This file is in progress

159 different P450 sequences

and some false positives annotated in Genbank as P450s

23 new CYP families not seen in 6 other fungal genomes,

including 2 other Aspergillus genomes.

D. Nelson March 29, 2006

 

#44 60% to CYP51F4, 79% to 51F1 An

 

>CYP51F1 BAE60239.1 [Aspergillus oryzae]

MGILAVILDSVCERCSGSSLWMLSTVALLSILVVSVVINVLRQLLFKNYKEPPLVFHWFPFIGSTISYGM

DPYRFFFNCREKYGDIFTFVLLGKKTTVYLGTKGNDFILNGKLRDVCAEEVYSPLTTPVFGRHVVYDCPN

AKLMEQKKFVKFGLTSDALRSYVRLITEEVEDFVQKSSALQGPNGVFDVCKTIAEITIYTASRSLQGKEV

RSRFDSTFAELYHDLDMGFAPINFMLPWAPLPHNRKRDAAQKRMTETYMEIIKERRKAGSKKDSEDMVWN

LMSCMYKDGTPVPDEEIAHMMIALLMAGQHSSSSTAAWIVLHLAASPEITEELYQEQLRILGHDMPPLTY

ENLQKLDLHAKVIKETLRIHAPIHSIIRAVKNPMPVEGTPYVIPTSHNVLSSPGVTARSEEHFPDPLEWK

PHRWDEAIAVSSEDEEKVDYGYGLVTKGTNSPYLPFGAGRHRCIGEQFAYVQLGAITAALVRLFKFSNLP

GVQTLPDTDYSSLFSKPLGNSKIQFEKREPVTKA

 

>CYP51F1 AF227920 Venturia inaequalis strain Ent27 14 alpha-demethylase (CYP51A1)

MGLLSPLLAXLPGSDRSWLFYTLASFGFTVAIVAANLVKQLLFS

NPNEPPVVFHWFPFFGNTVVYGIDPIKFFAECKEKHGDIFTFILLGRKTTVYIGTKGN

EFILNGKQSHVNAEEIYSPLTTPVFGSDVVYDCPNSKLMEQKKFVKYGLTTE ALKSYV

TLIQQEVEDYTKRYPQFKGEKGSFDVCASMAEITIFTASRSLQGKEVRDKFDASFADL

FHDLDMGFSPINFMLPWAPLPHNRRRDAANKKMTETYLEIIQSRKAEGVKKDSEDMIW

NLMQCVYKNGTPIPDKEIAHMMIALLMAGQHSSSSTSSWILLRLATRPDIQEELYQEQ

IRVCGADLPPLQYEDLARMPLHNQIIKETLRMHSPIHSILRAVKQPMPVEGTPYTIPT

SHVLLAAPIASGGSPMYFPAPEKWEPHRWDEGSGGTNISGGENGGEEKEDYGYGLITK

GASSPYLPFGAGRHRCIGEQFAYMQLNTVLATQVREFKFSLREGESFPKTDFSSLFSG

PLRPAWLNWERREKSS

 

#43 77% to CYP51F4, 75% to 51F2An

 

>CYP51F2 BAE57417.1 [Aspergillus oryzae]

MASFTLVSAYAAAGLLAIIVLNLLRQLLFRNKTDPPLVFHWIPFLGSTVTYGMDPYAFFFSCRQKYGDIF

TFILLGRKITVYLGIQGNEFILNGKLKDVNAEEIYSPLTTPVFGSDIVYDCPNSKLMEQKKFIKFGLTQA

ALESHVPLIEKEVLDYLKTSPNFKGTSGRVEITDAMAEITIFTAGRALQGEEVRKKLTTEFADLYHDLDR

GFTPINFMLPWAPLPRNRKRDAAHARMREIYMDIINERRKNPDRETSDMIWNLMHCTYKNGQPLPDKEIA

HMMITLLMAGQHSSSSISSWIMLRLASEPAVMEELYQEQITKLSPDGRTLPPLQYRDLDLLPLHQNLIKE

TLRLHLSIHSLMRKVKNPMPVPGTPYVVPADHVLLASPGVTALSDEYFPNASRWDPHRWENRVEKEDEED

IVDYGYGTVSKGTSSPYLPFGAGRHRCIGEKFAYVNLGVIVATMARHMKLFNVDGKKGVPATDYSSMFSG

PSKPAIIGWERRFPEKS

 

#42 72% to 51F2An, 77% to seq 43, 60% to seq 44

 

>CYP51F4 BAE63554.1 [Aspergillus oryzae]

MSWPRIGAYALLAFVAIMALNVTYQFLFRMLNKTRPPLVFHWIPFIGSTIHYGTDPYGFFFSCREKYGDI

FTFILLGRPTTVYLGTQGNEFILNGKLKDVNAEEVYSPLTTPVFGSDVVYDCPNSKLIEQKKFIKFGLSQ

AALEAHVPLIEKEVEDYLAMSPNFHGTSGEVDIPAAMAEITIFTAGSALQGEEVRSKLTTEFAVLYHDLD

KGFTPINFMLPWAPLPHNKKRDAAHARMRAIYIDIINKRRNAGDNVPEKLDMIGNLMQCTYKNGQPLPDK

EIAHIMITLLMAGQHSSSSISSWIMLRLASQPAVVEELYQEQLANLERTGPNGSLAPLQYKDFDNLPLHQ

NVIRETLRLHSSIHSLLRKVKNPLPVPGTPYVIPTSHVLLAAPGVTALSDEYFPNAMAWDPHRWETQAPQ

ENNKDDIVDYGYGAMSKGTSSPYLPFGAGRHRCIGEKFAYLNLAVIVATMVRHLRFSNLDGQTGVPDTDY

SSLFSGPMKPARIRWERRAAKSG

 

#24 58% to seq 25 63% to 52G1

 

>CYP52G3 BAE65166.1 AP007171.1 [Aspergillus oryzae]

14 P450 genes and 2 pseudogenes on this contig

MIPLLILAALAVVFRLVWSIFTSLRHAQNARKWHCGAIPTYPGDILGINTLKEVLRADKEKLIPVLSAQR

VETMTAREGRYVSTFRLRQMGRESIFTSDPKNMQAILATQFKEFELGSLRRNSLHPLLGSGIFSTDGEAW

SRSRSLLRPQFTRDQVSDLDLEERHVQKAMAGMLADPATKWTPEIDIQSIFFRLTIDSATEFLFGDSVES

QTAALSGSRIIEDKFPSYFDRGQWYAAQRARFEKLYWIVNNKESRETDRFVHAYVDRFIDAALAAVKEGK

IDPEKRNSDHYVFLHGLTTATQDPVELRSQLLNILLAGRDTTASLLSWCVLLLARHPDIFQKLRNTILAD

FGDYRNPRNITFSSLKSCRYLHYFMNEVLRLYPIVPGNRRVALKDTTLPRGGGPDGSEPVYVRKGQPVVY

SVFVTHRRKDIWGADAEVFNPDRWEDLKVGWEYLPFNGGPRICIGQQFALTEAGYVLVRLLQRFDQIVDA

RPEREIRFNATLTSAPWENVIVRLREGA

 

#25 54% to 52G1

 

>CYP52G4 BAE55312.1 [Aspergillus oryzae]

MSDARTTLMETWFTPALVAAIVAARLLFSLYSAWRHAQRARSLNCQEAPLYPSRDPFGVATLLETLRADR

DKFLPKLSQKRVDLISSQQNRYVSTFRVRQAGRENFFTVDPKNIQAMLATQFNDFFLGDMRRNAGAPVIR

SGIFVSDGADWSHSRSLIRPQFTRTQINNLELEERHVQNALRAMPTQSNGWTSEVDIQTILFRLTLDSAT

EFLFGKSCNSQLTALEKDAGEMSDSFLNSFDRCAWYLAARLRFERLYWIVNNKEFRECTRVVHELVDGYV

HAALQRAQQAEKPADPERGSHYVFVDALTATTQDPNQLRDECLNVLIAGCDTTASLLSWNILLLARHPDI

FQRLRKEIIERFGTYSEPRDINFSSLKSCQYLQHFINETLRLHPVVPFNRRCANKDTTLPRGGGKDGNSP

VYLQKGQPVLYSSYVLQRRKDIWGEDAEEFNPDRWYGRKAIWEHIPFSGGPRTCIGQQFAITNTSFVLVR

LLQRFDSIEDVYPEREIRYGVTLTNCPADRVTVRMHQAEL

 

#35 71% to 52H1, 48% to 584G1

 

>CYP52H3 BAE64862.1 AP007171.1 [Aspergillus oryzae]

14 P450 genes and 2 pseudogenes on this contig

MLAQIAPLFGALCITFLVLQYLQRLYQQRKRAQSLGCQPAAQGPSGIFGIRSFVRLLNEVRHKRWVEYIA

GQYGRYGNTYTQKALGKWMVSTIEPENIKALLATQFNDFGLGTRHREFYPLLGDGIFTLDGPGWSHARGL

LRPQFTRDQVADLELMDGHISRMIDLIPQDGSSFDIQRLFFLLTIDSATHFLFGESVGALESSNSASLLG

RSSVGSAQGFAEAFGTAQDYLTTRSRAMHFYWMVNPKEFREANQRVHEVVDHYVQLAIQSKNNPDKKSDR

YIFAEALAADNDDPKVLRDNMLNILVAGRDTTASLLSSAFFYLSRNQDVWKKLRQTIIDEFGDSQNPKGE

ITQAKLKDIPYLRYVLNEVLRLLPPVPLNFRVAAKDTSLPVGGGPDGRSPVFIPKGQVVAYSVYAMHRRT

DLYGPDSHSFRPERWEENGRRGWDYLPFNGGPRICLGQQYALTEASYTLVKLVQRFDTLECADPELKQPA

ILSTLTMSHDRGVKVRLSSSVPKCWFNQ

 

#16 44% to 52A5, 44% TO CYP52J1

 

>CYP52K1 BAE66393.1 [Aspergillus oryzae]

MLTLSFSALLGIALAWAIHRLAWKYSRLKAICVKRDNKLATQYGCEQPPRLRNWWPLGIDRLIQIWTADS

EQRLMDLFTFPFKDVGYTLEQKFLGTIAFGTIDPENLEAIMTNINVFSFGLRRHILFPLLGDGIFTQEGK

SWRHSRELLRPQFTRQHYRDLNIFRPHVDRLLHYLTGNGAATDLQPLFFRLTLDTTTEYLFGKSVNSLMP

GEATKGQSFANHFDMAQNYVVQRFRLLDLYWLIGGPKFWRSCSAVHRFIDEIIDTRMDSKEKDKDCNSKS

IFFDAVARDSRTRRDLRDQLTNVLLAGRDTTACLLSWTFHCLARHPDVLGRLNVEIASVVGTNTDLTRDD

FKRMPYLDQVLREVLRLYPPVPVNTRTAHKTTILPTGGGKDGTKPFMVREGENVAFCVYAMHRREDLYGP

DAGQFRPERWDEDLPLFQNERTATWGYLPFNGGPRACLGQDFGFVEAAYTVVRILQKYPIVKPDMYKGDI

QGRKWLGWSSHQPEGIEMVTEERQKMTIVLSLGDGCRVTLGR

 

#83 58% TO SEQ 84, 81% to 53A3

 

>CYP53A13 BAE60506.1 [Aspergillus oryzae]

MIAELLTPTGAAYVLTAAVIVYYILPYLQLWRLRDIPSPGFAAFSNLWLMLQYRKGNRFVTVDNAHKKYG

KLVRIAPRHVSIADDEAIQAIYGHGNGFLKADFYDAFVSIRRGLFNTRDRAEHTRKRKTVSHTFSMKSIG

QFEQYIHGNAELFVKQWNRIADTQSNPKTGYATIDALNWFNYLAFDIIGDLAFGAPFGMLEKGQDIAEMR

KSPNDKPSYVQAVEVLNRRGEVSATLGACPSLIPWAKYIPDRFFRDGLEAVENLAGIAVARVNERLRPEV

MANNTRVDLLARLMEGKDSNGNKLGREELTAEALTQLIAGSDTTSNTSCAILYWCLRTPGVIEKLHKVLD

ESIPKDVDVPVHAMVKDIPYLQWVIWETMRIHSTSAMGLPREIPAGNPPVTISGHTFYPGDVVSVPTYTI

HRSKEIWGPDAEQFVPERWDPKRLTARQKAAFIPFSTGPRACVGRNVAEMELLVIVGTVFRLFDFEIQQD

GPMETREGFLRKPLGLMVGMKRRSVAV

 

#84 56% to 53A3

 

>CYP53A14 BAE56637.1 [Aspergillus oryzae]

