74 named sequences of 74 total + one allele

 

D. Nelson March 21, 2006

 

#1

 

>CYP51F1 AAK73660.1 14-alpha sterol demethylase [Aspergillus fumigatus] 79% to 51F1

MGLIAFILDGICKHCSTQSTWVLVGIGLLSILAVSVIINVLQQLLFKNPHEPPVVFHWFPFIGSTISYGI

DPYKFFFDCRAKYGDIFTFILLGKKTTVYLGTKGNDFILNGKLRDVCAEEVYSPLTTPVFGRHVVYDCPN

AKLMEQKKFVKYGLTSDALRSYVPLITDEVESFVKNSPAFQGHKGVFDVCKTIAEITIYTASRSLQGKEV

RSKFDSTFAELYHNLDMGFAPINFMLPWAPLPHNRKRDAAQRKLTETYMEIIKARRQAGSKKDSEDMVWN

LMSCVYKNGTPVPDEEIAHMMIALLMAGQHSSSSTASWIVLRLATRPDIMEELYQEQIRVLGSDLPPLTY

DNLQKLDLHAKVIKETLRLHAPIHSIIRAVKNPMAVDGTSYVIPTSHNVLSSPGVTARSEEHFPNPLEWN

PHRWDENIAASAEDDEKVDYGYGLVSKGTNSPYLPFGAGRHRCIGEQFAYLQLGTITAVLVRLFRFRNLP

GVDGIPDTDYSSLFSKPLGRSFVEFEKRESATKA

 

>XP_749134.1 14-alpha sterol demethylase Cyp51B [Aspergillus fumigatus Af293]

MGLIAFILDGICKHCSTQSTWVLVGIGLLSILAVSVIINVLQQLLFKNPHEPPVVFHWFPFIGSTISYGI

DPYKFFFDCRAKYGDIFTFILLGKKTTVYLGTKGNDFILNGKLRDVCAEEVYSPLTTPVFGRHVVYDCPN

AKLMEQKKFVKYGLTSDALRSYVPLITDEVESFVKNSPAFQGHKGVFDVCKTIAEITIYTASRSLQGKEV

RSKFDSTFAELYHNLDMGFAPINFMLPWAPLPHNRKRDAAQRKLTETYMEIIKARRQAGSKKDSEDMVWN

LMSCVYKNGTPVPDEEIAHMMIALLMAGQHSSSSTASWIVLRLATRPDIMEELYQEQIRVLGSDLPPLTY

DNLQKLDLHAKVIKETLRLHAPIHSIIRAVKNPMAVDGTSYVIPTSHNVLSSPGVTARSEEHFPNPLEWN

PHRWDENIAASAEDDEKVDYGYGLVSKGTNSPYLPFGAGRHRCIGEQFAYLQLGTITAVLVRLFRFRNLP

GVDGIPDTDYSSLFSKPLGRSFVEFEKRESATKA

 

>EAL87096.1 14-alpha sterol demethylase Cyp51B [Aspergillus fumigatus Af293]

MGLIAFILDGICKHCSTQSTWVLVGIGLLSILAVSVIINVLQQLLFKNPHEPPVVFHWFPFIGSTISYGI

DPYKFFFDCRAKYGDIFTFILLGKKTTVYLGTKGNDFILNGKLRDVCAEEVYSPLTTPVFGRHVVYDCPN

AKLMEQKKFVKYGLTSDALRSYVPLITDEVESFVKNSPAFQGHKGVFDVCKTIAEITIYTASRSLQGKEV

RSKFDSTFAELYHNLDMGFAPINFMLPWAPLPHNRKRDAAQRKLTETYMEIIKARRQAGSKKDSEDMVWN

LMSCVYKNGTPVPDEEIAHMMIALLMAGQHSSSSTASWIVLRLATRPDIMEELYQEQIRVLGSDLPPLTY

DNLQKLDLHAKVIKETLRLHAPIHSIIRAVKNPMAVDGTSYVIPTSHNVLSSPGVTARSEEHFPNPLEWN

PHRWDENIAASAEDDEKVDYGYGLVSKGTNSPYLPFGAGRHRCIGEQFAYLQLGTITAVLVRLFRFRNLP

GVDGIPDTDYSSLFSKPLGRSFVEFEKRESATKA

 

#2

 

>CYP51F2v1 AAF32372.1 AF222068_1 cytochrome P450 sterol 14 alpha-demethylase [Aspergillus fumigatus]

MVPMLWLTAYMAVAVLTAILLNVVYQLFFRLWNRTEPPMVFHWVPFLGSTISYGIDPYKFFFACREKYGD

IFTFILLGQKTTVYLGVQGNEFILNGKLKDVNAEEVYSPLTTPVFGSDVVYDCPNSKLMEQKKFIKYGLT

QSALESHVPLIEKEVLDYLRDSPNFQGSSGRMDISAAMAEITIFTAARALQGQEVRSKLTAEFADLYHDL

DKGFTPINFMLPWAPLPHNKKRDAAHARMRSIYVDIINQRRLDGDKDSQKSDMIWNLMNCTYKNGQQVPD

KEIAHMMITLLMAGQHSSSSISAWIMLRLASQPKVLEELYQEQLANLGPAGPDGSLPPLQYKDLDKLPFH

QHVIRETLRIHSSIHSIMRKVKSPLPVPGTPYMIPPGRVLLASPGVTALSDEHFPNAGCWDPHRWENQAT

KEQENDEVVDYGYGAVSKGTSSPYLPFGAGRHRCIGEKFAYVNLGVILATIVRHLRLFNVDGKKGVPETD

YSSLFSGPMKPSIIGWEKRSKNTSK

 

>AAK73659.1 14-alpha sterol demethylase [Aspergillus fumigatus]

MVPMLWLTAYMAVAVLTAILLNVVYQLFFRLWNRTEPPMVFHWVPFLGSTISYGIDPYKFFFACREKYGD

IFTFILLGQKTTVYLGVQGNEFILNGKLKDVNAEEVYSPLTTPVFGSDVVYDCPNSKLMEQKKFIKYGLT

QSALESHVPLIEKEVLDYLRDSPNFQGSSGRMDISAAMAEITIFTAARALQGQEVRSKLTAEFADLYHDL

DKGFTPINFMLPWAPLPHNKKRDAAHARMRSIYVDIINQRRLDGDKDSQKSDMIWNLMNCTYKNGQQVPD

KEIAHMMITLLMAGQHSSSSISAWIMLRLASQPKVLEELYQEQLANLGPAGPDGSLPPLQYKDLDKLPFH

QHVIRETLRIHSSIHSIMRKVKSPLPVPGTPYMIPPGRVLLASPGVTALSDEHFPNAGCWDPHRWENQAT

KEQENDEVVDYGYGAVSKGTSSPYLPFGAGRHRCIGEKFAYVNLGVILATIVRHLRLFNVDGKKGVPETD

YSSLFSGPMKPSIIGWEKRSKNTSK

 

#2allele 5 aa  diffs

 

>CYP51F2v2 XP_752137.1 14-alpha sterol demethylase Cyp51A [Aspergillus fumigatus Af293] 74% to 51F2 A. nidulans 62% to 51F1 A. nidulans

MVPMLWLTAYMAVAVLTAILLNVVYQLFFRLWNRTEPPMVFHWVPYLGSTISYGIDPYKFFFACREKYGD

IFTFILLGQKTTVYLGVQGNEFILNGKLKDVNAEEVYSPLTTPVFGSDVVYDCPNSKLMEQKKFIKYGLT

QSALESHVPLIEKEVLDYLRDSPNFQGSSGRVDISAAMAEITIFTAARALQGQEVRSKLTAEFADLYHDL

DKGFTPINFMLPWAPLPHNKKRDAAHARMRSIYVDIITQRRLDGEKDSQKSDMIWNLMNCTYKNGQQVPD

KEIAHMMITLLMAGQHSSSSISAWIMLRLASQPKVLEELYQEQLANLGPAGPDGSLPPLQYKDLDKLPFH

QHVIRETLRIHSSIHSIMRKVKSPLPVPGTPYMIPPGRVLLASPGVTALSDEHFPNAGCWDPHRWENQAT

KEQENDKVVDYGYGAVSKGTSSPYLPFGAGRHRCIGEKFAYVNLGVILATIVRHLRLFNVDGKKGVPETD

YSSLFSGPMKPSIIGWEKRSKNTSK

 

>EAL90099.1 14-alpha sterol demethylase Cyp51A [Aspergillus fumigatus Af293]

MVPMLWLTAYMAVAVLTAILLNVVYQLFFRLWNRTEPPMVFHWVPYLGSTISYGIDPYKFFFACREKYGD

IFTFILLGQKTTVYLGVQGNEFILNGKLKDVNAEEVYSPLTTPVFGSDVVYDCPNSKLMEQKKFIKYGLT

QSALESHVPLIEKEVLDYLRDSPNFQGSSGRVDISAAMAEITIFTAARALQGQEVRSKLTAEFADLYHDL

DKGFTPINFMLPWAPLPHNKKRDAAHARMRSIYVDIITQRRLDGEKDSQKSDMIWNLMNCTYKNGQQVPD

KEIAHMMITLLMAGQHSSSSISAWIMLRLASQPKVLEELYQEQLANLGPAGPDGSLPPLQYKDLDKLPFH

QHVIRETLRIHSSIHSIMRKVKSPLPVPGTPYMIPPGRVLLASPGVTALSDEHFPNAGCWDPHRWENQAT

KEQENDKVVDYGYGAVSKGTSSPYLPFGAGRHRCIGEKFAYVNLGVILATIVRHLRLFNVDGKKGVPETD

YSSLFSGPMKPSIIGWEKRSKNTSK

 

#3

 

>CYP52G2 EAL93250.1 cytochrome P450 family protein, putative [Aspergillus fumigatus Af293]

60% to 52G1

MGLPLLTIAAVAVALRLLWTLAARWQHAQNARRLGCGSIPLYPSDPLGISVLKETLAADKAKKLLPLVER

RVALMSDREGRYVTTFRFRQMGRENYFTTDPKNIQAILATQFKDFELGAPRRQALHPLLGAGIFSSDGEE

WFHARGLLRPQFTRDQISDLDLEERHVQKAMQAMPVVNGKWTDAVDIQSIFFRLTIDSATEFLFGESVES

QLSALNGGQTPVDTFPYYFDKSQWYAAQRARFEKLYWIVNNKECRHAQNEVHAYVDRVVHKALKAAREGK

LANPNKPSQYVFLHALVSVTQDPIELRSQLLNILLAGRDTTASLLSWTVLMLARHPAEFHKLRQTIVDEF

GTYDQPRNITFAALKSCQYLQYCLNETLRLFPVVPGNRRSATRDTTLPRGGGSDGTQPIYIRKGQTVVYN

VHILHRRKDIWGPDAEEFKPSRWVDRKVGWDYVPFNGGPRICIGQQFALTEAGYVLVRLLQRFDAIEDMQ

PHLEIRHSLNLTSAPADNVTVRLREAA

 

>XP_755288.1 hypothetical protein Afu2g09540 [Aspergillus fumigatus Af293]

MGLPLLTIAAVAVALRLLWTLAARWQHAQNARRLGCGSIPLYPSDPLGISVLKETLAADKAKKLLPLVER

RVALMSDREGRYVTTFRFRQMGRENYFTTDPKNIQAILATQFKDFELGAPRRQALHPLLGAGIFSSDGEE

WFHARGLLRPQFTRDQISDLDLEERHVQKAMQAMPVVNGKWTDAVDIQSIFFRLTIDSATEFLFGESVES

QLSALNGGQTPVDTFPYYFDKSQWYAAQRARFEKLYWIVNNKECRHAQNEVHAYVDRVVHKALKAAREGK

LANPNKPSQYVFLHALVSVTQDPIELRSQLLNILLAGRDTTASLLSWTVLMLARHPAEFHKLRQTIVDEF

GTYDQPRNITFAALKSCQYLQYCLNETLRLFPVVPGNRRSATRDTTLPRGGGSDGTQPIYIRKGQTVVYN

VHILHRRKDIWGPDAEEFKPSRWVDRKVGWDYVPFNGGPRICIGQQFALTEAGYVLVRLLQRFDAIEDMQ

PHLEIRHSLNLTSAPADNVTVRLREAA

 

#4

 

>CYP52H2 XP_746567.1 cytochrome P450 alkane hydroxylase [Aspergillus fumigatus Af293]

72% to 52H1

MLAPAVALFAAVYTTFLVLRYFQQLYKHRKQARSLRCQPPADGEAGFLGIASFLRLRKAAKEKRWIELIA

EQYGKYGNTFTQTIFGQPLVSTIEPENLKALLATQFNDFELGTRHREFYPLLGDGIFTLDGAGWSHARAL

LRPQFTRDQVADLDLMDGHVSRLIDLVPKDGSAFDIQRLFFLLTIDSATHFLFGESVGSLHAGTDTGLLG

RSAVGNAEGFAEAFNKAQEYLAARSRAVVFYWMINPKEFRDANKRVHEVVDHYVQLALESRRNPEKKQPG

GRYIFAEALAAENDNPKVLRDNMLNILLAGRDTTASLLSSTFFYLARHPNVWIKLRQVIVDAFGDAEHPK

EEITQTKLKDIPYLRYVLNEVLRLLPPVPANFRVANKDTTLPVGGGPDQKSPVYIRKGTIVTYSVYAMHR

RTDFYGPDANEFRPERWEENGKRGWEYLPFNGGPRICLGQQYALTEASFTIVKLLQRFDRIENGDPDLIE

PIQQTNLTLAHDRGVYIRLYSSKAL

 

>EAL84529.1 cytochrome P450 alkane hydroxylase, putative [Aspergillus fumigatus Af293]

MLAPAVALFAAVYTTFLVLRYFQQLYKHRKQARSLRCQPPADGEAGFLGIASFLRLRKAAKEKRWIELIA

EQYGKYGNTFTQTIFGQPLVSTIEPENLKALLATQFNDFELGTRHREFYPLLGDGIFTLDGAGWSHARAL

LRPQFTRDQVADLDLMDGHVSRLIDLVPKDGSAFDIQRLFFLLTIDSATHFLFGESVGSLHAGTDTGLLG

RSAVGNAEGFAEAFNKAQEYLAARSRAVVFYWMINPKEFRDANKRVHEVVDHYVQLALESRRNPEKKQPG

GRYIFAEALAAENDNPKVLRDNMLNILLAGRDTTASLLSSTFFYLARHPNVWIKLRQVIVDAFGDAEHPK

EEITQTKLKDIPYLRYVLNEVLRLLPPVPANFRVANKDTTLPVGGGPDQKSPVYIRKGTIVTYSVYAMHR

RTDFYGPDANEFRPERWEENGKRGWEYLPFNGGPRICLGQQYALTEASFTIVKLLQRFDRIENGDPDLIE

PIQQTNLTLAHDRGVYIRLYSSKAL

 

#5

 

>CYP53A12 XP_755858.1 benzoate 4-monooxygenase [Aspergillus fumigatus Af293]

85% to CYP53A1, 79% to 53A3 seq looks correct

MITDLLSLQNAGLILLGLIAVYYVIPYLQKWHLHDIPSPRFAAFSNLWLLLQARRGRRFLKVDEAHKKYG

KLVRIAPKHVSIADDAAIQAIYGHGNGFLKADFYDAFVSIRRGLFNTRDRAEHTRKRKTVSHTFSMKSIG

QFEQYIHQNVELFVQQWTKLAKLNGNPRSGYATIDALNWFNYLAFDIIGDLAFGAPFGMLEKGKDIAEMR

KTPDSEPTYVQAVEVLNRRGEVSATLGCLPRLIPYAKYLPDRFFKDGVQAVENLAGIAVARVNERLKPEV

MEKNTRVDLLSRLMEGKDSNGNKLGREELTAEALTQLIAGSDTTSNTTCAILYWCMSTPGVIPKLQKVLD

EAIPDDVDVPTHAMVKDIPYLQWVIWETMRIHSTSAMGLPREIPPGNPPVTISGHTFYPGDVVSVPSYTI

HRSKEIWGPDAEKFVPERWDPARLTARQKAAFIPFSTGPRACVGRNVAEMELLVMTGTIFRLFEFEMQQD

GPMETREGFLRKPLGLIVGMKRRAVHASV

 

>EAL93820.1 benzoate 4-monooxygenase [Aspergillus fumigatus Af293] 85% to CYP53A1

MITDLLSLQNAGLILLGLIAVYYVIPYLQKWHLHDIPSPRFAAFSNLWLLLQARRGRRFLKVDEAHKKYG

KLVRIAPKHVSIADDAAIQAIYGHGNGFLKADFYDAFVSIRRGLFNTRDRAEHTRKRKTVSHTFSMKSIG

QFEQYIHQNVELFVQQWTKLAKLNGNPRSGYATIDALNWFNYLAFDIIGDLAFGAPFGMLEKGKDIAEMR

KTPDSEPTYVQAVEVLNRRGEVSATLGCLPRLIPYAKYLPDRFFKDGVQAVENLAGIAVARVNERLKPEV

MEKNTRVDLLSRLMEGKDSNGNKLGREELTAEALTQLIAGSDTTSNTTCAILYWCMSTPGVIPKLQKVLD

EAIPDDVDVPTHAMVKDIPYLQWVIWETMRIHSTSAMGLPREIPPGNPPVTISGHTFYPGDVVSVPSYTI

HRSKEIWGPDAEKFVPERWDPARLTARQKAAFIPFSTGPRACVGRNVAEMELLVMTGTIFRLFEFEMQQD

GPMETREGFLRKPLGLIVGMKRRAVHASV

 

#6a CYP58D3

 

>XP_753152.1 trichodiene oxygenase [Aspergillus fumigatus Af293] 71% to 58D1

N-term AAHF01000003.1  Aspergillus fumigatus Af293 broken gene

MRRKLLNNFFSRRSIENIEPVIHNSLSRFLDGLTTAYKEGSVVELIDRLQGLTGDVITEYAYGENYGLQD

PENYGKGIVKVVQEGTDQIHFFRFFPLVSQLLRIIPSWFMGQVFPARAAIYQLLDGVRKQSILALQQKNV

STAPQRMTIFQALTAPEVPPEERNLQRLQDEGLVLFAAGTETTATTLAVALFYN

 

>EAL91114.1 trichodiene oxygenase [Aspergillus fumigatus Af293]

MRRKLLNNFFSRRSIENIEPVIHNSLSRFLDGLTTAYKEGSVVELIDRLQGLTGDVITEYAYGENYGLQD

PENYGKGIVKVVQEGTDQIHFFRFFPLVSQLLRIIPSWFMGQVFPARAAIYQLLDGVRKQSILALQQKNV

STAPQRMTIFQALTAPEVPPEERNLQRLQDEGLVLFAAGTETTATTLAVALFYN

 

#6b

 

>CYP58D3 XP_753171.1 [Aspergillus fumigatus Af293]

73% to 58D1 C-term AAHF01000003.1  Aspergillus fumigatus Af293 broken gene

MPTPQHPTTWRELEKLPYLTAVIREALRFSGIVMRQQRISPTEALKYKDIVVPPGTPVSMIARFVHMDPT

IFPDPTRFHPERWMLAAGREEGLSKFLVTFSRGNRGCIGMNLAYAELYNTLAAVVRRFDLELNQTTPENI

RFVRDKLLPRSKDGSWTVRVKVVGIREQ

 

>EAL91133.1 cytochrome P450 [Aspergillus fumigatus Af293]

YILNDKRVLSKLRRELEQI

MPTPQHPTTWRELEKLPYLTAVIREALRFSGIVMRQQRISPTEALKYKDIVVPPGTPVSMIARFVHMDPT

IFPDPTRFHPERWMLAAGREEGLSKFLVTFSRGNRGCIGMNLAYAELYNTLAAVVRRFDLELNQTTPENI

RFVRDKLLPRSKDGSWTVRVKVVGIREQ

 

#7

 

>CYP61A1 XP_750145.1 cytochrome P450 sterol C-22 desaturase [Aspergillus fumigatus Af293]

81% to 61A1 Ao

MANVNGSFVSPSADATISPQLFYNVDSLSAVLNGFTFWKALATLFFAAVIYDQLRYFYLKGSLVGPTFKL

PFMGPFLQSVNPKFHEYKAKWDSGELSCVSVFHKFVVIASTRDMSRKIFNSPAYVKPCVVDIAHKLLGPD

NWVFLDGKEHVEFRKGLNGLFTRSALSSYLPVMEECYNKYYKYFLEKSKANDYKPEPWMPEFRELMCAVS

CRTFVGHYMTDAAIKKIADDYYMITAALELVNFPFILPFTKAWYGKKASDMVLEEFSNCAAKSKAHMAAG

GEITCIMDAWVKAQQDSAKYNEKIAKGLPVEDSEKPSHLLREFTDYEIAQTVFTLLFASQDATSAACTWL

FQLVADRPDVLEKIREENLRVRNGNINAPLTMDLLDEMKYTRAVVRETLRYRPPVIMVPYLVKKDFPITD

SITVSKGSMIIPSVWPATHDPEAYPNPDSFDPDRWITGDAEKQAKNFLVFGTGPHYCLGQTYAQLNLIAM

IGKASLEMDWEHAPTPKSEDIKVFATIFPEV

 

>EAL88107.1 cytochrome P450 sterol C-22 desaturase, putative [Aspergillus fumigatus Af293]

MANVNGSFVSPSADATISPQLFYNVDSLSAVLNGFTFWKALATLFFAAVIYDQLRYFYLKGSLVGPTFKL

PFMGPFLQSVNPKFHEYKAKWDSGELSCVSVFHKFVVIASTRDMSRKIFNSPAYVKPCVVDIAHKLLGPD

NWVFLDGKEHVEFRKGLNGLFTRSALSSYLPVMEECYNKYYKYFLEKSKANDYKPEPWMPEFRELMCAVS

CRTFVGHYMTDAAIKKIADDYYMITAALELVNFPFILPFTKAWYGKKASDMVLEEFSNCAAKSKAHMAAG

GEITCIMDAWVKAQQDSAKYNEKIAKGLPVEDSEKPSHLLREFTDYEIAQTVFTLLFASQDATSAACTWL

FQLVADRPDVLEKIREENLRVRNGNINAPLTMDLLDEMKYTRAVVRETLRYRPPVIMVPYLVKKDFPITD

SITVSKGSMIIPSVWPATHDPEAYPNPDSFDPDRWITGDAEKQAKNFLVFGTGPHYCLGQTYAQLNLIAM

IGKASLEMDWEHAPTPKSEDIKVFATIFPEV

 

>CYP65T2 AAKE02000011.1  Neosartorya fischeri NRRL 181

57% to 65T1

MMFVILAAASLLYISYILLLAIKTIYFHPLSHIPGPKWRIGIPLLHHLS

628603  AIRGRLDLDISSWHEKYGDVVRSGPDEVTFITAQAWKDIYGHGHRQLPKVQISAINGKDI  628424

628423  FSANDVDHARFRKALSHAFSAKGLQAQERIVTQYIDKLIQRLKWFAESGTAADMGKW  628253

YNLATFDLIGDLAFGEPFGGLDSA

EYHHWVATMFGFVKSIPFLRALHRYPVVFKVILAFHPGSLMEMRSKQVEHAKATVQKRL

SNSAAGRGDFMDSMLRHQGDKGGLSLDELEENANVLILAGSETTAALLSG

VTYWLLRTPDALDKVMREVRAAFALERDITFNQVTAKLPYMLACLNEAFRLYPPVPGGLQ

RWTEVPTWISGYRVPAN (0)

TKVSVHQLSAYSSLKNFHQADRFIPERWLPEAIEDPASPFFSDNRAVFQPFSIGPRNCLG

RNLAYTEMRVILARVLWTFDLTLCEESRDWKDQKIFVIWERGPLMCKLAMRDDRGDCQGGR*

 

#8

 

>CYP65T3P XP_748490.1 cytochrome P450 monooxygenase [Aspergillus fumigatus Af293]

AAHF01000010.1

58% to 65T1 Nterm aa 52-168 plus C-term part, 84% to 65T2

SLRGRLDLDLRSWHEKYDGVVRPGPDEVTFITAQAWKDIYGHGHLQLPKVQISTINGK

NIFATNDVDHARFRKALSHAFSAKGLQAQECLVTRYIDKRIERLKGFTESGTAADMGKW 425909

*NLATFDLIGDVAFGEPFGGLD

 

AYSSPRNFHQADRSIPERWLPQVIENPASPFFLDNRAVFQPFSIRPRNCLGRNLAYTEMR

MILARGLWTFXX

LCEESRDWTDR

 

>EAL86452.1 cytochrome P450 monooxygenase [Aspergillus fumigatus Af293]

MADRISTPATPCSLRGRLDLDLRSWHEKYDGVVRPGPDEVTFITAQAWKDIYGHGHLQLPKVQISTINGK

NIFATNDVDHARFRKALSHAFSAKGLQAQECLVTRYIDKRIERLKGFTESGTAADMGKW

 

 

#9

 

>CYP65Y1 XP_746900.1 cytochrome P450 [Aspergillus fumigatus Af293] 49% to CYP65V1

MHQRYGDIVRVAPDELFFAHPDAWSDIHKKTGREMDKAPWFYRPLEQSPRCIVDESHEQHSRLRRQMAPG

FSEKSMRDQEPIIRGYVDLLLQRLLEKSNDGQPVVISDWFNYTTFDIIGDLVFGEPFECLGSSKYDGWIK

SIFESLRPLTIVQALSFFPWLKRIALDTVPKNLQGDIKQQQQQTEAKMRRRMAVTASRGDLMEGLLKKKD

ELHLSTEELIGNAQVLILAGSETTASLLSGVIYLLLQNAVAYRQLVDEVRSTFNSEKDINFVSVSQLSYM

LACLNEALRIYPPVANGLPRVVPKGGAQILGQYIPEQTYVAIPQWALYHREQYFAEPNDFHPERFLGDPK

FANDRRDALQPFSVGPRNCLGRNLAYAEMRLILALVIFHFDMKIDPDCRDWIQQRNFTLWQKPPLKVYLK

PVARKSEPNQV

 

>EAL84862.1 cytochrome P450, putative [Aspergillus fumigatus Af293]

MHQRYGDIVRVAPDELFFAHPDAWSDIHKKTGREMDKAPWFYRPLEQSPRCIVDESHEQHSRLRRQMAPG

FSEKSMRDQEPIIRGYVDLLLQRLLEKSNDGQPVVISDWFNYTTFDIIGDLVFGEPFECLGSSKYDGWIK

SIFESLRPLTIVQALSFFPWLKRIALDTVPKNLQGDIKQQQQQTEAKMRRRMAVTASRGDLMEGLLKKKD

ELHLSTEELIGNAQVLILAGSETTASLLSGVIYLLLQNAVAYRQLVDEVRSTFNSEKDINFVSVSQLSYM

LACLNEALRIYPPVANGLPRVVPKGGAQILGQYIPEQTYVAIPQWALYHREQYFAEPNDFHPERFLGDPK

FANDRRDALQPFSVGPRNCLGRNLAYAEMRLILALVIFHFDMKIDPDCRDWIQQRNFTLWQKPPLKVYLK

PVARKSEPNQV

 

#10

 

>CYP65Z1 XP_751828.1 [Aspergillus fumigatus Af293] 41% to 65R1 Fg, 44% to 65S3

MAPWNHDIFDRLMLSAILSWSILLQSQIANYRRRTLTRRQGCVYLIGHSIYAIYFHPLSRYPGPKIAAIS

PIALLVWEIRGKVHSKVKHLHDRYGDVVRIGPNALVYRAPRAWKEIYGYRTKKGQRTFQKDPSLYVPTPN

GVHAIITAAESDHIRMRRLLAHAFSDRALREQESLLHFYADLLVQKLHENLNHSHSEVVDIARWYNFTTF

DLIGDLAFGEPFQCLKDSKYHWWVSIMLDAVKLSVYLKVLWFFPILSPLTKLLVPRYLHQRREASFQLTV

EKVSRRLHRQTNRPDFISYILRHKDDENRMSRQEIDANAATFVLAGSETTAALLSGCTFYLLKNPHIYRR

LVTEIRSRFQHPSEIRLSSIATLSYLNAVLEESLRIYPPIPAMLPRLVPEEGAMINGEYVPAGTSVSMSL

WSTFHSSGNFHNPDSFVPERWLASPEEEASRCFTMDKKEAFQPFSYGPRNCLGQHLANAEMRLILAKVFW

HSDMELCPESENWADQESYNLWSRPPLMVMISRANGRNYEDNMV

 

>EAL89790.1 cytochrome P450 monooxygenase, putative [Aspergillus fumigatus Af293]

MAPWNHDIFDRLMLSAILSWSILLQSQIANYRRRTLTRRQGCVYLIGHSIYAIYFHPLSRYPGPKIAAIS

PIALLVWEIRGKVHSKVKHLHDRYGDVVRIGPNALVYRAPRAWKEIYGYRTKKGQRTFQKDPSLYVPTPN

GVHAIITAAESDHIRMRRLLAHAFSDRALREQESLLHFYADLLVQKLHENLNHSHSEVVDIARWYNFTTF

DLIGDLAFGEPFQCLKDSKYHWWVSIMLDAVKLSVYLKVLWFFPILSPLTKLLVPRYLHQRREASFQLTV

EKVSRRLHRQTNRPDFISYILRHKDDENRMSRQEIDANAATFVLAGSETTAALLSGCTFYLLKNPHIYRR

LVTEIRSRFQHPSEIRLSSIATLSYLNAVLEESLRIYPPIPAMLPRLVPEEGAMINGEYVPAGTSVSMSL

WSTFHSSGNFHNPDSFVPERWLASPEEEASRCFTMDKKEAFQPFSYGPRNCLGQHLANAEMRLILAKVFW

HSDMELCPESENWADQESYNLWSRPPLMVMISRANGRNYEDNMV

 

#11

 

>CYP68P1 XP_756138.1 [Aspergillus fumigatus Af293] 41% to 68N1, 39% to 68A1

MDFLQRILGILSSEDVAPALFASSISVLFLILSYQVLYPPSKYSAFPTINGTRWLALSNRRILAEFVTDA

QGLMRNGLEKYDIFRIISSIGPMTILHPKYTDEIHNDRQLNFMAVLAKEMFPNYPGFDLFREGTDGSTVL

QDAVKFGSSRCLGKSTQLLSDETSTLLQKLWGDEPEWHEVTAKSSVHDIIAHLSALLFYGPELCSHKEWL

EVTDEYASVGFLAARQLRLWPPILRPIAQWFLPACRRLRYLASRTRGLIEPVIAARQKEKAICYSHGRQP

PVYDDAIEWTERAAKGRPYDAAMSPLLFSINALHTTTDLLTQVILDLSTQPDLIVALRQEILSVKPQQNG

WKNASLNQLLLMDSAIKESQRLKPTESILMRRYAMDDLTLADGNKIPKGTVLGIPIFGMRDPKIYVDPDM

YDGYRFQKMRDKPGFENKCQLVSTSPWHLGFGHGIHACPGRFLAAVQVKIILCYIVAKYDFKLAGGAPPK

VQSVGIELISDTEARLAVRRRQEMVIGLE

 

