92
96% to 705A4

AQ958087 LERAU82TR LERA Arabidopsis thaliana genomic clone LERAU82
95% to 705A22

AQ958546 LERAY24TR LERA Arabidopsis thaliana genomic clone LERAY24
100% to 705A22

AQ958987 LEREG36TR LERE Arabidopsis thaliana genomic clone LEREG36
100% to 706A4

AQ958986 LEREG36TF LERE Arabidopsis thaliana genomic clone LEREG36
100% to 706A4

AQ958546 LERAY24TR LERA Arabidopsis thaliana genomic clone LERAY24
98% to 706A6

AQ962106 LERGD38TR LERG Arabidopsis thaliana genomic clone LERGD38
100% to 707A1

AQ956035 LERAH08TF LERA Arabidopsis thaliana genomic clone LERAH08
98% to 707A3

AQ956036 LERAH08TR LERA Arabidopsis thaliana genomic clone LERAH08
98% to 707A3

AQ969679 LERJP26TR LERG Arabidopsis thaliana genomic clone LERJP26
44% to a Deinococcus radiodurans P450 sequence
this may be a bacterial contamination of the genomic library
it does not match any other plant sequence at better than 30%

AQ969679      DLIVSLTGPYVAGLDTVANTTAAITYTVLKHPDVLKRVHDEVDALFADGTIGEEDLLKRI 61
              D+ ++  G ++AG+DT AN+ A + Y +  H + L  +  E DALF DG    E  L R 
AE002014 1317 DVRLAALGAFIAGMDTAANSLAFVLYRMHLHSEFLPALRAEADALFRDGPPTAE-ALGRS 1141

Query: 62   PSLQGAIMETMRLYPIAVAQMRSATKDFVFEGHQIYEGEMIYVGTSVPHFMHEYWPEPEN 121
            P L   +MET+R++PIA A  R+ T+D  F GH+I  G  + +GT+VPH + E +P+PE+
Sbjct: 1140 PLLHRFVMETLRVHPIAPALSRTLTEDVEFAGHRIPAGTPVIIGTTVPHGLPELFPDPEH 961

Query: 122  FDIDRYAKPRAEHMQPGVYSPYGRGPHTCLGKSLAEIQIALSMARLFYKLDLELESPNYK 181
            FD  R+A  RAEH QPG Y+P+G G HTC G  +AE  I L  A     LDL LE P+Y 
Sbjct: 960  FDPGRFAPGRAEHRQPGAYAPFGVGSHTCAGSGMAEGLIMLGAAAALRTLDLSLE-PDYV 784

Query: 182  LKTKTAPTP 190
            L+    PTP
Sbjct: 783  LRQTAKPTP 757

AQ969672 LERJP23TF LERG Arabidopsis thaliana genomic clone LERJP23
Same seq as AQ969679