MDGDSCPSCCSTCTSLNVFLCPHIPILTLGLLLVYYVTGYLKRWHLRDIPGPFIAGFSRIWLIVQVRQGY

RSLVVHDLHRRYGKIVRLAPNHISIADESAIQAIYGHGNGFLETDFYNAFLNVDWSIFTTRSRAEHTRKR

KIVSHAFSARSLAQVEQHAHNNMEHLVRQWRKMIDSEEGLDDPYAVIDARVWCNYLTFDIIGDLAFGAPF

GMLERENATVSMRKAPENPEVTLDAVEVLNHRGDVSAAFGICPDLIPYAKWLPDPFFRQGAEAIANLAGV

AGAAVDRRLKMDTSMTEKRGDLLALLIDAEDQAGAKLGHRELTGEAVTLIAAGSDTSSSTLCALLYWVSS

TPRVLWKLQNVLDEVIPVDIEVPYLAMVKKITYLQWVIWEALRIHSTFGQGLPREVPPERGPVEICGHTF

YPGDVLSVPGYTMHHSADIWGIDVEDFVPERWDPRRLTQRQKDSFIPFSEGPRACIGRNLAEMELFVGCA

TLFRLFEFRVEGQGPLKVRERWLRKPVSLQVGIRRRYLDARSS

 

#45

 

>CYP55A5v1 BAC01275.1 cytochrome P450nor [Aspergillus oryzae]

MNSEPVYPRFPFARPSGDEPPAEFHRLLRECPVSRVELWDGSHPWLVVKHKDVCEVLTDPRLSKVRQRDG

FPEMSPGGKAAARNRPTFVDMDAPDHMHQRSMVSAFFNDEYVESRLPFIRDTVQHYLDRLIRAGKDGKEV

DLVKHFALPIPSHIIYDILGIPIEDFEYLSGCDATRTNGSSTAAAAQAANKEILEYLERLVDKKTTNPSH

DVISTLVIQQLKPGHIEKLDVVQIAFLLLVAGNATVVSMIALGVVTLLEHPDQLSRLLEDPSLSNLFVEE

LCRFHTASALATRRVATVDIELRGQKIRAGEGIIASNQAANRDPEVFPDPDTFDMFRKRGPEEALGFGYG

DHRCIAEMLARAELETVFSTLFQTLPSLKLAIPKSEIQWTPPTRDVGIVGLPVTWDRD

 

#45b allele?

 

>CYP55A5v2 BAE61721.1 [Aspergillus oryzae] 6 aa diffs to v1

MQLEPVYPRFPFARPSGDEPPAEFHRLLRECPVSRVELWDGSHPWLVVKHKDVCEVLTDPRLSKVRQRDG

FPEMSPGGKAAARNRPTFVDMDAPDHMHQRSMVSAFFNDAYVESRLPFIRDTVQYYLDRLIRAGEDGKEV

DLVKHFALPIPSHIIYDILGIPIEDFEYLSGCDATRTNGSSTAAAAQAANKEILEYLERLVDKKTTNPSH

DVISTLVIQQLKPGHIEKLDVVQIAFLLLVAGNATVVSMIALGVVTLLEHPDQLSRLLEDPSLSNLFVEE

LCRFHTASALATRRVATVDIELRGQKIRAGEGIIASNQAANRDPEVFPDPDTFDMFRKRGPEEALGFGYG

DHRCIAEMLARAELETVFSTLFQTLPSLKLAVPKSEIQWTPPTRDVGIVGLPVTWDRD

 

#46

 

>CYP56C1   Aspergillus oryzae

          GenEMBL AP007164.1c

          third P450 of six on this accession

          CDS join(1160825..1161472,1161531..1162415,1162505..1162558)

          47% to CYP56B1 Aspergillus nidulans

          41% to CYP56A1 S. cerevisiae

MVMHGLCIIIGKALAVGILFLSICIFSRIVPPRYPRNIPAVPFW

VTLLSLVRDIDQEDIYRRHIQKPLQTHGAIKIFFAGQWNLLIQRSSYLNEIFRNEDVY

QKSGNQKKIPHSVLAEFL (1?)

GDNVISSRGTTWRLYRDIITPG

LQGHFDAGLIAANAEELCSSLLAFQNTVGNCGVPVQDLLQQFTIANVSQVLLQANHKP

TKGDESSLHQLQLAVKREIFKPIFMNFPVLDRLGKLIPCRVRARNVVEQFSAALQYGV

RHGQGTPNASNLGARLMAARDGGVLTGKQFRDNLNVLFVAGQENPQLLLISMLYLLAKHP (0)

DVQSRLRREIDACSTLDPSNVAFSELPYVTCVIYESLRLLP

PISQLINRRTSQDVILGNQIYIPKGTYVGYNCYSTNRDPAVWGPTADEFRPERWGQSN

TEISQCYRQRRARAEFVSFHGGSRACLGEKFALLEARVALFVLVSRLSWSLDPEWPDR

KTPAGPLYPRALRLIFTERK

 

>CYP56C1 BAE62147.1 [Aspergillus oryzae] assembly errors

MVMHGLCIIIGKALAVGILFLSICIFSRIVPPRYPRNIPAVPFWVTLLSLVRDIDQEDIYRRHIQKPLQT

HGAIKIFFAGQWNLLIQRSSYLNEIFRNEDVYQKSGNQKKIPHSVLAEFLGRFPVSPSVALLLTLGPKGD

NVISSRGTTWRLYRDIITPGLQGHFDAGLIAANAEELCSSLLAFQNTVGNCGVPVQDLLQQFTIANVSQV

LLQANHKPTKGDESSLHQLQLAVKREIFKPIFMNFPVLDRLGKLIPCRVRARNVVEQFSAALQYGVRHGQ

GTPNASNLGARLMAARDGGVLTGKQFRDNLNVLFVAGQENPQLLLISMLYLLAKHPVSVSCPLKSMELMS

QDVQSRLRREIDACSTLDPSNVAFSELPYVTCVIYESLRLLPPISQLINRRTSQDVILGNQIYIPKGTYV

GYNCYSTNRDPAVWGPTADEFRPERWGQSNTEISQCYRQRRARAEFVSFHGGSRACLGEKFALLEARVAL

FVLVSRLSWSLDPEWPDRKTPAGPLYPRALRLIFTERK

 

#102 56% to 57B2, 55% to 57B1

>CYP57B3 BAE55311.1 [Aspergillus oryzae]

MIGTVLDTVLGNPQGAVGGLFVGSFVIFWVVPFLYNLFFSPLRNVPGPFWARFTILWEFSQLMKGRSHEE

YIKLHKKYGPVVRVSPKRYSVIDPQDVKKIYGFGADFPKSEFYDSLGDPKNIFTVRDNEDHKDRRRKVAS

LYTMSSMVAYEDAVDRMTTLCIKKMTDLAASRKLISIPKFMQFYAFDVIGEITFDQNFGMMENMGDTQGI

IKEIHAMNNTIGIMGLLPELQSTWRAAQKVLFSGTAMGKLTEYIWSQYWKHRNTNSGAKQKSQYDTFLRK

VLELEAAHKVGRMNVLDSCGSNIGAGSDTTGITLSAALWYIYRNPDKLAKLRHEIDTMTAEGRISDPVTY

KQAQEMPYLNAVIKETLRVHPGVGTILARVVPKGGITLTGGYYVPEGTHIGTNAWPLHYSETVYGPDADQ

YRPERWLEDKPQPDYRDSMMFAFGSGSRTCIGRNISLLEITKVLPQIVRKFDLKFEEKKDPWDAWCAWFV

YPKYKCWIEPRKPVENVA

 

#47

 

>CYP58D2 BAE58658.1 [Aspergillus oryzae]

MGVISVVTFLASAKEHFIISILLLFPIALILRTIYRLYIDPLHHIPGPKLAAISHLYEFYHDVVRGGLFI

WEIEKMHQEYGPIVRINPREVHIKDPYFYDELYAPAHGWRDKDAKSVEIFSSPNALVSTVDHHTHRMRRK

LLTSFFSRRSIERIEPVIHESLSKFLDSLITAYEEDSVVELIDRLQALTGHVITQYAYGEDYGLHEPQNI

GKGIVKVVQEGTEQIHLHRFFPLIQRFLRLIPSFFMTQLFPARAAMYDLLHGVRKKSIEVLQQKDVCTPT

ERTTMFHALTAPEVPPEERTLQRLEDEGLVLFAAGTETTATTLGVAIFHILSDPMVLTKLRKELEQVMPT

PEGLATWRELEKLPYLNGVIHEALRFSGLAMRQQRVSPTEVIKYKDYAIPPGTPVSMLQYFLHTDPALFS

DPEKFYPERWMLAAERKESLSRFLVTFGKGTRSCIGMNLAYAELHTALAAIVRRFDLELYETTAEDIRFV

RDKLLPRAKNGPWRVRVKVVGIRKD

 

#90 61% TO 58E1 47% TO 58A2, 41% to 58C1, 46% TO 58A3

 

>CYP58E2 BAE59845.1 [Aspergillus oryzae]

MLDTISESRPNGLATLGVVVATFATYLALKALYNLYLHPLRKFPGPKLAAIGPYYEFYYDVMKDGMFLWE

MERMHQVYGPIVRVNANEIHIRDPHYYSTVYAGNHRSTDKYHDAVAAFSVPQASLATIHHKVHRLRRSIL

NPYFSKAAVTRLESAINERIERMCSRLEETMHYGQVVDLDAGFAALTADIVTTYFYGQNFDYLGNEGFKF

QVRDAILGLIQFYHFTRFFPWIANTIKKLPIPIMRLIHPGAAYLVSSQEEIKDSIRASLDKGNKADAKSV

IVQALEDPTIPPQERTLDRLGDEGTTIIFAGTETTARALSVGMFHILNNKTILKKLREELDTLPGVSSGV

YSHVQLECLPYLTGAVQESLRLSHGPAIRLPRVANDKALKYGDYIIPPGTPVSLCTVLVHQDPCIFPDPH

RFDPERWVKASKEGVNLDKFIAAFTKGTRQCLGINLAYAEIYLTFAKLIRTFNMEIYDTTVDDLTVHHIR

LTGAPKQGTGEVKVKVTEKIL

 

#125 46% TO 58E2, 40% to 58C1, 45% to 58D1, 44% to 58B1

46% to 58A3

 

>CYP58F1 BAE64028.1 [Aspergillus oryzae]

MALLVILGIGFVTYLVFLSIYRLYFHPLSHIPGPKLAAITHGYEFYHNIIRGGLFIWELERLHEVYGPII

RINPREVHIKDPDYYDDIYASSARKREKDPVLVAQFGLEGSGFSAIDQETHHQRRAPVAKFFSKRAIENQ

EHLIRDSLNKLVGHFQEACRAHTVVSLDAAFAALTSDVIHQYAYGFNPNNLDKEGFNAKVRDGINGLFQL

AHLLYFFPILQTLMNVMPLPLLQVLNPPAFALASQKKELYEQGAAALEKANSKAGSGTLIDTLAAPSMPE

HMRSAHRLMNEGFALVIGGTETTARSLALGAWHLFTREDIRNKLREELKQVMPTPDSQPTWNDLEKLPYM

SGVISESLRLSTGIANRSSRVAPTEALVYKDYTIPPGTPVSETNYFTLMDPEIFSDPHAFDPERWIRAAA

KGQRLDRYLVNFSKGSRMCVGLNLAYAELFLVIATIVRRFDIELYETPKSNIDFARDFGTPYPDKGNFSV

RALVTGVISE

 

#126 40% to 58C1, 41% to 58D1, 39% to 58B1, 35% to 58A3

39% to 52E2, 41% to 58F1

 

>CYP58G1 BAE64022.1 [Aspergillus oryzae]

MNLPLIWIGLFTAVSYLVIRSIYRLYFHPLSNFPGPKLAAVTHLYEFYYDVVKGGKFIWEMQRMHDQYGM

YCTTIHIKDPYYFDPIYTSKGQAKDPYIVRTFATPLSTAATVEHDRHRYRRDLVNPFFSKRSVMGVDYIV

QDKVDKVCKRLTQVHERGTVVSLDDLFAALTADVISHYAYGESLGFLDTENLKNEFRDAVASAGLLCHFA

RFFFVVSMVAETMPALVEWMQPSSKGLWEAKRMIEQMARSSLEKDHEKNANSRKTIFDALCAESVRPEER

TVARVRDEAMVVFGAGTETTARVLATGSYYLYRDKPRLEKLRAEIETVMPDSTDHVSLTQLESLPYLTAV

INESLRMAHSVTMRLPRISPTPLAYKDYIIPPGVSHLDAMELLRSNTSRSDTDSFNPERWLEASSKGERL

TKFLVPFSKGSRICLGMNLAYSELYQMFATLVRCFDLEIQTPPESVRITRDFIIGLPDDADYLKVHSLVT

NAL

 