>EAL94100.1 [Aspergillus fumigatus Af293] 39% to 68A1

MDFLQRILGILSSEDVAPALFASSISVLFLILSYQVLYPPSKYSAFPTINGTRWLALSNRRILAEFVTDA

QGLMRNGLEKYDIFRIISSIGPMTILHPKYTDEIHNDRQLNFMAVLAKEMFPNYPGFDLFREGTDGSTVL

QDAVKFGSSRCLGKSTQLLSDETSTLLQKLWGDEPEWHEVTAKSSVHDIIAHLSALLFYGPELCSHKEWL

EVTDEYASVGFLAARQLRLWPPILRPIAQWFLPACRRLRYLASRTRGLIEPVIAARQKEKAICYSHGRQP

PVYDDAIEWTERAAKGRPYDAAMSPLLFSINALHTTTDLLTQVILDLSTQPDLIVALRQEILSVKPQQNG

WKNASLNQLLLMDSAIKESQRLKPTESILMRRYAMDDLTLADGNKIPKGTVLGIPIFGMRDPKIYVDPDM

YDGYRFQKMRDKPGFENKCQLVSTSPWHLGFGHGIHACPGRFLAAVQVKIILCYIVAKYDFKLAGGAPPK

VQSVGIELISDTEARLAVRRRQEMVIGLE

 

#12

 

>CYP504A7 XP_748171.1 phenylacetate 2-hydroxylase [Aspergillus fumigatus Af293] 85% to 504A1

MAQTIVLAVLAAVYLLIRYLNRTDIPKIKGLPEIPGVPIFGNLLQLGDRHATVAARWAKKYGPVFQVRMG

NKRIVFANSFESVKQLWIKDQSALISRPTFHTFHSVVSSSQGFTIGTSPWDESCKRRRKAAATALNRPAV

QSYMPIIDLESTASIKELLKDCRNGAVDINPTAYFQRFALNTSLTLNYGFRIEGNVDDALLREIVDVERG

VSNFRSTSNNWQDYIPLLRIFPKTNREAEEFRVRRDKYLTFLLDMLKERIAKGTDKPCITGNILKDPEAK

LNEAEVKSICLTMVSAGLDTVPGNLIMGIAYLASEAGQRIQQKAYEEILKVYPNGDAWEKCLVEEKVPYI

TALVKETLRFWTVIPICLPRESTKDIVYNGATIPAGTTFFMNAYAADYDDEHFKMPDKFIPERYLDVSEG

SGTPHYGYGAGSRMCAGSHLANRELYTAYIRLITAFTMHPARDPADQPILDAIECNAIPTALTTEPKPFK

VGFKPRDASKLQQWIAESDERTKEL

 

>EAL86133.1 phenylacetate 2-hydroxylase, putative [Aspergillus fumigatus Af293]

MAQTIVLAVLAAVYLLIRYLNRTDIPKIKGLPEIPGVPIFGNLLQLGDRHATVAARWAKKYGPVFQVRMG

NKRIVFANSFESVKQLWIKDQSALISRPTFHTFHSVVSSSQGFTIGTSPWDESCKRRRKAAATALNRPAV

QSYMPIIDLESTASIKELLKDCRNGAVDINPTAYFQRFALNTSLTLNYGFRIEGNVDDALLREIVDVERG

VSNFRSTSNNWQDYIPLLRIFPKTNREAEEFRVRRDKYLTFLLDMLKERIAKGTDKPCITGNILKDPEAK

LNEAEVKSICLTMVSAGLDTVPGNLIMGIAYLASEAGQRIQQKAYEEILKVYPNGDAWEKCLVEEKVPYI

TALVKETLRFWTVIPICLPRESTKDIVYNGATIPAGTTFFMNAYAADYDDEHFKMPDKFIPERYLDVSEG

SGTPHYGYGAGSRMCAGSHLANRELYTAYIRLITAFTMHPARDPADQPILDAIECNAIPTALTTEPKPFK

VGFKPRDASKLQQWIAESDERTKEL

 

#13

 

>CYP504B5 XP_752247.1 phenylacetate hydroxylase [Aspergillus fumigatus Af293]

68% to 504B4

MAIAAAVSSLQQNVLRHPLQSLAITALVVPIIYIIINEFIRASARVPGFKGPRGLPLIGNLAQIRKNAAE

QYRIWSKTYGPVYQIQLGNIPIIVVNSAAAAKILFGQNAQALSSRPEFYTFHRIVSNTAGTTIGTSPYSE

SLKRRRKGAASALNRPSVESYVSHLDVETKAFVAELLKYGNGGKTPVDPMAMIQRLSLSLSLTLNWGVRV

ASQEEDLFNEITHVEEEISKFRSTTGNLQDYIPLLRLNPFSTNSRKAKEMRDRRDRYLNALNRDLDDRME

KGIHKPCIQANVILDKEAKLNKEELISISLTMLSGGLDTITTLVAWSFCLLSRRPDIQEKAAQAIQDMFS

QDEPLCDAQDDQKCAYVAALVRECLRYYTVLRLALPRTSIKDITYDGKVIPKGTVFFLNSWACNMDPEVW

NDPEEFRPERWFEQPDAPMLTYGIGYRMCAGSLLANRELYLVFMRTLNSFHIEPHDDVDWHPINGNSDPT

SLVAIPKKYKVRFVPKNEQALTRALA

 

>CYP504B5 EAL90209.1 phenylacetate hydroxylase [Aspergillus fumigatus Af293]

MAIAAAVSSLQQNVLRHPLQSLAITALVVPIIYIIINEFIRASARVPGFKGPRGLPLIGNLAQIRKNAAE

QYRIWSKTYGPVYQIQLGNIPIIVVNSAAAAKILFGQNAQALSSRPEFYTFHRIVSNTAGTTIGTSPYSE

SLKRRRKGAASALNRPSVESYVSHLDVETKAFVAELLKYGNGGKTPVDPMAMIQRLSLSLSLTLNWGVRV

ASQEEDLFNEITHVEEEISKFRSTTGNLQDYIPLLRLNPFSTNSRKAKEMRDRRDRYLNALNRDLDDRME

KGIHKPCIQANVILDKEAKLNKEELISISLTMLSGGLDTITTLVAWSFCLLSRRPDIQEKAAQAIQDMFS

QDEPLCDAQDDQKCAYVAALVRECLRYYTVLRLALPRTSIKDITYDGKVIPKGTVFFLNSWACNMDPEVW

NDPEEFRPERWFEQPDAPMLTYGIGYRMCAGSLLANRELYLVFMRTLNSFHIEPHDDVDWHPINGNSDPT

SLVAIPKKYKVRFVPKNEQALTRALA

 

#14

 

>CYP505A13 gi70999962ref XP_754698.1 fatty acid hydroxylase [Aspergillus fumigatus Af293]

60% to 505A8

MSESKTVPIPGPRGVPLLGNIYDIEQEVPLRSINLMADQYGPIYRLTTFGWSRVFVSTHELVDEVCDEER

FTKVVTAGLNQIRNGVHDGLFTANFPGEENWAIAHRVLVPAFGPLSIRGMFDEMYDIATQLVMKWARHGP

TVPIMVTDDFTRLTLDTIALCAMGTRFNSFYHEEMHPFVEAMVGLLQGSGDRARRPALLNNLPTSENSKY

WDDIAFLRNLAQELVEARRKNPEDKKDLLNALILGRDPKTGKGLTDESIIDNMITFLIAGHETTSGLLSF

LFYYLLKTPNAYKKAQEEVDSVVGRRKITVEDMSRLPYLNAVMRETLRLRSTAPLIAVHAHPEKNKEDPV

TLGGGKYVLNKDEPIVIILDKLHRDPQVYGPDAEEFKPERMLDENFEKLPKNAWKPFGNGMRACIGRPFA

WQEALLVVAILLQNFNFQMDDPSYNLHIKQTLTIKPKDFHMRATLRHGLDATKLGIALSGSADRAPPESS

GAASRVRKQATPPAGQLKPMHIFFGSNTGTCETFARRLADDAVGYGFAADVQSLDSAMQNVPKDEPVVFI

TASYEGQPPDNAAHFFEWLSALKENELEGVNYAVFGCGHHDWQATFHRIPKAVNQLVAEHGGNRLCDLGL

ADAANSDMFTDFDSWGESTFWPAITSKFGGGKSDEPKPSSSLQVEVSTGMRASTLGLQLQEGLVIDNQLL

SAPDVPAKRMIRFKLPSDMSYRCGDYLAVLPVNPTSVVRRAIRRFDLPWDAMLTIRKPSQAPKGSTSIPL

DTPISAFELLSTYVELSQPASKRDLTALADAAITDADAQAELRYLASSPTRFTEEIVKKRMSPLDLLIRY

PSIKLPVGDFLAMLPPMRVRQYSISSSPLADPSECSITFSVLNAPALAAASLPPAERAEAEQYMGVASTY

LSELKPGERAHIAVRPSHSGFKPPMDLKAPMIMACAGSGLAPFRGFIMDRAEKIRGRRSSVGADGQLPEV

EQPAKAILYVGCRTKGKDDIHATELAEWAQLGAVDVRWAYSRPEDGSKGRHVQDLMLEDREELVSLFDQG

ARIYVCGSTGVGNGVRQACKDIYLERRRQLRQAARERGEEVPAEEDEDAAAEQFLDNLRTKERYATDVFT

 

>gi66852335gb EAL92660.1 fatty acid hydroxylase, putative [Aspergillus fumigatus Af293]

MSESKTVPIPGPRGVPLLGNIYDIEQEVPLRSINLMADQYGPIYRLTTFGWSRVFVSTHELVDEVCDEER

FTKVVTAGLNQIRNGVHDGLFTANFPGEENWAIAHRVLVPAFGPLSIRGMFDEMYDIATQLVMKWARHGP

TVPIMVTDDFTRLTLDTIALCAMGTRFNSFYHEEMHPFVEAMVGLLQGSGDRARRPALLNNLPTSENSKY

WDDIAFLRNLAQELVEARRKNPEDKKDLLNALILGRDPKTGKGLTDESIIDNMITFLIAGHETTSGLLSF

LFYYLLKTPNAYKKAQEEVDSVVGRRKITVEDMSRLPYLNAVMRETLRLRSTAPLIAVHAHPEKNKEDPV

TLGGGKYVLNKDEPIVIILDKLHRDPQVYGPDAEEFKPERMLDENFEKLPKNAWKPFGNGMRACIGRPFA

WQEALLVVAILLQNFNFQMDDPSYNLHIKQTLTIKPKDFHMRATLRHGLDATKLGIALSGSADRAPPESS

GAASRVRKQATPPAGQLKPMHIFFGSNTGTCETFARRLADDAVGYGFAADVQSLDSAMQNVPKDEPVVFI

TASYEGQPPDNAAHFFEWLSALKENELEGVNYAVFGCGHHDWQATFHRIPKAVNQLVAEHGGNRLCDLGL

ADAANSDMFTDFDSWGESTFWPAITSKFGGGKSDEPKPSSSLQVEVSTGMRASTLGLQLQEGLVIDNQLL

SAPDVPAKRMIRFKLPSDMSYRCGDYLAVLPVNPTSVVRRAIRRFDLPWDAMLTIRKPSQAPKGSTSIPL

DTPISAFELLSTYVELSQPASKRDLTALADAAITDADAQAELRYLASSPTRFTEEIVKKRMSPLDLLIRY

PSIKLPVGDFLAMLPPMRVRQYSISSSPLADPSECSITFSVLNAPALAAASLPPAERAEAEQYMGVASTY

LSELKPGERAHIAVRPSHSGFKPPMDLKAPMIMACAGSGLAPFRGFIMDRAEKIRGRRSSVGADGQLPEV

EQPAKAILYVGCRTKGKDDIHATELAEWAQLGAVDVRWAYSRPEDGSKGRHVQDLMLEDREELVSLFDQG

ARIYVCGSTGVGNGVRQACKDIYLERRRQLRQAARERGEEVPAEEDEDAAAEQFLDNLRTKERYATDVFT

 

#15

 

>AAHF01000014 Aspergillus fumigatus

CYP530A5

complement(join(613367..614597,614640..614689,

614717..614932))

locus_tag="Afu8g00760" third P450 of 8 on this accession

53% to CYP530A4, 73% to 530A2, add missing first exon

MLPLALVGAVGALVFLVFRLLSIGRRPKNYPPGPPTLPIIGNIHQ (0)

MPTRDAHLQLQKWAQEYGPVYSLILGTKPLIVLSSDQAVKALLD

KRSALYSHRQEMYIGQTLCSGGLRMLMMCAGSADPRRDTPQSGEEFQFRKMVHGLLNV

TAAKSYVPYQMLENKQMMYEFLTQPERFLYSIRRYSNALTTTMVFGWRTPTYEDAKMK

QLFDGFSEFAEINQTGTAALIDFFPWLRMLPDFLLPTQKRAKELHEREKALYLGHYLR

AKQDIRDGQIKPCFCVGLAEAQKSDGFSDDQAAYISGTLLEAGSDTTSNTLYAFVQAM

LLFPDVQRKLQEEIDRVVGPRMPTMDDEQDLQYVRACMKETLRWMPTTILGAVPHAVT

QDDEYMGYLIPKGAGVVNNVWAIHMDEKRHPNPRVFNPDRYKDDRQSLAEAAANPDAT

KRDQFTFGAGRRICPGIHIAERSLFLGISRMMWAFNVEPAVDEKGQPILPDPDRLTQG

FVCMPEEFPARITPRSQAKADMVIKEWKEAEQQCLDPETKQWLLSPVQ*

 

>CYP530A5 XP_747129.1 cytochrome P450 [Aspergillus fumigatus Af293]

MPTRDAHLQLQKWAQEYGPVYSLILGTKPLIVLSSDQAVKALLDKRSALYSHRQEMYIGQTLCSGGLRML

MMCAGSADPRRDTPQSGEEFQFRKMVHGLLNVTAAKSYVPYQMLENKQMMYEFLTQPERFLYSIRRYSNA

LTTTMVFGWRTPTYEDAKMKQLFDGFSEFAEINQTGTAALIDFFPWLRMLPDFLLPTQKRAKELHEREKA

LYLGHYLRAKQDIRDGQIKPCFCVGLAEAQKSDGFSDDQAAYISGTLLEAGSDTTSNTLYAFVQAMLLFP

DVQRKLQEEIDRVVGPRMPTMDDEQDLQYVRACMKETLRWMPTTILGAVPHAVTQDDEYMGYLIPKGAGV

VNNVWAIHMDEKRHPNPRVFNPDRYKDDRQSLAEAAANPDATKRDQFTFGAGRRICPGIHIAERSLFLGI

SRMMWAFNVEPAVDEKGQPILPDPDRLTQGFVCMPEEFPARITPRSQAKADMVIKEWKEAEQQCLDPETK

QWLLSPVQ

 

>CYP530A5 EAL85091.1 cytochrome P450, putative [Aspergillus fumigatus Af293]

MPTRDAHLQLQKWAQEYGPVYSLILGTKPLIVLSSDQAVKALLDKRSALYSHRQEMYIGQTLCSGGLRML

MMCAGSADPRRDTPQSGEEFQFRKMVHGLLNVTAAKSYVPYQMLENKQMMYEFLTQPERFLYSIRRYSNA

LTTTMVFGWRTPTYEDAKMKQLFDGFSEFAEINQTGTAALIDFFPWLRMLPDFLLPTQKRAKELHEREKA

LYLGHYLRAKQDIRDGQIKPCFCVGLAEAQKSDGFSDDQAAYISGTLLEAGSDTTSNTLYAFVQAMLLFP

DVQRKLQEEIDRVVGPRMPTMDDEQDLQYVRACMKETLRWMPTTILGAVPHAVTQDDEYMGYLIPKGAGV

VNNVWAIHMDEKRHPNPRVFNPDRYKDDRQSLAEAAANPDATKRDQFTFGAGRRICPGIHIAERSLFLGI

SRMMWAFNVEPAVDEKGQPILPDPDRLTQGFVCMPEEFPARITPRSQAKADMVIKEWKEAEQQCLDPETK

QWLLSPVQ

 

#16

 

>CYP539D2 XP_750735.1 cytochrome P450 alkane hydroxylase [Aspergillus fumigatus Af293]

71% to 539D1

MIEELLAQIHSGWAALYVLGALFFACLIRKAQVSMEISKLGYRAPRIRFYLPWAIDFLYEASKANEDGTD

HVFLHQAILNAKGATQLDCVKTAELNGGITRRVILTKDPENIKAILTGQFADYGKGEEFHEQWKDFLGDS

IFATDGELWSRSRHLIRPMFVRDRIVDTEIFEKHVQNLIPLLEGSNSPSGSKAVDVGSLFFRFTLDAATD

YLLGQGTNSLHNPETRFAEAFGYVKHRQSEIFRLGDGISMFSFIVAKRKFRRELKVMDDFFQPYIKRALS

LTPSELDQKISKRETFLDALARFTRDPRVLRDQIVAVLLAGRDTTAAVLTFCIFELARNPDVVAKLREEI

SARLGLGPSAQKSSYNDLKEMKYLNAVLNETMRLYPPVPFNVRYSLRDTTLPRGGGPDGLSPVGVRANTR

VIYSTMIMQRSAENYDPPGSPNYFDPEKWLPDRWLSGWQPKPWQYIPFNGGPRICLGQQFATIEMGYTVV

RILQAFERIHAMPANGKERVEDPVLKFEVTLSPGSELNCVFVREGEDTLPLKDG

 

>EAL88697.1 cytochrome P450 alkane hydroxylase, putative [Aspergillus fumigatus Af293]

MIEELLAQIHSGWAALYVLGALFFACLIRKAQVSMEISKLGYRAPRIRFYLPWAIDFLYEASKANEDGTD

HVFLHQAILNAKGATQLDCVKTAELNGGITRRVILTKDPENIKAILTGQFADYGKGEEFHEQWKDFLGDS

IFATDGELWSRSRHLIRPMFVRDRIVDTEIFEKHVQNLIPLLEGSNSPSGSKAVDVGSLFFRFTLDAATD

YLLGQGTNSLHNPETRFAEAFGYVKHRQSEIFRLGDGISMFSFIVAKRKFRRELKVMDDFFQPYIKRALS

LTPSELDQKISKRETFLDALARFTRDPRVLRDQIVAVLLAGRDTTAAVLTFCIFELARNPDVVAKLREEI

SARLGLGPSAQKSSYNDLKEMKYLNAVLNETMRLYPPVPFNVRYSLRDTTLPRGGGPDGLSPVGVRANTR

VIYSTMIMQRSAENYDPPGSPNYFDPEKWLPDRWLSGWQPKPWQYIPFNGGPRICLGQQFATIEMGYTVV

RILQAFERIHAMPANGKERVEDPVLKFEVTLSPGSELNCVFVREGEDTLPLKDG

 

#17

 

>CYP539F1 XP_747469.1 cytochrome P450 alkane hydroxylase [Aspergillus fumigatus Af293]

51% to 539B2, 50% to 539A3, 39% to 539C1, 43% to 539D1, 39% to 539E1

MQGNQMTTTTTTILDYLLLLSLSSYLLKTILGNLSSLKEGFTSLWALKIIGCLFLTIVARPIWNILFSSH

TPRDSKLPQIRTFLPLGIDYITRGIIYSAQNKSLVFWEELFRKYHPFQTLEVRLGPQTVIVSRDPQVVKA

LLTTQFGDFGKGERFHTEWREFLGDAIFTTDGDKWHASRALIRPMFTPDRVSNLSTFERHVQKLLRILES

PRHERQPVNVLDLCLRLTMDIATDFLLGQSVDSLSNPTHRFSAAFADVQRIQSWITMAGPLQVFLPKAKY

YEGLKTINSFVDPFITRTLALGRRSFEEMEGSEEEYNFLEGLATFTQDPKVIRDQLISVLLAARDTTAAT

LARTLYELSGHPDVVQRLREEILAQVGTASAPTYADLKNMRYLQAIHKETLRLYPAIPFNMRVALSDTTL

PSGGGPSGTQPVHVKKDTIVAYSPLYMHRSDLYPDAYADGTPFSDPREYHPHRWMYPGSKTADSEKINEG

PWIPKPWTYIPFNGGPRICLGQQFALAEMGYTLVRIFQKYKCLERRMRAEDGGLMRANIVLTPAQEVNVV

FIQSLSTSGAVMLILYRLRS

 

>EAL85431.1 cytochrome P450 alkane hydroxylase [Aspergillus fumigatus Af293]

MQGNQMTTTTTTILDYLLLLSLSSYLLKTILGNLSSLKEGFTSLWALKIIGCLFLTIVARPIWNILFSSH

TPRDSKLPQIRTFLPLGIDYITRGIIYSAQNKSLVFWEELFRKYHPFQTLEVRLGPQTVIVSRDPQVVKA

LLTTQFGDFGKGERFHTEWREFLGDAIFTTDGDKWHASRALIRPMFTPDRVSNLSTFERHVQKLLRILES

PRHERQPVNVLDLCLRLTMDIATDFLLGQSVDSLSNPTHRFSAAFADVQRIQSWITMAGPLQVFLPKAKY

YEGLKTINSFVDPFITRTLALGRRSFEEMEGSEEEYNFLEGLATFTQDPKVIRDQLISVLLAARDTTAAT

LARTLYELSGHPDVVQRLREEILAQVGTASAPTYADLKNMRYLQAIHKETLRLYPAIPFNMRVALSDTTL

PSGGGPSGTQPVHVKKDTIVAYSPLYMHRSDLYPDAYADGTPFSDPREYHPHRWMYPGSKTADSEKINEG

PWIPKPWTYIPFNGGPRICLGQQFALAEMGYTLVRIFQKYKCLERRMRAEDGGLMRANIVLTPAQEVNVV

FIQSLSTSGAVMLILYRLRS

 

#18

 

>CYP540B7 XP_753637.1 [Aspergillus fumigatus Af293]

MASQQFYLLGESISSARTISLDGINDLEGLRNLIASHFAIVEPSGIEFSRQDVSLTDLHEITSATTPVAI

TIDGHAVRNAPSPKGLPFFGNFFQIFPDHLGNHQRLFEQYGPLIKTNTLGRTVYQTNDPILSAIVFNESD

FFTKKINEAHPLYSLKTPAAGVFLGDTDTPEWRVAHKFLPPALGPKAVRHYAPTMQKTVEDACTIFDQLD

AQGEAWNVYQYMLKLGSQAVGKLTLGLDFEHFSSADAPIHEMVHLIAEVLSLNKKVTSKGDWYASLPFGD

PKRLRDTKARIEQLVEESVQKAQRGGVEDLPLQDAALRAANMVDYALRATDNKGEKLPKSSLVWALVVAT

GAGFTTTSSLLSWLIYGLVTYPGMQDRLLQELVDHGFDDTTEITADFTDQLTFLDKYIKETQRRHNPSFQ

PGRTAKLDLILPGGYKIPQDAVVIPALHHIHNNPAIWDNPARFNPDRWDTDEVKQRHKAAYIPFGTGPRM

CIGFNFALQEIKVFLPKLIYRYKFTREGDGPIEYDPMFQLIRPNNLYVRAERRVKWPYKSDA

 

>CYP540B7 EAL91599.1 [Aspergillus fumigatus Af293] 76% to 540B4

MASQQFYLLGESISSARTISLDGINDLEGLRNLIASHFAIVEPSGIEFSRQDVSLTDLHEITSATTPVAI

TIDGHAVRNAPSPKGLPFFGNFFQIFPDHLGNHQRLFEQYGPLIKTNTLGRTVYQTNDPILSAIVFNESD

FFTKKINEAHPLYSLKTPAAGVFLGDTDTPEWRVAHKFLPPALGPKAVRHYAPTMQKTVEDACTIFDQLD

AQGEAWNVYQYMLKLGSQAVGKLTLGLDFEHFSSADAPIHEMVHLIAEVLSLNKKVTSKGDWYASLPFGD

PKRLRDTKARIEQLVEESVQKAQRGGVEDLPLQDAALRAANMVDYALRATDNKGEKLPKSSLVWALVVAT

GAGFTTTSSLLSWLIYGLVTYPGMQDRLLQELVDHGFDDTTEITADFTDQLTFLDKYIKETQRRHNPSFQ

PGRTAKLDLILPGGYKIPQDAVVIPALHHIHNNPAIWDNPARFNPDRWDTDEVKQRHKAAYIPFGTGPRM

CIGFNFALQEIKVFLPKLIYRYKFTREGDGPIEYDPMFQLIRPNNLYVRAERRVKWPYKSDA

 

#19

 

>CYP540B8 XP_748718.1 [Aspergillus fumigatus Af293]

75% to 540B7, 73% to 540B4

MSTTTTKLFHLLGEPLSTAKEIQFESTTTYGDLRHLVAAHFAIVEPSGIGFISQDSILHDVPEIAASDEI

ISITIDGKAVREIPGPKGLPVIGNFFEVYPDHLGNHQRLFEQYGPIFKTTNMGRTVYHTNDPQLSSIIFA

ETDFFTKKINAAHPLHPIKNQEAGVFLGDTDTPEWRTAHKFLPPALGPKAVRHYAPMMQETVEDAFTVFD

ALDERGEAWNVYQYMLKLGSQAVGKLVLGIDFKHFSSIDEPPHELVYRIAESLELNKKVTAWGDWYAKLP

FGDPQRLRNARGRIIEMVNESIQNAARGGIEDLPLQDAALKASNMVDYALRATDNKGEKLPKTSLMQALV

VATGAGFTTTSSLLSWLIYGLVTYPGVQERLLQELIDNGIDADTQLTADLTDRLTFLDKFIKETQRRHNP

SYQPGRTAKVDMILPGGYKLPQDSVVIGALHHLHNNPDVWSNPARFDPDRWDTEEVKNRHKTAYIPFATG

PRMCIGFNFALQEVKVFLPKLVYRYKFTRENDGHIEYDPMFQLIRPTNLYVRAERRVKWPPRSDNAVPSP

SL

 

>CYP540B8 EAL86680.1 [Aspergillus fumigatus Af293] 75% to 540B7, 73% to 540B4

MSTTTTKLFHLLGEPLSTAKEIQFESTTTYGDLRHLVAAHFAIVEPSGIGFISQDSILHDVPEIAASDEI

ISITIDGKAVREIPGPKGLPVIGNFFEVYPDHLGNHQRLFEQYGPIFKTTNMGRTVYHTNDPQLSSIIFA

ETDFFTKKINAAHPLHPIKNQEAGVFLGDTDTPEWRTAHKFLPPALGPKAVRHYAPMMQETVEDAFTVFD

ALDERGEAWNVYQYMLKLGSQAVGKLVLGIDFKHFSSIDEPPHELVYRIAESLELNKKVTAWGDWYAKLP

FGDPQRLRNARGRIIEMVNESIQNAARGGIEDLPLQDAALKASNMVDYALRATDNKGEKLPKTSLMQALV

VATGAGFTTTSSLLSWLIYGLVTYPGVQERLLQELIDNGIDADTQLTADLTDRLTFLDKFIKETQRRHNP

SYQPGRTAKVDMILPGGYKLPQDSVVIGALHHLHNNPDVWSNPARFDPDRWDTEEVKNRHKTAYIPFATG

PRMCIGFNFALQEVKVFLPKLVYRYKFTRENDGHIEYDPMFQLIRPTNLYVRAERRVKWPPRSDNAVPSP

SL

 

#20

 

>CYP541B2v1  XM_742988.1 Aspergillus fumigatus

67% to 541B1 49% to 541A1, 98% to CYP541B4Nf allele

MPTPIPLPSGLPILGNLLSISPGNTWGSFNKLAVNNKNFYPIFK

ITILGHDIVFITSAKLLEEICDEKRFRKCVTGPIVEIREAVHDSLFTAYHDEESWGIA

HRIMAPLMTPEAVIDAFAGMRETATDLVKKWTAGPRQRINVSNDMDRLNHAANMLCFF

DQRIHCLEGPEPSVLQAMEAATFEALRRPTRPKVLKWLIYQRRFDRYIKTMRDYAAEI

VAKRRAAPTEKKDMLHAIMHGTDPQTGKALTESQYLDEIINLFIGSATAANLVSFALY

YLMKNPHEIARAREEIDAVVGGPAAQLEHEHLARLPYCEAILRESLRLSATAPGFNIE

PIPDLEQPVLLAGGEYQVPNKQPLIALLAAVNRDPEVFEDPDAFKPERMVGEKYDRLP

SGVKKGFGNGKRECFGKRYAWEWSFMILVTIMKDVDFVLADKNYKTEVGGVNYNGAFS

TKPLGLFALTGPRQSV*

 

>CYP541B2v1 XP_748081.1 [Aspergillus fumigatus Af293]

MPTPIPLPSGLPILGNLLSISPGNTWGSFNKLAVNNKNFYPIFKITILGHDIVFITSAKLLEEICDEKRF

RKCVTGPIVEIREAVHDSLFTAYHDEESWGIAHRIMAPLMTPEAVIDAFAGMRETATDLVKKWTAGPRQR

INVSNDMDRLNHAANMLCFFDQRIHCLEGPEPSVLQAMEAATFEALRRPTRPKVLKWLIYQRRFDRYIKT

MRDYAAEIVAKRRAAPTEKKDMLHAIMHGTDPQTGKALTESQYLDEIINLFIGSATAANLVSFALYYLMK

NPHEIARAREEIDAVVGGPAAQLEHEHLARLPYCEAILRESLRLSATAPGFNIEPIPDLEQPVLLAGGEY

QVPNKQPLIALLAAVNRDPEVFEDPDAFKPERMVGEKYDRLPSGVKKGFGNGKRECFGKRYAWEWSFMIL

VTIMKDVDFVLADKNYKTEVGGVNYNGAFSTKPLGLFALTGPRQSV

 

>CYP541B2v1 EAL86043.1 cytochrome P450, putative [Aspergillus fumigatus Af293]

MPTPIPLPSGLPILGNLLSISPGNTWGSFNKLAVNNKNFYPIFKITILGHDIVFITSAKLLEEICDEKRF

RKCVTGPIVEIREAVHDSLFTAYHDEESWGIAHRIMAPLMTPEAVIDAFAGMRETATDLVKKWTAGPRQR

INVSNDMDRLNHAANMLCFFDQRIHCLEGPEPSVLQAMEAATFEALRRPTRPKVLKWLIYQRRFDRYIKT

MRDYAAEIVAKRRAAPTEKKDMLHAIMHGTDPQTGKALTESQYLDEIINLFIGSATAANLVSFALYYLMK

NPHEIARAREEIDAVVGGPAAQLEHEHLARLPYCEAILRESLRLSATAPGFNIEPIPDLEQPVLLAGGEY

QVPNKQPLIALLAAVNRDPEVFEDPDAFKPERMVGEKYDRLPSGVKKGFGNGKRECFGKRYAWEWSFMIL

VTIMKDVDFVLADKNYKTEVGGVNYNGAFSTKPLGLFALTGPRQSV

 

#21

 

>AAHF01000014 Aspergillus fumigatus

CYP547C2

complement(join(100751..101365,101422..101806,

101859..102304,102353..102550))

locus_tag="Afu8g02610" first P450 of 8 on this accession

71% to 547C1 Aspergillus nidulans note: check SVWARYFTLSRLT for intron

MADTLLAIASVSLAEGYFLQRSVLKEYSFHSVCLGAVGVNLALK

IFWDFIIYPFFITANRHLPTVKGTFVNGKVIFDNPRGRLPLQWMKTIPNEGLIHFRDV

FNRSHLLPTTHQALLDIMSTNTYDFEKPWRAREFLARIIGFGLILSEGAAHKKQRKAL

TPAFNIKNIRSLYSLMWEKTGLFLDELEKEIRQNPMEGTSPEDGVGKVEMSMWAR (2)

LPSRLTLDIIGPAAMGRDFRSLHNPENKVADSFLAILEPTKEKMAFLAINFILPQWFARRLPWR

LNNVIDTETGFLRDLCKDIVREKRNTIVSSNMTAKELEADILGTMMVGGDFTDDELVD

QMLTFLAAGHETTASALTWACYLLTLHPDVQERLRTEIREHIPSGNHPISWSDLESMP

LLNGVCQEVLRLYPTVPITIREAVRDTTIAGKHVPKGTRILICPYAINRSPEFWGDNG

EEFLPERWIDHDKNGQKVVNHNGGASTNYAQITFLHGQRSCIGKDFARAELRCAVAGV

VGRFKFEMQDPKQEIHIAGAVTTKPVEGMHLKMSRVDEW*

 

>CYP547C2 XP_746946.1 [Aspergillus fumigatus Af293]

MADTLLAIASVSLAEGYFLQRSVLKEYSFHSVCLGAVGVNLALKIFWDFIIYPFFITANRHLPTVKGTFV

NGKVIFDNPRGRLPLQWMKTIPNEGLIHFRDVFNRSHLLPTTHQALLDIMSTNTYDFEKPWRAREFLARI

IGFGLILSEGAAHKKQRKALTPAFNIKNIRSLYSLMWEKTGLFLDELEKEIRQNPMEGTSPEDGVGKVEM

SMWASRLTLDIIGPAAMGRDFRSLHNPENKVADSFLAILEPTKEKMAFLAINFILPQWFARRLPWRLNNV

IDTETGFLRDLCKDIVREKRNTIVSSNMTAKELEADILGTMMVGGDFTDDELVDQMLTFLAAGHETTASA

LTWACYLLTLHPDVQERLRTEIREHIPSGNHPISWSDLESMPLLNGVCQEVLRLYPTVPITIREAVRDTT

IAGKHVPKGTRILICPYAINRSPEFWGDNGEEFLPERWIDHDKNGQKVVNHNGGASTNYAQITFLHGQRS

CIGKDFARAELRCAVAGVVGRFKFEMQDPKQEIHIAGAVTTKPVEGMHLKMSRVDEW

 

>CYP547C2 EAL84908.1 [Aspergillus fumigatus Af293]

MADTLLAIASVSLAEGYFLQRSVLKEYSFHSVCLGAVGVNLALKIFWDFIIYPFFITANRHLPTVKGTFV

NGKVIFDNPRGRLPLQWMKTIPNEGLIHFRDVFNRSHLLPTTHQALLDIMSTNTYDFEKPWRAREFLARI

IGFGLILSEGAAHKKQRKALTPAFNIKNIRSLYSLMWEKTGLFLDELEKEIRQNPMEGTSPEDGVGKVEM

SMWASRLTLDIIGPAAMGRDFRSLHNPENKVADSFLAILEPTKEKMAFLAINFILPQWFARRLPWRLNNV

IDTETGFLRDLCKDIVREKRNTIVSSNMTAKELEADILGTMMVGGDFTDDELVDQMLTFLAAGHETTASA

LTWACYLLTLHPDVQERLRTEIREHIPSGNHPISWSDLESMPLLNGVCQEVLRLYPTVPITIREAVRDTT

IAGKHVPKGTRILICPYAINRSPEFWGDNGEEFLPERWIDHDKNGQKVVNHNGGASTNYAQITFLHGQRS

CIGKDFARAELRCAVAGVVGRFKFEMQDPKQEIHIAGAVTTKPVEGMHLKMSRVDEW

 

#22

 

>CYP548D2 XP_747856.1 cytochrome P450 [Aspergillus fumigatus Af293] 70% to 548D1

MLVQPLLENLSVWGAVQGILSLLGVLTLAYVTYNRFFHPLRSIPGPFLASITPWVQLYHGLKGDRHLWLH

RLHEKYGSHVRAAPNFVSINTDRGLHDIYGHGKRLRKANFYNAFPAIKGVYNTHNAIDKAMHGRKRRVLS

QAFSDQALKSMEDVMLLHVRQLCEILTGGLDGPKGEKSATAVFNLGDWFSYLTYDVMGELCFGKSFDMLI

SSGRRKLIELVDRAANRHYVVWPQKKKCGLWMPLDTWHLDQILIHKLTNDRWNFIMNSRVEANERAKERT

QAGHDAKKDFFYYLLNAKDPETGKGLTTPELWGEANVLMIAGSDTTSTTMSATIFYLVRNPRAMELLRKE

IRENFSSVEEIVTGPKLNELVYLKACIDEAMRLAPAVPGAPPREVMEGGAMIDGVFLPEGTDCGTPTYSI

HRQPEYYREPEVYIPERWIEGATCQAGSESWTTSKESVELARRAFCPFSIGPRGCIGKSMAFMEMRLTIA

RLMFLFDLELADHKGEDEKGQLALVDHFTSAKYGPNVVVRKRV

 

>EAL85818.1 cytochrome P450, putative [Aspergillus fumigatus Af293]

MLVQPLLENLSVWGAVQGILSLLGVLTLAYVTYNRFFHPLRSIPGPFLASITPWVQLYHGLKGDRHLWLH

RLHEKYGSHVRAAPNFVSINTDRGLHDIYGHGKRLRKANFYNAFPAIKGVYNTHNAIDKAMHGRKRRVLS

QAFSDQALKSMEDVMLLHVRQLCEILTGGLDGPKGEKSATAVFNLGDWFSYLTYDVMGELCFGKSFDMLI

SSGRRKLIELVDRAANRHYVVWPQKKKCGLWMPLDTWHLDQILIHKLTNDRWNFIMNSRVEANERAKERT

QAGHDAKKDFFYYLLNAKDPETGKGLTTPELWGEANVLMIAGSDTTSTTMSATIFYLVRNPRAMELLRKE

IRENFSSVEEIVTGPKLNELVYLKACIDEAMRLAPAVPGAPPREVMEGGAMIDGVFLPEGTDCGTPTYSI

HRQPEYYREPEVYIPERWIEGATCQAGSESWTTSKESVELARRAFCPFSIGPRGCIGKSMAFMEMRLTIA

RLMFLFDLELADHKGEDEKGQLALVDHFTSAKYGPNVVVRKRV

 

#23

 

>CYP566C2 XP_750865.1 cytochrome P450 [Aspergillus fumigatus Af293]

65% to 566C1

some errors in assembly

MVRYSPFSRATVALLTCQRDTGPIVRVGPNQLSFATVEAQKMIYNAKPTHTGSDELFGREGTLQDVLLSM

ILGAANIGSLSNRAEHKKMRKRLQPGFTSKALFEQESLLRLHMDRLLERLAQDTGVIDLTEYFSTFLWDL

IGDLSFGEPLTRCGRWLRYTKGVFPSWKLSIMPFRKLKESLGWLCSWCPQRLCARSCPLPHSGSMTILLL

FLTHIIPAVILTPEVQHGWKMCSSFCDIKAPLTGGIFSSCIDRQDGRSDFITHITGDKSRNPTELELSYE

ELHSNATVILIAGYKTTETSLSALFYRLLSTPGVLKKLQSELFRNFPSIDEITGKKLLSLPYLNGCVNES

LRLTPPVAGKFASRRSPGAIIEGFYVPKGTEVFTETYTMQRSPQYWHAPDEYRPERWVERGEGSPYAQDV

HEAFKPFSSGPRACLGREMALQTLRLTTALLVYRFHMKIVDEKRFVWEQDTDSRMIYSQYQIKAILQDRL

T

 

>EAL88827.1 cytochrome P450, putative [Aspergillus fumigatus Af293]

MVRYSPFSRATVALLTCQRDTGPIVRVGPNQLSFATVEAQKMIYNAKPTHTGSDELFGREGTLQDVLLSM

ILGAANIGSLSNRAEHKKMRKRLQPGFTSKALFEQESLLRLHMDRLLERLAQDTGVIDLTEYFSTFLWDL

IGDLSFGEPLTRCGRWLRYTKGVFPSWKLSIMPFRKLKESLGWLCSWCPQRLCARSCPLPHSGSMTILLL

FLTHIIPAVILTPEVQHGWKMCSSFCDIKAPLTGGIFSSCIDRQDGRSDFITHITGDKSRNPTELELSYE

ELHSNATVILIAGYKTTETSLSALFYRLLSTPGVLKKLQSELFRNFPSIDEITGKKLLSLPYLNGCVNES

LRLTPPVAGKFASRRSPGAIIEGFYVPKGTEVFTETYTMQRSPQYWHAPDEYRPERWVERGEGSPYAQDV

HEAFKPFSSGPRACLGREMALQTLRLTTALLVYRFHMKIVDEKRFVWEQDTDSRMIYSQYQIKAILQDRLT

 

#24

 

>CYP573A6 XP_748848.1 cytochrome P450 monooxygenase [Aspergillus fumigatus Af293]

68% to 573A3An

MGLREEILARLTLSHVVLGLVAYVLLKFVYQIVYYHFFHPLSVFPGPFWGGVTRLWIAWHNLRETELPTV

YALTKKYATRPNCRTSTIATPTRQDTTSPEVLARRSHCSTCDRIRRTQLFESTWRDLPQYSFTNVKKMEP

LVDIRIQHWIDKLNEKFAQTGEIFDFSWWAVYMAYDIISEIGFGAPFGFVEQGQDVGGLIQGFHDGLPAF

GLLARLHPFTSWMKTTFMKKYLVATPQDDSGIGVLMRFRDRLIDQRFRELETKKDIGRIDLLQTFIEART

EDGSPLDMEYLKAEVLLVLLAGADTTGTVFQALVHFLLTHRDAYRRLMEEIDAATAQGLISDPVPQYDEI

VEHLPYYVACVRETLRLNPPAPNIFPRYVSEPGMDLYGKFAPAGTEISGNPWIMQRDKKLYGEDAEEFKP

ERWLDAERAKRYNKYSFTFGYGARVCLGRDIAMMELYKGPLQFFRRYHVQTVTDKPKARFVIKGGVGFYR

DVWVTIDRRLPQKA

 

>EAL86810.1 cytochrome P450 monooxygenase, putative [Aspergillus fumigatus Af293]

MGLREEILARLTLSHVVLGLVAYVLLKFVYQIVYYHFFHPLSVFPGPFWGGVTRLWIAWHNLRETELPTV

YALTKKYATRPNCRTSTIATPTRQDTTSPEVLARRSHCSTCDRIRRTQLFESTWRDLPQYSFTNVKKMEP

LVDIRIQHWIDKLNEKFAQTGEIFDFSWWAVYMAYDIISEIGFGAPFGFVEQGQDVGGLIQGFHDGLPAF

GLLARLHPFTSWMKTTFMKKYLVATPQDDSGIGVLMRFRDRLIDQRFRELETKKDIGRIDLLQTFIEART

EDGSPLDMEYLKAEVLLVLLAGADTTGTVFQALVHFLLTHRDAYRRLMEEIDAATAQGLISDPVPQYDEI

VEHLPYYVACVRETLRLNPPAPNIFPRYVSEPGMDLYGKFAPAGTEISGNPWIMQRDKKLYGEDAEEFKP

ERWLDAERAKRYNKYSFTFGYGARVCLGRDIAMMELYKGPLQFFRRYHVQTVTDKPKARFVIKGGVGFYR

DVWVTIDRRLPQKA

 

#25

 

>CYP578B2 XP_748713.1 cytochrome P450 [Aspergillus fumigatus Af293]

65% to 578B1

MFLLTIVAVSSFLVLLLYKILISPYFLSPLSKIPNAHFTAPISDYWIERKRRSGEEVLTIYNLHREHGPV

VRLGPNELSVNSLGGLHVIYTGAFEKHSFYRDTFVNFLTDNLVGMLPNDSHARQKRMLSKIYSKSYLHES

VDLRNASSIILSQRLLPVLKNAAEKGEAINVLPLFQAVGMDFTSAFLFGTANSTTFLFDLPGWKRWLVEY

ERFKTLSGKERYLGFIERWCLSLCSRVQSNEHPNDVPVATNPVVYSQLRQSLEKHPDQRPLDLALASELL

DHLVAGHETSGITFVYMMWELSKRPRLQAELRQELLTLSPSLRYPLVELGDGSLPLLPSPAAIDSLPLLD

AVVRETLRVHSPAPAPLPRITPSSSEGIAIEGYDRIPGGVKVSSSSYTLHRISEVYPQPFEWLPERWLDP

GPGKIHDMRRLFWPFGSGGRMCLGSNFALQEIKLVMAAVYSNYTTSIVDDEGIEQDYAFISLPKGRKLML

KFTPVKL

 

>EAL86675.1 cytochrome P450, putative [Aspergillus fumigatus Af293]

MFLLTIVAVSSFLVLLLYKILISPYFLSPLSKIPNAHFTAPISDYWIERKRRSGEEVLTIYNLHREHGPV

VRLGPNELSVNSLGGLHVIYTGAFEKHSFYRDTFVNFLTDNLVGMLPNDSHARQKRMLSKIYSKSYLHES

VDLRNASSIILSQRLLPVLKNAAEKGEAINVLPLFQAVGMDFTSAFLFGTANSTTFLFDLPGWKRWLVEY

ERFKTLSGKERYLGFIERWCLSLCSRVQSNEHPNDVPVATNPVVYSQLRQSLEKHPDQRPLDLALASELL

DHLVAGHETSGITFVYMMWELSKRPRLQAELRQELLTLSPSLRYPLVELGDGSLPLLPSPAAIDSLPLLD

AVVRETLRVHSPAPAPLPRITPSSSEGIAIEGYDRIPGGVKVSSSSYTLHRISEVYPQPFEWLPERWLDP

GPGKIHDMRRLFWPFGSGGRMCLGSNFALQEIKLVMAAVYSNYTTSIVDDEGIEQDYAFISLPKGRKLML

KFTPVKL

 

#26

 

>AAHF01000007.1 Aspergillus fumigatus Af293 chromosome 1 afu1_98, whole genome

CYP578C3 74% to 578C1, 43% to CYP578D1, 46% to 578A2

1250155  MVVSIYTSLSIVILLLFVAYKAIVYPVFLSPLAKIPNAHWSAPVSPAWILWKRFRSQNNSTIHAAHE  1250355

1250356  RLGPIVRLGPSEISINCVEGGIKTVYSGGFEKHEWYPRVFGSFG (2)

1250548  TVSMFTMTGSKDHSVRKRMLSNIYSKSFLQSSPHMRLISRTIVYDRLLPILYDAAT  1250715

1250716  SSRPVDVHDLNQGLTMDFVSAYLYGVTNGTNFLQDAPYRQRMLHLYQSRKPFEFYHQEVP  1250895

1250896  NLLSWTKSLGIRLIPRYCDQANEILDSWGLGLCDKAEESLKSNRLEDEPAVYKHLKQM  1251069

1251070  ILKHLPENKNDVEYARILEQQRLDIACEMYDHLTAGHETSAVALTYLLWELSKRPELQDA  1251249

1251250  LRAELSTLEPMVIFPRPSESAELPPAKSIDSLPLLEAIVTETLRLHAPIPGIQPRVTPY  1251426

1251427  PSCTLAGYNNIPPKTRVNAQAYSLHRNPEVFPDPETWEPKRWLKDVNTPSELEERRRWFW  1251606

1251607  AFGSGGRMCVGSNLALQEMKLVVAAVYTNFKTSIVSDDNMEAIDAYTVKPTGESLILRFELVE* 1251848

 

>CYP578C3 XP_750187.1 [Aspergillus fumigatus Af293]

MKLLTEARHLRRTVSMFTMTGSKDHSVRKRMLSNIYSKSFLQSSPHMRLISRTIVYDRLLPILYDAATSS

RPVDVHDLNQGLTMDFVSAYLYGVTNGTNFLQDAPYRQRMLHLYQSRKPFEFYHQEVPNLLSWTKSLGIR

LIPRYCDQANEILDSWGLGLCDKAEESLKSNRLEDEPAVYKHLKQMILKHLPENKNDVEYARILEQQRLD

IACEMYDHLTAGHETSAVALTYLLWELSKRPELQDALRAELSTLEPMVIFPRPSESAELPPAKSIDSLPL

LEAIVTETLRLHAPIPGIQPRVTPYPSCTLAGYNNIPPKTRVNAQAYSLHRNPEVFPDPETWEPKRWLKD

VNTPSELEERRRWFWAFGSGGRMCVGSNLALQEMKLVVAAVYTNFKTSIVSDDNMEAIDAYTVKPTGESL

ILRFELVE

 

>CYP578C3 EAL88149.1 [Aspergillus fumigatus Af293]

MKLLTEARHLRRTVSMFTMTGSKDHSVRKRMLSNIYSKSFLQSSPHMRLISRTIVYDRLLPILYDAATSS

RPVDVHDLNQGLTMDFVSAYLYGVTNGTNFLQDAPYRQRMLHLYQSRKPFEFYHQEVPNLLSWTKSLGIR

LIPRYCDQANEILDSWGLGLCDKAEESLKSNRLEDEPAVYKHLKQMILKHLPENKNDVEYARILEQQRLD

IACEMYDHLTAGHETSAVALTYLLWELSKRPELQDALRAELSTLEPMVIFPRPSESAELPPAKSIDSLPL

LEAIVTETLRLHAPIPGIQPRVTPYPSCTLAGYNNIPPKTRVNAQAYSLHRNPEVFPDPETWEPKRWLKD

VNTPSELEERRRWFWAFGSGGRMCVGSNLALQEMKLVVAAVYTNFKTSIVSDDNMEAIDAYTVKPTGESL

ILRFELVE

 

#27

 

>CYP584E2 XP_749919.1 cytochrome P450 alkane hydroxylase [Aspergillus fumigatus Af293]

64% to 584E1

MTSNYSISLVAGAIAVFVYTLSVLRRKWTQYRFARAHNCQAPPRLASKDPLFGLDTIYATVQNVKEHKFL

ERAQARFDAVGHTIQTRRLLQTIIFTRDPQNIKTILSLRFKDYALGHRYKTFGPLLGHGIFTTDGEHWAQ

SRAMIRPNFVREQVADLAIFEAQMADLLELIPNDGRTVDLQDLFFSYTIDSATEFLFGQSVQSLKKRRSG

GRDAHAEDDFASAFNYAQHAIATRIRLGPLAAFYRDRKVERCNRVCHALVEQFVDKALEVRAQGGRVDEK

TLEDGDGEKKPRYVFLHGLAQQTGDRRRIRDEVMNVLLAGRDTTASLLSNLFFMLAKHPRIWARLRDEVA

PLNGRPPTYEQLRNLTYVKYCLNESLRLHPVVPGNARFAITDTVLPVGGGPDGQSPVFVPKGGIVTYSVW

SMHRREDIYGPDANEFRPERWADLRPGWEYLPFNGGPRICVGQQYALTEAGYVTVRLAQQFAVLESRDPG

PWEENLTLTLCSRNGTKVSLRN

 

>EAL87881.1 cytochrome P450 alkane hydroxylase, putative [Aspergillus fumigatus Af293]

MTSNYSISLVAGAIAVFVYTLSVLRRKWTQYRFARAHNCQAPPRLASKDPLFGLDTIYATVQNVKEHKFL

ERAQARFDAVGHTIQTRRLLQTIIFTRDPQNIKTILSLRFKDYALGHRYKTFGPLLGHGIFTTDGEHWAQ

SRAMIRPNFVREQVADLAIFEAQMADLLELIPNDGRTVDLQDLFFSYTIDSATEFLFGQSVQSLKKRRSG

GRDAHAEDDFASAFNYAQHAIATRIRLGPLAAFYRDRKVERCNRVCHALVEQFVDKALEVRAQGGRVDEK

TLEDGDGEKKPRYVFLHGLAQQTGDRRRIRDEVMNVLLAGRDTTASLLSNLFFMLAKHPRIWARLRDEVA

PLNGRPPTYEQLRNLTYVKYCLNESLRLHPVVPGNARFAITDTVLPVGGGPDGQSPVFVPKGGIVTYSVW

SMHRREDIYGPDANEFRPERWADLRPGWEYLPFNGGPRICVGQQYALTEAGYVTVRLAQQFAVLESRDPG

PWEENLTLTLCSRNGTKVSLRN

 

#28

 

>CYP584E3 XP_747767.1 cytochrome P450 alkane hydroxylase [Aspergillus fumigatus Af293]

54% to 584E1

MHLILHPKTLILLLAVLVTIVCISIRRFLARRQFARQHGCQPVARSLNKDPFLGLDTIPETLRAASQHRI

LERSVELFRLYGNTFTVKELHKYAILTIEPENIKTILSLNFKDYGLSHRLQPFKPLLGEGIFDTDGAHWA

SSRALIRPSFTRGQVADLTALEDLMQDLFALLPRDGQTVVDLQELFFRYTIDSATEFLFGQSVGTLRKTP

SELGFAQAFHYAQKAIITRGMLGPLAVFYRDRKADECNRVCRAFVQRFVDDAFRAAENNGEKTPDGTKRQ

KRIFSHELAARTSDKRRVLDELMNVLVAGRDTTASLLGNLFFVLAKKPEIWEKLRAEVACLQGRTPTYDE

LRSLRYVQCCVNESLRLHPVVPRNERQAVRDTVLPLGGGSDGLSPVFVPKGTIVSYNVYVMHRRPGLYGP

DAEEFRPERWEDGKLQPRWGYLPFNGGPRICIGQRYALTEVSYVLVRMAQEFRVLESRDPGPWEESLALT

LCSRNGTRVCLVSG

 

>EAL85729.1 cytochrome P450 alkane hydroxylase, putative [Aspergillus fumigatus Af293]

MHLILHPKTLILLLAVLVTIVCISIRRFLARRQFARQHGCQPVARSLNKDPFLGLDTIPETLRAASQHRI

LERSVELFRLYGNTFTVKELHKYAILTIEPENIKTILSLNFKDYGLSHRLQPFKPLLGEGIFDTDGAHWA

SSRALIRPSFTRGQVADLTALEDLMQDLFALLPRDGQTVVDLQELFFRYTIDSATEFLFGQSVGTLRKTP

SELGFAQAFHYAQKAIITRGMLGPLAVFYRDRKADECNRVCRAFVQRFVDDAFRAAENNGEKTPDGTKRQ

KRIFSHELAARTSDKRRVLDELMNVLVAGRDTTASLLGNLFFVLAKKPEIWEKLRAEVACLQGRTPTYDE

LRSLRYVQCCVNESLRLHPVVPRNERQAVRDTVLPLGGGSDGLSPVFVPKGTIVSYNVYVMHRRPGLYGP

DAEEFRPERWEDGKLQPRWGYLPFNGGPRICIGQRYALTEVSYVLVRMAQEFRVLESRDPGPWEESLALT

LCSRNGTRVCLVSG

 

#29

 

>XM_743428.1  Aspergillus fumigatus end may be wrong

AAHF01000010 revised

CYP586C1

MNFADMFLILSVIATLQLLAFWLLNKLDYYRIKQFAAWPQPKPSRIWGHMKDLNAFISRGEPNRHIGK (2)

EDYVFAEIKAHLGNPPLYLLDARP

MQHPLGIVCSHEIAEQVSRSSKQFPYGLPKTPTLQDYKYLGEEW

KSLRKRFNPGFAPQHILTLLPRILDKTVPFFETLDRYAESGEDGTGAVTMDEDLGAQL

PLDKQSEMVRLYHELTASYHQKSSVRAKPSNPLVIWQQYKLARKLNAIIKNHIKRKFA

ELKEASSDEKKSRSVLALSLQGIEKLDAHVLDQTCDQLKTFLFAGHDTTSIVLQWAFY

ELSRTPRVLESISRELDDVFGPDPSPAVVRDKLLAPNGGELLSKLPYTTAVIKEILRV

YPSSGTGRLVPEGSDVYIQLPDGRSLCIDGVLMYNCETLIHRDETVYGESKDDFLPER

WLGDSGADRIPSSAWRPFERGPRSCIGQGLATIEAQVILACAVRQYEFVKIGLGEVAR

DNAGEPILGPQGQYEVKSKLFNV (1)

MTAKPVDGMIMKVKLSSGGRKEL*

 

>CYP586C1 XP_748521.1 cytochrome P450 monooxygenase [Aspergillus fumigatus Af293]

MQHPLGIVCSHEIAEQVSRSSKQFPYGLPKTPTLQDYKYLGEEWKSLRKRFNPGFAPQHILTLLPRILDK

TVPFFETLDRYAESGEDGTGAVTMDEDLGAQLPLDKQSEMVRLYHELTASYHQKSSVRAKPSNPLVIWQQ

YKLARKLNAIIKNHIKRKFAELKEASSDEKKSRSVLALSLQGIEKLDAHVLDQTCDQLKTFLFAGHDTTS

IVLQWAFYELSRTPRVLESISRELDDVFGPDPSPAVVRDKLLAPNGGELLSKLPYTTAVIKEILRVYPSS

GTGRLVPEGSDVYIQLPDGRSLCIDGVLMYNCETLIHRDETVYGESKDDFLPERWLGDSGADRIPSSAWR

PFERGPRSCIGQGLATIEAQVILACAVRQYEFVKIGLGEVARDNAGEPILGPQGQYEVKSKLFNVSLRVS

FWDLSTALTFKLDNASDCKAGRWNDNESEVVLRW

 

>CYP586C1 EAL86483.1 cytochrome P450 monooxygenase, putative [Aspergillus fumigatus Af293]

MQHPLGIVCSHEIAEQVSRSSKQFPYGLPKTPTLQDYKYLGEEWKSLRKRFNPGFAPQHILTLLPRILDK

TVPFFETLDRYAESGEDGTGAVTMDEDLGAQLPLDKQSEMVRLYHELTASYHQKSSVRAKPSNPLVIWQQ

YKLARKLNAIIKNHIKRKFAELKEASSDEKKSRSVLALSLQGIEKLDAHVLDQTCDQLKTFLFAGHDTTS

IVLQWAFYELSRTPRVLESISRELDDVFGPDPSPAVVRDKLLAPNGGELLSKLPYTTAVIKEILRVYPSS

GTGRLVPEGSDVYIQLPDGRSLCIDGVLMYNCETLIHRDETVYGESKDDFLPERWLGDSGADRIPSSAWR

PFERGPRSCIGQGLATIEAQVILACAVRQYEFVKIGLGEVARDNAGEPILGPQGQYEVKSKLFNVSLRVS

FWDLSTALTFKLDNASDCKAGRWNDNESEVVLRW

 

#30

 

>CYP617D2 XP_749561.1 [Aspergillus fumigatus Af293] 61% to 617D1

MTVKIPWPAVYLAIAASVYMRPQYAILDSLTATFVVLSLAVTSFRIIYAFVLYPKFFTPIKHIPTPSNWS

WLTGNTSSYLIESPFEEMIEWAYKVPNNGLIRYYIFGNLERVLLTNPKALSELLVTKVYEFPKPQLVRQS

LARVTGKHGVLLVEGDEHKRQRKNLMPAFSYRHIKNLYPIFWSKSIEMVKLIEKDLHSRADAKDNIVRVS

EWASRATLDIIGVAGMDHDFGSLHDSNNELTKHYRRLLEEPPLAMRIIFVLGVLFGSVGVVESLPLKRNR

EIRESSLYIRDVARQMIRKKEAKMKSQASAETGTDIVSVALESGAFTEEELVDQMMTFLAAGHETTSTAL

QWSVYALCKHPDVQTRLREEVRTHLPPISPEHPEPLSAATLDSLPYLNAFCNEVFRFHPSVPGTVRDAAK

DTTLLGYPIPKGTRILVSPEVINHSKELWGPDADQFNVERWLGSGRANTGGASSNYSFLTFLHGPRSCIG

QGFAKAELACLVAAIVGRFQMELKDADAKLEVRRSATVAPKDGVLARFTPLEGW

 

>EAL87523.1 cytochrome P450 monooxygenase, putative [Aspergillus fumigatus Af293]

MTVKIPWPAVYLAIAASVYMRPQYAILDSLTATFVVLSLAVTSFRIIYAFVLYPKFFTPIKHIPTPSNWS

WLTGNTSSYLIESPFEEMIEWAYKVPNNGLIRYYIFGNLERVLLTNPKALSELLVTKVYEFPKPQLVRQS

LARVTGKHGVLLVEGDEHKRQRKNLMPAFSYRHIKNLYPIFWSKSIEMVKLIEKDLHSRADAKDNIVRVS

EWASRATLDIIGVAGMDHDFGSLHDSNNELTKHYRRLLEEPPLAMRIIFVLGVLFGSVGVVESLPLKRNR

EIRESSLYIRDVARQMIRKKEAKMKSQASAETGTDIVSVALESGAFTEEELVDQMMTFLAAGHETTSTAL

QWSVYALCKHPDVQTRLREEVRTHLPPISPEHPEPLSAATLDSLPYLNAFCNEVFRFHPSVPGTVRDAAK

DTTLLGYPIPKGTRILVSPEVINHSKELWGPDADQFNVERWLGSGRANTGGASSNYSFLTFLHGPRSCIG

QGFAKAELACLVAAIVGRFQMELKDADAKLEVRRSATVAPKDGVLARFTPLEGW

 

#31

 

>CYP617D3 XP_754149.1 [Aspergillus fumigatus Af293]

MGPIHNYFGVVCLGIAASVYFRPECALYGSRIATFAVLLTGIAISKLLYQLFIYPQFVTPLKHFPAPPNR

HWLTGNTGSLLVDTPHALMKEWAKTIPNDGILRYYIVGNMERLTVTSPAVLREILVSKAYEFAKPLVIQQ

TLRRVLGNGILIAEGEEHKFQRKNLKPAFAYRHVKDLYSVFWSKGTEMTKLIRNDLQSRKAPDDNTIQVR

TWASRSSLDIIGLAGMGRDFGSLQDPENSLSRSYEMIFATPGLGTKILFILGMLLGNTTWLAKLPTKQNR

LIDTGCRNIRDATRRMIREQKAKMEDPNAAAEVDIISVAMRSGNFDDDNLVDQLMTFLGAGHETTAGALQ

WAIYALCKHPDVQSRLREEVRANLPPIHGENPGPIDAATIDSLPYLNAVCNEVIRFHPSVPNTVRVALND

TTLMGHPIPKGTQVVISPELVNHMPALWGPDAERFNPDRWMGPGKANTGGAASNYAFLSFLHGPRSCIGQ

VFAKAELACLLAAVVGSFAFELKSPDAPLEVREGATIAPKDGVLAKFTPVEGW

 