#153 43% to 58B1, 44% to 58C1, 42% to 58D1, 38% to 58A3

42% to 58G1, 40% to 58E2, 42% to 58F1

 

>CYP58H1 BAE56719.1 [Aspergillus oryzae]

MDEFTISAGSLCLLSLVVGFIIQSVYRLFFHPLRKFPGPKLGAISHLVQGLCFANNPKGPVVRINPRELH

INDPYYYEQIYAGSSRIREKDPRFIGVFTTPLPMVATVGHEHHRIRRGLLSSYFSRRALKKAELIIDQKV

DRLLVRFHSAFKCHAVLPLQRVFAALAADIVSEYCYGASQGYLEQKVFQNQMIDAVNYVMSMCHINKSIP

IIPKLLRCVPVGLMEKLGLQMADVIGVRNLIRRQAAKSLDKEWLSHDTNMLSKNVFDAIAAADVAPQEKT

LRRLEEEGAALFGAGIETTARALTVAMFHLISDETMIRKLRDELKQVMLSPASRPTWAELEQLPYLTGVV

NESLRLSFGLVARSPRVSPIESLAYGEYVIPPG (0)

TPVSQSAYFVHMNPQV

FPEPESFNPERWIKAAEKGQYLSRFLVAFSKGSRQCLGMNLAYAELYLTLARIVRLVDMKLVGTTIDNIR

VGRDLGHPAPKAGNFKVKVEVMGIASKS

 

#136 41% to 58C1 46% to 58C1, 44% to 58D1, 41% to 58B1,

40% to 58A3, 43% to 58E2, 42% to 58F1, 41% to 58G1,

41% to 58H1

>CYP58J1 BAE62179.1 [Aspergillus oryzae]

MDSPRLWTGLAGLITYLIVISVYRLFSHPLRNIPGPKLAAVTHLYEWYYDLFLGGKYLFEIERMHERYGP

IVRINPPEIHINDPKYYDEIYASGTHRRNKDAEFVSFTGLLLSSASTTDHDLHRYRRGLMNNFFSKKSVR

GISYFVEEKVHNLMQRFEAFYRCNKVVRLDDAFAAMTSDVITHYCYGKSWDYLDYANLRTDVRKAVRDLT

CSVHFNRIFPIFLAVLKKLPLRWLYAIHPGRSVVLDIQKTIYEQSAEAIHGDKYKIGHNDAVDKHKTIYD

QLTDPSIPAEERSLQRLQDEGLLLISVGTETTARALTTACFHIASDDQLRTRLREELRTVLPTPTSSVTW

SELEKLPYL (0)

TGTVNESLRLGGFLTTRSPRIAPDEPLTYKEYTIPPS (0)

TPVSSSSYFGHKNPNIFPEPEKFSPERWISAGRNNDHLFKYITSFSRGSRICAGMNLAF

LELYMTLAYFVRRFDVELVDTTVEDMKIVRDMRVGFTHRGEPTVYGRIVRVYED

 

#134

41% to 58J1, 38% to 58A1, 40% to 58D2, 39% to 58C1,

38% to 58B1, 42% to 58J1, 37% to 58H1, 37% to 58G1,

39% to 58F1, 39% to 58E2

>CYP58K1 BAE63021.1 [Aspergillus oryzae]

MVMDQAWTWMALVAIAGLFWITRIFYRLYFHPLAKIPGPKLAAASHLLEFYYDVILGGKFLFQVEKMHQK

YGPIVRINPKEVHIIDPTFYNEIYASGMRKRDKYEGFVRSLAADESTVSTVGSEKHRFRRSILQNFFSKR

SVMEFSSAIGERVEKLMRRLEVFEKTQTPVALDVVFSALTSDMITYICYGKDWKFLDHKDFNCDIHQAGV

DFANFFHFNRFFPWVFMTLRALSPRMLALLIPGRAATFKFQESLLKHAIEMAANEQSDAPSKETEKSRPN

VISNLINPSIPYMERSRRRLEDEVITILVAGTEAPVKVLSMAMYYLGSEPAIGEKLRAELKTILPARTST

ATYAELEKLPYLHGVVYESLRISDSVIARFPRIAPTETLRYKDHILPPGTPMSCSSYFISRNHDLFPNPE

KFDPERWIHAAEKGENLKQHLTAFTKGSRICLGINLTIAELFLTIAHMCRRYHILLHNTEPEDVCTTSDL

LAGYTRRGVLKVHAKLKAVRE

 

#5 72% to 59A1

 

>CYP59A4 BAE59520.1 [Aspergillus oryzae]

MPEFQLLAGHFGTLKKTIQGMPSDATLHSIMLKISQQFPSGIFYINMWPFSGTWMIVSTPSAASQIQKLN

LSKPAILRRPLEMVTGGPSMMSMHGETWKKWRALFNPGFNPAYIIGLAPNISDEVAIFCAQLRKIAQQGE

VFPLESLTTRLTVDSICSVVLDTQLHHQIKDHPLATALQRQIDWTSFGTTFNPFKRYLTIRPLVLWYNNK

FMDRIIDGEVDRAYCTPPGHPSKSVISLALREYLQEQASNNSTRSLAEFKRLVAPQLRVFLFAGRNTTSS

TLIYTYYLLAQHPEALAKIRAEHGDVLGADPAEAQGRIKEDVQLLNKLPYTTAVIKETLRLFPPSASMRE

GRPDAEIIGEDGQRYPTVGCNVWTLTVALHHNSDYWDQVENFIPERWLVGPEDPLYPVKGAWRAFEFGPR

SCIGQTLAMLELRIALAMTIRQFDITPAYDEWDSIHPATTAREVNGHRAYQAERGAGGAHPADGFPCRVK

ERC

 

>BAE71324.1 monooxygenase [Aspergillus oryzae]

MPEFQLLAGHFGTLKKTIQGMPSDATLHSIMLKISQQFPSGIFYINMWPFSGTWMIVSTPSAASQIQKLN

LSKPAILRRPLEMVTGGPSMMSMHGETWKKWRALFNPGFNPAYIIGLAPNISDEVAIFCAQLRKIAQQGE

VFPLESLTTRLTVDSICSVVLDTQLHHQIKDHPLATALQRQIDWTSFGTTFNPFKRYLTIRPLVLWYNNK

FMDRIIDGEVDRAYCTPPGHPSKSVISLALREYLQEQASNNSTRSLAEFKRLVAPQLRVFLFAGRNTTSS

TLIYTYYLLAQHPEALAKIRAEHGDVLGADPAEAQGRIKEDVQLLNKLPYTTAVIKETLRLFPPSASMRE

GRPDAEIIGEDGQRYPTVGCNVWTLTVALHHNSDYWDQVENFIPERWLVGPEDPLYPVKGAWRAFEFGPR

SCIGQTLAMLELRIALAMTIRQFDITPAYDEWDSIHPATTAREVNGHRAYQAERGAGGAHPADGFPCRVK

ERC

 

#6 92% to seq 5, 71% to 59A1

 

>CYP59A5 BAE48804.1 monooxygenase [Aspergillus oryzae]

MPEFKLLAGHFGTLKKTIQGMPSDATLHSIMLKISKQFQSGIFYINMWPFSGTWMIVSTPSAATQIQKLN

LTKPAILRQPPETVTGGPSMMTMHGETWKKWRALFNPGFNPAYIIGLAPNITDEVATFCAQLRKKAQQGE

VFPLESLTTRLTVNSICSVVLDTQLHHQIKDYPLATALQRQINWTSFGTTFNPLKRYFTIRPLVLWYNNK

VMDRIIGGEVDRAYRTPPDHPSKSVISLALREYLQEQASSNSTRSLAEFKRLVAPQLRVFLFAGRNTTSS

TLIYTYYLLAQHPDILAKIRAEHEDVLGVNPEEVQGRIKEDAQLLNKLPYTTAVIKETLRLFPPSASMRE

GRPDAEIIGENGQRYPTVGCNVWTLTVALHHNSDHWNQVESFTPERWLVGPEDPLYPVKGAWRAFEFGPR

SCIGQTLAMLELRIALAMTIRQFDITPAYDEWDSIHPATTSKEVNGHRAYQAERGAGGAHPADGFPCRVK

ERF

 

#112 55% TO SEQ 97, 41% to 59A1, 41% to 59C1

 

>CYP59D1 BAE66084.1 [Aspergillus oryzae]

AP007175.1

470087 MVIAVSDLVGSYGARVALVLALVIVLRFLQEMLKVRLLFYRLRKQ

GLPMPKWNFAAGNLQMLPDLMKRHP

KGSQQSEAFTLLSYEFASSDNCFYIDVWPFTKPLLVVNSPDLAVQACQTYALPKPPVLAKFFNPFAGGPS

IFTTNGPEWKRNRGLFNPAFSTSNILQHTPHI 470671

VEEAEEYVEILREHARKGDTFTLDKMTCDYVLDIIGRVAM (2)

KARLHSQRGRNPVAAALRSQVEWHCQDEQMNPFIRWNPMRPIMQWCNGRTM

NQYIGAELDKRYEAWTQNKPSTRANSIIDIVLAEYMSTRPVRAALDPEFKSWAT

IQLRTFLFAGHDSTAATIVYSIYLLSKHPEILSKVRTEHDEVFGSDISAAAGILKQHPEL

INRLPYTLAVIKETLRLFPAASALREGQPGVYLQDKNGTKYPTEGLCIWIIHGGIQRNPN

YWPDPHAFKPERWLVGPDHPLYPPKGAWRPFEQGLRDCIGQALALLDVKITLVLTLREFD

FQDQYAHWDRLHPRSGPKTVFGERAYQIPQGGSHPVDGLPCRVSLRNQITK*

 

#97 37% to 59A1, 37% to 59C1

 

>CYP59D2 BAE58153.1 [Aspergillus oryzae] AP007155.1

 

2825205 MGANTLGWDGLTSRIAVAVATVCLTSFVYKLIKMRLMFYRLRKKGL (0) 2825068

2825008 PTPPWNPILGNLAVMAQLQKKWPSDSREAESFALLSTEAPGCEAGFYVDVWPFSIP

MLVVTSPALAVQACQTYDLPKPDVLQPFINPMAGGSDNLFVSNGAHWKQARELFNHGFSMAAAMSHMTYI

LEEAQVFVQMLKDHARKGDTFSLDALTCRYVMDIIGNVA LNTRFRFQEQHNPIAAAMRDTIELECGIETS

NFLSRWNPRRLYRQWQNGRTMDYLIGVELDKRYKEWRETAKSSSHPRTQSIMDMVIAEYMKTRPQAQQQQ

ELDPEFKRWATIQIRLFLFVGHDSEATTIIYSLYLLSKNPGVLIKVRAEHDRVFGAGVSSAYDVLTDHPE

KINQLSYTHAVIKETLRLFPPANGLRGGLPGVSLRDEQGRIFPTEGCAIWIVHTAVHRNPSSWPQPHAFI

PDRWLVEPGHPLYPPAGGWRPFEQGPRNCIGQNISLLGIKASLAMLVRQFDFHDAYAEYDRLHPSTGLKT

MFGERAYMIQKGAGHPAQGFPCKVTLR

 

#2 95% to CYP60A3

 

>CYP60A5 BAE71325.1 cytochrome P450 monooxygenase [Aspergillus oryzae]

MGGDGWPSDGHILLLIVLTVLTPPSLALYRLWIHPLRSYPGPRWWAIWRGPYILSNIRGNLVRDLQRLHQ

QFGHVVRIAPNELSFIVPEAASPIYTSNPEFPKDPMHLPPFHNGTPGILAADHAHHRRYRRLLAFSFSDK

GLRQQRSLIERSVNLLITRLHENCGQGPLDLTLWFNWATFDIIGDLAFGNSFGCLDNVQTHPWISSIQGN

VKLIPILNAFRRYRLDGLLQLLGSRKLLEQRRRNAQFTTDQVDRRLKNSSTPRGDIWDAVLAQKPDGEPP

MSREEMISNTSAIVLAGSETSATLLSGCTWLLLKNPGHLHQLTSRIRSQFTHASEIDSQSVSRVEGLQAI

LEESLRLYPPVPMQSNRIVPQSGAYIAGGWVPGGTSVGLQQFVACRSSSNFHRPEEFLPERWQGQGEFAH

DRREVSQPFSIGPRNCIGRQLAYVETRLILVKLLWHFDLRLDTTRMKDTDWLAEQGIWILWDKNPLWVNL

EPRNE

 

>BAC45242.1 cytochrome P450 monooxygenase [Aspergillus oryzae]