>EAL92111.1 [Aspergillus fumigatus Af293] 55% to 617D1An, 48% to 617A2

MGPIHNYFGVVCLGIAASVYFRPECALYGSRIATFAVLLTGIAISKLLYQLFIYPQFVTPLKHFPAPPNR

HWLTGNTGSLLVDTPHALMKEWAKTIPNDGILRYYIVGNMERLTVTSPAVLREILVSKAYEFAKPLVIQQ

TLRRVLGNGILIAEGEEHKFQRKNLKPAFAYRHVKDLYSVFWSKGTEMTKLIRNDLQSRKAPDDNTIQVR

TWASRSSLDIIGLAGMGRDFGSLQDPENSLSRSYEMIFATPGLGTKILFILGMLLGNTTWLAKLPTKQNR

LIDTGCRNIRDATRRMIREQKAKMEDPNAAAEVDIISVAMRSGNFDDDNLVDQLMTFLGAGHETTAGALQ

WAIYALCKHPDVQSRLREEVRANLPPIHGENPGPIDAATIDSLPYLNAVCNEVIRFHPSVPNTVRVALND

TTLMGHPIPKGTQVVISPELVNHMPALWGPDAERFNPDRWMGPGKANTGGAASNYAFLSFLHGPRSCIGQ

VFAKAELACLLAAVVGSFAFELKSPDAPLEVREGATIAPKDGVLAKFTPVEGW

 

#32

 

>CYP617E1 XP_753139.1 [Aspergillus fumigatus Af293] 45% to 617C1, 36% to 617A2

MISFLGLWLCTVTLASGGIFHQALAGGEHTALHFQVLGAHVVAFVAFAVYW

MILYPRYFTPFGNIPTPSRRRILTGNYPVLFPDNAWVPLRELAETTPNDGLLRIYSALSGEALLVTSPPA

IRDMLTVNAFDFTHQDLVKIAIRRFTGSNLERTQLHRKNMMPAFTVPHVRKLTSIFWAKAQEMVRCMSNE

LRADSFARIDFREYMSRATLNNIGLAGMGHDFQTLKQPDTDLRSHHRKLILDPTRVFSWVGLLSRYFDMR

LLMRVPLKKLIEISQSAKYLRELTTAVIQGRREQLVVAENNRGKDIITVALAGGVFDEHHLVDHVMTFLT

AGHESTATAFEWTMYELGRRPEMQSRLRDELRATIGTDLAAVNFGLRVQNLPYLNAFCSEVLRCYPFSPI

IVKVAQKETMLIGQRIPKGTVVLYSAEVSNHDKTLWGPDADKFDPERWMGAKKAKSGGASSNYAMLTFGA

GPRNCIGANFARATLECLVAAVLSTFEIELANPDTAGRLKFGQTKKSAEGIYGRLKFVQPVEV

 

>EAL91101.1 [Aspergillus fumigatus Af293]

MPHLLKKLFTQFLFQQPFSMISFLGLWLCTVTLASGGIFHQALAGGEHTALHFQVLGAHVVAFVAFAVYW

MILYPRYFTPFGNIPTPSRRRILTGNYPVLFPDNAWVPLRELAETTPNDGLLRIYSALSGEALLVTSPPA

IRDMLTVNAFDFTHQDLVKIAIRRFTGSNLERTQLHRKNMMPAFTVPHVRKLTSIFWAKAQEMVRCMSNE

LRADSFARIDFREYMSRATLNNIGLAGMGHDFQTLKQPDTDLRSHHRKLILDPTRVFSWVGLLSRYFDMR

LLMRVPLKKLIEISQSAKYLRELTTAVIQGRREQLVVAENNRGKDIITVALAGGVFDEHHLVDHVMTFLT

AGHESTATAFEWTMYELGRRPEMQSRLRDELRATIGTDLAAVNFGLRVQNLPYLNAFCSEVLRCYPFSPI

IVKVAQKETMLIGQRIPKGTVVLYSAEVSNHDKTLWGPDADKFDPERWMGAKKAKSGGASSNYAMLTFGA

GPRNCIGANFARATLECLVAAVLSTFEIELANPDTAGRLKFGQTKKSAEGIYGRLKFVQPVEV

 

#33

 

>CYP620F1 XP_747154.1 O-methylsterigmatocystin oxidoreductase [Aspergillus fumigatus Af293]

46% to 620D1, 48% to 620B1, 44% to 620C2, 38% to 620A1, 38% to 620E1

MAYELSTLQLSCVAFVAFMAVLVFRTRTRNLKQNVPPGPRPLPIIGNFFDLPPKGQPEYLHWFKHKDAYG

PVSSINVMGTTLVIFHDKDAAHAVMGKKAQKTSARPQLNFAQLCGFENFLITHQYNDKYRLHRKMVHQEI

GTKGLSAGFRPIQEQESIRFILQTFNRPDDILQHLKTLAAAIVLKITYGYSIERKGQDPLVELIEHAMEN

LSQAFVPLAWAVDSVPAIKYLPDWFPGMSYRKTARKWRAINEAAAELPYDFVKRQMAHKAHQPSYVSNLL

EKHMIKSEDNKINVSAADEEAIKWTAVSLYAAGSDSTVAIIHSVICGLVMFPEVVTRAQEEIDRVVGSDR

LPNFDDRTNLPYVDGIIKEAWRWNPVGPMGLTHKSEEDLVCGEYLIPKGSYLLPSLWWFLNDPKEYPEPR

VFKPERYMEPFNHPDPSEIAFGYGRRSCAGRYFADASVYITVVQLLAVFNVRKARDDQGNEIPVTLQAIP

GMVNRPAPFQFKVEPRSQHHIDLLRRIESEQIPEVSHASLLKPSTV

 

>EAL85116.1 O-methylsterigmatocystin oxidoreductase, putative [Aspergillus fumigatus Af293]

MAYELSTLQLSCVAFVAFMAVLVFRTRTRNLKQNVPPGPRPLPIIGNFFDLPPKGQPEYLHWFKHKDAYG

PVSSINVMGTTLVIFHDKDAAHAVMGKKAQKTSARPQLNFAQLCGFENFLITHQYNDKYRLHRKMVHQEI

GTKGLSAGFRPIQEQESIRFILQTFNRPDDILQHLKTLAAAIVLKITYGYSIERKGQDPLVELIEHAMEN

LSQAFVPLAWAVDSVPAIKYLPDWFPGMSYRKTARKWRAINEAAAELPYDFVKRQMAHKAHQPSYVSNLL

EKHMIKSEDNKINVSAADEEAIKWTAVSLYAAGSDSTVAIIHSVICGLVMFPEVVTRAQEEIDRVVGSDR

LPNFDDRTNLPYVDGIIKEAWRWNPVGPMGLTHKSEEDLVCGEYLIPKGSYLLPSLWWFLNDPKEYPEPR

VFKPERYMEPFNHPDPSEIAFGYGRRSCAGRYFADASVYITVVQLLAVFNVRKARDDQGNEIPVTLQAIP

GMVNRPAPFQFKVEPRSQHHIDLLRRIESEQIPEVSHASLLKPSTV

 

#34

 

>CYP630B9 XP_755127.1 [Aspergillus fumigatus Af293] 61% to CYP630B1 FG

MWSLFTIAPYACILGLLLFVYFIAYPFVEYIRDPKGLRRYPNFHPFSGMSAIPFMVLASRGFRSMELLNL

HRKHPVLRTGPNTLSYGDVRAIKDIYGHNTKCIKDPSYIVTAGTHYHLADVVDKPDHARKRKVLSSAYAL

KNLETWEYKVSDKLERLIAHFDRVCTKPPSAAVAEGKAAPDPADLTVDFRAWTNFFTLDAIADIGLSEKL

GFLDSGSDVCTAERKDGTTYEVHLREALYPTARKQSLILWNYEWYPVLNKLVNIIPFFRRMQRSSDNWEN

IVWRRASQRLRRYEAGEKLDDFFQALMEDKNGHPNNLEWGEIVAEVNIMMNAGSVTTAIAIANVMYQLLK

NPRCLAKLREEVDAVLDEEDIIAPYDKVKHLPYLRACLDESLRIFPPTSHGLPRQTPPEGMEILGQWVPG

NTSVSISALVAHRDESVFPQADQYIPERWLGEEGKALQPYFVAFSAGARSCIGRNISYLEQTKAIATLVH

RYEFALPHPGWELKRLETMNLILGDMPVKVWRRQT

 

>CYP630B9 EAL93089.1 [Aspergillus fumigatus Af293] 61% to CYP630B1 FG

MWSLFTIAPYACILGLLLFVYFIAYPFVEYIRDPKGLRRYPNFHPFSGMSAIPFMVLASRGFRSMELLNL

HRKHPVLRTGPNTLSYGDVRAIKDIYGHNTKCIKDPSYIVTAGTHYHLADVVDKPDHARKRKVLSSAYAL

KNLETWEYKVSDKLERLIAHFDRVCTKPPSAAVAEGKAAPDPADLTVDFRAWTNFFTLDAIADIGLSEKL

GFLDSGSDVCTAERKDGTTYEVHLREALYPTARKQSLILWNYEWYPVLNKLVNIIPFFRRMQRSSDNWEN

IVWRRASQRLRRYEAGEKLDDFFQALMEDKNGHPNNLEWGEIVAEVNIMMNAGSVTTAIAIANVMYQLLK

NPRCLAKLREEVDAVLDEEDIIAPYDKVKHLPYLRACLDESLRIFPPTSHGLPRQTPPEGMEILGQWVPG

NTSVSISALVAHRDESVFPQADQYIPERWLGEEGKALQPYFVAFSAGARSCIGRNISYLEQTKAIATLVH

RYEFALPHPGWELKRLETMNLILGDMPVKVWRRQT

 

#35

 

>CYP630B10 XP_748668.1 [Aspergillus fumigatus Af293] 46% to 630B2 with errors

closer to 54% if gaps removed, needs revision

MLGMMLLLGLLARLFFRFVIWAIFVYLRDPKGLRKYPLMHPLSGISDIPFMLESMRGFRSATLLQLHYGQ

GHPVIRLGPNALSFAGGQAIPAIYGHNTPATKDRQYLNAAGSHFHLADVVDKKEHARKRKVLASAFAAKH

LEDWEYKVADKVQRLMQRFDQHLAQMPDDPLDYRSWTNLFTIDSLCDTLIVAPTVSFRDCLYATFHIVGD

LVWSYEWYHVVSWLLQRVSAHDIFAALMEDPAGNPQDLEWGEVLAEISLAISGSSSTSNSIASTMQLLIE

HPEKMRKLQEEVDSVMATQLEDSPDGDTPTVASYDQIKSLPYLRAVIDESLRLYPPISHGLPRETPKEGM

MIMDQWVPGNTTVSVSAYVAHRDPAVFDQPESFVPERWLGEQGRALQTRFIAFSAGARGCIGRPISYLQA

SILLANLVHQYDFEMWDPKWKPSRRETMNLIMGPMPPGGFSGEGG

 

>EAL86630.1 [Aspergillus fumigatus Af293]

MLGMMLLLGLLARLFFRFVIWAIFVYLRDPKGLRKYPLMHPLSGISDIPFMLESMRGFRSATLLQLHYGQ

GHPVIRLGPNALSFAGGQAIPAIYGHNTPATKDRQYLNAAGSHFHLADVVDKKEHARKRKVLASAFAAKH

LEDWEYKVADKVQRLMQRFDQHLAQMPDDPLDYRSWTNLFTIDSLCDTLIVAPTVSFRDCLYATFHIVGD

LVWSYEWYHVVSWLLQRVSAHDIFAALMEDPAGNPQDLEWGEVLAEISLAISGSSSTSNSIASTMQLLIE

HPEKMRKLQEEVDSVMATQLEDSPDGDTPTVASYDQIKSLPYLRAVIDESLRLYPPISHGLPRETPKEGM

MIMDQWVPGNTTVSVSAYVAHRDPAVFDQPESFVPERWLGEQGRALQTRFIAFSAGARGCIGRPISYLQA

SILLANLVHQYDFEMWDPKWKPSRRETMNLIMGPMPPGGFSGEGG

 

#36

 

>AAHF01000014 Aspergillus fumigatus

CYP646A2 80% to 646A1

join(572205..572288,572338..572670,572727..573086)

locus_tag="Afu8g00960" second P450 of 8 on this accession

80% to 646A1 Aspergillus nidulans

MLLNISAFALSTTGVLCMLLCLVVKLFETSPVPKNIPWVLSKKGFFGRAAERFLGVNPIGFIQEGYQQ (0)

YSKNQQPFVMPSVNEGDEVILPKEHSNAVLFAKESEYSFKAHISDFFQLKYTSWPLAFAERYDFFVKL

VSKDLTETLKSKAVAESLAEEARSCLSEFWGEDTDNWVEVPLYSFMEN (2)

HDTTLLGAMTNCSNAIVFGANVIKAFPSFVHP (2)

IIGPIVGLVNRWQERVFHARMKPIIEAKIKEQKEADDPQSLQERLKANGSLLDLLIQAGLRSKW

PVERETMWLAYRIFMLNFPGVHTSGISATSALLDILSYPTEEGLMDMLQAEIEQIAAN

SDGSWSAADLERASLLESAIKESLRFNGINALSPTRK (0)

VVAPEGAFLPNGVFLPYGTKI

GIPQYAVHRDSDLYPNPNEYNPYRFYKENATPEERRQNLMTNTSDTYLVFGHGRRQCP

GRWLFAHIFKLLIAEMLLKYEIKPFAARPKIH (1)

RAGWGRFQLPPLSVKITVRRKKNPVAVCNQFST*

 

>CYP646A2 XP_747110.1 cytochrome P450 [Aspergillus fumigatus Af293]

MKPIIEAKIKEQKEADDPQSLQERLKANGSLLDLLIQAGLRSKWPVERETMWLAYRIFMLNFPGVHTSGI

SATSALLDILSYPTEEGLMDMLQAEIEQIAANSDGSWSAADLERASLLESAIKESLRFNGINALSPTRKV

VAPEGAFLPNGVFLPYGTKIGIPQYAVHRDSDLYPNPNEYNPYRFYKENATPEERRQNLMTNTSDTYLVF

GHGRRQCPGRWLFAHIFKLLIAEMLLKYEIKPFAARPKIHRKASRSFI

 

>CYP646A2 EAL85072.1 cytochrome P450, putative [Aspergillus fumigatus Af293]

MKPIIEAKIKEQKEADDPQSLQERLKANGSLLDLLIQAGLRSKWPVERETMWLAYRIFMLNFPGVHTSGI

SATSALLDILSYPTEEGLMDMLQAEIEQIAANSDGSWSAADLERASLLESAIKESLRFNGINALSPTRKV

VAPEGAFLPNGVFLPYGTKIGIPQYAVHRDSDLYPNPNEYNPYRFYKENATPEERRQNLMTNTSDTYLVF

GHGRRQCPGRWLFAHIFKLLIAEMLLKYEIKPFAARPKIHRKASRSFI

 

#37

 

>CYP653A2 XP_748033.1 cytochrome P450 monooxygenase [Aspergillus fumigatus Af293]

47% to 653A1 with errors, needs revision

MHLASFSLLTSITLHHYCAHNTPITLHNIDQLLNGTSLAQRRILRLSSAKLSVMADQVLELPCWPFALLL

SSSLYFFHYPPGETSAEIPTVRFSRFLPGFINRLMFIFVAPYLIKYGYEKYRDQPYRILKADGDLLVLPP

KYLPEIRHLPPSKLSGVDAQFENILGKYTNVLIDSNLPVKTVHKGLTPAIGKYLLCVHLLECLTADESQL

QGRVLPRLLDELQFAFQVEVPDCDDRWVPVNLYDMILGLVTRATSRVIVGKNICRNSQWLETVTSYTVNL

GVTVILLRPFPNFMRPLVAKVLPSVKKLRTQLRFVQNELFIPMILARREAEINGPAYQKPDDFLQWMMDL

AEDDFDKDPANISQMLLIVMALAVVHTSSMLMTHAIYDLMIRPEYIEPLREEIRGTLKDGWDKVTQASFA

SQRRLDSFMRESQRFNPTGELSTHRMVMETMVLSDGLVLEKGTHICFPSKPMGMDDSIIEDALTFRGFRW

CEDPEARSTSLVSISPSNMHFGYGRQACPGRFFAANTNKAILGRLIADYEFKFEGDNNKRPRNLTLGEQI

MPNMHTKILLKKRAFV

 

>EAL85995.1 cytochrome P450 monooxygenase [Aspergillus fumigatus Af293]

MHLASFSLLTSITLHHYCAHNTPITLHNIDQLLNGTSLAQRRILRLSSAKLSVMADQVLELPCWPFALLL

SSSLYFFHYPPGETSAEIPTVRFSRFLPGFINRLMFIFVAPYLIKYGYEKYRDQPYRILKADGDLLVLPP

KYLPEIRHLPPSKLSGVDAQFENILGKYTNVLIDSNLPVKTVHKGLTPAIGKYLLCVHLLECLTADESQL

QGRVLPRLLDELQFAFQVEVPDCDDRWVPVNLYDMILGLVTRATSRVIVGKNICRNSQWLETVTSYTVNL

GVTVILLRPFPNFMRPLVAKVLPSVKKLRTQLRFVQNELFIPMILARREAEINGPAYQKPDDFLQWMMDL

AEDDFDKDPANISQMLLIVMALAVVHTSSMLMTHAIYDLMIRPEYIEPLREEIRGTLKDGWDKVTQASFA

SQRRLDSFMRESQRFNPTGELSTHRMVMETMVLSDGLVLEKGTHICFPSKPMGMDDSIIEDALTFRGFRW

CEDPEARSTSLVSISPSNMHFGYGRQACPGRFFAANTNKAILGRLIADYEFKFEGDNNKRPRNLTLGEQI

MPNMHTKILLKKRAFV

 

#38

 

>CYP657B1 XP_750481.1 cytochrome P450 [Aspergillus fumigatus Af293] 51% to 657A1An

MDDVREWIWPILLAILLSSCLATRIITGLKSWPDKRIDARLPRSVRVVPYWLPWLGHSIPFGWDHIDFVR

RARDYMNEAVFGIILGGLKHDVVVSPSLTKAILASRGTSSNALINYALEKVGGDQGAIRSLSATDHHIIH

HNIPNLLMREPFLTEASKVAKDITEREAPNLVTFCRSMVDQAPWERRSEAEVTDGQEKLMAEVNLFALVR

NFVGHISTSVLMGQAFLEAFPDLLDDMWTFDNRFPVMALGAPRWLPLPGLSAAYAARDRILDALAAYHQA

FVSWDEGNDPGVKFRDLDDVSESMKQRIRKFKELGLSPRSSAPGHLSLFWALNANSPNVVFWNILRIYSD

PALLEEVRKEIAPFVKVYRPSREETGLPFQEPVKVSLDPDELFRSCPLLKASFYETMRLDSAGLSFREVT

SDLTVTESPEDAAAASLAEPRTYRIKKGGNIVMAHGMVQRDPRLFSNPEQFDPLRFVVTDPDTGARKADM

HTIYPFGAGVSGCKGRALAERMNLLFTAAIISTWDIEPASGKALTVPGHRPSSGAYLPKDDIRVRLRMRV

 

>EAL88443.1 cytochrome P450, putative [Aspergillus fumigatus Af293]

MDDVREWIWPILLAILLSSCLATRIITGLKSWPDKRIDARLPRSVRVVPYWLPWLGHSIPFGWDHIDFVR

RARDYMNEAVFGIILGGLKHDVVVSPSLTKAILASRGTSSNALINYALEKVGGDQGAIRSLSATDHHIIH

HNIPNLLMREPFLTEASKVAKDITEREAPNLVTFCRSMVDQAPWERRSEAEVTDGQEKLMAEVNLFALVR

NFVGHISTSVLMGQAFLEAFPDLLDDMWTFDNRFPVMALGAPRWLPLPGLSAAYAARDRILDALAAYHQA

FVSWDEGNDPGVKFRDLDDVSESMKQRIRKFKELGLSPRSSAPGHLSLFWALNANSPNVVFWNILRIYSD

PALLEEVRKEIAPFVKVYRPSREETGLPFQEPVKVSLDPDELFRSCPLLKASFYETMRLDSAGLSFREVT

SDLTVTESPEDAAAASLAEPRTYRIKKGGNIVMAHGMVQRDPRLFSNPEQFDPLRFVVTDPDTGARKADM

HTIYPFGAGVSGCKGRALAERMNLLFTAAIISTWDIEPASGKALTVPGHRPSSGAYLPKDDIRVRLRMRV

 

#39

 

>CYP660B1 XP_747896.1 cytochrome P450 [Aspergillus fumigatus Af293] 43% to 660A1

MDNLSLVVGTLILIAGSALMLRLRHDPREPPVVHNGIPFIGHMIGFVRHGIDYYALQSAKHGLEAFTMDV

LFTKIYVITTPTLVMATRRHHRAMSFEPAITGAARRVTGLKGRGFELLSEKRPGGENLHGAVVNAMRPAL

EGAGLDRMNEKVIGYLLRSVDDLPTAAPFDFHAWCRAALTLSSTDAVYGPLNPYRSKELQDAFWDFEENL

ALLLMDVVQRVTARTAWKARRRLVAAFLDYYRAGGHLDSSQLTYARWETQQKGGATLEDIARLETAAALG

TLSNTVPAMFWFMFNIFSRPELLNEVRDEVARRAVQVDAQGVHTVDLAEIKEKCPLLMSAFQETLRLRSN

TVPIRVIFEDMILDDRYLLKKGGILQMPAHAINRDRTIWGSDADDYDPRRFVKINQSDSRKKANGFLSFG

TSPHVCPGRHFATGEILALIAMLVLRYDIVPAGGVWKEPRTSKSAITSSTGPPAEEFKVLATARKEYEGV

EWAFRVTEGKGKYGLIIG

 

>EAL85858.1 cytochrome P450, putative [Aspergillus fumigatus Af293]

MDNLSLVVGTLILIAGSALMLRLRHDPREPPVVHNGIPFIGHMIGFVRHGIDYYALQSAKHGLEAFTMDV

LFTKIYVITTPTLVMATRRHHRAMSFEPAITGAARRVTGLKGRGFELLSEKRPGGENLHGAVVNAMRPAL

EGAGLDRMNEKVIGYLLRSVDDLPTAAPFDFHAWCRAALTLSSTDAVYGPLNPYRSKELQDAFWDFEENL

ALLLMDVVQRVTARTAWKARRRLVAAFLDYYRAGGHLDSSQLTYARWETQQKGGATLEDIARLETAAALG

TLSNTVPAMFWFMFNIFSRPELLNEVRDEVARRAVQVDAQGVHTVDLAEIKEKCPLLMSAFQETLRLRSN

TVPIRVIFEDMILDDRYLLKKGGILQMPAHAINRDRTIWGSDADDYDPRRFVKINQSDSRKKANGFLSFG

TSPHVCPGRHFATGEILALIAMLVLRYDIVPAGGVWKEPRTSKSAITSSTGPPAEEFKVLATARKEYEGV

EWAFRVTEGKGKYGLIIG

 

#40

 

>XM_742987 Aspergillus fumigatus

CYP661B1

38% to CYP661A1

MTWMRVMPRCQNRTYKRPRGPPLSIHPLEFFQAKKVEKTAKAKM

ILYYLASIPLAIICYLAWYLHVPWDLPSLPRIPFYVSILGLWSSMGQDEIYERWLRKP

LEAHGAVLIWFAGRWSILVTRPDLLTDMFRNEDLYAKAGSQKKIPWSVIATLVGDNII

NSHGDTWKLYTGIMKPGLQKKNFDTAPLLLKSRRFVDEILAEQNSAGRGTGILVNTFV

QQWAVDVMGMSFLDLDLQSLEKPHGTVRLEAIQSVIKLMLFRPLFFNFPDLDQFAWLI

KSRQRAYEIMHEFGDTLMATVLGRIDSDREKGIKPAEEMVVHMLVDAYRDGRLTEKQF

KDNLKIVFLTAHENAQQLVNSMFWEIGKNNEVQTRLRAEILSTNTTTPTSEVVNALPY

LTAVVYELLRLYPPVSQLINRVTVRPAMLGNEIPIPAGTFVGWNAYGVHVNPAIWGPD

ANEFKPERWGRTVGEMHARFRRETVRGTYIPFNAHSRKCLGQGFVLLQMKILLFEVLR

RIEWTVDPGYRLKMTPVSYFLESGRKSTDA

 

>CYP661B1 XP_748080.1 [Aspergillus fumigatus Af293]

MTWMRVMPRCQNRTYKRPRGPPLSIHPLEFFQAKKVEKTAKAKMILYYLASIPLAIICYLAWYLHVPWDL

PSLPRIPFYVSILGLWSSMGQDEIYERWLRKPLEAHGAVLIWFAGRWSILVTRPDLLTDMFRNEDLYAKA

GSQKKIPWSVIATLVGDNIINSHGDTWKLYTGIMKPGLQKKNFDTAPLLLKSRRFVDEILAEQNSAGRGT

GILVNTFVQQWAVDVMGMSFLDLDLQSLEKPHGTVRLEAIQSVIKLMLFRPLFFNFPDLDQFAWLIKSRQ

RAYEIMHEFGDTLMATVLGRIDSDREKGIKPAEEMVVHMLVDAYRDGRLTEKQFKDNLKIVFLTAHENAQ

QLVNSMFWEIGKNNEVQTRLRAEILSTNTTTPTSEVVNALPYLTAVVYELLRLYPPVSQLINRVTVRPAM

LGNEIPIPAGTFVGWNAYGVHVNPAIWGPDANEFKPERWGRTVGEMHARFRRETVRGTYIPFNAHSRKCL

GQGFVLLQMKILLFEVLRRIEWTVDPGYRLKMTPVSYFLESGRKSTDA

 

>CYP661B1 EAL86042.1 [Aspergillus fumigatus Af293]

MTWMRVMPRCQNRTYKRPRGPPLSIHPLEFFQAKKVEKTAKAKMILYYLASIPLAIICYLAWYLHVPWDL

PSLPRIPFYVSILGLWSSMGQDEIYERWLRKPLEAHGAVLIWFAGRWSILVTRPDLLTDMFRNEDLYAKA

GSQKKIPWSVIATLVGDNIINSHGDTWKLYTGIMKPGLQKKNFDTAPLLLKSRRFVDEILAEQNSAGRGT

GILVNTFVQQWAVDVMGMSFLDLDLQSLEKPHGTVRLEAIQSVIKLMLFRPLFFNFPDLDQFAWLIKSRQ

RAYEIMHEFGDTLMATVLGRIDSDREKGIKPAEEMVVHMLVDAYRDGRLTEKQFKDNLKIVFLTAHENAQ

QLVNSMFWEIGKNNEVQTRLRAEILSTNTTTPTSEVVNALPYLTAVVYELLRLYPPVSQLINRVTVRPAM

LGNEIPIPAGTFVGWNAYGVHVNPAIWGPDANEFKPERWGRTVGEMHARFRRETVRGTYIPFNAHSRKCL

GQGFVLLQMKILLFEVLRRIEWTVDPGYRLKMTPVSYFLESGRKSTDA

 

#41

 

>XM_741694.1 Aspergillus fumigatus Af293 cytochrome P450 monooxygenase (Afu7g01450)

CYP666B1 44% to 666A1, 48% to 666A2

gene model wrong, correct with genomic DNA from AAHF01000015.1

      MIWSSVLLGLAGLYAFDYFRRLFNNIR

82    LAQRTGLPYTVLPFAGNSLQVKILLSIRWLPYIINHWLPGWLADIINDETYDYRWTVKDR  261

262   RAKKLGKMYMVVTAENIVCHIADASLVTQICNARQSFPKPIWQY (1)

      ELLNLYGPNLLT (0)

      CEDQAWAHHRRHTAPTFNEKNSALVWEESIRQMTEMLHHWQVAGTSEKLHGFVVASTRGDLLK  543

544   FSLNVLCGAGFGVKLPFKQLPQESTNDPNDVFKDTEKPPEGFSFTFRSAVAYMNLRIMTV  723

724   VLATMVIPKWIPRALMPWLKSDFEAHRDLEAYLRKLISMGKAEKTADKPDNSQNLVQGLL  903

904   MSRNKEAASGSSKGIGLTDLEIIGNMHIFTIAGHETTATSLRFTLLLLALHQDVQDWL  1077

1078  YEGVLEAAHGEPKDVAQWDYHRMFPKLITPLC (0)

      LEVLRLYPPVVTVPKSTSETPSPLTY  1257

1258  QGKQYVLPPRVNINLNTNCLHYSEQYWGPDVAIFYPQRWDARNQNSFLAKNASTQGLAGP  1437

1438  GLEFPTVHKPVRGAFIPFSDGFRACLGKKFAQVEFIAALSALSRNYKVELADDSPEGRND  1617

1618  AERVLRESTSVLTLSMREDVPIRFQRRKD*  1707

 

>CYP666B1 XP_746787.1 [Aspergillus fumigatus Af293]

MIWSSVLLGLAGLYAFDYFRRLFNNIRLAQRTGLPYTVLPFAGNSLQVKILLSIRWLPYIINHWLPGWLA

DIINDETYDYRWTVKDRRAKKLGKMYMVVTAENIVCHIADASLVTQICNARQSFPKPIWQYAPTFNEKNS

ALVWEESIRQMTEMLHHWQVAGTSEKLHGFVVASTRGDLLKFSLNVLCGAGFGVKLPFKQLPQESTNDPN

DVFKDTEKPPEGFSFTFRSAVAYMNLRIMTVVLATMVIPKWIPRALMPWLKSDFEAHRDLEAYLRKLISM

GKAEKTADKPDNSQNLVQGLLMSRNKEAASGSSKGIGLTDLEIIGNMHIFTIAGHETTATSLRFTLLLLA

LHQDVQDWLYEGVLEAAHGEPKDVAQWDYHRMFPKLITPLCVMLEVLRLYPPVVTVPKSTSETPSPLTYQ

GKQYVLPPRVNINLNTNCLHYSEQYWGPDVAIFYPQRWDARNQNSFLAKNASTQGLAGPGLEFPTVHKPV

RGAFIPFSDGFRACLGKKFAQVEFIAALSALSRNYKVELADDSPEGRNDAERVLRESTSVLTLSMREDVP

IRFQRRKD

 

>CYP666B1 EAL84749.1 [Aspergillus fumigatus Af293]

MIWSSVLLGLAGLYAFDYFRRLFNNIRLAQRTGLPYTVLPFAGNSLQVKILLSIRWLPYIINHWLPGWLA

DIINDETYDYRWTVKDRRAKKLGKMYMVVTAENIVCHIADASLVTQICNARQSFPKPIWQYAPTFNEKNS

ALVWEESIRQMTEMLHHWQVAGTSEKLHGFVVASTRGDLLKFSLNVLCGAGFGVKLPFKQLPQESTNDPN

DVFKDTEKPPEGFSFTFRSAVAYMNLRIMTVVLATMVIPKWIPRALMPWLKSDFEAHRDLEAYLRKLISM

GKAEKTADKPDNSQNLVQGLLMSRNKEAASGSSKGIGLTDLEIIGNMHIFTIAGHETTATSLRFTLLLLA

LHQDVQDWLYEGVLEAAHGEPKDVAQWDYHRMFPKLITPLCVMLEVLRLYPPVVTVPKSTSETPSPLTYQ

GKQYVLPPRVNINLNTNCLHYSEQYWGPDVAIFYPQRWDARNQNSFLAKNASTQGLAGPGLEFPTVHKPV

RGAFIPFSDGFRACLGKKFAQVEFIAALSALSRNYKVELADDSPEGRNDAERVLRESTSVLTLSMREDVP

IRFQRRKD

 

#42

 

>CYP672A2 XP_751418.1 [Aspergillus fumigatus Af293] 67% to 672A1

MVLVAMSLPSGPFPELAYPVIPFPVLAIGTKLAFLSGRSTYRFHSLHQSYGNIVRFAPGQATTNTVKALR

QIYSTGTGKGAAFLKTSFYRNISRRNIFTAADPVYHASVRKLFGPSFTPGSMHAHAGVIRECILRLHEVI

RDKLETHNTISLNELLYCHSVDTVSEVLLGKPLGCLKRGKPYFWTEQLPRIFYWATIRDQFEGSGIPTAI

KWLLRRFLRKGIRLRAEQARMRLINEQLHAPHTRRDIMVEVMERSGGSELPEDEIAENFSAIMLAGFHTT

QNALCAVIYLVLTHPEAHVKLVQELQTAFASADDISGDVAAQLPYLNAVITEALRLYPPVPLGGPRVSPG

AYVDGVYIPAGTEICTSLFALHHNPEYFSSPYEFLPERWTEPGSTDRKEAVQPFLIGSRACIAKYFAKQM

LQLTLAGFFLEFEAEHVGKVRDWQRQSRCYAFWDVPDLQVKLRKRLID

 

>EAL89380.1 [Aspergillus fumigatus Af293]

MVLVAMSLPSGPFPELAYPVIPFPVLAIGTKLAFLSGRSTYRFHSLHQSYGNIVRFAPGQATTNTVKALR

QIYSTGTGKGAAFLKTSFYRNISRRNIFTAADPVYHASVRKLFGPSFTPGSMHAHAGVIRECILRLHEVI

RDKLETHNTISLNELLYCHSVDTVSEVLLGKPLGCLKRGKPYFWTEQLPRIFYWATIRDQFEGSGIPTAI

KWLLRRFLRKGIRLRAEQARMRLINEQLHAPHTRRDIMVEVMERSGGSELPEDEIAENFSAIMLAGFHTT

QNALCAVIYLVLTHPEAHVKLVQELQTAFASADDISGDVAAQLPYLNAVITEALRLYPPVPLGGPRVSPG

AYVDGVYIPAGTEICTSLFALHHNPEYFSSPYEFLPERWTEPGSTDRKEAVQPFLIGSRACIAKYFAKQM

LQLTLAGFFLEFEAEHVGKVRDWQRQSRCYAFWDVPDLQVKLRKRLID

 

#43

 

>CYP682C2 XP_748206.1 cytochrome P450 [Aspergillus fumigatus Af293]

69% to 682C1

MELFRLLLSHPVSSAVALGAVYLLWVVLDRLYLSPIAGFPGPKLAALTHLYEFYWDTICCGQFTFQIGRL

HEKYGPIVRISPTELHINDPDYYEVLYSRDSPRNKYEYYQKTLNAPLALLNTIDHHLHRQLRAQLNPFFS

STRIRRQEPAIKALVNKLCRRLDELKNTGQPLNIEHALTCYTTDVITDYSMGDGYHYLDAPDFIPQWHGT

LNGTAKTMVFIRPVAWALPLLLALPEAVTAWLNPGMELFFDFQRRCRKMIKRIVAAHNEKGNQGVQNEGF

VNIFDDILRSNLPAKNKSETRLAQEMQVLVSAGAETTAKAITYILFYLLNDPETMAKLKAELETVGEDPA

LVQLEQLPYLTGVMLEGIRLSYGVSARLPRIAPYNALKFRDWTIPPGVPVSMSCLLMHHNETVFPDSHRF

KPERWLDPAERKRLEKYMVAFSKGSRQCIGMHLAKAEILLAVSTLLRRMDLELYETTVEDVAIKHDIFIP

FPRMDSKGVRVLIKG

 

>EAL86168.1 cytochrome P450, putative [Aspergillus fumigatus Af293]

MELFRLLLSHPVSSAVALGAVYLLWVVLDRLYLSPIAGFPGPKLAALTHLYEFYWDTICCGQFTFQIGRL

HEKYGPIVRISPTELHINDPDYYEVLYSRDSPRNKYEYYQKTLNAPLALLNTIDHHLHRQLRAQLNPFFS

STRIRRQEPAIKALVNKLCRRLDELKNTGQPLNIEHALTCYTTDVITDYSMGDGYHYLDAPDFIPQWHGT

LNGTAKTMVFIRPVAWALPLLLALPEAVTAWLNPGMELFFDFQRRCRKMIKRIVAAHNEKGNQGVQNEGF

VNIFDDILRSNLPAKNKSETRLAQEMQVLVSAGAETTAKAITYILFYLLNDPETMAKLKAELETVGEDPA

LVQLEQLPYLTGVMLEGIRLSYGVSARLPRIAPYNALKFRDWTIPPGVPVSMSCLLMHHNETVFPDSHRF

KPERWLDPAERKRLEKYMVAFSKGSRQCIGMHLAKAEILLAVSTLLRRMDLELYETTVEDVAIKHDIFIP

FPRMDSKGVRVLIKG

 

#44

 

>XM_749573 Aspergillus fumigatus

CYP5052C1

MSDPNTTAVRPVPRVGFATIVLGLIVLGILRWAYACYKWNQKYK

LPARVPGIPILGNSLQVPAVQQGPWAKDLAAKYGEM (2)

FTCQFGGSTWVFLNSSRVVKDLLEKRAAIYNSRPPFPMTQDIISRGGRIVLMPYGER

WRLVRRVMHQILSVTNQPMFQPFQDLESRQLFWDYLHKPDRWFAANGRYANSVIMSVV

FGRRSLLDDPDVAELFETIELFLAEQQPGGESGGCVPGAGELAPVLAVVAAAGRSGFS

RRPSSRQTGTTNPRRYEAKMLRGEFLASKEITQMDEVTKLFVFGSLMEAGSDTSRVTL

GQIIAGAITYPDWVTRAREQLDRVCGAHAERLPGWDDRPRLPYITAVVKEGFRWRPNI

AEIGAPTVLIKDDEYEGSRFPKGTVFTWNAWAIALSPDEYEQPERFWPDRFLNEDLEN

ALKGHGAFGP(1)

GRRVCAGWKVGETNVWIAIARLLYCFDF

HPVPGQPIDTMRIPQLAGNAASFAARVSVRSPAHAELIRRECAEAVKTQY

 

>CYP5052C1 XP_754666.1 [Aspergillus fumigatus Af293]

MSDPNTTAVRPVPRVGFATIVLGLIVLGILRWAYACYKWNQKYKLPARVPGIPILGNSLQVPAVQQGPWA

KDLAAKYGEMYVGVPFPSLPSREDVELKHKRNRFTCQFGGSTWVFLNSSRVVKDLLEKRAAIYNSRPPFP

MTQDIISRGGRIVLMPYGERWRLVRRVMHQILSVTNQPMFQPFQDLESRQLFWDYLHKPDRWFAANGRYA

NSVIMSVVFGRRSLLDDPDVAELFETIELFLAEQQPGGESGGCVPGAGELAPVLAVVAAAGRSGFSRRPS

SRQTGTTNPRRYEAKMLRGEFLASKEITQMDEVTKLFVFGSLMEAGSDTSRVTLGQIIAGAITYPDWVTR

AREQLDRVCGAHAERLPGWDDRPRLPYITAVVKEGFRWRPNIAEIGAPTVLIKDDEYEGSRFPKGTVFTW

NAWAIALSPDEYEQPERFWPDRFLNEDLENALKGHGAFGPGMVLRNHCRKQLHFPANQMTGRRVCAGWKV

GETNVWIAIARLLYCFDFHPVPGQPIDTMRIPQLAGNAASFAARVSVRSPAHAELIRRECAEAVKTQY

 

>CYP5052C1 EAL92628.1 [Aspergillus fumigatus Af293]

MSDPNTTAVRPVPRVGFATIVLGLIVLGILRWAYACYKWNQKYKLPARVPGIPILGNSLQVPAVQQGPWA

KDLAAKYGEMYVGVPFPSLPSREDVELKHKRNRFTCQFGGSTWVFLNSSRVVKDLLEKRAAIYNSRPPFP

MTQDIISRGGRIVLMPYGERWRLVRRVMHQILSVTNQPMFQPFQDLESRQLFWDYLHKPDRWFAANGRYA

NSVIMSVVFGRRSLLDDPDVAELFETIELFLAEQQPGGESGGCVPGAGELAPVLAVVAAAGRSGFSRRPS

SRQTGTTNPRRYEAKMLRGEFLASKEITQMDEVTKLFVFGSLMEAGSDTSRVTLGQIIAGAITYPDWVTR

AREQLDRVCGAHAERLPGWDDRPRLPYITAVVKEGFRWRPNIAEIGAPTVLIKDDEYEGSRFPKGTVFTW

NAWAIALSPDEYEQPERFWPDRFLNEDLENALKGHGAFGPGMVLRNHCRKQLHFPANQMTGRRVCAGWKV

GETNVWIAIARLLYCFDFHPVPGQPIDTMRIPQLAGNAASFAARVSVRSPAHAELIRRECAEAVKTQY

 

#45

 

>XM_742056.1  Aspergillus fumigatus Af293 cytochrome P450 (Afu8g00560) mRNA,

CYP5058A2 54% to CYP5058A1

Gene prediction has wrong N-term (first exon)

AAHF01000014 Aspergillus fumigatus

complement(join(661025..661409,661471..662275, 662337..662700,662860..662895))

locus_tag="Afu8g00560 fifth P450 of 8 on this accession

      MIISSYHLLWLALVAFILQYVAGIVSTRQRRQGAKVPPGPKG(1)  86

139   GWPFLGSAPALAAVDTNGIIGIFKSWAEQYGSITQFSAMGDKQVILTEDKDARELFV  309

310   RRGIKYSDRGAPHAVEYISMKQNPGFRPKDDGWRRQRSMIQSAINITSINKYQSLMDDEA  489

490   TFTVNALLQSPDSFHGEFLRYSYSVLTSSLLGFSVRSPSDPFIHHNETFTAELMNSFRPD  669

670   CFPSNVFPVLRKLPMWLLPSLRTMERLRKEYVGEMWAFRRKIEKLVKEGSATECIYKHFL  849

850   LHRDQYNVTEEESVHTFQAMIDGGTRSPHNNLLTFLFLMMEFPEWQKKLQEEVDRVVGRD  1029

1030  RMPSYRDIPNLPTVRAIVKETVRYRSIVAEMGIGHCLQTDDIYKGYFFEKGTVFNAIFAS  1209

1210  ILMDKDTYPDGKLFNPARWLEPSYPTYKEPLTTYPNCQGFPAFGYGRRACPGVDFAERTL  1389

1390  VIMFAKLGWTMNIRWPRDEDGNELREELQYEPVPAPRPLKFGCRLEARDADRAKIVEE  1563

1564  AAKHLKLQ*  1590

 

>CYP5058A2 XP_747149.1 [Aspergillus fumigatus Af293]

MHGVAGLHIPQSCQRVNGDRAPRCRRDQKVYNKSIHVLNTVAKGIKGWPFLGSAPALAAVDTNGIIGIFK

SWAEQYGSITQFSAMGDKQVILTEDKDARELFVRRGIKYSDRGAPHAVEYISMKQNPGFRPKDDGWRRQR

SMIQSAINITSINKYQSLMDDEATFTVNALLQSPDSFHGEFLRYSYSVLTSSLLGFSVRSPSDPFIHHNE

TFTAELMNSFRPDCFPSNVFPVLRKLPMWLLPSLRTMERLRKEYVGEMWAFRRKIEKLVKEGSATECIYK

HFLLHRDQYNVTEEESVHTFQAMIDGGTRSPHNNLLTFLFLMMEFPEWQKKLQEEVDRVVGRDRMPSYRD

IPNLPTVRAIVKETVRYRSIVAEMGIGHCLQTDDIYKGYFFEKGTVFNAIFASILMDKDTYPDGKLFNPA

RWLEPSYPTYKEPLTTYPNCQGFPAFGYGRRACPGVDFAERTLVIMFAKLGWTMNIRWPRDEDGNELREE

LQYEPVPAPRPLKFGCRLEARDADRAKIVEEAAKHLKLQ

 

>CYP5058A2 EAL85111.1 [Aspergillus fumigatus Af293]

MHGVAGLHIPQSCQRVNGDRAPRCRRDQKVYNKSIHVLNTVAKGIKGWPFLGSAPALAAVDTNGIIGIFK

SWAEQYGSITQFSAMGDKQVILTEDKDARELFVRRGIKYSDRGAPHAVEYISMKQNPGFRPKDDGWRRQR

SMIQSAINITSINKYQSLMDDEATFTVNALLQSPDSFHGEFLRYSYSVLTSSLLGFSVRSPSDPFIHHNE

TFTAELMNSFRPDCFPSNVFPVLRKLPMWLLPSLRTMERLRKEYVGEMWAFRRKIEKLVKEGSATECIYK

HFLLHRDQYNVTEEESVHTFQAMIDGGTRSPHNNLLTFLFLMMEFPEWQKKLQEEVDRVVGRDRMPSYRD

IPNLPTVRAIVKETVRYRSIVAEMGIGHCLQTDDIYKGYFFEKGTVFNAIFASILMDKDTYPDGKLFNPA

RWLEPSYPTYKEPLTTYPNCQGFPAFGYGRRACPGVDFAERTLVIMFAKLGWTMNIRWPRDEDGNELREE

LQYEPVPAPRPLKFGCRLEARDADRAKIVEEAAKHLKLQ

 

#46

 

>CYP5061B4 XP_750704.1 cytochrome P450 monooxygenase [Aspergillus fumigatus Af293]

44% to 68L1, 93% to CYP5061B2

MGEKVCRDKEWLHVSVNYTIDAFGAARELRLWPSVTQPLVHWFLPSTRRVRKHISVAKKIVQKEIEKREL

IRQGKLLEYSPPKPNDALDWFREVAAGRPYDITKSQITLSLAAIHTTSNLLTNIMYDLIAYQEYIQPLRD

EIVAVVKEEGCLKKTSLTKLKLMDSFIKETQRLNPVSITSLQRYALADITLSDGTFIPKGAMLIMSAHTM

KDESIYPHADTFDGYRFYNKRKEPGNEHRYQLVTTSNEHLGFGHGLHACPGRFFAANEVKILLIHLLLKY

DWKFAEDRGRPQSIMYGTEIICDPTVKLLYKARTPEIDPSKLGELSTDSPSV

 

>EAL88666.1 cytochrome P450 monooxygenase [Aspergillus fumigatus Af293]

MGEKVCRDKEWLHVSVNYTIDAFGAARELRLWPSVTQPLVHWFLPSTRRVRKHISVAKKIVQKEIEKREL

IRQGKLLEYSPPKPNDALDWFREVAAGRPYDITKSQITLSLAAIHTTSNLLTNIMYDLIAYQEYIQPLRD

EIVAVVKEEGCLKKTSLTKLKLMDSFIKETQRLNPVSITSLQRYALADITLSDGTFIPKGAMLIMSAHTM

KDESIYPHADTFDGYRFYNKRKEPGNEHRYQLVTTSNEHLGFGHGLHACPGRFFAANEVKILLIHLLLKY

DWKFAEDRGRPQSIMYGTEIICDPTVKLLYKARTPEIDPSKLGELSTDSPSV

 

#47

 

>CYP5063A2 BX649605.1  Aspergillus fumigatus 56% to CYP5063A1

44210  MAATSVVAVIVIGLLTVLYISRKNGKKTDKVLLKLPLIGDLHSSPIEKPLANWDSWAQQN  44389

44390  GPIAVPKLFGIIPIVVLNSYEAATELFNRRSQWYSNRPPSVSMEMITGAPPGRSRFTLMH  44569

44570  DYDDHLKLHHRILSPSLGALAAPKYQPLMELEAKQLLHDLVKALQHSPDGATISTNTIYP  44749

44750  LLERTQSSVILALHYGLRIPHPDERILHQVIDIQVQVTHLAANPALPDLIPALRHLPAIL  44929

44930  SPWKRAADRLYAAQVDLYMRLFHHGRDAAGWNATKQALSTAAKYAPASSSSSSSSSSSSS  45109

45110  SSQIPDLDLAFTLATSIQGGMETSPRQLLWLFIAALHQPSFVTRAHAVLDEVVGRDRLPR  45289

45290  FSDRAQLAFIDAVAHELFRWRPIAPGSIPRRADRDDEFQGVKINKGVTIMANAWGIGRDE  45469

45470  QVFDPALGDLQEFVPERWLRAGEAGEERLRSDLPLPVFGQGRRICQGRRVAVDGTFLQV  45646

45647  ASLLWAFDVAMVDDGAGPVDPWEMVVVGFMTMPKERRFKLKPRGDWVLDVIKREWETAEK  45826

45827  SLDKVMGTNDVE* 45865

 

>CYP5063A2 CAE47865.1 [Aspergillus fumigatus]

MAATSVVAVIVIGLLTVLYISRKNGKKTDKVLLKLPLIGDLHSSPIEKPLANWDSWAQQNGPIAVPKLFG

IIPIVVLNSYEAATELFNRRSQWYSNRPPSVSMEMITGAPPGRSRFTLMHDYDDHLKLHHRILSPSLGAL

AAPKYQPLMELEAKQLLHDLVKALQHSPDGATISTNTIYPLLERTQSSVILALHYGLRIPHPDERILHQV

IDIQVQVTHLAANPALPDLIPALRHLPAILSPWKRAADRLYAAQVDLYMRLFHHGRDAAGWNATKQALST

AAKYAPASSSSSSSSSSSSSSSQIPDLDLAFTLATSIQGGMETSPRQLLWLFIAALHQPSFVTRAHAVLD

EVVGRDRLPRFSDRAQLAFIDAVAHELFRWRPIAPGSIPRRADRDDEFQGVKINKGVTIMANAWGIGRDE

QVFDPALGDLQEFVPERWLRAGEAGEERLRSDLPLPVFGQGRRICQGRRVAVDGTFLQVASLLWAFDVAM

VDDGAGPVDPWEMVVVGFMTMPKERRFKLKPRGDWVLDVIKREWETAEKSLDKVMGTNDVE

 

>CYP5063A2 XP_752504.1 [Aspergillus fumigatus Af293]

MAATSVVAVIVIGLLTVLYISRKNGKKTDKVLLKLPLIGDLHSSPIEKPLANWDSWAQQNGPIAVPKLFG

IIPIVVLNSYEAATELFNRRSQWYSNRPPSVSMEMITGAPPGRSRFTLMHDYDDHLKLHHRILSPSLGAL

AAPKYQPLMELEAKQLLHDLVKALQHSPDGATISTNTIYPLLERTQSSVILALHYGLRIPHPDERILHQV

IDIQVQVTHLAANPALPDLIPALRHLPAILSPWKRAADRLYAAQVDLYMRLFHHGRDAAGWNATKQALST

AAKYAPASSSSSSSSSSSSSSSQIPDLDLAFTLATSIQGGMETSPRQLLWLFIAALHQPSFVTRAHAVLD

EVVGRDRLPRFSDRAQLAFIDAVAHELFRWRPIAPGSIPRRADRDDEFQGVKINKGVTIMANAWGIGRDE

QVFDPALGDLQEFVPERWLRAGEAGEERLRSDLPLPVFGQGRRICQGRRVAVDGTFLQVASLLWAFDVAM

VDDGAGPVDPWEMVVVGFMTMPKERRFKLKPRGDWVLDVIKREWETAEKSLDKVMGTNDVE

 

>CYP5063A2 EAL90466.1 [Aspergillus fumigatus Af293]

MAATSVVAVIVIGLLTVLYISRKNGKKTDKVLLKLPLIGDLHSSPIEKPLANWDSWAQQNGPIAVPKLFG

IIPIVVLNSYEAATELFNRRSQWYSNRPPSVSMEMITGAPPGRSRFTLMHDYDDHLKLHHRILSPSLGAL

AAPKYQPLMELEAKQLLHDLVKALQHSPDGATISTNTIYPLLERTQSSVILALHYGLRIPHPDERILHQV

IDIQVQVTHLAANPALPDLIPALRHLPAILSPWKRAADRLYAAQVDLYMRLFHHGRDAAGWNATKQALST

AAKYAPASSSSSSSSSSSSSSSQIPDLDLAFTLATSIQGGMETSPRQLLWLFIAALHQPSFVTRAHAVLD

EVVGRDRLPRFSDRAQLAFIDAVAHELFRWRPIAPGSIPRRADRDDEFQGVKINKGVTIMANAWGIGRDE

QVFDPALGDLQEFVPERWLRAGEAGEERLRSDLPLPVFGQGRRICQGRRVAVDGTFLQVASLLWAFDVAM

VDDGAGPVDPWEMVVVGFMTMPKERRFKLKPRGDWVLDVIKREWETAEKSLDKVMGTNDVE

 

#48

 

>AAHF01000014 Aspergillus fumigatus

CYP5066A1 no introns 89% to CYP5066A2 in CYP64 clan

756944..758524

locus_tag="Afu8g00220" seventh P450 of 8 on this accession

89% to 5066A2

Note: CYP5066A and CYP5067A are close in Aspergillus fumigatus

and Neosartorya fischeri, separated by a phytanoyl-CoA dioxygenase

they are probably working in a pathway.

MERLPLSPAVLFLIIVLPILYLWIRYTAPARPHGKHLSLPPGPP

RLPKIGNLHQVPRQIPWKKYKEWSDTYGPIMSVQLADTIAVVFSSWDLIKNHIERRNT

IYSSRPSVPFFLHATGGLNASILPYGPEWKLQRAIRSSVLKPSMTVKYRDVQHVETTQ

LLHELLSTNDFPVCLRRCIASVFLTVAYGERCVDHAGLEAIDRLEELNRAIALHAEAL

FSGAAGILTQLVLPKALVDRLPVRWKKDADMLHNRLTADLVARTRAALVRPGWNWVKE

FSMKDGIGSGDGDGEQGSKVELKRLAYMVGSLYEASMAASQALRVIILAGLLHPDATR

RMHDELDAVVGTGRLPDFHDAAQLPYTQAFIKEAMRWRSLTPMGSPRATSDEDECRGY

HIPCGATVLVNVWAINHDEAIFLDPFAFQPERWIENPDLPQLMYGMGQRACPGRHMGQ

DSLFLATARLFWAFDMALPDGADPIDQERFLDSGTTLAAFLPDFEVRFTPRSEKYQEV

IENSMAVLPDVLSISATP*

 

>CYP5066A1 XP_747182.1 [Aspergillus fumigatus Af293]

MERLPLSPAVLFLIIVLPILYLWIRYTAPARPHGKHLSLPPGPPRLPKIGNLHQVPRQIPWKKYKEWSDT

YGPIMSVQLADTIAVVFSSWDLIKNHIERRNTIYSSRPSVPFFLHATGGLNASILPYGPEWKLQRAIRSS

VLKPSMTVKYRDVQHVETTQLLHELLSTNDFPVCLRRCIASVFLTVAYGERCVDHAGLEAIDRLEELNRA

IALHAEALFSGAAGILTQLVLPKALVDRLPVRWKKDADMLHNRLTADLVARTRAALVRPGWNWVKEFSMK

DGIGSGDGDGEQGSKVELKRLAYMVGSLYEASMAASQALRVIILAGLLHPDATRRMHDELDAVVGTGRLP

DFHDAAQLPYTQAFIKEAMRWRSLTPMGSPRATSDEDECRGYHIPCGATVLVNVWAINHDEAIFLDPFAF

QPERWIENPDLPQLMYGMGQRACPGRHMGQDSLFLATARLFWAFDMALPDGADPIDQERFLDSGTTLAAF

LPDFEVRFTPRSEKYQEVIENSMAVLPDVLSISATP

 

>CYP5066A1 EAL85144.1 [Aspergillus fumigatus Af293]

MERLPLSPAVLFLIIVLPILYLWIRYTAPARPHGKHLSLPPGPPRLPKIGNLHQVPRQIPWKKYKEWSDT

YGPIMSVQLADTIAVVFSSWDLIKNHIERRNTIYSSRPSVPFFLHATGGLNASILPYGPEWKLQRAIRSS

VLKPSMTVKYRDVQHVETTQLLHELLSTNDFPVCLRRCIASVFLTVAYGERCVDHAGLEAIDRLEELNRA

IALHAEALFSGAAGILTQLVLPKALVDRLPVRWKKDADMLHNRLTADLVARTRAALVRPGWNWVKEFSMK

DGIGSGDGDGEQGSKVELKRLAYMVGSLYEASMAASQALRVIILAGLLHPDATRRMHDELDAVVGTGRLP

DFHDAAQLPYTQAFIKEAMRWRSLTPMGSPRATSDEDECRGYHIPCGATVLVNVWAINHDEAIFLDPFAF

QPERWIENPDLPQLMYGMGQRACPGRHMGQDSLFLATARLFWAFDMALPDGADPIDQERFLDSGTTLAAF

LPDFEVRFTPRSEKYQEVIENSMAVLPDVLSISATP

 

#49

 

>AAHF01000014 Aspergillus fumigatus

CYP5067A1 most like CYP68 family, may be a subfamily of CYP68

join(752285..752491,752557..752673,752735..752834,

752888..752956,753007..753597,753667..754008,

754032..754078) model revised at intron 4

locus_tag="Afu8g00240" sixth P450 of 8 on this accession

37% to 68A1 Gibberella fujikuroi, best hits all CYP68

Note: CYP5066A4 and CYP5067A1 are close in Aspergillus fumigatus

and Neosartorya fischeri, separated by a phytanoyl-CoA dioxygenase

they are probably working in a pathway.

METLDAIQLPYLGVVGASLIVILGIILLFPLGSDPFITINQHPRDLFQTKAKQQFEYNAAALLNEGLQT (0)

GHSAFRLVTNMVTYLILKDQYAEEIKNDSRFGAHEAVDP (0)

VLLVDLPGLESMFQGSLHNQVPPMAVRALNKEL (1)

VHLTPSLSEEAMNCLQTRWTDS TGTC(0)

TEWHGVSIPETVLALIAQMTTRALLGPELCRNPEWLDIAKSFTTNRAIAVAAVQS

WPSFLQPVIHWFLPPCRALRRQIQCARNIILPALERERRAYCSDQPTKREFSNLVFID

QYAKGARYDATMAQLRIIAVAFQTTSDLVEKVIARLCKHPELIEPLREEVVSVVGNHG

LHRHSLRKLTLMESVMKETQRLEPAVI (1)

IGMFRLAKEKVTLKDGTVVPKGTNIAFANDL

RFDPEMYLEPETFDGYRFQRMREDPAKIDLAPFTKTRMSHLAFGHGKHACPGRFLACD

EAKLILCHILLNYDIRAVEGSPPEL (1)

PGSWGNDVGEKTAGD*

 

>CYP5067A1 XP_747180.1 [Aspergillus fumigatus Af293]

METLDAIQLPYLGVVGASLIVILGIILLFPLGSDPFITINQHPRDLFQTKAKQQFEYNAAALLNEGLQTG

HSAFRLVTNMVTYLILKDQYAEEIKNDSRFGAHEAVDPVLLVDLPGLESMFQGSLHNQVPPMAVRALNKE

LVHLTPSLSEEAMNCLQTRWTDSTEWHGVSIPETVLALIAQMTTRALLGPELCRNPEWLDIAKSFTTNRA

IAVAAVQSWPSFLQPVIHWFLPPCRALRRQIQCARNIILPALERERRAYCSDQPTKREFSNLVFIDQYAK

GARYDATMAQLRIIAVAFQTTSDLVEKVIARLCKHPELIEPLREEVVSVVGNHGLHRHSLRKLTLMESVM

KETQRLEPAVIIGMFRLAKEKVTLKDGTVVPKGTNIAFANDLRFDPEMYLEPETFDGYRFQRMREDPAKI

DLAPFTKTRMSHLAFGHGKHACPGRFLACDEAKLILCHILLNYDIRAVEGSPPELPGSWGNDVGEKTAGD

 

>CYP5067A1 EAL85142.1 [Aspergillus fumigatus Af293]

METLDAIQLPYLGVVGASLIVILGIILLFPLGSDPFITINQHPRDLFQTKAKQQFEYNAAALLNEGLQTG

HSAFRLVTNMVTYLILKDQYAEEIKNDSRFGAHEAVDPVLLVDLPGLESMFQGSLHNQVPPMAVRALNKE

LVHLTPSLSEEAMNCLQTRWTDSTEWHGVSIPETVLALIAQMTTRALLGPELCRNPEWLDIAKSFTTNRA

IAVAAVQSWPSFLQPVIHWFLPPCRALRRQIQCARNIILPALERERRAYCSDQPTKREFSNLVFIDQYAK

GARYDATMAQLRIIAVAFQTTSDLVEKVIARLCKHPELIEPLREEVVSVVGNHGLHRHSLRKLTLMESVM

KETQRLEPAVIIGMFRLAKEKVTLKDGTVVPKGTNIAFANDLRFDPEMYLEPETFDGYRFQRMREDPAKI

DLAPFTKTRMSHLAFGHGKHACPGRFLACDEAKLILCHILLNYDIRAVEGSPPELPGSWGNDVGEKTAGD

 

#50

 

>AAHF01000014 Aspergillus fumigatus

CYP5068A1

complement(618220..619713) no introns

locus_tag="Afu8g00740" fourth P450 of 8 on this accession

CYP65% to CYP5068A2

32% to 663A1 A. nidulans in the CYP64 clan

MELVAPTLLAIVLVCCCLHLLRSQ

ASRLPLPPGPTLLSRPFPEK

DIATTFQKWNQRYGPVISFRVGSRTFVVLGTRQAAQDLLEKRGSIYSSRPPSVWMEKY

LNKGLAAAFMPYGHEWRLNRRLHGSLLSAHHTNAYRSLQDIQSKQLLHDFLSTNDFSH

CFHQYTSNVMFTLVYGKGRGKDDNDHRRLEQINELAGFVLQGASFWTFLMDLFPILDY

VPRIFWKWRTEAARLHDRTMVVYRECCEEALTAECWHWSKEVTQKPDIMQLPWDNVCY

SLGELYVAGIHTTKMVLELCVMVSILYPDVVCKAQQELDSMVGADRLPSFDDMERLPF

INAIISELLRWRPISPIAVPHAAIQDDEYMGYFIPKGATVIANQFGMNMDDAFFYDPS

SFHPERYVENPDLPVSAFGFGRRACPGHRLARSSLFIVISRLLWAFHITSANKEPLTE

ESSPAAVKATFRVRSPHRQKIIERDWALAEKDERIVLSQIESRIRGK*

 

>CYP5068A1 XP_747131.1 [Aspergillus fumigatus Af293]

MELVAPTLLAIVLVCCCLHLLRSQASRLPLPPGPTLLSRPFPEKDIATTFQKWNQRYGPVISFRVGSRTF

VVLGTRQAAQDLLEKRGSIYSSRPPSVWMEKYLNKGLAAAFMPYGHEWRLNRRLHGSLLSAHHTNAYRSL

QDIQSKQLLHDFLSTNDFSHCFHQYTSNVMFTLVYGKGRGKDDNDHRRLEQINELAGFVLQGASFWTFLM

DLFPILDYVPRIFWKWRTEAARLHDRTMVVYRECCEEALTAECWHWSKEVTQKPDIMQLPWDNVCYSLGE

LYVAGIHTTKMVLELCVMVSILYPDVVCKAQQELDSMVGADRLPSFDDMERLPFINAIISELLRWRPISP

IAVPHAAIQDDEYMGYFIPKGATVIANQFGMNMDDAFFYDPSSFHPERYVENPDLPVSAFGFGRRACPGH

RLARSSLFIVISRLLWAFHITSANKEPLTEESSPAAVKATFRVRSPHRQKIIERDWALAEKDERIVLSQI

ESRIRGK

 

>CYP5068A1 EAL85093.1 [Aspergillus fumigatus Af293]

MELVAPTLLAIVLVCCCLHLLRSQASRLPLPPGPTLLSRPFPEKDIATTFQKWNQRYGPVISFRVGSRTF

VVLGTRQAAQDLLEKRGSIYSSRPPSVWMEKYLNKGLAAAFMPYGHEWRLNRRLHGSLLSAHHTNAYRSL

QDIQSKQLLHDFLSTNDFSHCFHQYTSNVMFTLVYGKGRGKDDNDHRRLEQINELAGFVLQGASFWTFLM

DLFPILDYVPRIFWKWRTEAARLHDRTMVVYRECCEEALTAECWHWSKEVTQKPDIMQLPWDNVCYSLGE

LYVAGIHTTKMVLELCVMVSILYPDVVCKAQQELDSMVGADRLPSFDDMERLPFINAIISELLRWRPISP

IAVPHAAIQDDEYMGYFIPKGATVIANQFGMNMDDAFFYDPSSFHPERYVENPDLPVSAFGFGRRACPGH

RLARSSLFIVISRLLWAFHITSANKEPLTEESSPAAVKATFRVRSPHRQKIIERDWALAEKDERIVLSQI

ESRIRGK

 

#51

 

>XM_741366 Aspergillus fumigatus  mRNA PLN 06-FEB-2006

CYP5069A1 41% to 5050A1 but only 34% to 5050B1, keep in a separate family.