MGGDGWPSDGHILLLIVLTVLTPPSLALYRLWIHPLRSYPGPRWWAIWRGPYILSNIRGNLVRDLQRLHQ

QFGHVVRIAPNELSFIVPEAASPIYTSNPEFPKDPMHLPPFHNGTPGILAADHAHHRRYRRLLAFSFSDK

GLRQQRSLIERSVNLLITRLHENCGQGPLDLTLWFNWATFDIIGDLAFGNSFGCLDNVQTHPWISSIQGN

VKLIPILNAFRRYRLDGLLQLLGSRKLLEQRRRNAQFTTDQVDRRLKNSSTPRGDIWDAVLAQKPDGEPP

MSREEMISNTSAIVLAGSETSATLLSGCTWLLLKNPGHLHQLTSRIRSQFTHASEIDSQSVSRVEGLQAI

LEESLRLYPPVPMQSNRIVPQSGAYIAGGWVPGGTSVGLQQFVACRSSSNFHRPEEFLPERWQGQGEFAH

DRREVSQPFSIGPRNCIGRQLAYVETRLILVKLLWHFDLRLDTTRMKDTDWLAEQGIWILWDKNPLWVNL

EPRNE

 

>BAE59521.1 [Aspergillus oryzae]

MGGDGWPSDGHILLLIVLTVLTPPSLALYRLWIHPLRSYPGPRWWAIWRGPYILSNIRGNLVRDLQRLHQ

QFGHVVRIAPNELSFIVPEAASPIYTSNPEFPKDPMHLPPFHNGTPGILAADHAHHRRYRRLLAFSFSDK

GLRQQRSLIERSVNLLITRLHENCGQGPLDLTLWFNWATFDIIGDLAFGNSFGCLDNVQTHPWISSIQGN

VKLIPILNAFRRYRLDGLLQLLGSRKLLEQRRRNAQFTTDQVDRRLKNSSTPRGDIWDAVLAQKPDGEPP

MSREEMISNTSAIVLAGSETSATLLSGCTWLLLKNPGHLHQLTSRIRSQFTHASEIDSQSVSRVEGLQAI

LEESLRLYPPVPMQSNRIVPQSGAYIAGGWVPGGTSVGLQQFVACRSSSNFHRPEEFLPERWQGQGEFAH

DRREVSQPFSIGPRNCIGRQLAYVETRLILVKLLWHFDLRLDTTRMKDTDWLAEQGIWILWDKNPLWVNL

EPRNE

 

#1

 

>CYP60B3 BAE71326.1 desaturase [Aspergillus oryzae] 81% TO 60B1

MYFLSLPALAIIVPVGYVLLHLGYNLFFHPLRGYPGPLLWRASSLPWKIALLRGTMHHDLMRFHQKYGDT

VRVKPDEISYANAQAWRDIHAHVPGRPEFLKDPVRLPLAPNGVMSILVSDTKNHARFRSLFGHAFSDKGL

RTQESTIVQYADLLVEVLREMANTGRSAEMVYYFNMAIFDSIGALSFGESFDSLKSRQLHPWVDAIHKNL

KSVAISHVLRSMGIEFLTPYVLPKELRGKRQENYSYAVEKLNKRMKMEGDLGDFWDKVLVKSADDNQRGD

GMSAGEMLNNAAVMVVAGSETTASALSGAMYLLCLSGKIEKATAEIRKSFASPEDIDLISVSHLPYLAAV

IDETLRMYPAVPGQPPRVVPAGGATVCGRFVPEETRVGVSHLGAYFADYNFTHADKFIPERHLQKTEEPY

KYDNYGAYQPWSVGLRNCIGRNLAYAEVRLTLAKLLWHFDFTLDVGKTGNFLDQKIWSIWAKRELYMFIK

TRGTSSSSPQ

 

>BAC45243.1 cytochrome P450 monooxygenase [Aspergillus oryzae]

MYFLSLPALAIIVPVGYVLLHLGYNLFFHPLRGYPGPLLWRASSLPWKIALLRGTMHHDLMRFHQKYGDT

VRVKPDEISYANAQAWRDIHAHVPGRPEFLKDPVRLPLAPNGVMSILVSDTKNHARFRSLFGHAFSDKGL

RTQESTIVQYADLLVEVLREMANTGRSAEMVYYFNMAIFDSIGALSFGESFDSLKSRQLHPWVDAIHKNL

KSVAISHVLRSMGIEFLTPYVLPKELRGKRQENYSYAVEKLNKRMKMEGDLGDFWDKVLVKSADDNQRGD

GMSAGEMLNNAAVMVVAGSETTASALSGAMYLLCLSGKIEKATAEIRKSFASPEDIDLISVSHLPYLAAV

IDETLRMYPAVPGQPPRVVPAGGATVCGRFVPEETRVGVSHLGAYFADYNFTHADKFIPERHLQKTEEPY

KYDNYGAYQPWSVGLRNCIGRNLAYAEVRLTLAKLLWHFDFTLDVGKTGNFLDQKIWSIWAKRELYMFIK

TRGTSSSSPQ

 

>BAE59522.1 [Aspergillus oryzae]

MYFLSLPALAIIVPVGYVLLHLGYNLFFHPLRGYPGPLLWRASSLPWKIALLRGTMHHDLMRFHQKYGDT

VRVKPDEISYANAQAWRDIHAHVPGRPEFLKDPVRLPLAPNGVMSILVSDTKNHARFRSLFGHAFSDKGL

RTQESTIVQYADLLVEVLREMANTGRSAEMVYYFNMAIFDSIGALSFGESFDSLKSRQLHPWVDAIHKNL

KSVAISHVLRSMGIEFLTPYVLPKELRGKRQENYSYAVEKLNKRMKMEGDLGDFWDKVLVKSADDNQRGD

GMSAGEMLNNAAVMVVAGSETTASALSGAMYLLCLSGKIEKATAEIRKSFASPEDIDLISVSHLPYLAAV

IDETLRMYPAVPGQPPRVVPAGGATVCGRFVPEETRVGVSHLGAYFADYNFTHADKFIPERHLQKTEEPY

KYDNYGAYQPWSVGLRNCIGRNLAYAEVRLTLAKLLWHFDFTLDVGKTGNFLDQKIWSIWAKRELYMFIK

TRGTSSSSPQ

 

#48

 

>CYP61A1 BAE58068.1 [Aspergillus oryzae]

MANVTGSFVSPSADATVVPQLFQPSGLLGSLLGDFNVWKGLLTLFIAAVIYDQFRYFYQKGSIVGPRWKL

PFMGPFLQSVNPKFHEYKAKWDSGELSCVSVFHKFVVIASTRDMSRKIFNSPAYVKPCVVDSAHKLLGED

NWVFLDGKDHVEFRKGLNGLFTRSALSCYLPRQEETFNQYFKHFLEKSKANGYKPTPWMPEFRELMTAIS

CRTFVGHYMTDEVIQKINDDYYLITAALELVNFPIILPFTKTWYGKKAADMVMEEFAKCAAKSKARMAAG

GEVSCIMDAWVKAQQVSAKYREDVAKGIPAEKPPQLLRDFTDEEIAKTVFTFLFASQDATSAASTWLFQL

MADRPEVLEKVREENVRLRNGDINAPITMELLDQMEYTRAVVKETLRYRPPVIMVPYLVKKDFPITEKIT

VLKGSMIIPSVWPATHDEEAYPNPDTFDPDRWITGTAEQNPKNWLVFGTGPHYCLGQTYAQLNLMAMIGK

ASMEMTWEHTTTPKSEDIKVFATIFPQDDCLLTFRPRA

 

#49

 

>CYP61A6 BAE57461.1 [Aspergillus oryzae]

MDAKMATEIFNTTSAQPESPQSWAYKTSQLQGALPDFLAEWSAWQYVVTFLVGLVLYDQVLYLKRKGALP

GPTFKIPLMGPFIQAIHPTFDGYLRQWASGPLSCVSIFHRFVVLASDRDLAHKVFKSPAYAEPCLVPVAR

DIIGHKAWVFLQGRDHAEYRRGLVPLFTSRAIATYLPVQERVLDDYYNQFVAATKANQGKPMAFMTLFRE

INCALSCRTFFGDYISDDQVKKIADDFYLATDALDLVNIPLAMYVPFTKTWLGKRTADAVHRVFAECAAR

CKANMAKGATPTCIVDHWVLHMMESNRYRERVAAGETNLEKPKNMIREFTNEEISDTLFTFLFASQDASS

SATTWLFQILAQRPDVLDKLREENLAARGGDRNKPFDLPMLESLTYTNAVIKELLRYKPPVILVPYLATK

DFPVTPDYTVPKGSMIIPSCYPALHDPEAYPNPDVFDPERWISGDAESKTKNWLVFGAGPHDCLARKYVP

LSLAGMIGKASLELDWEHHPTPRSEEIRVFATLFPMDGCNLVFKRRP

 

#3 66% to CYP62A1 An ortholog

 

>CYP62A1 BAE71332.1 cytochrome P450 monooxygenase [Aspergillus oryzae]

MTNTASRELIRAIEHVPLTWWFLAVGGAWIVSKIVKILQTAYFSPLRKVPGPWYARLTSARLAWASFANN

RIYYVQSLHEKYGPIVLIGPEEVDIADPVAAKQIHRMGSGFVKAPFYKLLSPGPVDNIFNFRDAKLHSTR

RKLYAKGFTLNSLRQQWEPTIRNIVALTVERIRHDAQQGEAEILGWWTLMANETVCKLTFNGGHDTVRNG

TKDPFVLMLERRMGDLAHLLQHFAPPLYYLGRLLGRAEPRLHDVFFSQETMFEAGKHVVAIARSARDAEG

DRNLFVKALAAGDLESKIGCLNDTEIITDAGALLLAGSDPTALSLTYLIWCVLNRPKLQADLESEVAGLQ

GDITDAACADLPTLNAVICESLRLYGPAPGSMPRSPPPDGATLCGYYIPPSAVVVTQNWSLHGNPKVWKD

PHTFDHTRWLPGSSLSEEAKMSFNPFGQGARQCLGIHLGWMQLRLATALFFRRCPGAKLAPSTTPESMVM

IDSFIAGMPKARRCAIQL

 

>BAE59529.1 [Aspergillus oryzae]

MTNTASRELIRAIEHVPLTWWFLAVGGAWIVSKIVKILQTAYFSPLRKVPGPWYARLTSARLAWASFANN

RIYYVQSLHEKYGPIVLIGPEEVDIADPVAAKQIHRMGSGFVKAPFYKLLSPGPVDNIFNFRDAKLHSTR

RKLYAKGFTLNSLRQQWEPTIRNIVALTVERIRHDAQQGEAEILGWWTLMANETVCKLTFNGGHDTVRNG

TKDPFVLMLERRMGDLAHLLQHFAPPLYYLGRLLGRAEPRLHDVFFSQETMFEAGKHVVAIARSARDAEG

DRNLFVKALAAGDLESKIGCLNDTEIITDAGALLLAGSDPTALSLTYLIWCVLNRPKLQADLESEVAGLQ

GDITDAACADLPTLNAVICESLRLYGPAPGSMPRSPPPDGATLCGYYIPPSAVVVTQNWSLHGNPKVWKD

PHTFDHTRWLPGSSLSEEAKMSFNPFGQGARQCLGIHLGWMQLRLATALFFRRCPGAKLAPSTTPESMVM

IDSFIAGMPKARRCAIQL

 

>BAC20333.1 cytochrome P450 monooxygenase [Aspergillus oryzae]

MGSGFVKAPFYKLLSPGPVDNIFNFRDAKLHSTRRKLYAKGFTLNSLRQQWEPTIRNIVALTVERIRHDA

QQGEAEILGWWTLMANETVCKLTFNGGHDTVRNGTKDPFVLMLERRMGDLAHLLQHFAPPLYYLGRLLGR

AEPRLHDVFFSQETMFEAGKHVVAIARSARDAEGDRNLFVKALAAGDLESKI

 

#103 63% to 62C1, 99% to 62C2

 

>CYP62C2 BAE55279.1 [Aspergillus oryzae] first exon differs, check

MSIKVIV

LYTAFTSPLRRVPGPLYTVLTRLPLKLASLTGNRIYFVHELHRKYGPIVRIAPDEVDISSLAE

FREIHRAGSPFLKSKWYEKFVPSKRSGVFTMRDPKEHAARRKLFARPFSKSELRRTWEPAVREKVQLAVS

QIQRELKAVGKSDLLKWWTFLATDVSGQLMFGESFNMLQLGKKNQYINVLESTMMGSGIGAELPLVAWLG

RHIPLSSFQNMFRATDYLFQYGQRAVTNSRTTSNASRNIFAGMVYESEKGDGIITDEEVVLEAGNLIVAG

SDTTAITLTYLIWAVLSQPKLQRELEEEVNSLSADFDDSALEELPLLNAVIMEALRLYGAAPGALPRETP

EGGAKFCGYFIPQGMTVTTQAYSIHRDGDIYPDPERFDVSRWLKTETSASELAKKAFSPFGAGGRICLGI

HLAWMELRLATAQFFRECAGVRLAPSATWENMRPVNYFLISPRGHQCEVECNY

 

#4

 

>CYP64A1 BAE71330.1 [Aspergillus oryzae] 99% to CYP64 Aspergillus flavus

MIYSIIICAGALLGLWILEKLLAPKDTRPPLPPGPWRKPIIGNLTDFPPKGTPEWLFWAKHQERYGPMSS

LEVMGQTIIMINDAQLGIEIMHKKSALSQMIPDAPFAHMAGWGMSLATERNRQAWKTIRANMKQEIGTRR

AISTFHSKMEIGIRRFLLRTLDNPDDLRFHIRKEANAFMMDVAYGYTIAPHGKDELYDLTQQSVRQFSHI

FSPGEWSVNFFPILRYVPSWFPGASFQIKAAEYKWTIERMTMVPYLWIKDQVARGCSRPSILLRLLQKGH

YESGSHQEQVLVWTNAEFVMGGSDTTVSAVSSLFVAMALYPEVQRKAREELDRVVGPTTLATFEHRSQLP

FIDALVKEVFRWHPASPLGAPHITQEDQIWDGYLLPKGALLLPNIWTFTHDPSVYHDPMVFKPERFLEGK

DSPPETDPMKFVFGFGRRICPGRFVTDEKLFLIACHAVSCFFISPKDPGAPEPDWLPGVISQPGTFDLNV

VPRSPAHEELIRSIETDHPWKNADATDISRFMARNQMI

 

>BAE59527.1 [Aspergillus oryzae]

MIYSIIICAGALLGLWILEKLLAPKDTRPPLPPGPWRKPIIGNLTDFPPKGTPEWLFWAKHQERYGPMSS

LEVMGQTIIMINDAQLGIEIMHKKSALSQMIPDAPFAHMAGWGMSLATERNRQAWKTIRANMKQEIGTRR

AISTFHSKMEIGIRRFLLRTLDNPDDLRFHIRKEANAFMMDVAYGYTIAPHGKDELYDLTQQSVRQFSHI

FSPGEWSVNFFPILRYVPSWFPGASFQIKAAEYKWTIERMTMVPYLWIKDQVARGCSRPSILLRLLQKGH

YESGSHQEQVLVWTNAEFVMGGSDTTVSAVSSLFVAMALYPEVQRKAREELDRVVGPTTLATFEHRSQLP

FIDALVKEVFRWHPASPLGAPHITQEDQIWDGYLLPKGALLLPNIWTFTHDPSVYHDPMVFKPERFLEGK

DSPPETDPMKFVFGFGRRICPGRFVTDEKLFLIACHAVSCFFISPKDPGAPEPDWLPGVISQPGTFDLNV

VPRSPAHEELIRSIETDHPWKNADATDISRFMARNQMI

 

#91 45% TO SEQ 26, 68% to 65T1

 

>CYP65T4 BAE59716.1 [Aspergillus oryzae]

MPFNILLWPVIAFFLYSLLTAIWYIYFHPLRRIPGPKSWIIFPIMRHASAIRGRFDIDMRQHHAVYGPVV

RFGRDEVSFITAEAWKDIYGHGHQQLPKVLSSASNMLDIISSNDTDHSRYRKALSHAFSAKGLQAQEPLL

NSYVDKLIERLKGIAESNLPADMVKWYNLTTFDIIGDLAFGEPFGGLDNSEYHHWVSTIFESIKAIPFLK

LKDAYPLAFKAILGLIPKGIMEARKRQLEHSRITVQKRLQTSSSYNRGDFMDSMLRNRGEKDSLNDSELE

ANSNILIIAGSETTATLLSGATYWILRNPEALAKLTDEVRSVMKSEPEITAQKASAELPYMLACFDEAFR

LYPPVPTGLQRRTLVPTRISGCDIPAGTKVSVHQSAAYWSSTNFHAPDRFIPERWLPEAKSDPSSPFYSD

NRGVVQPFSTGPRNCIGRNLAYAEMRVILARVLWNFDLELCEESTQWSDQKAYTLWEKPPLMCRLKLRES

FRG

 

#9 43% to 65B1

 

>CYP65V2 BAE61720.1 AP007163.1 [Aspergillus oryzae]

MMLNSINIPQNAISWAVACAAA (0)

198235 (0) ATFCLASSVVYNIFFHPLARYPGPLSHAASRVPYFIRVFKGTLPFD

MLDFHTRYGDVVRIAPDELAFSHPDAWKDIMGHSKGGLYLEKASWFYRP

LEYDPPHIFNEGRQAHSLLRRQLAHSFSDKGMRDQEPMIRGYVDLLLQRLREMGGREDTVDISAWYNYTT

FDIIGDLSFGESFGCLKGSNYDEWIESIFRAFPFITALQALSFTPLVKEVLLALVPPSMRDRRERLRDFT

RQKMLRRMAIAEERPDLIEGLLKKKEEL (0)

199048 VSLLTISGFDHRQAHRQ

AETLVVAGSETTATLLSGVTYLLLKNPEAYQ 199191

RLREEVRSTFSSEDDINLSSAAKLPYMLACVEEALRMYPPGA

IGPPRVTPKGGAEILGARIPGRTYVSIHHWALYRREEYFTDPHTFHPERFLGDPRFSNDRHNVLQPFHIG

PRSCLGRNLAYSEMRLILALLFFNFDMELSDDSQDWIQQKNVIMWQRGPLKVHLTYIHRNSA

 

 

#10 about 60% to seq 9, 48% to 65B2, 54% to 65V1

one stop codon and one frameshift in last exon

>CYP65V3P BAE55600.1 AP007151.1 [Aspergillus oryzae] wrong C-term, revised

MSTAALVNAKSVLIATISA (0)

PIIYMLGMAIYNVYFHPLNRFPGPVSHAISRIPYFYRAVRGTLPFD

MLKLHERYGDIVRIAPDELAFSHPDAWKDIFGHKNGEPEMAKAAWFYRPLDDPLHIVNEDTDEHRRLRRQMAHGF

SEKSMRAQEPIIRKYVDLSLEKLHQSCKNGSLVILDWYNFTTFDIIGDLAFGEPFGCLEGCNYDQWIKGI

FKGAYLGSFMQALSFVPRLKSTLLLLVPKSMQEAHQGHKALTKAKMLRRAAITEKRPDLIDGLLRNKDEL

1455183 KLGLDKLIANAEILIIGGSETTASLLSGVTYLLLQNPNAYETLKNEVRSKFNHQEEIN 1455356

LISVNKLSYILA

CLDEALRMYPPIANGLPRVCPKEGSWVLGEYIPGKTVLSIHQWALYRREKHFKDPNTYHPERFLSSPEFL

DDRRDAFQPFHTGPRNCLGRN (2)

LAYS*MRLILALVIFNFDMRLPQRAKDWIRQRNYLMWDKGPLKVYLRPRTSI*1455965

 

#50

 

>CYP65X1 BAE58707.1 [Aspergillus oryzae]

MALAAEYFSHALSQPYGSSFWVAVAASLVFICYITCDTVYNLCLSPLSSFPGPRLWAVSNIPRQLSILGG

RSHLKMLALHHRYGPVVRVGPSELSFNSPQGFRDIYGFRRGQPQFQKDPKMYGSPLTGISNSIGGHVDSD

THSRHRRLLSHSFSERSLREQEGIVVYYVDLFIQRLRERTSVNKIHRAEEDLKSWFNFTTFDIIGDLMFA

ETFDCLKDSQLHPWIALMFNNVKGIAFLGVLNEYSLFRKMQGALLPKALKQKMLENHKLCAQKADRRLQK

GASRPDFVSMQTQSCKHMGPLLFFFFMAANTDSITIAGSETTASLLSGCLFYLCKHKYIMDQLNKEIRTT

FSKDEEITSSKCFNLSYLNAVLKESLRLYPPVAASLLRLVPKGGCTIDGHFVPEDVTVSTHHYASYRDAA

NFTFPEQFIPERWLGTDNRFDSDRKDVVQPFSLGPRDCLGKNLAHMEMRLILSKLLFNFDIHLTPESENW

GQQKMFIVWDKPALMVRLTDRFA

 

#101 41% to 60A2, 39% to 60A5, 40% to 60B3

43% to 65S1, 40% to 65A2, 41% to 65B1, 44% to 65H1

47% to 65S3

>CYP65AB1 BAE56591.1 [Aspergillus oryzae]

MLFSLGPLTIVYGLVIFVVAKTIYNLYLHPLRSYPGPLLARATRWYYSYYVKIGLLPQKTKELHDQYGPC

VRIAPDELSYNTAEAWEDICGHRTGQRTESFEKDLTFFPPAPNGVDSIVRIDDVHRRFRRLLSHPMSDKA

LGSQQEIITGYVDQLIHELRQRSERSEVVDMVRWFNFTSFDILGDLAFGESFGCLGSGLMHPWIELIFTS

IKSVMDMQIIRRIPGLFSLILTIAGLQQKQDLQEQFMFCQKKARERYTKETTRPDFMTYILRATEEKGMT

PEEIEANAQILIMAGSETTASALSGTLFYLLKNSMAMQKLRQEIHATFQAEAEITMRSTQSMEYLHAVLQ

EAMRVYPPVPCTFPRTTPPGGAMVCGRFVPGGYIVGVNQLAAMTSEKNFKDPLKFIPERWCGDERYQEDS

RKAYQPFSYGPRNCLGKNLAYAEMRLVLTRLLWNFEFDLLEESKDWHAKQKVWMMWDKGDLKVRLKPLRH

 

#93 58% TO SEQ 94, 45% to 65U1

 

>CYP65AC1 BAE59505.1 AY510452.1 [Aspergillus oryzae]

MSQFAREIVRNAIYNTSSPDADSVSLRKATTTVLLIGVT (0)

YCILVGIYRVTLHPLAKYPGPKLAAVTRLWHSYHLCTGDIVSVLSRAHEAYGPVLRIAPD

EVLFISSRAWDDIYGARPGKPE

MDKDTPLYKGPTAPHSIVTVDGELHRFYRRLLAKGFSDAALREQEPVIQRNINLLVEKLHKEVAAGKTPE

MTAWFNYATFDLIGELAFGETYGCLENSHYHPWVEMILEVMKLRAMTHAVGYYPWIFHILMWFVPKSLRE

KFVTHRRYTHDKVQRRMDQKIHYKDLTTNLVDPQNGLERYEIDGNCSTLIIAGSETTATALSATLYFLTQ

NENAKRKVIGEIRTTFNNAGDINSISVNQLKYLSACMNEALRIFPPGPAVFPRRVPQGGDFIDGHWIPGG

TQVGIAHYCINRSRRNFVDPDKFIPERWLGDPTYQTDDRHAVQPFSYGPRNCIAHNLARLEMRLVLARLI

WEFDWELAPGSERWEEEALVFNVWSTKPLMIKFTPVAR

 

#94 40% to 60A2 (CYP60 is in the 65 family)

 

>CYP65AC2 BAE54634.1 AP007150.1 [Aspergillus oryzae]

MTLSAESSQLPWALGNIVQQVHGIPIWGT (0) HYAIYAVYNITFHPLAKYPGPKVAAMTRIVYTSHLLSGRLVEFLHQTHLKYGAVVGVAPN

EVIFTSSQAWNDIYNVRQGAPE

MSKDTPLYQSLGTPPTIAEAGHDLHRRYRRLLAKGFSEAGLREQEPVIQQKISVLIKQLHAATAKGTTPE

MTSWFNFFTFDLISELTFGESFKCQENGRFHPWILMVTQSIKFRAIIQALGYYPLLFKLFMGLIPKSYQE

AFRDHQKLTSENVQRRIDKKVDYTDLASNLIDPKHNLERYEIDGNCAVLIVAGSETTTTALSATMYYLTQ

NPEAKAKVIKEVRSSFSSAEEITAISVNQLKYLPACFNEAMRKLPPAPAVFTRRVPREGAYIAGNCIPGG

THVGMCHFATNNSSLNFKDPEKYIPERWLGDPEYEDDARAAMQVFSVGPRNCIGQNLARLELRLLLSRVI

WEFDWELDSASMDWDKDMPVYLSWGMKPLKFHFAPVVR

 

#104

45% to 65V1, 43% to BAE65144.1   [Aspergillus oryzae]

>CYP65AD1 BAE55230.1 [Aspergillus oryzae]