Aspergillus fumigatus Af293 O-methylsterigmatocystin oxidoreductase

MDPFKAIDLPLPPHFVAALGRPTVLVGFACVFLFSQLLVWTAKY

SRKKSKGLADIPGPSGWPIIGIGLDLPARPRKLLNSWANQFGDTFKVRVGWYNWVFFN

HPDAVKEVFDRQAAVTSGKPPLPIAQEYCLRGDGVLPMTYNAKWKRLHAFLKQLLNAK

ASAAFIPSQEFEIKQLLWDLSHEAGKNSTDFYMHIRRMTFSIVMTSAYGLRIPQWDCQ

EVRDVYGNMRMLSIILSPGVFWIDVFPPLNWLPRFLFPSWPKAKFMAQKMHANKMRHW

NNLKERIALGNAPDCFAKDLMESNYRDYGLEEETVSWLASAVPEAGAETTASALNGMI

RYLAMFPEAQARAHEEVTRILGDGRMATLADEPQMPYIKAVIKETLRLCPVATTGLRR

MADGDVKYRDYVIPKGTILLANLNALHWDPERFPDPFSFKPERYLNHPHRSAVYAAGG

DIMARDHFTFGAGRRICPGIHLAENGLFLAVSNLIWAYEFKLPLDEKGNEIPLDISDE

GFMEGAIRVPKQYTVRILERNPARSRLIRESWEQAQKDGYILRGVHVDADGGVRGSAK

VKA*

 

>CYP5069A1 XP_746459.1 O-methylsterigmatocystin oxidoreductase [Aspergillus fumigatus Af293]

MDPFKAIDLPLPPHFVAALGRPTVLVGFACVFLFSQLLVWTAKYSRKKSKGLADIPGPSGWPIIGIGLDL

PARPRKLLNSWANQFGDTFKVRVGWYNWVFFNHPDAVKEVFDRQAAVTSGKPPLPIAQEYCLRGDGVLPM

TYNAKWKRLHAFLKQLLNAKASAAFIPSQEFEIKQLLWDLSHEAGKNSTDFYMHIRRMTFSIVMTSAYGL

RIPQWDCQEVRDVYGNMRMLSIILSPGVFWIDVFPPLNWLPRFLFPSWPKAKFMAQKMHANKMRHWNNLK

ERIALGNAPDCFAKDLMESNYRDYGLEEETVSWLASAVPEAGAETTASALNGMIRYLAMFPEAQARAHEE

VTRILGDGRMATLADEPQMPYIKAVIKETLRLCPVATTGLRRMADGDVKYRDYVIPKGTILLANLNALHW

DPERFPDPFSFKPERYLNHPHRSAVYAAGGDIMARDHFTFGAGRRICPGIHLAENGLFLAVSNLIWAYEF

KLPLDEKGNEIPLDISDEGFMEGAIRVPKQYTVRILERNPARSRLIRESWEQAQKDGYILRGVHVDADGG

VRGSAKVKA

 

>CYP5069A1 EAL84421.1 O-methylsterigmatocystin oxidoreductase, putative [Aspergillus fumigatus Af293]

MDPFKAIDLPLPPHFVAALGRPTVLVGFACVFLFSQLLVWTAKYSRKKSKGLADIPGPSGWPIIGIGLDL

PARPRKLLNSWANQFGDTFKVRVGWYNWVFFNHPDAVKEVFDRQAAVTSGKPPLPIAQEYCLRGDGVLPM

TYNAKWKRLHAFLKQLLNAKASAAFIPSQEFEIKQLLWDLSHEAGKNSTDFYMHIRRMTFSIVMTSAYGL

RIPQWDCQEVRDVYGNMRMLSIILSPGVFWIDVFPPLNWLPRFLFPSWPKAKFMAQKMHANKMRHWNNLK

ERIALGNAPDCFAKDLMESNYRDYGLEEETVSWLASAVPEAGAETTASALNGMIRYLAMFPEAQARAHEE

VTRILGDGRMATLADEPQMPYIKAVIKETLRLCPVATTGLRRMADGDVKYRDYVIPKGTILLANLNALHW

DPERFPDPFSFKPERYLNHPHRSAVYAAGGDIMARDHFTFGAGRRICPGIHLAENGLFLAVSNLIWAYEF

KLPLDEKGNEIPLDISDEGFMEGAIRVPKQYTVRILERNPARSRLIRESWEQAQKDGYILRGVHVDADGG

VRGSAKVKA

 

#52

 

>AAHF01000006.1  Aspergillus fumigatus

CYP5074A1 temp = CYP68P1

40% to CYP68D2, 41% to 68A1, 42% to 68L1

may be a CYP68 new subfamily or a new family close to CYP68

join(2240366..2240617,2240858..2240960,2241166..2241768,

2241834..2242254,2243095..2243299,2243359..2243572,

2243792..2244367,2244427..2244655,2244889..2244922)

locus_tag="Afu6g13940" gene  model is wrong, two genes fused, missing exons

         MVSSFSSKRLGDTMDSLALGSNWAGGVAIVLFLAPLALHLVSSY

         LFPSTSTVINSGRAWDIFRTTAKKRFRSDAARLLQ NGFEK  (0)

2240686  SPDAFRILTDNGPLLVLSPRYAREVRSDDRLSLDHFIAS (0)  2240802

2240858  EFHPDIPGFEPFKLILDPRNPLNTILKTSLTQAL (1)  2240959

         AYMTEDLSVEVADALSTALTDDS (1)

         EWHEISPCQTALKLVAQMASKAFIGPEKCRDPKWHNVIITYT

         HNVYRAAQALHFWPKFLRPIVARFLPACQTLQAQIAEAREILEPLVAQRRADRACRAA

         QGKPVPSRADVIDWLEDSHGDQPYDPVAAQLLLSFAAIHGTSNLLAQALMDLCTAPDL

         IRDIRAEITSVLGDAGLTRAALYRLKLMDSALKESQRLAPNRL  (1)

         LSMGRIAQSDMHLSDGLRIPRGTTLMVSAHAMWEPQIYPDPRRYD

         GYRFYKLRQVPGQEGQHQLVSATEKHMGFGYGKHACPGRFFAAAEIKVALCHILL

         KYDLEHRGGGPPPRVWSQGIHLFPDPTARIRVRRRKEEISL*   

 

>CYP5074A1 XP_751269.1 [Aspergillus fumigatus Af293]

MVSSFSSKRLGDTMDSLALGSNWAGGVAIVLFLAPLALHLVSSYLFPSTSTVINSGRAWDIFRTTAKKRF

RSDAARLLQNGFEKEFHPDIPGFEPFKLILDPRNPLNTILKTSLTQALEWHEISPCQTALKLVAQMASKA

FIGPEKCRDPKWHNVIITYTHNVYRAAQALHFWPKFLRPIVARFLPACQTLQAQIAEAREILEPLVAQRR

ADRACRAAQGKPVPSRADVIDWLEDSHGDQPYDPVAAQLLLSFAAIHGTSNLLAQALMDLCTAPDLIRDI

RAEITSVLGDAGLTRAALYRLKLMDSALKESQRLAPNRLLSMGRIAQSDMHLSDGLRIPRGTTLMVSAHA

MWEPQIYPDPRRYDGYRFYKLRQVPGQEGQHQLVSATEKHMGFGYGKHACPGRFFAAAEIKVALCHILLK

YDLEHRGGGPPPRVWSQGIHLFPDPTARIRVRRRKEEISLVEDASIGTVWVTCLLAVGLYFIRSRLLSDQ

FAGFPSVNSRKPWEVLNVFAHRRFQQNGPEYLKAGFAKSPVFGVVTDLGPKLVVSGAFIEDFKDEKLLDH

YRAMVEDFMAEVPGFESMFLGNLHNTVLRDVISVITRELDWTEVTLLPSMLGLIARVSSLIFVGEPLCRD

PAWLETVVNFTIVRHQAILALHMCPAVLRPVLHWFLPPCQKLRREIKTARSLINSALEELRKNPPTDRFS

SLAWVDAFASGKKYDATMVQLRLANASIHSSADLLAKVLINLCEQPGLIQDLRDEVISVLEENGWRASTL

NQLKLLDSVLKESQRLHPITTGTFSRFTRQNIKLTNGTEIPTGTPVMVTNDVAGDAAIYPDPEVFDGYRY

LRMREGADKARAPFTTTGQNHLGFGYGNQGNHVPKEEE

 

>CYP5074A1 EAL89231.1 [Aspergillus fumigatus Af293]

MVSSFSSKRLGDTMDSLALGSNWAGGVAIVLFLAPLALHLVSSYLFPSTSTVINSGRAWDIFRTTAKKRF

RSDAARLLQNGFEKEFHPDIPGFEPFKLILDPRNPLNTILKTSLTQALEWHEISPCQTALKLVAQMASKA

FIGPEKCRDPKWHNVIITYTHNVYRAAQALHFWPKFLRPIVARFLPACQTLQAQIAEAREILEPLVAQRR

ADRACRAAQGKPVPSRADVIDWLEDSHGDQPYDPVAAQLLLSFAAIHGTSNLLAQALMDLCTAPDLIRDI

RAEITSVLGDAGLTRAALYRLKLMDSALKESQRLAPNRLLSMGRIAQSDMHLSDGLRIPRGTTLMVSAHA

MWEPQIYPDPRRYDGYRFYKLRQVPGQEGQHQLVSATEKHMGFGYGKHACPGRFFAAAEIKVALCHILLK

YDLEHRGGGPPPRVWSQGIHLFPDPTARIRVRRRKEEISLVEDASIGTVWVTCLLAVGLYFIRSRLLSDQ

FAGFPSVNSRKPWEVLNVFAHRRFQQNGPEYLKAGFAKSPVFGVVTDLGPKLVVSGAFIEDFKDEKLLDH

YRAMVEDFMAEVPGFESMFLGNLHNTVLRDVISVITRELDWTEVTLLPSMLGLIARVSSLIFVGEPLCRD

PAWLETVVNFTIVRHQAILALHMCPAVLRPVLHWFLPPCQKLRREIKTARSLINSALEELRKNPPTDRFS

SLAWVDAFASGKKYDATMVQLRLANASIHSSADLLAKVLINLCEQPGLIQDLRDEVISVLEENGWRASTL

NQLKLLDSVLKESQRLHPITTGTFSRFTRQNIKLTNGTEIPTGTPVMVTNDVAGDAAIYPDPEVFDGYRY

LRMREGADKARAPFTTTGQNHLGFGYGNQGNHVPKEEE

 

#53

 

>AAHF01000014 Aspergillus fumigatus

CYP5076C2 = old CYP5066A4? = old CYP5072A1

join(762752..763720,763784..763905,763978..764276,

764348..764487), gene model missing last exon

end of this predicted seq is wrong, replace with last exon

locus_tag="Afu8g00190" eighth P450 of 8 on this accession

51% to CYP5076C1, 43% to CYP5076A1, 34% to 670A1

MMPSVMKCGYLATAGLIGICTHLSYFRYGEHHLY

PWRYVRFHLCLTMGVAALLYAKKPPQYTLCSMDLVKDVSLLMATYLVGLFASLLLYRT

LFHPLRQIRGPWAAKISSFWLSFRLRRGPSFRILHELHEEYGPVVRVGPSEVSIIHPE

AVRMIYGPNSRCSKNTFYDNGHPMMSLHSYRDRIAHDQRRRVWSAGFGDRALRGYEQR

MRVYRQKLFQRLEARAVAESAINISQWFNFYSYDTMGDLAFARSFDMLDASRNHWAVD

MLMHGMIGYRYLFPSWFFRLLATMPSLSSDWHKFIGFATDTMLRRVGEQVDVPDIFAS

LLAPLNGREPTEDERNMLMGDAMLIITAGSDTTATSLTSIVYELARHLDEVDKLRAEL

DPIEADSDGEYQHDTLAKLPHLNGFINETLRLHPPIPGVIPRKTPPEGIHVKDVFIPG

NMTVFSPQWSMGRSEAAYIDPEIFNPERWYKHMDLVKDPSAFAPFSI (1)

GPYSCIGKPLALMNIRTTVARLIMSFDVRFPEGEDGIRWMDAADEHFAMGIHQMPVVLTRRH*

 

>CYP5076C2 XP_747185.1 [Aspergillus fumigatus Af293]

MKPSHSDTPLMMPSVMKCGYLATAGLIGICTHLSYFRYGEHHLYPWRYVRFHLCLTMGVAALLYAKKPPQ

YTLCSMDLVKDVSLLMATYLVGLFASLLLYRTLFHPLRQIRGPWAAKISSFWLSFRLRRGPSFRILHELH

EEYGPVVRVGPSEVSIIHPEAVRMIYGPNSRCSKNTFYDNGHPMMSLHSYRDRIAHDQRRRVWSAGFGDR

ALRGYEQRMRVYRQKLFQRLEARAVAESAINISQWFNFYSYDTMGDLAFARSFDMLDASRNHWAVDMLMH

GMIGYRYLFPSWFFRLLATMPSLSSDWHKFIGFATDTMLRRVGEQVDVPDIFASLLAPLNGREPTEDERN

MLMGDAMLIITAGSDTTATSLTSIVYELARHLDEVDKLRAELDPIEADSDGEYQHDTLAKLPHLNGFINE

TLRLHPPIPGVIPRKTPPEGIHVKDVFIPGNMTVFSPQWSMGRSEAAYIDPEIFNPERWYKHMDLVKDPS

AFAPFSIGSYIRSDLARSL

 

>CYP5076C2 EAL85147.1 [Aspergillus fumigatus Af293]

MKPSHSDTPLMMPSVMKCGYLATAGLIGICTHLSYFRYGEHHLYPWRYVRFHLCLTMGVAALLYAKKPPQ

YTLCSMDLVKDVSLLMATYLVGLFASLLLYRTLFHPLRQIRGPWAAKISSFWLSFRLRRGPSFRILHELH

EEYGPVVRVGPSEVSIIHPEAVRMIYGPNSRCSKNTFYDNGHPMMSLHSYRDRIAHDQRRRVWSAGFGDR

ALRGYEQRMRVYRQKLFQRLEARAVAESAINISQWFNFYSYDTMGDLAFARSFDMLDASRNHWAVDMLMH

GMIGYRYLFPSWFFRLLATMPSLSSDWHKFIGFATDTMLRRVGEQVDVPDIFASLLAPLNGREPTEDERN

MLMGDAMLIITAGSDTTATSLTSIVYELARHLDEVDKLRAELDPIEADSDGEYQHDTLAKLPHLNGFINE

TLRLHPPIPGVIPRKTPPEGIHVKDVFIPGNMTVFSPQWSMGRSEAAYIDPEIFNPERWYKHMDLVKDPS

AFAPFSIGSYIRSDLARSL

 

#54

 

>CYP5076D1 XP_751878.1 [Aspergillus fumigatus Af293]

52% to CYP5076A1An, 48% to 5076C1, 46% to 5076C2, 42% to 5076B1

MDSYVLIAIAGVLSHVVYFRRGEHQLYSHIYLVLFVISAAVVTVLVHYSYILVYLASLYTSILVYRLLLH

PLRSFPGPLAARVSGLWYIHPKHNAYLSLQALHSQYGPIVRTGPSDLSIIYPSAVPAIYGAQSACTKGPW

YDLSYPSRPLQHCRNAKEHHARRRTWTPAFSDRMVRGYEQRIQTYQQQLIAQLTARQTVDIRKWIYLYTF

DVMGDLSFGRSFDCLAAGHEHPGITLLNAALRNIGLFLPPWLHLILLKIPWLTRDWWAFQSFCSERLHAR

MRMDLPIPDISASLLAPLHGRAPTPEERLMLDGDARLIVVGGSDTTAVSLCGALYELARHPEQLRKLRKL

REEVEPFVDAAGDVRGADIALLEHLNGVINEALRMYPAVSSGLQRKTPPEGIQVEGVHIPGEMTVYCPQY

VLGRSELCYARPDEFIPERWYKYPGLIKDRSAFAPFSLGPYSCVGRPLALLNMRTTIAKLVTTFDMGFAP

GEDGKAFKQQAQDNFVLYMGPLHLTFARREGNWRRRSDG

 

>EAL89840.1 [Aspergillus fumigatus Af293]

MDSYVLIAIAGVLSHVVYFRRGEHQLYSHIYLVLFVISAAVVTVLVHYSYILVYLASLYTSILVYRLLLH

PLRSFPGPLAARVSGLWYIHPKHNAYLSLQALHSQYGPIVRTGPSDLSIIYPSAVPAIYGAQSACTKGPW

YDLSYPSRPLQHCRNAKEHHARRRTWTPAFSDRMVRGYEQRIQTYQQQLIAQLTARQTVDIRKWIYLYTF

DVMGDLSFGRSFDCLAAGHEHPGITLLNAALRNIGLFLPPWLHLILLKIPWLTRDWWAFQSFCSERLHAR

MRMDLPIPDISASLLAPLHGRAPTPEERLMLDGDARLIVVGGSDTTAVSLCGALYELARHPEQLRKLRKL

REEVEPFVDAAGDVRGADIALLEHLNGVINEALRMYPAVSSGLQRKTPPEGIQVEGVHIPGEMTVYCPQY

VLGRSELCYARPDEFIPERWYKYPGLIKDRSAFAPFSLGPYSCVGRPLALLNMRTTIAKLVTTFDMGFAP

GEDGKAFKQQAQDNFVLYMGPLHLTFARREGNWRRRSDG

 

#55

 

>CYP5078A4 XP_748665.1 cytochrome P450 monooxygenase [Aspergillus fumigatus Af293]

72% to 5078A3An old 532C2

MEVSILSLFKAYAAYVTVAVVLLRLITNRFRRGLAGIPGPTIAKWTRLWKLHSVWKGNHHTTAIDLHRKY

GPLVRIGPKHVSVGDPSAIPIIYGLNKGFTKMNLFSTRDEMFHREQKRPVANAYSMTSLLELEPAVDSCT

EIFINQLARFANSKKPVDLGMWLQYYAFDVVGEFTFAKKLGFLQEGKDVDGMIEAIQGMLVYASVCGQIP

EAHPLLLGNPLFPIFMPSMETWNQVLNFTLKAINSRASLQRDGELDAEKPEAGKDMLSRWMAIHLSDPEK

LTTRDVIVHLSTNVFAGSDTTAIALRAVFYFLLRNPSVLAKLNAEIDNADREGKLSTPISYRETMNHLPY

LQAVLKESMRLHPSVGLILEREVPKGGVTICDRHFPGGTIVGINAWVLHRDARVFPDPDKFIPERWIDSD

PQHLKKMDQSFFAFGAGSRTCIGKNISLIEMHKIIPQLLREFEIRLHSPEKEWKTKNVWFVQQEGLVCDL

VCRRDAKCYH

 

>EAL86627.1 cytochrome P450 monooxygenase, putative [Aspergillus fumigatus Af293]

MEVSILSLFKAYAAYVTVAVVLLRLITNRFRRGLAGIPGPTIAKWTRLWKLHSVWKGNHHTTAIDLHRKY

GPLVRIGPKHVSVGDPSAIPIIYGLNKGFTKMNLFSTRDEMFHREQKRPVANAYSMTSLLELEPAVDSCT

EIFINQLARFANSKKPVDLGMWLQYYAFDVVGEFTFAKKLGFLQEGKDVDGMIEAIQGMLVYASVCGQIP

EAHPLLLGNPLFPIFMPSMETWNQVLNFTLKAINSRASLQRDGELDAEKPEAGKDMLSRWMAIHLSDPEK

LTTRDVIVHLSTNVFAGSDTTAIALRAVFYFLLRNPSVLAKLNAEIDNADREGKLSTPISYRETMNHLPY

LQAVLKESMRLHPSVGLILEREVPKGGVTICDRHFPGGTIVGINAWVLHRDARVFPDPDKFIPERWIDSD

PQHLKKMDQSFFAFGAGSRTCIGKNISLIEMHKIIPQLLREFEIRLHSPEKEWKTKNVWFVQQEGLVCDL

VCRRDAKCYH

 

#56

 

>CYP5080B3 XP_753882.1 [Aspergillus fumigatus Af293]

MFLIIVIPIVILLYPFLSTLYTTLRTRSLRRIPGPFLTRLTKLWYFYRVRAGHFETDNIALHRRYGPVVR

IAPDHYSISGSAAIKTVYGTGSKFTKSAWYEGWKHPDPNQWTLFPDRNIKRHAETRKRFSSLYSMTSLVH

YEAFVDRCADLFCMRLREFAARGEEFNLGHWFQCYAFDVIGDITYGQRFGFLDRGEDIEGTIAALQRLMT

YSTLVGIYPEWHPRLFGPLSRFSWSGAAGRAYIVRFVQEKIRGLSVKADPGQVERGPLATQNFVEKMMLA

RDKDPEKVTDYHVFMMGLSNVIAGSDTTAISLSAIMYHLLRYPAVMEKLRREIDAFAADGKCSDSVTFRE

SQEMPYFQAVIKEALRMHSATGLPLWRVVPDGGVEINGYFFPAGTVVGINTWVAHYDEEVFPDATTFRPE

RWIEAESNPEKLRAMNEMYMPVGLTHFSRIQHTDDGSSALGLGRVLESTSPFWKCRN

 

>EAL91844.1 [Aspergillus fumigatus Af293] 71% to 5080B2

MFLIIVIPIVILLYPFLSTLYTTLRTRSLRRIPGPFLTRLTKLWYFYRVRAGHFETDNIALHRRYGPVVR

IAPDHYSISGSAAIKTVYGTGSKFTKSAWYEGWKHPDPNQWTLFPDRNIKRHAETRKRFSSLYSMTSLVH

YEAFVDRCADLFCMRLREFAARGEEFNLGHWFQCYAFDVIGDITYGQRFGFLDRGEDIEGTIAALQRLMT

YSTLVGIYPEWHPRLFGPLSRFSWSGAAGRAYIVRFVQEKIRGLSVKADPGQVERGPLATQNFVEKMMLA

RDKDPEKVTDYHVFMMGLSNVIAGSDTTAISLSAIMYHLLRYPAVMEKLRREIDAFAADGKCSDSVTFRE

SQEMPYFQAVIKEALRMHSATGLPLWRVVPDGGVEINGYFFPAGTVVGINTWVAHYDEEVFPDATTFRPE

RWIEAESNPEKLRAMNEMYMPVGLTHFSRIQHTDDGSSALGLGRVLESTSPFWKCRN

 

These seqs are not assigned to a family yet.  Some are too short.

 

#57

 

>CYP5092A1 XP_756135.1 cytochrome p450 [Aspergillus fumigatus Af293]

MLLLTFTLPVVTLLLAHIIRSWFRLRHIPGPFWAKITDLWREHHYIKGDYGDRPMAPYFAIPSLLGMESA

MDQIQQELEDQICRRVTIDVVLWMRLFSLESLHWIAFSNKLGYLSEGKDTDGILSILQSKFIGLAGQLCG

WIHRTTLRFHFPKSCTGTAVAPSQRKASHRDLLAHFMDASQKNPETLEERGVLGATISTIFAGTDTTGTS

LTFFMYYLIKHPAALARLQEELDSAVRSGNLSYPPKWVEVSTLKYLQAVFKETLRLHSTARMSLYRVVGP

EGLDLCGERLPSGTNLGCFGYTAHRNEPIYGRDAALFRPERWIEASNDTLLSMERASL

 

>EAL94097.1 cytochrome p450, putative [Aspergillus fumigatus Af293]

MLLLTFTLPVVTLLLAHIIRSWFRLRHIPGPFWAKITDLWREHHYIKGDYGDRPMAPYFAIPSLLGMESA

MDQIQQELEDQICRRVTIDVVLWMRLFSLESLHWIAFSNKLGYLSEGKDTDGILSILQSKFIGLAGQLCG

WIHRTTLRFHFPKSCTGTAVAPSQRKASHRDLLAHFMDASQKNPETLEERGVLGATISTIFAGTDTTGTS

LTFFMYYLIKHPAALARLQEELDSAVRSGNLSYPPKWVEVSTLKYLQAVFKETLRLHSTARMSLYRVVGP

EGLDLCGERLPSGTNLGCFGYTAHRNEPIYGRDAALFRPERWIEASNDTLLSMERASL

 

#58

 

>CYP5091A1 XP_755777.1 cytochrome P450 [Aspergillus fumigatus Af293]

MFGFEWHNQRGVEGTGFVRALRSRLTAHLPILMPELQRIVETAIADELVAPGSDGKWGSPQLCLIPSDCS

RLRALQTVPYDQANGHQGQLLRLLRGGTWYDYPWHVRHRQAHCVAAQNPEFTAAALEFPQRVILAAEILR

ITPSFLRRTLFRYLKPIVEKRLAARANSPRSLQEDAPMDCMQWLIDTSPRKIPWTPTRMVGEIVAVWFGS

VHQLAMVRSYSARRNLTVRRKALTPFMFSDGLEVAEGDWVCIPQRAMMRDRIRYQNPQAFDGFRFARANK

QLRAGDVSLDVPENSPLTMTDVSVDWPIWGLGKTACPGRFYAATILKLIMVCILEKWECRLENPKSQRWR

TWRSSVVPREGTVVMFRRKEEALTG

 

>EAL93739.1 cytochrome P450, putative [Aspergillus fumigatus Af293]

MFGFEWHNQRGVEGTGFVRALRSRLTAHLPILMPELQRIVETAIADELVAPGSDGKWGSPQLCLIPSDCS

RLRALQTVPYDQANGHQGQLLRLLRGGTWYDYPWHVRHRQAHCVAAQNPEFTAAALEFPQRVILAAEILR

ITPSFLRRTLFRYLKPIVEKRLAARANSPRSLQEDAPMDCMQWLIDTSPRKIPWTPTRMVGEIVAVWFGS

VHQLAMVRSYSARRNLTVRRKALTPFMFSDGLEVAEGDWVCIPQRAMMRDRIRYQNPQAFDGFRFARANK

QLRAGDVSLDVPENSPLTMTDVSVDWPIWGLGKTACPGRFYAATILKLIMVCILEKWECRLENPKSQRWR

TWRSSVVPREGTVVMFRRKEEALTG

 

#59

 

>CYP5090A1 XP_755776.1 cytochrome p450 [Aspergillus fumigatus Af293]

MLSDAVSAAIDWTGQGISWVKQEYPALTVAVTSACVLVLWRIWRNYFNNIQDPFALSIANSLIYVITKPQ

DVAEAYRNTDTLSFNEFVQAMMRACGNTESCVKTMYKPLPKDKPGFPNPHGKPLATLARQMHIHQLYPGD

NLDFLEKQFLDWVEPRLTLDALRRECPYAIQSGPPAVTKDDGIVLPLMQWCSDYFTRAGQRAYFGPALDG

IDPKLPQTFIVFDELSWQVLYQYPEFLAGKMKSARNAIQRALKKYIQLPQESRQGDAWFTKAMENEMRAL

GISEDDIATMLVTIYWGINTNTRKAAFWLLTYILHYGPEHYVDIIRQETLPAFLPDKSIPDLNYLHDNCP

HLDAMWNETIRLSAYSASVRFVTSDTIIGGKILRKGNRLMIPYRQLHFDESIFGVDYPVEEFRHERFMQK

GRNLTRSDNWRPFGGGTTQCPGRYVAKRFVLLFVAMLLRRFDVELVTTRIPAAEEGKPVLGIMSIKDGED

VLVRVRPR

 

>EAL93738.1 cytochrome p450, putative [Aspergillus fumigatus Af293]

MLSDAVSAAIDWTGQGISWVKQEYPALTVAVTSACVLVLWRIWRNYFNNIQDPFALSIANSLIYVITKPQ

DVAEAYRNTDTLSFNEFVQAMMRACGNTESCVKTMYKPLPKDKPGFPNPHGKPLATLARQMHIHQLYPGD

NLDFLEKQFLDWVEPRLTLDALRRECPYAIQSGPPAVTKDDGIVLPLMQWCSDYFTRAGQRAYFGPALDG

IDPKLPQTFIVFDELSWQVLYQYPEFLAGKMKSARNAIQRALKKYIQLPQESRQGDAWFTKAMENEMRAL

GISEDDIATMLVTIYWGINTNTRKAAFWLLTYILHYGPEHYVDIIRQETLPAFLPDKSIPDLNYLHDNCP

HLDAMWNETIRLSAYSASVRFVTSDTIIGGKILRKGNRLMIPYRQLHFDESIFGVDYPVEEFRHERFMQK

GRNLTRSDNWRPFGGGTTQCPGRYVAKRFVLLFVAMLLRRFDVELVTTRIPAAEEGKPVLGIMSIKDGED

VLVRVRPR

 