MFPCCLVPTISTSQPVEVSIAAIASWSYNVFFHPLSNYPGPRLAAATRLWYAWHCAKGSLPFAIHKLHLR

YGDVVRVAPDELSYIHPDGWNEIYGHRPGQSEIPKDPSFYSSALSSPEGIFRAPRDRHGYIRRQMSHGFS

EKSMREQEDTIRHYADLMISYLSTQANGPKENVVDFTRWYNYFTFDVMGQLVFGESFNCLQSSGFHPWVS

IIFDSIRYNVFVRCTQFWPWLSPVIRRFIPKSFQRRKIEQQALSREKANYRKTIHDGRNDLVANLLKPDS

GVTDLEYQSTVQTLIVAGSETTASLLCGVTFHLLNNPEKLEKAVKEVRSEFDSADKISFVSVNKLHYLLA

CLNEALRVYPPVADGFPRRTGSNVEVINGQPVPPNTAIRMTHWATYRSPRNFVRPNEYLPERWLGNAPGF

EKDHKNALQPFHVGPRNCIGRNLAYMEMRLLLALVLWNFDLELYPASKLWDKQRVYNLWEKPELKVKVLP

RKI

 

#87

40% to BAE65144.1   [Aspergillus oryzae, 39% to 65S2

>CYP65AE1 BAE60010.1 [Aspergillus oryzae]

MEALPTYLESFWHSGGGTMGISILVMLSTFLALGTIFVYRIWLHPLSGFPGPKCCSVSSIPVAWAQLRGR

NHEFVSSLHRKYGSVVRISPSELSFISGAAWNDIYSRSKGRPALERDRTFFNDMLVDPETITMANEATHS

RIRRAMAPAFSPRALLEQEPIIQANIKLLMDKLEARAGSGGAPTDLRAWFNYTTFDLIGDLAFGESFGCL

ATSTCHEWVQFVLDHFYTSTLLHVVHRFHPFNRVLAALLPKSLIEKRKAHDSMTLTKVHRRLEVQGRRND

FTQHLLDAAEAGTLSSREVEKQASVLILAGSETTSVALTFAIYLVLTNKPVLDQLNDELHSTFKEEQEIN

LLSVNQLKYLHAVIQEALRFCPPISNGFPRQTPPQGATVDGMFIPGKTVVNINHWAAYRSPRNFTLPEQF

LPERWLGDPRFDEDAKDVFQPFSVGPRNCIGKKFAYDSMKLILAKFLWRFKPTLLDKSRSWLAHQPTFVS

FHQPPLLVDLEIKGSDAFPVRE

 

#26 46% to 65T1 50% to 65S2

 

>CYP65AF1 BAE65144.1 AP007171.1 [Aspergillus oryzae]

14 P450 genes and 2 pseudogenes on this contig

MTTVPRGGIKLLSRTKQSILYLFAVIIYNVYFHPLAKFPGPKSYAATRIPYFQALLGGQIGQAIKDLHQK

YGEVVRIAPNELSFIDGEAWKAIYGTRPGHKQKPKDVRYYPPTAGGVPSIVISNDEDHSRFRRTLSHAFS

ETSLRVQEPLVNSYIDLLIQRLHEHCEAGNKPLDMVAWYNFTTFDIIGDLAFGEPFNCLQNSAYHKWVSM

IFSNIRYGTYGNLARRFPGSKFLLRLITPTRIANGRNWHIELTKEKVKDRLAKSNDRMDFYGHILKQKDT

ERAMTFDEMVTNGSTLIVAGSETTATLLSAVTFYLLKNERVLSKLQQEIRASFESEKDITVTGCNQLEYL

NAVLTEGLRIFPPTPTGLPRIVDADGDMIAGKWVPGGTIVSIPHLAAFHSASNFTEPESFIPERFLGDPR

FANDSKTVLQPFSFGPRNCIGRNLANAEMRLILARVLYNFDLELDERSENWSRQETYILWNKPGLYVRLR

PRVGI

 

#89 45% TO SEQ 26, 39% to 65U1, 47% to 55Z1

 

>CYP65AG1 BAE60004.1 [Aspergillus oryzae]

MSRRFPIQVAQSEIPPIAWGLWRMVYRLWLHPLSGYPGPRLAAVSNLPYFAWTCTGNLHLRLQELHKVYG

DVIRIRPNALTYRTPEAWTDIYGHRKPGTLPFSKDPEFFMPAQAGSSHMINANEKDHTRQKRLLNHAFSE

RSLRQQEHLIMGYIDLFIQRLRGQARMGAETVNMEEWLNFLTFDIIGDLAFGEPFGCLQNSEYHPWVATI

FKSIKTGAILRALNIYPILLGFIRRFLPKSLVQKRIAHYQMSKDRVTRRLQTETSRPDFISYILKYNDDR

GMSTPEIEMNAALLIQAGSETTATVLAACLYFLQKNAACHRRLVQDIRSAFTQETDINFLSAAQLPYMNG

VIEESLRLFPPAPGIGPRVVPKGGARICGRYVPGGVSVSVGHYSTFRSARNFTRPNEFLPQRWLDRDAES

EFASDQTMALQPFSYGPRACIGRNLAYAEMRTILAKILWHFDVQLDERSADWANSKSYIVWEKGPLWLKL

HPRNVPQETD

 

#110 47% TO SEQ 111, 59% to 68L1

 

>CYP68L2 BAE66422.1 [Aspergillus oryzae]

MLGDLFESVLTNNSVTLLITVAVAAIALHLSSPKSNLPLVNDKKPWEFRFTKARKRFLANAHNLIKAGLA

KAPAFRIVTGNGKRVVLDAKYANELRSHDDLSFGLHIADNFHAHIRGFQPFKQGSNDDEIYQNAVRMKLT

QSLGNLTQPLVDETLVALQTYWTNDTNWHAIPLKSNIQKVVAQLSSRIFLGDQICRNPNWLRIAVDYTVD

AFKAAEELRLWPKAFRAIVALFLPSCRKIRAELQEAQDIIRPVLDARRKDKQAALSAGKEPERYNDAMQW

LEECAKGRSYEPAFGQLTFSVAAIHTTSDMLTQVLYDLCGRDALIQALREEVITVVQEEGWTKPTLYKLK

LMDSVLKESQRLKPISVVSMQRVATADLRLSDGTFIPKGTSLAVSSDRMWDSEIYPNPLEFDGYRFLKLR

ELPGHETSAQVVSPSPEHMGFGFGRHACSGRFFAINEVKIALCHILLKYEFKLADGSVPRATKFGFSFTS

DPTTKLMIRRRQEETVL

 

#111 47% TO 68L2, 45% to 68L1, 48% to 68D1

 

>CYP68Q1 BAE64916.1 AP007171.1 [Aspergillus oryzae]

14 P450 genes and 2 pseudogenes on this contig

MDHFNLAGPESNTSITSLEWLGIKNSFTGSHWAHITGLSELHPTGFLCLIATLIIGIVHLTRGPKPTVLP

VVNPPGTFELTANRVKKEWLVDARQIIRRGFEKFPGKPFNMIAADVGLTTVLPPEYASEIRNNPSLSFVA

FMAHLFFSELPGFEPTREGMFDNDIGITVVHKYLTVNLARITEPLSREATAALKDIFTDNSEWHDANLKA

INLALVARLSSRIFLGEELCRNEEWLKITVNYTVDVMKAAERLRRVPGPLRRIVHWFLPEAQKCRDEVKR

AGKVIRPVLEKRRREKATMESEGKEALQYNDAIEWFEQMAKSQGTSYDPEVVQLFLSTVAIHTTSDLLTV

VMADLARNPEIIEPLREEISSVLRDGGWKKTSLTDMKLLDSVLKESLRLKPIAVVSMRRVAMDHLKLSDG

TFLPKGTKMAVSSHRMWDPDVYENPEQWDGFRYVNLRETPGQDKHAQFVSTSERHLGFGHGKHACPGRFF

ASSELKVALCHILMKYDFELAPGTVVQHRYSGASYYADPAIRVMLRRRNVALPSWFER

 

#95 45% TO SEQ 96 86% to 504A1

 

>CYP504A8 BAE58419.1 [Aspergillus oryzae]

MSLQTIAIAAIAVAYFIIRYLNRTDVPKIKGIPEIPGVPLFGNLLQLGDQHATVAGKWAKKFGPVFQVRM

GNKRVVFANSFDSVRQLWIKDQAALISRPTFHSFHSVVSSSQGFTIGTSPWDESCKRRRKAAATALNRPA

VQSYMPIIDLEATASIKELLKDSQNGTVDVNPTAYFQRFALNTSLTLNYGFRIEGNVDDELLKEIVDVER

GVSNFRSTSNNWQDYIPLLRIIPKMNREAEEFRVRRDKYLTYLLDILKDRIAKGTDTPCITGNILKDPEA

KLNEAEVKSICLTMVSAGLDTVPGNLIMGIAYLASEDGQRIQQKAYDEIMKVYPDGDAWEKCLVEEKVPY

VSALVKETLRFWTVIPICLPRVNIKEIEFNGAKIPAGTTFFMNAWAADYDEDHFKMPEKFLPERYLEVSE

GSGTPHYGYGAGSRMCAGSHLANRELYTAYIRLITAFTMHPAQNPADRPILDAIECNEIPTALTTEPKPF

KVGFKPRDAPKLQQWIMESDERTKDL

 

#96 82% to 504B1

 

>CYP504B6 BAE56546.1 [Aspergillus oryzae]

MAITATLFSIQKSLIHTPLQSIAIAALFTSCLYFIVNEFIRAFSRVPGFKGPRGLPLIGNIAQIRKNAAE

QYRIWSKTYGPVYQIQLGNIPVIVVNSAVSAKAIFGQNAQALSSRPEFYTFHKIVSNTAGTTIGTSPYSD

SLKRRRKGAASALNRPSVESYVSHLDAESKAFVAELLKYGEGGNVPVDPMAMIQRLSLSLALTLNWGVRV

VSQEEDLFNEITHVEEEISKFRSTTGNLQDYIPLLRLNPFNTNSKKAKEMRDRRDKYLNGLNRDLDDRME

KGIHKPCIQANVILDQEAKLNSEELTSISLTMLSGGLDTVTTLVAWSIGLLAKRPDIQDKAAEAILNMYG

PNQPMCDAADDQRCAYVAALVRECLRYFTVLRLALPRTSIRDITYGGNIIPKGTVFFLNSWACNMDPDTW

SDPEEFRPERWLEQPDAPLFTYGLGYRMCAGSLLANRELYLIFMRTINSFRIEPYDEIDWHPVHGNADPT

SLVAIPKKYKVRFIPRDNKVLEDVLGSAFSLKRVI

 

#41 56% to 505A8

 

>CYP505A3 BAC55896.1 fatty acid hydroxylase [Aspergillus oryzae]

MSTPKAEPVPIPGPRGVPLMGNILDIESEIPLRSLEMMADTYGPIYRLTTFGFSRCMISSHELAAEVFDE

ERFTKKIMAGLSELRHGIHDGLFTAHMGEENWEIAHRVLMPAFGPLNIQNMFDEMHDIATQLVMKWARQG

PKQKIMVTDDFTRLTLDTIALCAMGTRFNSFYSEEMHPFVDAMVGMLKTAGDRSRRPGLVNNLPTTENNK

YWEDIDYLRNLCKELVDTRKKNPTDKKDLLNALINGRDPKTGKGMSYDSIIDNMITFLIAGHETTSGLLS

FAFYNMLKNPQAYQKAQEEVDRVIGRRRITVEDLQKLPYITAVMRETLRLTPTAPAIAVGPHPTKNHEDP

VTLGNGKYVLGKDEPCALLLGKIQRDPKVYGPDAEEFKPERMLDEHFNKLPKHAWKPFGNGMRACIGRPF

AWQEALLVIAMLLQNFNFQMDDPSYNIQLKQTLTIKPNHFYMRAALREGLDAVHLGSALSASSSEHADHA

AGHGKAGAAKKGADLKPMHVYYGSNTGTCEAFARRLADDATSYGYSAEVESLDSAKDSIPKNGPVVFITA

SYEGQPPDNAAHFFEWLSALKGDKPLDGVNYAVFGCGHHDWQTTFYRIPKEVNRLVGENGANRLCEIGLA

DTANADIVTDFDTWGETSFWPAVAAKFGSNTQGSQKSSTFRVEVSSGHRATTLGLQLQEGLVVENTLLTQ

AGVPAKRTIRFKLPTDTQYKCGDYLAILPVNPSTVVRKVMSRFDLPWDAVLRIEKASPSSSKHISIPMDT

QVSAYDLFATYVELSQPASKRDLAVLADAAAVDPETQAELQAIASDPARFAEISQKRISVLDLLLQYPSI

NLAIGDFVAMLPPMRVRQYSISSSPLVDPTECSITFSVLKAPSLAALTKEDEYLGVASTYLSELRSGERV

QLSVRLSHTGFKPPTELSTPMIMACAGSGLAPFRGFVMDRAEKIRGRRSSGSMPEQPAKAILYAGCRTQG

KDDIHADELAEWEKIGAVEVRRAYSRPSDGSKGTHVQDLMMEDKKELIDLFESGARIYVCGTPGVGNAVR

DSIKSMFLERREEIRRIAKEKGEPVSDDDEETAFEKFLDDMKTKERYTTDVFA

 