#60

 

>XP_754325.1 cytochrome P450 [Aspergillus fumigatus Af293]

similar to CYP686A1 (only one seq known and short)

MDSAQPTKLDFLTVPATPFSIGGLASIVVLVTVVIGPKAVIDTVLNSYLSLV

HRIPAADGKKYMSGPAYTFPNGQMVDKFLAARTRSWEWEEKYGKTYRIWAASIPEVVITDPKDVEVLYQQ

STDHNKAPQANAGWLLTQLLGSGLGLINGTRWSTLRKTLDPMFSHRAALQYLRDSLDAGAQDYVAGIHQF

AKADGQVQTADGKVMVINATQALQRYPFFEVASMFYGKMSEAEHERLWDLGRRYSEVFAAIVSGGIHRSK

LTRYLNTKAWNNARDYQKAWRDFNREIYTARKMTAPDTPIVALTEAAERGELTPNEVTDTIAESTFANLD

IVTHVISSCIILLADSPEVQNDLLQEMEKNKADRENYITRKDTLLHYCLLESLRLRPVLCLKEYWLTQVK

AFTFPENPPREKILGNFVVPKDTTIIVDAFAINIRNPFWGPDNRAYRPSRFAGIKQSQLRYNLATFGYGP

RKCLGQHIADKIVKAVVYHLFSKYRVSLMPMQAVEGDFKVDKTSWVALYDVDLKLEPRES

 

>CYP5082A1 EAL92287.1 cytochrome P450, putative [Aspergillus fumigatus Af293] AAHF01000002.1 94% to Neosartorya fischeri

86% to Aspergillus terreus, 44% to Leptosphaeria maculans

35% to CYP686A1P

MDSAQPTKLDFLTVPATPFSIGGLASIVVLVTVVIGPKAVIDTVLN (0)

SYLSLVHRIPAADGKKYMSGPAYTFPNGQMVDKFLAARTRSWEWEEKYGKTYRIWAASIPEV (2)

633544  VITDPKDVEVLYQQSTDHNKAPQANAGWLLTQLLGSGLGLINGTRWSTLRKTLDPMFSHR  633723

633724  AALQYLRDSLDAGAQDYVAGIHQFAKADGQVQTADGKVMVINATQALQRYPFFEVASMFY  633903

633904  GKMSEAEHERLWDLGRRYSEVFAAIVSGGIHRSKLTRY  634017

LNTKAWNNARDYQKAWRDFNREIYTARKMTAPDTPIVALTEAAERGELTPNE (0)

VTDTIAESTFANLD

IVTHVISSCIILLADSPEVQNDLLQEMEKNKADRENYITRKDTLLHYCLLESLRLRPVL (1)

SFTFPENPPREKILGNFVVPKDTTIIVDAFAINIRNPFWGPDNRAYRPSRFAGIKQSQLRYNLATFGYGP

RKCLGQHIADKIVKAVVYHLFSKYRVSLMPMQAVEGDFKVDKTSWVALYDVDLKLEPRES*

 

>CYP5082A2 AAKE02000007.1 Neosartorya fischeri NRRL 181

MDSAQPTKLDFLAVPVTPFSIGVLASIVVLVAVLIGPKVVIDTILN (0)

GYLSLVHRIPAANGKKYMSGPAYTFPNGQMVDKFLAARTRSWEWEEKYGKTYRIWAASIPEV (2)

602792  VITDPKDVEVLYQQSTDHNKAPQANAGWLLTQLLGSGLGLINGTRWTTLRKTLDPMFSHR  602971

602972  TALRYFRDSLDAGAQDYVAGIHRFAKADGQMQNADGKGIIINATQALQRYPFFEVASMFY  603151

603152  GKMSEGEQERLWDLGRRYSEVFAAVVSGGIHRSKLTRY  603265

LNTKAWNNARDYQKA

WLDFNREIYTARKMTAPDTPIVVLTEAAERGELTPNE (0)

VTDTIAESTFANLDIVTHVISSCIILLADSPEVQNDLIQEMEKNKADREDYITRKDTLLHYCL

LESLRLRPVL (1)

TFTFPENPPREKILGNFVIPKDTTIIVDAFAINIRNPFWGPDNRAYRPSRFAGIKQSQ (0)

LRYNLATFGYGPRKCLGQHIADKIIKAVVYHMFSKYRVSLMP

MQAVEGDFKVDKTSWVALYDVDLKLEPRES*

 

>CYP5082A3 AAJN01000207.1 Aspergillus terreus NIH2624

MDHAQPTKLGFLAVPAAPYSIGILVFVLVVLAAIGPWAVVDSILN (0)

CYLSFVHRIPAADGKKYISGPAYTFPNGQMVDKFLDARTKSWEWEEKYGKTYRIWAASIPEV (2)

337559  VITDPKDVETLYQQSTDHNKAPQANAGWLLTQLLGSGLGLINGTRWTSLRKTLDPMFSHR  337380

337379  TSLQYFSDSLDAGAENYVAGIHQFAKADQVCADGKSIILNATQALQRYPFFEVASMFY  337206

337205  GKMSEEEQERLWVLGRRYSEVFAAIVSGGIHRSKLTRY  337092

LNTKAWNNARDYQTAWREFNREIYKRRKLTAS

EAPIVVLTEAAERGELTYNE (0)

VTDTIAESTFANLDIVTHVISSCIILLADAPEVQKDLLQEMNRNKADRKAYITRKDTLLHYCLLESLRLRPVL (1)

SFTFPENPPREKVLGNFVIPKDTTVIVDAFAINIR

NPFWGPDNRAYRPQRFAGIKQNQ (0)

LRYNLATFGYGPRKCLGQHIADKIIKAVVYHLFTHYKVSLQPMQAIEGDFKVDKTSWVGL

YDVDLKLDPRGPCVDKVDV*

 

>CYP5082B1 AY553235.1 Leptosphaeria maculans HDX1 (HDX1), PKS1 (PKS1), and UVI-1h (UVI-1h)

genes, complete cds; sirodesmin biosynthetic gene cluster,

       MESIVYETQPLLRGMVVGTIMLLC

37766  YRYGLALSILQVKHPLAMINFVQSLLIQMKLYLNFMYRITNEKGKPLRGPEFSWPDGQT  37590

37589  VEKFLQGGQKSFSWQAYGPLYRIWTVFRPEV (2)

       VITRPEDV  37413

37412  KAFFFDSHTHQKAASSNAGWLFSQILGDCLGLINGERWSRVRHAFDPFFTRKISAQRLPH  37233

37232  IMAAGEGYVNEVHQYDLGGKQAASTINLNAVDAFQRFPFFYVAEIIYGPLGITERVE  37062

37061  LWKLAETHTNIFRRLVQGGIHRYKATKFLSTSAYKETAHFVAAWRQFTLELAQKQLREGR  36882

36881  TSPLTDLMAEVEDGKVTLNE (0)

36745  VLHTIDESLFANLDVTTHVLTWAIVLLGNHPDVQELVRSEIKANTNDLETYMNRKDTLL  36569

36568  HYSLLESLRVRPLL (1) 36527

36474  AFTIPESAQEDKVLSGYRVPKN (0)

       TDVVVDVNALHLRNPFWG  36301

36300  ADRMQYRPQRFQVLSKAE (0)

       IRYNLSTFGFGPRKCLGQHMAEN 36121

36120  MIKAILVPLLRQFRFKLLADQYKNGEYKVDKTNWVTLSDVNLEMERVPSGGS*  35962

 

>CYP686A1P AN8510.2 AACD01000154

pseudogene two stops and two frameshifts

33% to 613A1 613 clan?

MAAVQFPIEADPQWPSNGTSPVQSLPGPFNTRF*ELFHHDQPQPPRI

PILALTARYRAVDRKRSLTGPDYVWPFGNFRHMFAESRALSHKW

RKEYGDIYRIWTGFYSEV (2)

VISTPADIATFYSDSASHKKTLALRSN*VVNKLLGACVGFTNGX

RWKRNRKAFDPLLANNVAVKHNSRSHQEAAEFVSSIATTRVDG

GSNEETMIIKAAGSFLPFTLNETTSIFFGPLTDEEKIELWDVCL

AFMGIVDTALLKG

PFRWGLGYWMLSREKYQSAKAYLARWEAFLMRTSQARKDQTDLPITR

LWRDVEVGNLSKDE (0)

LLQTLTESTVFNLEPTSHALIMTIFLISDNQAFQDNLVAELDANRSAITRYLGRKDTLL

HYALLEAVRLQPVL (1)

PFTLPEAASVDKGLGGYLIPKG (0)

TSVIADSYGINVRNPFWGPDATSYRPSRFTTLTPAEIHRNLSMFWFGARKCLGQFFA

KQVRAVVFNLFDRYKVTCSDYSGIAPGINVDKTEYVDRFGLEFLL*

 

#61

 

>CYP5083A1 XP_754165.1 cytochrome P450 [Aspergillus fumigatus Af293]

MEAVIVSWLIRVLWSNKLNQGIREQHQKHGKPSMPFPSTSFTRSDKLTEHKGDVVRLGPSELSFCSLSAH

DTIYNTNSTSFITYGSFQSAVEGLCPPGVTFVSHHSPAEQKELRRVFQPAIRLAVAGGMEAHHKRRFSEL

VAGLNIKPGVPICVNLTGLLERLEWDLIGDLGLGYSVPDRLKDNWNSQKTHQNLIGVAFALGSFLLSRRG

LKMLVDSFGPFWIPKYLDPAHLIDVALKQRAEGKSTFVSQAIPYKNEKYPHLTKQMSSNVTGLIYAAFET

SESSTRAILCALMRDPVRYRNLQQEIRSKFSASKPITDSQLVGLPYLTACINEGLRLWPGLNGQFTSRVS

TGAVVDGVYVPPGCLVSADLYTLQRHPRYWHDPDTFKPERWLDPKNPDEMRAFRPFSAGPRSCPGRQIAL

QKLRLTLAKFMFLFDMQFVNPQFEWDRDVPSGLLWSSVEVMVRMTLLEPPVEPAEAVETAEAVEA

 

>EAL92127.1 cytochrome P450, putative [Aspergillus fumigatus Af293]

MEAVIVSWLIRVLWSNKLNQGIREQHQKHGKPSMPFPSTSFTRSDKLTEHKGDVVRLGPSELSFCSLSAH

DTIYNTNSTSFITYGSFQSAVEGLCPPGVTFVSHHSPAEQKELRRVFQPAIRLAVAGGMEAHHKRRFSEL

VAGLNIKPGVPICVNLTGLLERLEWDLIGDLGLGYSVPDRLKDNWNSQKTHQNLIGVAFALGSFLLSRRG

LKMLVDSFGPFWIPKYLDPAHLIDVALKQRAEGKSTFVSQAIPYKNEKYPHLTKQMSSNVTGLIYAAFET

SESSTRAILCALMRDPVRYRNLQQEIRSKFSASKPITDSQLVGLPYLTACINEGLRLWPGLNGQFTSRVS

TGAVVDGVYVPPGCLVSADLYTLQRHPRYWHDPDTFKPERWLDPKNPDEMRAFRPFSAGPRSCPGRQIAL

QKLRLTLAKFMFLFDMQFVNPQFEWDRDVPSGLLWSSVEVMVRMTLLEPPVEPAEAVETAEAVEA

 

#62

50% to #63, 46% to #64, 43% to #65

>CYP5081A1 XP_751355.1 [Aspergillus fumigatus Af293]

MRTYAIRPVSNRLPGPIEPKKHRRDRDNSTTGSLYNALIHPVQGEKTITSTMIRVAEFQPFLNTISVLQV

LAAIFIGALTYRLIDAFFLSPLRSIPGPLLARLTTKRANVDTFSGKVTQTVDKDVARYGDVYVYKPRAVC

INHPDDIRAVLGSQEFRKAAFFDIFNDGNTPNIVSLREPELANRRRRQLGPFFNYAYLGRAEPLILQHGY

QAIRTKWDALIQANSGRPTEVNYRTDTQLVTFDIMSALAFGRNFNAISRGSSSIMKWAGLIMEMLESPAV

LALLSLLPFSLIMRPWKIMYRELAAFSSDAVDMRKQLLAEDSTEKPLDMLQAFIDAEDPESKIKMSPHEV

QAESIMMMLAGSETTSSAIMWTFHLLLLYPETLRRAVHEVRSAFSLNHLVTYKDVRSSLPYVEACVYEAL

RHSPTTAGLTPRISHSTGITLQGYYIPPGTEIYVNLRSPSMHPSLWDDPARFNPDRFLDSDNNKRLLFTF

SYGPRNCLGRNLAWVEMLTIVANVLKDYDIALTEDSLFGPHCTDENGLPVLMPAKCFIASFPAKPERDCR

MVITRRMAGVKACAREYSPC

 

>EAL89317.1 [Aspergillus fumigatus Af293]

MRTYAIRPVSNRLPGPIEPKKHRRDRDNSTTGSLYNALIHPVQGEKTITSTMIRVAEFQPFLNTISVLQV

LAAIFIGALTYRLIDAFFLSPLRSIPGPLLARLTTKRANVDTFSGKVTQTVDKDVARYGDVYVYKPRAVC

INHPDDIRAVLGSQEFRKAAFFDIFNDGNTPNIVSLREPELANRRRRQLGPFFNYAYLGRAEPLILQHGY

QAIRTKWDALIQANSGRPTEVNYRTDTQLVTFDIMSALAFGRNFNAISRGSSSIMKWAGLIMEMLESPAV

LALLSLLPFSLIMRPWKIMYRELAAFSSDAVDMRKQLLAEDSTEKPLDMLQAFIDAEDPESKIKMSPHEV

QAESIMMMLAGSETTSSAIMWTFHLLLLYPETLRRAVHEVRSAFSLNHLVTYKDVRSSLPYVEACVYEAL

RHSPTTAGLTPRISHSTGITLQGYYIPPGTEIYVNLRSPSMHPSLWDDPARFNPDRFLDSDNNKRLLFTF

SYGPRNCLGRNLAWVEMLTIVANVLKDYDIALTEDSLFGPHCTDENGLPVLMPAKCFIASFPAKPERDCR

MVITRRMAGVKACAREYSPC

 

#63

50% to #62, 50% to #64, 43% to #65

>CYP5081B1 XP_751354.1 [Aspergillus fumigatus Af293]

MALPIILCLAVILWTSWRLLDALFLSPLHRVPGPVLARLTPLRAIYARLPSRVIPAALADFHSYGDIYLS

KPRTITISHPRDVRAILASSEFQKIDVYHGLNDPVMANIVTFSDPKLASRRRRQIGPYFNPSYLAKMEEL

ILRCGCRAVADKWGRLIAQQGHGPQKSVKVNYRHDLQLATFDIMSALAFGRWLDSLKEEGESVAIVEWIM

ATAVYIGVRINFRLLMVFPFSRLVRRWTRAYAEFVQFSKHAVASRKELLAQGCQKPVDLLQAFIDAEDPD

SKVKMTTVEVQAESVGMQLAGSETTAASLTWAVHLFTLYPEYYRIAVDEVRGQFGPNHLITYADCSRLVF

LEAFVYEMLRYTPITSSFMPRVSFTKGTTLQGHYIPPGTEIAFNLIAMNNREDVWEEPERFLPDRFLKDP

DLKRSVFAFSYGTRSCIGRHLAWMEMMTILANLLKDYDWSLPEDSLYGPHHVDEKGIPIRMPSKCHIVFA

PTHPDRDCQLVISRPKT

 

>EAL89316.1 [Aspergillus fumigatus Af293]

MALPIILCLAVILWTSWRLLDALFLSPLHRVPGPVLARLTPLRAIYARLPSRVIPAALADFHSYGDIYLS

KPRTITISHPRDVRAILASSEFQKIDVYHGLNDPVMANIVTFSDPKLASRRRRQIGPYFNPSYLAKMEEL

ILRCGCRAVADKWGRLIAQQGHGPQKSVKVNYRHDLQLATFDIMSALAFGRWLDSLKEEGESVAIVEWIM

ATAVYIGVRINFRLLMVFPFSRLVRRWTRAYAEFVQFSKHAVASRKELLAQGCQKPVDLLQAFIDAEDPD

SKVKMTTVEVQAESVGMQLAGSETTAASLTWAVHLFTLYPEYYRIAVDEVRGQFGPNHLITYADCSRLVF

LEAFVYEMLRYTPITSSFMPRVSFTKGTTLQGHYIPPGTEIAFNLIAMNNREDVWEEPERFLPDRFLKDP

DLKRSVFAFSYGTRSCIGRHLAWMEMMTILANLLKDYDWSLPEDSLYGPHHVDEKGIPIRMPSKCHIVFA

PTHPDRDCQLVISRPKT

 

#64

50% to #63, 46% to #62, 45% to #65

>CYP5081C1 EAL89312.1 cytochrome P450 monooxygenase, putative [Aspergillus fumigatus Af293]

MVEILRFIPLVLLLTLTWRITYELFFSPLRHIPGSLLARLSSKYSILKRVLSDGPQSVQADYQYYGNIYV

HRPNGVSISHPDDIRTVLLSPEFRKTKVYEMLDIEGHASIFTTRDPAQASRRRRQIGPYLNHGYLGRMEG

LIMKYSVLAIKRKWDRLLEESGGQQVTVNYRDHKQYATFDTIGALAFGREFNALTNDDRTVIRWIEATGL

YLGIRKNFPLLKLWPFSRVLRQYRERYERFIAYSKESVTRRKNLLSTVGERPMDLLQAFIDAEDPENPHV

KMTADEVMTESIAMQLAGSESTSFVTSWVIHLLTLYPQHLAKVTEEIRSQFSPSHLITFAECRDKLPYLE

ACVYETLRYSPITSGFLPRISYTKGLTIQGHYIPPGVEIAINLHGAHINKDVWTNPHLYDPTRFLGDDQA

KRNVFAFSYGHRNCIGRNLAMMEIMIIIANILKEYDIALPEDSVHGPWNVDALGRPRIMPTRSALFTTPK

YPERDCRLVVSRRQ

 

>XP_751350.1 cytochrome P450 monooxygenase [Aspergillus fumigatus Af293]

MVEILRFIPLVLLLTLTWRITYELFFSPLRHIPGSLLARLSSKYSILKRVLSDGPQSVQADYQYYGNIYV

HRPNGVSISHPDDIRTVLLSPEFRKTKVYEMLDIEGHASIFTTRDPAQASRRRRQIGPYLNHGYLGRMEG

LIMKYSVLAIKRKWDRLLEESGGQQVTVNYRDHKQYATFDTIGALAFGREFNALTNDDRTVIRWIEATGL

YLGIRKNFPLLKLWPFSRVLRQYRERYERFIAYSKESVTRRKNLLSTVGERPMDLLQAFIDAEDPENPHV

KMTADEVMTESIAMQLAGSESTSFVTSWVIHLLTLYPQHLAKVTEEIRSQFSPSHLITFAECRDKLPYLE

ACVYETLRYSPITSGFLPRISYTKGLTIQGHYIPPGVEIAINLHGAHINKDVWTNPHLYDPTRFLGDDQA

KRNVFAFSYGHRNCIGRNLAMMEIMIIIANILKEYDIALPEDSVHGPWNVDALGRPRIMPTRSALFTTPK

YPERDCRLVVSRRQ

 

#65

45% to #64, 43% to #63, 43% to #62

>CYP5081D1 XP_751352.1 [Aspergillus fumigatus Af293]

MQKACRGHRTAIFRILISLFPFTTLCSSLVGPETQSLHDTMAVATLISILFAVLALRLCYLLIHALFLSP

LRHIPAPFMARVTSKRPLWHLLTGKAEIAARQDYSTFGDIYLCKPNTVYLCDPHDACTVLSSHAFRKTDM

YRVFEYEGIPNVSTFTDPAQAQRRRRQLHPFFNNAYLTQMEPVMLKYGIQALKARWDAQLARHKKVEVNY

RFDTQLAMFDITGALVFGREFHALETSNLVYTKWVNNTLSYMLVSHYFPWVKRVPLSWLVRGLKQSYDDL

VAFSQESIAIRQADLQAGRPKPADLLQALLDAEDPDSKAPMTAREVQAESIAMLVGGSESTSSVISWVIH

FLLLYPEHLQAVVAETRANFPADHTITFNESKANLPYLEACIYETLRCIPTASTSFPRVSDQAIILKGYY

IPAGTEIATNKCAAHLHQPSWQDPDRFYPPRFLNQETYHETRRNMLSFAYGTRFCIGRNLAWAVMMVTLA

NLFKDYEVELPEDSRFGPTIVDAAGRPKIMPTKMGVATMPADPERDCRMVLSVRITE

 

>EAL89314.1 [Aspergillus fumigatus Af293]

MQKACRGHRTAIFRILISLFPFTTLCSSLVGPETQSLHDTMAVATLISILFAVLALRLCYLLIHALFLSP

LRHIPAPFMARVTSKRPLWHLLTGKAEIAARQDYSTFGDIYLCKPNTVYLCDPHDACTVLSSHAFRKTDM

YRVFEYEGIPNVSTFTDPAQAQRRRRQLHPFFNNAYLTQMEPVMLKYGIQALKARWDAQLARHKKVEVNY

RFDTQLAMFDITGALVFGREFHALETSNLVYTKWVNNTLSYMLVSHYFPWVKRVPLSWLVRGLKQSYDDL

VAFSQESIAIRQADLQAGRPKPADLLQALLDAEDPDSKAPMTAREVQAESIAMLVGGSESTSSVISWVIH

FLLLYPEHLQAVVAETRANFPADHTITFNESKANLPYLEACIYETLRCIPTASTSFPRVSDQAIILKGYY

IPAGTEIATNKCAAHLHQPSWQDPDRFYPPRFLNQETYHETRRNMLSFAYGTRFCIGRNLAWAVMMVTLA

NLFKDYEVELPEDSRFGPTIVDAAGRPKIMPTKMGVATMPADPERDCRMVLSVRITE

 

#66

 

>CYP5084A1 XP_751310.1 cytochrome P450 [Aspergillus fumigatus Af293]

MSLTNGCFCGFAIDSLRIRRYPVELYPAKHTPRPVACGSGRRRSASLTPPSSSGWMPPALKGRSDHRIYL

DEQTDDGPQHHDEIKNLVLNFLRAIRRQHTMKLTVFRNFATDIVGRMFVGDLGDDRAAPIGTRSNHIDRC

RFTTSLDHIMFKSPVAKLKRKRNKGLRWISCAGTYSRWNDASIVDVLPETGRKTILQAETREYDGPYDSL

IVNGADCMAAAFVSMFRHLFKCPTAMFQLQDEVDNAFRNLTISDVLHQETELHALPFLDAVMKESMRLAM

KFDYRRAVPAGGLAVLGHYVPERTVVQFHSEALRNNRTTFGEDVSDFRPQRWLQADLDQWQRTRMEEALL

FLRPNIPNSAEARAAWLELKRAAALIIWKFDLHPLNYEEVFIQDAVSPEQEYEIMVNFTPRMH

 

>EAL89272.1 cytochrome P450, putative [Aspergillus fumigatus Af293]

MSLTNGCFCGFAIDSLRIRRYPVELYPAKHTPRPVACGSGRRRSASLTPPSSSGWMPPALKGRSDHRIYL

DEQTDDGPQHHDEIKNLVLNFLRAIRRQHTMKLTVFRNFATDIVGRMFVGDLGDDRAAPIGTRSNHIDRC

RFTTSLDHIMFKSPVAKLKRKRNKGLRWISCAGTYSRWNDASIVDVLPETGRKTILQAETREYDGPYDSL

IVNGADCMAAAFVSMFRHLFKCPTAMFQLQDEVDNAFRNLTISDVLHQETELHALPFLDAVMKESMRLAM

KFDYRRAVPAGGLAVLGHYVPERTVVQFHSEALRNNRTTFGEDVSDFRPQRWLQADLDQWQRTRMEEALL

FLRPNIPNSAEARAAWLELKRAAALIIWKFDLHPLNYEEVFIQDAVSPEQEYEIMVNFTPRMH

 

#67

 

>CYP5085A1 XP_750862.1 cytochrome P450 [Aspergillus fumigatus Af293]

MDQVYLPQSVRTAVAVSFGVGLLYWVYRLLLQKTKSLKALDLPVLQSVGDQDIVKTLEEGHAKYPDTPFA

LGVPGQQLVVLPVSEIDTVKALPENQLSIKKHHYNQFLGEYSYMGTKADEFDDAMRYLLVRNTPAVLASF

TAEIDYAMSTVLQVPPNSWTRVKPRSIMPKVATILSGRAFVGLPLSREPDWIESNVNYTQDVSRAWMVLR

FYPHWIRPLVAPFLREVKTLEQNKALIGRKIAKLLADQEAQKLSPAQEKIPGGDMIDWFKSRYQAQGKTA

TAQQLTRDQLLATFASIYNLSNALTYVMFDLAANPAAVDELREELDQVLGPNVGAESIDKTALPRLIKLD

SFVRESQRLSPTSLVNIPRIVTDPNGLRLKTGHVIPPGYLVMVRAQPINQSPTLYPNPERFDAFRFARLR

QQGGANENRWQHTSTGADNINFGHGIWACPGRFFASAEIKVVVAYVIRHYDLRLIEGRPHPKPKYGGLAI

FPDAGAEVELKPRV

 

>EAL88824.1 cytochrome P450, putative [Aspergillus fumigatus Af293]

MDQVYLPQSVRTAVAVSFGVGLLYWVYRLLLQKTKSLKALDLPVLQSVGDQDIVKTLEEGHAKYPDTPFA

LGVPGQQLVVLPVSEIDTVKALPENQLSIKKHHYNQFLGEYSYMGTKADEFDDAMRYLLVRNTPAVLASF

TAEIDYAMSTVLQVPPNSWTRVKPRSIMPKVATILSGRAFVGLPLSREPDWIESNVNYTQDVSRAWMVLR

FYPHWIRPLVAPFLREVKTLEQNKALIGRKIAKLLADQEAQKLSPAQEKIPGGDMIDWFKSRYQAQGKTA

TAQQLTRDQLLATFASIYNLSNALTYVMFDLAANPAAVDELREELDQVLGPNVGAESIDKTALPRLIKLD

SFVRESQRLSPTSLVNIPRIVTDPNGLRLKTGHVIPPGYLVMVRAQPINQSPTLYPNPERFDAFRFARLR

QQGGANENRWQHTSTGADNINFGHGIWACPGRFFASAEIKVVVAYVIRHYDLRLIEGRPHPKPKYGGLAI

FPDAGAEVELKPRV

 

>AAW03300.1 GliF [Aspergillus fumigatus]

MDQVYLPQSVRTAVAVSFGVGLLYWVYRLLLQKTKSLKALDLPVLQSVGDQDIVKTLEEGHAKSQYPDTP

FALGVPGQQLVVLPVSEIDTVKALPENQLSIKKHHYNQFLGEYSYMGTKADEFDDAMRYLLVRNTPAVLA

SFTAEIDYAMSTVLQVPPNSWTRVKPRSIMPKVATILSGRAFVGLPLSREPDWIESNVNYTQDVSRAWMV

LRFYPHWIRPLVAPFLREVKTLEQNKALIGRKIAKLLADQEAQKLSPAQEKIPGGDMIDWFKSRYQAQGK

TATAQQLTRDQLLATFASIYNLSNALTYVMFDLAANPAAVDELREELDQVLGPNVGAESIDKTALPRLIK

LDSFVRESQRLSPTSLVNIPRIVTDPNGLRLKTGHVIPPGYLVMVRAQPINQSPTLYPNPERFDAFRFAR

LRQQGGANENRWQHTSTGADNINFGHGIWACPGRFFASAEIKVVVAYVIRHYDLRLIEGRPHPKPKYGGL

AIFPDAGAEVELKPRV

 

#68

 

>CYP613B1 XP_750856.1 cytochrome P450 [Aspergillus fumigatus Af293]

GliC in the gliotoxin biosynthetic gene cluster AY838877

39% to 613A1 Mg

MAFTLTILVPCMVLALVAARPVLYWVLSVVIDAFLRWKYPLPHHAGSKPMPRARYTWPNGQGTEKFFNGR

SAARQWRQRWGPIYQIWSGWCPEIVLTTPTHAVQFFRNSHRHTKAVNNDSGWLFGEVLGVCVGLLSGTDW

KRVRQQVEDGFSRPTAARYTGDLVFLAREYLQNTLLASSEQSLENKGIIHVEPAKTLQFYPFLSVAQILF

GRLSPMQRTQLTTLAPLREELFKEVIRGGINRLSIAPWFKSRGVRLLNEFQTQWEQFVEDAYHAAVKRNQ

SPRPLVIGLWEAYQAGTISKRECLQTLDESLYANLDVTTHALSWNVLLLAENGEAQTELRQEVLSALQSE

ASESYERYIDRDDTFLAACILESARLRPILPFSNPESAPEDLYVDGYLIPAN

VCNLPSLKSRGHSADIIQ intron

TNVIVDAQAINIDNPYWVNGTQYNPRRFFSLNKSDVRHNMWRFGFGPRQCLGKHIGERMLKAIVAEIIRQ

YVISISADSALKNDLQEDSWVGLPATRIQCVPVGREVEKN

 

>EAL88818.1 cytochrome P450, putative [Aspergillus fumigatus Af293]

MAFTLTILVPCMVLALVAARPVLYWVLSVVIDAFLRWKYPLPHHAGSKPMPRARYTWPNGQGTEKFFNGR

SAARQWRQRWGPIYQIWSGWCPEIVLTTPTHAVQFFRNSHRHTKAVNNDSGWLFGEVLGVCVGLLSGTDW

KRVRQQVEDGFSRPTAARYTGDLVFLAREYLQNTLLASSEQSLENKGIIHVEPAKTLQFYPFLSVAQILF

GRLSPMQRTQLTTLAPLREELFKEVIRGGINRLSIAPWFKSRGVRLLNEFQTQWEQFVEDAYHAAVKRNQ

SPRPLVIGLWEAYQAGTISKRECLQTLDESLYANLDVTTHALSWNVLLLAENGEAQTELRQEVLSALQSE

ASESYERYIDRDDTFLAACILESARLRPILPFSNPESAPEDLYVDGYLIPANVCNLPSLKSRGHSADIIQ

TNVIVDAQAINIDNPYWVNGTQYNPRRFFSLNKSDVRHNMWRFGFGPRQCLGKHIGERMLKAIVAEIIRQ

YVISISADSALKNDLQEDSWVGLPATRIQCVPVGREVEKN

 

>AAW03306.1 GliC [Aspergillus fumigatus]

MAFTLTILVPCMVLALVAARPVLYWVLSVVID

AFLRWKYPLPHHAGSKPMPRARYTWPNGQGTEKFFNGR

SAARQWRQRWGPIYQIWSGWCPEI VLTTPTHAVQFFRNSHRHTKAVNNDSGWLFGEVLGVCVGLLSGTDW

KRVRQQVEDGFSRPTAARYTGDLVFLAREYLQNTLLASSEQSLENKGIIHVEPAKTLQFYPFLSVAQILF

GRLSPMQRTQLTTLAPLREELFKEVIRGGINRLSIAPWFKSRGVRLLNEFQTQWEQFVEDAYHAAVKRNQ

SPRPLVIGLWEAYQAGTISKRECLQTLDESLYANLDVTTHALSWNVLLLAENGEAQTELRQEVLSALQSE

ASESYERYIDRDDTFLAACILESARLRPILPFSNPESAPEDLYVDGYLIPANTNVIVDAQAINIDNPYWV

NGTQYNPRRFFSLNKSDVRHNMWRFGFGPRQCLGKHIGERMLKAIVAEIIRQYVISISADSALKNDLQED

SWVGLPATRIQCVPVGREVEKN

 

>CYP613B2 AAKE02000024.1 Neosartorya fischeri NRRL 181 95% to #68

MAYALTILVPCLVLALVAARPVLYWVLSVVVD (0)

AFLRWKYPLPHHAGSKPMPRARYT

WPNGQGTEKFFNGRSAAKQWRQQWGPIYQIWSGWSPEI (2)

VLTTPTHAVQFFRNSHRHTKAVNNDSGWLFGEVLGVCVGL

LSGSDWKRVRQQVEDGFSRPTAARYTADLVTLAREYLQSTLLTSSEQSVEKKGIIHVEPA

KTLQFYPFLSVAQILFGRLSPMQRTQLTTLAPLREELFKEVIRGGINRLSIAPWFGSRGV

RLLNEFQTQWERFVEDAYHTAVKRNQSPRPLVIGLWEAYQAGTISKRE (0)

CLQTLDESLYANLDVTTHA

LSWNVLLLAENGEAQTELRQEVLSALQSEASESYERYIDRDDTFLAACVLESARLRPIL (1)

PFSNPESAPEDLYVDGYLIPAN (0)

160249  TNVIVDAQAINIDNPFWVNGTQYNPRRFFSLNKSD (0)

VRHNMWRF  160428

GFGPRQCLG  160455

KHIGERMLKAIVAEIIRQYVVSISADSALEKNVLQEDSWVGLPATRIQCVPVGRE

VEKN*

 

#69

 

>CYP5086A1 XP_749878.1 cytochrome P450 monooxygenase [Aspergillus fumigatus Af293] missing first half of gene

MTISIPIGVAISVVDMTVGISVRESTDMSIRVSVCGPVDMAIALLLFLRPLVYRLIPDVQRVYQHNARAR

QLVGSIVKQREKDEATIPGYTKPNDAIEWIWDLVPNEDKKNYGYQGIAQLAIAAVSVRRTSQLLTNIVLN

LIAYPEYVPILKEEIENVLASCDGQWTLDSMSKLEKLDSFMKEVSEDTVADSDTATFQRKAVQRITLSDG

TVLQPGTLALAPCNAIAFDPNIYPNPEQFDELRFYKLRHQNDSKANNIIYFTAASKTQVQFGGGRHACPG

RWFAAHLIKMQAILFKYDLKFRTGEERPKTWLFQTINTPDPKGKILVRTAQHV

 

>EAL87840.1 cytochrome P450 monooxygenase, putative [Aspergillus fumigatus Af293]

MTISIPIGVAISVVDMTVGISVRESTDMSIRVSVCGPVDMAIALLLFLRPLVYRLIPDVQRVYQHNARAR

QLVGSIVKQREKDEATIPGYTKPNDAIEWIWDLVPNEDKKNYGYQGIAQLAIAAVSVRRTSQLLTNIVLN

LIAYPEYVPILKEEIENVLASCDGQWTLDSMSKLEKLDSFMKEVSEDTVADSDTATFQRKAVQRITLSDG

TVLQPGTLALAPCNAIAFDPNIYPNPEQFDELRFYKLRHQNDSKANNIIYFTAASKTQVQFGGGRHACPG

RWFAAHLIKMQAILFKYDLKFRTGEERPKTWLFQTINTPDPKGKILVRTAQHV

 

#70

 

>CYP65AA1 XP_749877.1 cytochrome P450 [Aspergillus fumigatus Af293] 43% to 65S2, 40% to 65Z1

MSFLMESSAVGQPSPLSFSNTLNALPGALVLYAALHSLYNIYLHSLSRFPGPKLWQTSYIFRHIASIRGT

LDVSIKAFHTEYGPVVRYSPDELSFISAEAWRDIYGFRENALPKDPSFYGLIQLSRDKSPSIFTVDQDHH

PRVRKALSYAFSEKALHDQEPFVKHYVDLLIQRLRGIADAEDNRVDLVKWYNFTTFDIIGDLAIGRSFDC

LQDSAYHSWVDAFWKSIKMISPYARAMATYTDVPRLLRLFAPRALKEARLRRLQYVGVHMEERLARGILR

DKPDFISYILRSKGTADELTDGEVEANVSFLLLAGTETTATALSGTTYYLLKNPEGLRKATAEVRSAYNS

EDEITFATTAERLPYMQACLTEGLRIYPSGPIAAPRRTPRGTVTWIAGHPVPPVGGASNSPLNFHRQADF

IPERWLSPSTMDPASPFRRDNRAASQPFSVGPRNCLGKAFALNEMQVILARMLWNFDMKLLPQSDGWERQ

RIFTLWDKGPLMVELNEVRSSLHNQLFLQVCMVVCMVVHQSRSLQRAVHSSGPARNLTG

 

>EAL87839.1 cytochrome P450, putative [Aspergillus fumigatus Af293]

MSFLMESSAVGQPSPLSFSNTLNALPGALVLYAALHSLYNIYLHSLSRFPGPKLWQTSYIFRHIASIRGT

LDVSIKAFHTEYGPVVRYSPDELSFISAEAWRDIYGFRENALPKDPSFYGLIQLSRDKSPSIFTVDQDHH

PRVRKALSYAFSEKALHDQEPFVKHYVDLLIQRLRGIADAEDNRVDLVKWYNFTTFDIIGDLAIGRSFDC

LQDSAYHSWVDAFWKSIKMISPYARAMATYTDVPRLLRLFAPRALKEARLRRLQYVGVHMEERLARGILR

DKPDFISYILRSKGTADELTDGEVEANVSFLLLAGTETTATALSGTTYYLLKNPEGLRKATAEVRSAYNS

EDEITFATTAERLPYMQACLTEGLRIYPSGPIAAPRRTPRGTVTWIAGHPVPPVGGASNSPLNFHRQADF

IPERWLSPSTMDPASPFRRDNRAASQPFSVGPRNCLGKAFALNEMQVILARMLWNFDMKLLPQSDGWERQ

RIFTLWDKGPLMVELNEVRSSLHNQLFLQVCMVVCMVVHQSRSLQRAVHSSGPARNLTG

 

#71

 

>CYP5087A1 XP_748328.1 cytochrome P450 alkane hydroxylase [Aspergillus fumigatus Af293]

MYTALGLAVFTALFHYTIVLAINHYRTREILSQLVKAHNCCPPKTERPWDILGLVKIYSSTKHLLNETAL

SNVSALFKCYGDTYASRILTQRVYFTCDPRNIRHVLINRFSDFDASDVRAHLFAPITPHGIFAVDGAEWK

EARSLYADIFSATRKIFDLQLQEDGFQGLIKQIPRGQAMDLAPLFLKLVLDVNSAFAMGTGLDTLKQDQS

LEKKEVAEALMYAKKIMARDGFLGPLHYLLSRKDFYAACETVKAYVEKVVRKEMTAREYQKQSNAATVDD

ERQKRTQSLLSRILDNTNDVHAVRDAVVTILIAGTDSVASMLSTTFYLLARHERVYAKLRQEILDTIGTE

PPTYDNIRKATYLRYVFNEAMRVYPPVPFNARTANRDTYLPAGGGPDGQSGVLIRKGQRVIFASWGSHRS

TRSFGADALEFRPERWEGLKSESLGYIPFSAGPRVCLG (1)

QQYALLEASYATIRIIQTFERLENRDVRPWTEKIGLNLSNKNGVLVELVH*  1196659

 

>EAL86290.1 cytochrome P450 alkane hydroxylase, putative [Aspergillus fumigatus Af293]

MYTALGLAVFTALFHYTIVLAINHYRTREILSQLVKAHNCCPPKTERPWDILGLVKIYSSTKHLLNETAL

SNVSALFKCYGDTYASRILTQRVYFTCDPRNIRHVLINRFSDFDASDVRAHLFAPITPHGIFAVDGAEWK

EARSLYADIFSATRKIFDLQLQEDGFQGLIKQIPRGQAMDLAPLFLKLVLDVNSAFAMGTGLDTLKQDQS

LEKKEVAEALMYAKKIMARDGFLGPLHYLLSRKDFYAACETVKAYVEKVVRKEMTAREYQKQSNAATVDD

ERQKRTQSLLSRILDNTNDVHAVRDAVVTILIAGTDSVASMLSTTFYLLARHERVYAKLRQEILDTIGTE

PPTYDNIRKATYLRYVFNEAMRVYPPVPFNARTANRDTYLPAGGGPDGQSGVLIRKGQRVIFASWGSHRS

TRSFGADALEFRPERWEGLKSESLGYIPFSAGPRVCLGRE

 

#72

 

>CYP52J1 XP_746816.1 cytochrome P450 alkane hydroxylase [Aspergillus fumigatus Af293] 42% to CYP52F1, in 52 clan

MTNTDIAFGHQHGCELPPELTKNWPLGLDRIKELWTANTEGHLLAFLCSVAEKYEPGNSITQYFLFGPRA

FHILQPESVEAILSTNFKDYGFGARAAIFAPRLGNGIFTQEGPAWRHSRDLLRKQFSRVQNRILEHFHEH

VDNMVARLPLDGVVDLQPLFFNLTLDIATALLFGRSVYSLLAGIDQDADNGLFAEGFNIAQDGLAKRFRI

APWHFLYNPPGFRKACGDVHRFVEQYIDQLDLENSEDLDDKTYGFIKRVAHESASRQHLRDQLLNVLLAG

RDTTACCLSWTFRLLVHHEQAMIRLREEIASVMGDSAHPTKEQIRKMPYLSCVIKESKYSFPSIPSPVTK

EVRSSSLPPPPPPVPLNNREAIRTTILPTGGGPDADRPILVRKGELVVFFQYVNSRKKNIYGPDADCFRP

ERWETGELDHIGWAYFPFNGGPRQCLGENFALMEVSYTVVRLLQTFSSIILPKGQPIEPVGSERQRLTLV

LSSADGCKVQIHS

 

>EAL84778.1 cytochrome P450 alkane hydroxylase, putative [Aspergillus fumigatus Af293]

MTNTDIAFGHQHGCELPPELTKNWPLGLDRIKELWTANTEGHLLAFLCSVAEKYEPGNSITQYFLFGPRA

FHILQPESVEAILSTNFKDYGFGARAAIFAPRLGNGIFTQEGPAWRHSRDLLRKQFSRVQNRILEHFHEH

VDNMVARLPLDGVVDLQPLFFNLTLDIATALLFGRSVYSLLAGIDQDADNGLFAEGFNIAQDGLAKRFRI

APWHFLYNPPGFRKACGDVHRFVEQYIDQLDLENSEDLDDKTYGFIKRVAHESASRQHLRDQLLNVLLAG

RDTTACCLSWTFRLLVHHEQAMIRLREEIASVMGDSAHPTKEQIRKMPYLSCVIKESKYSFPSIPSPVTK

EVRSSSLPPPPPPVPLNNREAIRTTILPTGGGPDADRPILVRKGELVVFFQYVNSRKKNIYGPDADCFRP

ERWETGELDHIGWAYFPFNGGPRQCLGENFALMEVSYTVVRLLQTFSSIILPKGQPIEPVGSERQRLTLV

LSSADGCKVQIHS

 

#73

 

>CYP5088A1 XP_752004.1 cytochrome P450 monooxygenase [Aspergillus fumigatus Af293] 44% to 68L1 A.nidulans mid region aa 183-260 similar to CYP5067A1 and CYP68 family

MRMRQPDTLLTMKGYWSPACPALIKRLLAYKICRNPDWLRITVGYTVDTFFARRESSALAQVDTPCCGQI

PATLPPCRKICWELKEATEIITPVLEERQQRPRSSQEAKPATKTRKDSNVIMSLPV

 

>EAL89966.1 cytochrome P450 monooxygenase, putative [Aspergillus fumigatus Af293]

MRMRQPDTLLTMKGYWSPACPALIKRLLAYKICRNPDWLRITVGYTVDTFFARRESSALAQVDTPCCGQI

PATLPPCRKICWELKEATEIITPVLEERQQRPRSSQEAKPATKTRKDSNVIMSLPV

 

#74

 

>CYP5089A1 CAF32039.1 cytochrome p450 (E-class), putative [Aspergillus fumigatus]

MVDVFVLRQLGVRDMVTLNCRMADERQGITDAINVSQSSQCTDLVGFQVGPCHLFSSRWHSGSDLSAERT

SIPRDIMSLAIILFALTLAAFIARVVYRCYFHPLARYPGPWFAHISNAWRLVAFFSGQHHLMEQRLHARY

GRVVRVAPNWLSFSTLEDFEAIYGFNKAIEKDEFYDFGRDRGSRPESIFAAKTETSHRVKKKKVVSPALT

STRITSYKPIIDKHVGILLTRLPSQSKGPLPEAKNNGTTAVNMAPIVHQCTLDAMLELVFGPRLSEHPYS

DTPAGEGVCSNLRIMTKMAWSFSLWPAFGWLMNTRPVNAMLRRPTYSKQGELTGMAGLMGVAMPRLLRNP

QQVVASSQPSIVKGWLEVPPDDATRMTPAEVASEASNLIIAGPGSTAAALTAVIFYLGTKDGQGWQERIR

EQIRASQSHDLGPSSLELQAVIKETLRLSAPFPTAFPRVIRPGAEMAIPSLAAPLPVGTTVSANTFVLGR

SRELWGNDADRWEPRRWLGSEQHRREMETKFVAFSKGSRSCIGRELALLLLAQAVIGIVQQWKFRSRGQL

QGKSFLEMQYDECWIKFEPLDLSLSA

 

>XP_752692.1 cytochrome p450 [Aspergillus fumigatus Af293]

MVDVFVLRQLGVRDMVTLNCRMADERQGITDAINVSQSSQCTDLVGFQGRTSIPRDIMSLAIILFALTLA

AFIARVVYRCYFHPLARYPGPWFAHISNAWRLVAFFSGQHHLMEQRLHARYGRVVRVAPNWLSFSTLEDF

EAIYGFNKAIEKDEFYDFGRDRGSRPESIFAAKTETSHRVKKKKVVSPALTSTRITSYKPIIDKHVGILL

TRLPSQSKGPLPEAKNNGTTAVNMAPIVHQCTLDAMLELVFGPRLSEHPYSDTPAGEGVCSNLRIMTKMA

WSFSLWPAFGWLMNTRPVNAMLRRPTYSKQGELTGMAGLMGVAMPRLLRNPQQVVASSQPSIVKGWLEVP

PDDATRMTPAEVASEASNLIIAGPGSTAAALTAVIFYLGTKDGQGWQERIREQIRASQSHDLGPSSLELQ

AVIKETLRLSAPFPTAFPRVIRPGAEMAIPSLAAPLPVGTTVSANTFVLGRSRELWGNDADRWEPRRWLG

SEQHRREMETKFVAFSKGSRSCIGRELALLLLAQAVIGIVQQWKFRSRGQLQGKSFLEMQYDECWIKFEP

LDLSLSA

 

>EAL90654.1 cytochrome p450, putative [Aspergillus fumigatus Af293]

MVDVFVLRQLGVRDMVTLNCRMADERQGITDAINVSQSSQCTDLVGFQGRTSIPRDIMSLAIILFALTLA

AFIARVVYRCYFHPLARYPGPWFAHISNAWRLVAFFSGQHHLMEQRLHARYGRVVRVAPNWLSFSTLEDF

EAIYGFNKAIEKDEFYDFGRDRGSRPESIFAAKTETSHRVKKKKVVSPALTSTRITSYKPIIDKHVGILL

TRLPSQSKGPLPEAKNNGTTAVNMAPIVHQCTLDAMLELVFGPRLSEHPYSDTPAGEGVCSNLRIMTKMA

WSFSLWPAFGWLMNTRPVNAMLRRPTYSKQGELTGMAGLMGVAMPRLLRNPQQVVASSQPSIVKGWLEVP

PDDATRMTPAEVASEASNLIIAGPGSTAAALTAVIFYLGTKDGQGWQERIREQIRASQSHDLGPSSLELQ

AVIKETLRLSAPFPTAFPRVIRPGAEMAIPSLAAPLPVGTTVSANTFVLGRSRELWGNDADRWEPRRWLG

SEQHRREMETKFVAFSKGSRSCIGRELALLLLAQAVIGIVQQWKFRSRGQLQGKSFLEMQYDECWIKFEP

LDLSLSA

 

 

These are not P450s

 

>XP_746438.1 fatty acid oxygenase [Aspergillus fumigatus Af293]

MIRTFEDGKIKPDCFSEPRLHILPAASGVILIMLNRFHNYVAEQLAIINENGRFTKPKAEIIDPVEARLA

WAKYDNDLFQTARLITCGMYINITLYDYLRTIINLNRDNSTWNLDPRTHDDQDEIPTAQGNQCSVEFNLA

YRWHSTIGRQDEAWTEKTYREIVGKPGQEATLQDLMDGMRKFNARMDKDPSKRTFAGLQRQGNGTFRDVD

LVDILTRAIEEVSGSFGPNNVPKVLRSVEILGIQQARKWNIGSLNEFRKFFDLKPYESFEEINPDPYVAD

QLRHLYEHPDYVELYPGIVAEEPKEPMVPGVGIAPGYTVSRAVLSDAVTLVRGDRFYTKEFNARNLTNWG

FSEAKYNLEINQGCSFYRLALRAFPKWFKYDSIYPHYPMTIPSENRVIMKALGREEDFSWDRPSYIPQRI

SVFDYANVRHILQDASNFRVMWGEATAYVFGSKGWDFMLSGDAPTHANQRNIMSRALYRGQWHDAVKQFY

LDITQQLLTEKSCRIGNVNQVDISRDVGNLAHVHFASNVFSLPLKSREHPHGIITAHEMFEAMAVIFTAI

FFDAEPVKSFELRHKAREAANKLGRLVELNVKAIKSSGLIATLLGNMPANRNALFEYGVHMVERLLQSGL

DPEQVTWSQVLPTAVAMVPNQAQVFTQIIDYYLSDKGRKHLPDIKRFAKEDSPASDEVLLRYCMEAIRLN

GIFGSYRKSQTNLTLDDKGGKVHIKAGDNVFVSFIDANRDPDVFPKPEEVDLNRPMESYIHYGVGPHTCL

GSEASKVALTTMLRVVGRLDNLRRAPGAQGELKKIPREHGFYTYMREDQSSFYPFSMSWKLHYDGEIPGK

EQPVRGDFVCNVPGHWQN

 

>EAL84400.1 fatty acid oxygenase, putative [Aspergillus fumigatus Af293]

MIRTFEDGKIKPDCFSEPRLHILPAASGVILIMLNRFHNYVAEQLAIINENGRFTKPKAEIIDPVEARLA

WAKYDNDLFQTARLITCGMYINITLYDYLRTIINLNRDNSTWNLDPRTHDDQDEIPTAQGNQCSVEFNLA

YRWHSTIGRQDEAWTEKTYREIVGKPGQEATLQDLMDGMRKFNARMDKDPSKRTFAGLQRQGNGTFRDVD

LVDILTRAIEEVSGSFGPNNVPKVLRSVEILGIQQARKWNIGSLNEFRKFFDLKPYESFEEINPDPYVAD

QLRHLYEHPDYVELYPGIVAEEPKEPMVPGVGIAPGYTVSRAVLSDAVTLVRGDRFYTKEFNARNLTNWG

FSEAKYNLEINQGCSFYRLALRAFPKWFKYDSIYPHYPMTIPSENRVIMKALGREEDFSWDRPSYIPQRI

SVFDYANVRHILQDASNFRVMWGEATAYVFGSKGWDFMLSGDAPTHANQRNIMSRALYRGQWHDAVKQFY

LDITQQLLTEKSCRIGNVNQVDISRDVGNLAHVHFASNVFSLPLKSREHPHGIITAHEMFEAMAVIFTAI

FFDAEPVKSFELRHKAREAANKLGRLVELNVKAIKSSGLIATLLGNMPANRNALFEYGVHMVERLLQSGL

DPEQVTWSQVLPTAVAMVPNQAQVFTQIIDYYLSDKGRKHLPDIKRFAKEDSPASDEVLLRYCMEAIRLN

GIFGSYRKSQTNLTLDDKGGKVHIKAGDNVFVSFIDANRDPDVFPKPEEVDLNRPMESYIHYGVGPHTCL

GSEASKVALTTMLRVVGRLDNLRRAPGAQGELKKIPREHGFYTYMREDQSSFYPFSMSWKLHYDGEIPGK

EQPVRGDFVCNVPGHWQN

 

 

>EAL89712.1 fatty acid oxygenase PpoA, putative [Aspergillus fumigatus Af293]

MSEKQTGSANGGLGKTLAQLEQVVSASLRPLPSQTGDGTYVTEQVKTGILKDLSHVDLGDLKTLVDVSKS

ALTGEALDDRKYIMERVIQLSAGLPSTSQIGKELTNTFLTTLWNDLEHPPISYLGRDAMYRRADGSGNNV

LWPHIGAAGTPYARSVQPKTVQSPNLPDPETLFDCLLARKEYKEHPNKISSVLFYIASIIIHDLFETDRK

DPAISLTSSYLDLSPLYGNNQQEQDLIRTFKDGKLKPDCFSTKRVLGFPPDVGVVLIMFNRFHNYVVEKL

AMINEGGRFTKPQESDTAAYAKYDNDLFQTGRLVTCGLYVNIILKDYVRTILNINRTDSIWSLDPRSEMK

DGLLGRAAAQATGNQVAAEFNLVYRWHSCISQRDQKWTEDMYQELFPGQDPSKISLQDFLRGLGRWEAKL

PGEPRERPFAGLQRKADGSYDDNDLVKIFEESVEDCAGAFGALHVPTVFRSIEALGIQQARSWNLATLNE

FRKYFNLAPYKTFEEINSDPYVADQLKRLYDHPDRVEIYPGIIVEDAKESMAPGSGLCTNFTISRAILSD

AVALVRGDRFHTVDFTPKHLTNWAYNEIQPQDSVDQTHVFYKLVLRAFPNHFRGDSIYAHFPLVVPSENK

KILTKLGTADKYSWDRPNYTPPPQFINSHSACMSILSDQETFKVTWGSKIEFLMRHNNQPYGRDFMLSGD

RTPNAMSRQMMGKALYRDKWETEVKRFYENITLKLLHRYSYKLAGVNQVDVVRDIANLAQVHFCASVFSL

PLKTESNPRGIFTESELYQIMAVVFTSIFYDADIGKSFELNQAARAVTQQLGQLTLANVELIAKTGFIAN

LVNSLHRHDVLSEYGVHMIQRLLDSGMPAPEIVWTHVLPTAGGMVANQAQLFSQSLDYYLSEEGSVHLPE

INRLAKEDTTEADDLLLRYFMEGARIRSSVALPRVVAQPTVVEDNGQKITLKQGQHIICNLVSASMDPVT

FPEPDKVKLDRDMNLYAHFGFGPHQCLGLGLCKTALTTMLKVIGRLDNLRRAPGGQGKLKKLSGPGGIAM

YMTPDQTAFFPFPTTMKIQWDGDLPEVKE

 

>XP_751750.1 fatty acid oxygenase PpoA [Aspergillus fumigatus Af293] not a P450

MSEKQTGSANGGLGKTLAQLEQVVSASLRPLPSQTGDGTYVTEQVKTGILKDLSHVDLGDLKTLVDVSKS

ALTGEALDDRKYIMERVIQLSAGLPSTSQIGKELTNTFLTTLWNDLEHPPISYLGRDAMYRRADGSGNNV

LWPHIGAAGTPYARSVQPKTVQSPNLPDPETLFDCLLARKEYKEHPNKISSVLFYIASIIIHDLFETDRK

DPAISLTSSYLDLSPLYGNNQQEQDLIRTFKDGKLKPDCFSTKRVLGFPPDVGVVLIMFNRFHNYVVEKL

AMINEGGRFTKPQESDTAAYAKYDNDLFQTGRLVTCGLYVNIILKDYVRTILNINRTDSIWSLDPRSEMK

DGLLGRAAAQATGNQVAAEFNLVYRWHSCISQRDQKWTEDMYQELFPGQDPSKISLQDFLRGLGRWEAKL

PGEPRERPFAGLQRKADGSYDDNDLVKIFEESVEDCAGAFGALHVPTVFRSIEALGIQQARSWNLATLNE

FRKYFNLAPYKTFEEINSDPYVADQLKRLYDHPDRVEIYPGIIVEDAKESMAPGSGLCTNFTISRAILSD

AVALVRGDRFHTVDFTPKHLTNWAYNEIQPQDSVDQTHVFYKLVLRAFPNHFRGDSIYAHFPLVVPSENK

KILTKLGTADKYSWDRPNYTPPPQFINSHSACMSILSDQETFKVTWGSKIEFLMRHNNQPYGRDFMLSGD

RTPNAMSRQMMGKALYRDKWETEVKRFYENITLKLLHRYSYKLAGVNQVDVVRDIANLAQVHFCASVFSL

PLKTESNPRGIFTESELYQIMAVVFTSIFYDADIGKSFELNQAARAVTQQLGQLTLANVELIAKTGFIAN

LVNSLHRHDVLSEYGVHMIQRLLDSGMPAPEIVWTHVLPTAGGMVANQAQLFSQSLDYYLSEEGSVHLPE

INRLAKEDTTEADDLLLRYFMEGARIRSSVALPRVVAQPTVVEDNGQKITLKQGQHIICNLVSASMDPVT

FPEPDKVKLDRDMNLYAHFGFGPHQCLGLGLCKTALTTMLKVIGRLDNLRRAPGGQGKLKKLSGPGGIAM

YMTPDQTAFFPFPTTMKIQWDGDLPEVKE

 

>XP_754409.1 fatty acid oxygenase PpoC [Aspergillus fumigatus Af293]

MILKTSTRSVKDFNAKTDIFQTDYKNPNMNKTSGYLDLSILYGDVQEEQNLIRTFKDGKLKPDSFSEPRL

QAFPATCCVLMVMLNRSISNTNAAINENGRFTKPADNLSEEEAKKAWAKYDEDLFQTGRLLTNDSITCGL

YINITLYDYLRTIVNLNRTNSTWCLDPRAQMEGSHTAPSGLGNQCSVEFNLAYRWHSATSATDEKWTEDV

YERLMGKPASEVSMTELLMGLGKYQAELPKDPSKRTFADLERQADGRFKDEDLVNLLVNAVEDVAGSFGA

RNVPKVLKNVEILGIIQSRKWNVGSLNEFRKFFGLKPYETFEEINSDPDVAESLRSLYDHPDFVELYPGI

VAEEAKQPMVPGVGIAPTYTISRAVLSDAVALVRGDRFYTIDYNPRNLTNWGYSEVRYDLSINQGCIFYK

LATRAFPNWFKPDSIYAHYPMTIPSENRKIMKDLGREIHYSWDRPQYTPPRVDLVSYSNAKLVAEQQNQF

RAAWGDTVEFVFGKASKEFKLYQDSAFIQKHADVMSKLLNKEEWHRSVKEFYEDITAKLLEDKTRRFGGI

NQVDITNDVGNLTPVIFAANVFSLPLKSKENPRGIYTEHEMFKVLAALYNCLYFDIDKTKSYPLHHASQA

VGEPLGKALEANVKALGGSSLLSGIFRSFRENKNALKEYGVHLTKQLLENGLGAHEIAWAQFLPTVIAMV

PAQAQAFTQIVDFYLSKEGSKHLPAIQRLAKQDTKKSDEQLLHYCLEAVRLNDMSGLYRQSETTLAVTDE

AVEVTIQPGDKVFVSFAKANRDASVFPDPAEVRLDRPMNSYINPTLGPHGFLSKETSHIALTAMLRAVGR

LNNLRVAPGVQGQLKKIPQPGGYSAYLREDHGSYSIFPTTFRVQYDA

 

>EAL92371.1 fatty acid oxygenase PpoC, putative [Aspergillus fumigatus Af293]

MILKTSTRSVKDFNAKTDIFQTDYKNPNMNKTSGYLDLSILYGDVQEEQNLIRTFKDGKLKPDSFSEPRL

QAFPATCCVLMVMLNRSISNTNAAINENGRFTKPADNLSEEEAKKAWAKYDEDLFQTGRLLTNDSITCGL

YINITLYDYLRTIVNLNRTNSTWCLDPRAQMEGSHTAPSGLGNQCSVEFNLAYRWHSATSATDEKWTEDV

YERLMGKPASEVSMTELLMGLGKYQAELPKDPSKRTFADLERQADGRFKDEDLVNLLVNAVEDVAGSFGA

RNVPKVLKNVEILGIIQSRKWNVGSLNEFRKFFGLKPYETFEEINSDPDVAESLRSLYDHPDFVELYPGI

VAEEAKQPMVPGVGIAPTYTISRAVLSDAVALVRGDRFYTIDYNPRNLTNWGYSEVRYDLSINQGCIFYK

LATRAFPNWFKPDSIYAHYPMTIPSENRKIMKDLGREIHYSWDRPQYTPPRVDLVSYSNAKLVAEQQNQF

RAAWGDTVEFVFGKASKEFKLYQDSAFIQKHADVMSKLLNKEEWHRSVKEFYEDITAKLLEDKTRRFGGI

NQVDITNDVGNLTPVIFAANVFSLPLKSKENPRGIYTEHEMFKVLAALYNCLYFDIDKTKSYPLHHASQA

VGEPLGKALEANVKALGGSSLLSGIFRSFRENKNALKEYGVHLTKQLLENGLGAHEIAWAQFLPTVIAMV

PAQAQAFTQIVDFYLSKEGSKHLPAIQRLAKQDTKKSDEQLLHYCLEAVRLNDMSGLYRQSETTLAVTDE

AVEVTIQPGDKVFVSFAKANRDASVFPDPAEVRLDRPMNSYINPTLGPHGFLSKETSHIALTAMLRAVGR

LNNLRVAPGVQGQLKKIPQPGGYSAYLREDHGSYSIFPTTFRVQYDA