>CYP505A3 BAE56963.1 [Aspergillus oryzae]

MSTPKAEPVPIPGPRGVPLMGNILDIESEIPLRSLEMMADTYGPIYRLTTFGFSRCMISSHELAAEVFDE

ERFTKKIMAGLSELRHGIHDGLFTAHMGEENWEIAHRVLMPAFGPLNIQNMFDEMHDIATQLVMKWARQG

PKQKIMVTDDFTRLTLDTIALCAMGTRFNSFYSEEMHPFVDAMVGMLKTAGDRSRRPGLVNNLPTTENNK

YWEDIDYLRNLCKELVDTRKKNPTDKKDLLNALINGRDPKTGKGMSYDSIIDNMITFLIAGHETTSGSLS

FAFYNMLKNPQAYQKAQEEVDRVIGRRRITVEDLQKLPYITAVMRETLRLTPTAPAIAVGPHPTKNHEDP

VTLGNGKYVLGKDEPCALLLGKIQRDPKVYGPDAEEFKPERMLDEHFNKLPKHAWKPFGNGMRACIGRPF

AWQEALLVIAMLLQNFNFQMDDPSYNIQLKQTLTIKPNHFYMRAALREGLDAVHLGSALSASSSEHADHA

AGHGKAGAAKKGADLKPMHVYYGSNTGTCEAFARRLADDATSYGYSAEVESLDSAKDSIPKNGPVVFITA

SYEGQPPDNAAHFFEWLSALKGDKPLDGVNYAVFGCGHHDWQTTFYRIPKEVNRLVGENGANRLCEIGLA

DTANADIVTDFDTWGETSFWPAVAAKFGSNTQGSQKSSTFRVEVSSGHRATTLGLQLQEGLVVENTLLTQ

AGVPAKRTIRFKLPTDTQYKCGDYLAILPVNPSTVVRKVMSRFDLPWDAVLRIEKASPSSSKHISIPMDT

QVSAYDLFATYVELSQPASKRDLAVLADAAAVDPETQAELQAIASDPARFAEISQKRISVLDLLLQYPSI

NLAIGDFVAMLPPMRVRQYSISSSPLVDPTECSITFSVLKAPSLAALTKEDEYLGVASTYLSELRSGERV

QLSVRPSHTGFKPPTELSTPMIMACAGSGLAPFRGFVMDRAEKIRGRRSSGSMPEQPAKAILYAGCRTQG

KDDIHADELAEWEKIGAVEVRRAYSRPSDGSKGTHVQDLMMEDKKELIDLFESGARIYVCGTPGVGNAVR

DSIKSMFLERREEIRRIAKEKGEPVSDDDEETAFEKFLDDMKTKERYTTDIFA

 

#157 61% TO 505A3

 

>CYP505A14 BAE56245.1 [Aspergillus oryzae]

MEETKLIPIPEPRGLPLLGNILDVDSEAPEKSFQRLAETYGPIFRLNLAGASRVFISTYELVDEICDEER

FTKVVTAGLREIRNGVQDGLFTADYPGEDNWAIAHRVLVPAFGPLMIRAMYEDMYDIASQLALKWARQGS

SATIMANDDFTRLTLDTIALCSMGTRFNSFYSEDLHPFIKAVATLLQGSSDRTFRSTLLNNLPTRENKKY

WSDISLLRTLSQELVDARRNNPIDKKDLLNALILGQDLQTGQHLSDDSIINNMITFLVAGKGVCVGHETT

SATLTFLFYYLLKNPHAYQRAQEEVDTVVGQRKIIVEDLSKLPYIAASLRETLRLQAPVPLIAFHPHPTK

NHEDPVTLGKGKYALNNDEPVVLIMGKVHRDPKVFGDDAEEFKPERMLDKNFEDLPKNAWKPFGNGMRGC

IGRPFAWQEMLLVVAMLLQNLNFEMENPSYDLRIKQSLSIKPDGFQMKATLRRGLDAAKLASVLNSGGDL

LSHAPQILNGEYKPNTDLRFHLRPMHIFFGSNTGTCEALARRLAKDSMGYGFATRVESLNSAMENIPRDN

PVIFITATYEGQPPDNAAHFFEWLNGLKKAELDGVNYCVFGCGHHDWSATFLRIPKATNDLIEKHGGTRL

CDMGMADAANSDMFSDFDTWSELILWPAINLKFGRASSEGDVQSKSALHVDVSSSMRAFTLGLQLQEGYV

LENKLLTTPDVPAKRMLRFKLPPDTTYQCGDYLIVLPVNPAHVVCRAIRRFNISWDSMLTVRKPSHASDG

ITNMPLETPISAFELFSTYVELSQPASKRDLITLADAATTDTDAQAELQSLASSPNRFTEEVINNRLSPL

DILIRHPSINLPLSTFLEMLPPLRARQYSISSSPLASRSDCTITFSVLNSPHLSTENKRFVGVASTYLSE

LQAGDRVQISIRASNNKGFKPPLKEETPMIMACAGSGLAPFRGFIMDRAERIRGRGTELLSDDDHPEIGK

PARAILYIGCRTKGKDDIHASELDEWTRQGAVDVRWAYSRPTDRSQGRHVQDLLFEDRNELLELIDQGAR

IYVCGGMSVGQGIRQVFKDMFIERCREVLENGSDGDEDVAAEEYLDSLKTEERYATDVFT

 

#40 45% to seq 41, 50% to 505A8, 54% to 505C2, 47% to 505B1

 

>CYP505C3 BAE63564.1 [Aspergillus oryzae]

MRQNDNEKQICPIPGPQGLPFLGNILDIDLDNGTMSTLKIAKTYYPIFKFTFAGETSIVINSVALLSELC

DETRFHKHVSFGLELLRSGTHDGLFTAYDHEKNWELAHRLLVPAFGPLRIREMFPQMHDIAQQLCLKWQR

YGPRRPLNLVDDFTRTTLDTIALCAMGYRFNSFYSEGDFHPFIKSMVRFLKEAETQATLPSFISNLRVRA

KRRTQLDIDLMRTVCREIVTERRQTNLDHKNDLLDTMLTSRDSLSGDALSDESIIDNILTFLVAGHETTS

GLLSFAVYYLLTTPDAMAKAAHEVDDVVGDQELTIEHLSMLKYLNAILRETLRLMPTAPGFSVTPYKPEI

IGGKYEVKPGDSLDVFLAAVHRDPAVYGSDADEFRPERMSDEHFQKLPANSWKPFGNGKRSCIGRAFAWQ

EALMILALILQSFSLNLVDRGYTLKLKESLTIKPDNLWAYATPRPGRNVLHTRLALQTNSTHPEGLMSLK

HETVESQPATILYGSNSGTCEALAHRLAIEMSSKGRFVCKVQPMDAIEHRRLPRGQPVIIITGSYDGRPP

ENARHFVKWLQSLKGNDLEGIQYAVFGCGLPGHHDWSTTFYKIPTLIDTIMAEHGGARLAPRGSADTAED

DPFAELESWSERSVWPGLEAAFDLVRHNSSDGTGKSTRITIRSPYTLRAAHETAVVHQVRVLTSAETTKK

VHVELALPDTINYRPGDHLAILPLNSRQSVQRVLSLFQIGSDTILYMTSSSATSLPTDTPISAHDLLSGY

VELNQVATPTSLRSLAAKATDEKTAEYLEALATDRYTTEVRGNHLSLLDILESYSVPSIEIQHYIQMLPL

LRPRQYTISSSPRLNRGQASLTVSVMERADVGGPRNCAGVASNYLASCTPGSILRVSLRQANPDFRLPDE

SCSHPIIMVAAGSGIAPFRAFVQERSVRQKEGIILPPAFLFFGCRRADLDDLYREELDAFEEQGVVTLFR

AFSRAQSESHGCKYVQDLLWMERVRVKTLWGQDAKVFVCGSVRMNEGVKAIISKIVSPTPTEELARRYIA

ETFI

 

#20 58% to 531C2

 

>CYP531C3 BAE65935.1 [Aspergillus oryzae]

MDSFLFLALDYSLRGFAVSLFGTLWIALVFWYLATYLISPLRKIPGPFLAGWTNLWRMYHVTQGQSQVVL

HELHQKYGPVVRIAPNVVDLDLPEMIKTIYNTKGDYRKTEFYHGSSAKSNGRIIYNLFSECDPDIHAQQK

RPIAKYYSLTGVLPLEPHIDEVINYLCQRLEEEFINGLNAGITCKLDQWLLFYTWDVVGQATFSEPIGYL

KNGFDFDGTIAISDTAMDYFSLVGQLPVLDHLLDKNPIYRIGPPAFGNITNISITHLLDRLQGKDTSYHD

ANKPDFLDRFIDAKDKYPDIVDDSQIISYLMINMIAGADTTAITLNAAIYFALKDRRVWARLQKEIRACQ

SSLDAAPSAVPYNIASALPYLNAVVREAMRMHPGVAMTLERYVPPGGLTLPNGQYIPQGSIVGMNPYVIA

RNRSVWGEDSDVFRPERWLRDDSQESEEEFQARLRLMNNSDLAFGAGSRICIGRNLGLLEVYKVMATLIS

RYDIELAHPHRDWKTHNSFFVRQEGINVKLSRRS

 

#39 45% to 531D2, 40% to 531D1, 39% to 531C1, 40% to 531A1

44% to 531D4, 42% to 531D3, 38% to 531C2, 37% to 531B1

>CYP531E1 BAE63827.1 [Aspergillus oryzae]

MLSITELIMDLGLAIVILGVSHLLWNYLSSPLKAFPGPLWASFTNLWRLQDVFKGRCDITHNQLHRKYGT

AVRMGPKVLSLSDPSVIPHVFNSKNPWMKSDMYNVNDVIVSGVRLKNLFSHQDEKWHSTYIRPVKGLYSM

TKVQDMEPGVDVTINLFMDKLRERFVEKGQLCDMADYLNFFAWDVMSQITFSQNLGILEAGSDYQGFLGR

SNKSLDYFASISQMPILDLLLDKNPIVRLGPPTFVWANIFSLEQLQKRLSGGTPPSGHTDFLDKFLETKK

KYPDLVNDNTVVTYLLSNTLAGSDTTGSAMCSAVYHILKHPRVHRKLREELYAAKVPLPAKWKDLQGLTY

LDAVMRESMRVNPGVGLMIERIVPEGGFTLPDGRFIPAGTIVGMNPWVINKNEAIFGANTEEFIPERWLP

SPGESDQAYQARFTKMKSTDFTFGAGPRMCMGRYLSQLESYKLIATLFSTFEMELPSLDHTWHVTNSWFV

RHKSIPVKMRERTDLAVSV

 

#142 52% TO SEQ 39, 40% to 531D2

60% to 531E1 after making adjustments for gaps

>CYP531E2 BAE59053.1 [Aspergillus oryzae]

MDIAFKLVLLGATLILSHLIWNYFRSPLKSFPGPFSANLSNLWRLQDVFKGLCDITHNELHRRYRSAVCI

GPNVLSLSDPALINQVYSTRDPWVKVSSERTQDPQHSDVYNVNDSVVSGVRIKNLFSHQDEQWHANQELE

PGVDITINLFLESEYINYFTWDTMSQLSYSQSIGMLEAKNDRFGILEVSNRSLDYFASPKTLISSFLQVC

QIPMLDLLLDKNPICRLGPPSFGWSVKFSAEQYQERFTEGKQSHNGIKDFLDRYIETKSKMPNIVDDNVA

QMYLVLNIIAGSDTTARAISAAVYYEELRGANLSTPPQWKEIRSLPYLDAVMRETMLVHPGVGLLLERIV

PKGGFTLPDGRFVPEGTIVGMNPWVINRNRTVFGPEPDSFKPERWLPAEGEHDEAYQTRFSKMKGTDLTF

GAGPRACLGRYISQLESYKFVATLFTMFDVSFGCLQDLEHPDHEWEVTNSWFVRQKNIPVVIQKKKVLNC

TPSVQWASTALMYMPQRESFSRALPPLHCGQKFQIGTSKLQHD

 

#12 74% to 532A4

 

>CYP532A6 BAE66552.1 [Aspergillus oryzae]

MTLLAEVFSRASPEYALYILPFISLIYIGHLYFHNGLNRYPGPFLAKFTDLWRFLDVWGRQPHETHIALH

RKHGDVVRIGPNTLSFSSPAATKVIYGLNKGFTKSEFYPVQMTVSKGEPLPSLFSTLDDKFHAELRRSVN

HAFSMSSLVQYEPMVDETTLLFLDQTDRLFATGGKVCDFARWLQFFAFDVIGSITYSKRHGFIEKNEDID

GIVKSLARIFNYAGPVGQMPWLDKVFWKNPIFDAMQKWGLLDNSHPVAIFARQRMMERMSSKAAIDPSSR

SDLLTKFMKAGELRPNFMTEKRVLTMAVSMAFAGSETTAISLAAVFYYLLKTPDYMRRVREELDEAIQNG

TIENRPSGLVSWTESQKLPFLDACIKEAFRIFPAAGLPLERVTPPSGADIAGQFIPGGTIVGCSPWVIHR

REDIFGSDVDTYNPDRWLNASEDKLKIMNGMMLQFGAGSRTCIGKNISLMEIYKLIPSFLRRFDVRLAYP

EQEWRLWNAWFVRQYNFNTVFTPRKIEVQ

 

#137 46% to 535D1, 49% to 535C1 Mg, 47% to 535A1

52% to 535D2, 44% to 535B1 Mg

>CYP535E1 BAE61757.1 [Aspergillus oryzae]

MGLVELVLETRWLIVGSLFILYFLKKFQAYYRLRKFKGPLSCGFSHFLHTKAVLSLRCERWYKEMTDQYG

SIVRIGPNALITSSPELWAHINAVRSPYKRSDWYYHAARFKPGEDHVFSETNNERHDRRRKQMLMGYSGK

ENLSLESDIDLRVLDFLDLIRNRYLSTEDCLKPMDLAKKVQYLTLDVISTVGLGNSFGMLKADKDVNDYI

KSGEEGLWVSNFLMGTGLHWIMQIEWVGRLLGPSTDDLKGFGKMMATTGQMVAKRLQSPTNARSDMLASF

IRHGLIGNELWMEAFEQVLAGSDTTASGIRGILLCLLSNPRVYKKLQAEIDGAVQDGRAPSTGIISDAQL

RRLEYLQAVIREGLRIFVPVVNIFARDVPPEGDEVIVDGESVQIPGGTWIGYSALGMHLNKATYGEDAEV

FRPERWLIDDKDHLANMTRVNDLIFGYGRWKCLGQTVALIEIGKTIFEVHDELPLLTIVGLDILTVLEGA

A

 

#107 67% to 537B1

 

>CYP537B2 BAE66494.1 [Aspergillus oryzae]

MWSLWLSSILLVGLYLFKRLSSPLAKVPGPWYTNLTSFCLKYHEFTATRRLFVHRLHKKYGPVVRLAPNE

VSFASLDAIREIYASGGSGYDKTEYYDLFRQYGIKYAMSNIVRDKHVSAIKERAQAFVSRCAAIEGSVNV

YSLLHCYALDGVTNFMFSPGGLKSLDNTKDYEMMEELTYHQSLQKNLLYYYLPRLAPYFPSCLHPRPAPR

ANAYVLQMAGQQHPEAHSLVARLTRKGSPLSHMQVAAECKDHMAAGIDTTGDALCFLMWELSQPQNLQFQ

DRLHKELLSTSDDTPLDKMSYLDAVIKEALRCAPPIPMSIPRYVPSGGRTIDGYFIPENTIVSCQPYTVH

RFNEEVFPEPDRFNPERWLEEKGFNDRNRLFFAFGTGGRGCTGKNLAMVEMKILLRELYSRFRSSVAPDM

TASMDLDDQIISARPKDQICKLNFAVRGDDVDTA

 

#99 56% TO SEQ 75, 84% to 540A2

 

>CYP540A3 BAE57130.1 [Aspergillus oryzae]

MKCQFYLVGDDIATAQSILVDSRWKFEDLQRAVGGIFHVALPTGISFHTSENETLSSVADIISASSSPIG

LRIDGNAVQTPQGPKGLPLVGSFYEIFPDHLGNHYRLFRKYGPVIKTTNMGKTTYLTDDPQVASVCLAES

AYMTKKINENHPLWGVKDNTAIFIGDTETENWRLAHKYLPPAMGPKAVRHYTGLMQNCARKSLPVFDELD

GRDESWNVYQYMVKLASQTIGSFSLGKDFGHFDSVDSPLHPIVTNIANLLSLNKKITARGEWYRYLPFGD

PARLRHVQHTIYTLLQEAIDEVAGSGIADAPMNEAALSASCVVDYLLHAVDDKGEHFPQGLILANMLIVT

GAGFTTTSALLSWLLYCLVTYVGTQDRLYAELVEHGIVGPSGERNQTTWTPDLAHSLPYLDKFVKETQRL

HNASFQPGRTTKTDVVLPGGYRLPPDSVIVPALYAIHTNPKTWRDPFRFDPDRWDTEEVKGRHRCAYIPF

ATGPRGCIGFNFALLEVKILLAELVSRYEFVRDGLEAIDYDPEFQLIRPLNFYVRAKRRV

 

#75 80% TO SEQ 76, 69% to 540B1

 

>CYP540B9 BAE62604.1 [Aspergillus oryzae]

MAAADSISITIDGKSVREISGPKGLPIVGNFFEIYPDHLGNHQRLFEQYGPIIKTTNMGRTVYQTNDPQL

SSIIFSETDFFTKKINEAHPLHAIKNQQAGVFLGDTDTPEWRAAHKFLPPALGPKAVRHYAPTMQQTVED

AFKVFDHFDENGEAWNVYQYMLKLGSQAVGKLVLGIDFNHFSSPDAPPHELIQIIAESLSLNKKVTARGD

WYAKLPFGDPQRLRNMRYRIFDIVDQSIQNASRNGVEDLPLQDAALKASNMIDYAVRATDNKGEKLPKTS

LIQSLVVATGAGFTTTSSLLSWLIYSLVTYPGVQDRLLQELIDNDITEDTQITADLTDRLTFMDKLIKET

QRRHNPSYQPARTAKVDMILPGGYKLPEESVVVGALHHLHNNPEVWSNPTRFDPDRWDTEEVKNRHKAAY

IPFATGPRMCIGFNFALQEVKVFLPKLVYRYKFTKENDGPIEYDPMFQLIRPNNLYVRAERRVKWPPKSE

SATTRASL

 

#76 80% TO SEQ 75

 

>CYP540B10 BAE59862.1 [Aspergillus oryzae]

MTQLRIVEVGSRNSEGIDKDFSDSKVREPPGPKGLPIVGNFFEVYPDHLGNHQRLFEQYGPIIKTTSLGR

TTYQTNDPVLSSIVFAESDFFTKKINEAHPLYALKQPSAGVFLGDTETPEWKVAHKFLPPALGPKAVRHY

APTMQETVEDAFKVFDEFDKQGEAWNVYQYMLKLGSQAVGKLTLGLDFQHFTSPDANLHEMVNLIAELLS

LNKKVTSKGDWYAKLPFGDPQKLKQIKVRIIEMVEESIRSAERGGVVDLPLQDAALQASNMVDYAVRATD

NKGEKLPKTSLVWALTVATGAGFTTTSSLLSWLIYGLVTYPDMQERLLQELIDHDIDENTQLTADITDRL

TFLDKYIKETQRRHNPSFQPGRTAKVDLILPGGYKIPQDSVIIPALHHIHNNPELWDNPQKFNPDRWDTE

EVKNRHKAAYIPFAMGPRMCIGFNFALQEIKVFLPKLIYRYKFTREGDGHIEYDPMFQLIRPNNLYVRAE

RRVKWPPKTEN

 

#51

 

>CYP541B3 BAE61440.1 [Aspergillus oryzae]

MPSPIPKPKGVPILGNVFDLDGNNTWGSFNKLAKDYRPIFKINILGKDIVFITGAHLLEEVCDETRFRKC

VAGPILAIRDAVNDSLFTAKHTTEEIISWGIAHRIMAPLVSWEAVEQVFSGIQETTDDLIKKWTTGSRQR

INVTNDLDRCNHAANMLCFFDQRVHIMEGPEPAVIKAMGCATNEAMHRPFRLRIVNWLFHSRKWNAWIKT

MRDYGKDIVETRRANPTDKKDMLYALLEGKDPETGKGLTDSQVLDEIINIFIGSATAPNLIAFAMYYLAN

NPDAAAKAREELDAVVGGPSVRIEHEHLARLPYTEGVLRESFRLSGVAPGFNIEPIPENEGPVLLAGGEY

EVPKGQALIAILAAVNRDPAVFEDPEAFKPERMVGENFDRLPKGVKKGFGNGKRECIGKRYAWQWSFMVL

ASILKDVEFELADPNYKVGNDGVNCNGAFSVRPQEMFVVTGPRARAA

 

#11 73% to 547C1

 

>CYP547C3 BAE66568.1 [Aspergillus oryzae]

MDLMLALITLSLVEGFLLQRTVFVDLTFRTVTLSSVGVNLVLLTIWNTLIYPYFVTPLRHLPTISGNLNN

ARIVFDDPRGRLPLEWMKTVPNEGLIHFRDIVNRSYLLATNHQALLDIMSTNTYDFEKPWRARDFLARII

GFGLILSEGSAHKKQRRALTPSFNVKNIRALYSLMWEKTGLLMDELEKQIKQNPMDGTNAQSGEGKIEMS

VWASRLTLDIIGPAAMGRDFRSLHNPENKVADSFLAILEPTKEKMAFLAVNFALPQWFARRIPWRLNKVI

NDETGFLRDLCRDIVHEKRASITATKATAKELEADILGTMMLGGDFTDDELIDQMLTFLAAGHETTASAF

TWACYLLTLYPDVQERLRTEIRERIPSGNHPITWSDLETLPLLNGVCQEVLRLYPTVPMTIREAVRDSVV

AGKHIPKGTRILLCPYAINRSPEFWGNDGEEFRPERWIDTDKNGQLVTNNTGGASTNFAQITFLHGQRSC

IGKDFARAELRCAVAGVVGRFRFEMQNPKQKIHIAGAVTTKPVEGMHLRMSRVDDW

 

#72 45% to 548A2, 81% to 548D2

 

>CYP548D3 BAE62732.1 [Aspergillus oryzae]

MLVQEVWKTLSIEGVVVGVSALLGLLSFAYVIYNRFLHPLRKFNGPFLASITPWVQLYHGLKGDRHLWLH

NLHQQYGSHVRVAPNFVSINSAQGLHDIYGHGKKLKKANFYNGFTAIKGVYNTHNVIDKTVHGRKRRVLS

QAFSDQALKSMEDVMLLHVRQLCTALAEQQTEGNKAEAQKTTVQNMGDWFSYLTYDVMGELCFGKSFDML

VSSGRRKMIQLVDRAANRHYVCGLWMPLDTWHLDQIVIHRLTNDRWNFIMNSRVEANKRAQERTQAGHDS

KKDFFYYLLNAKDPETGKGLTTPELWGEANVLMIAGSDTTSTTLAATIFYLVRNPRAMKLLKKEVREAFT

SVEEIVTGGKLNELVYLKACIDEALRLAPAVPGAIPREVMEGGAVVDGAFLPAGTDCGTPTYSIHRQPQY

YREPEAYLPERWIEGATCVTADDKWESTKDAVETARRAFCPFSIGPRGCIGKGMAFMEMRLTIARLMFLF

DMELADRQGEDEKGHLALVDHFTSAKQGPNVIVRRRDITV

 

#52

 

>CYP548F1 BAE58762.1 [Aspergillus oryzae]

MQVGGLRSRVSVLVAIQLVSLIVYRIYFHPLSKIPGPLLPKITDWYPAWCVWRGSSHTALWEGHRRYGSI

GRCGPNSVSVCSQTGLMEIYSTKANVCKDESYVVMSVGSHAPNTFSFIDKKTHAFRRKILFQAFTDNALN

GVQDQILSHISEFCAMLNPPPSNGAGQSSVWGPSVDIAPLCDYLAFDVISDLSYGRSFGMLKSDRYRYVP

KLTRRLARRNATCMTQSKLWRYKLDRLFFAGFLKALRDFGLWIRHQGKERIRLGNNGPRKDCFHYLLSGS

DPKTGQGLTERELRVELLLLIVAGSDTVATSLSAVLFNLAHNQQALQKATAEIRSCFEREEDIRLGTRLK

SCSYLHACISESLRISPAVSNMPPRRVLPGGITVDGYYIPEGTIIGTPIYALHHNEEYFPRPFKYEPERW

LENEANGENPSTDDGLKRARAAFCPFSIGPRSCVAKNLAWAELTLTLARVLFSYDVRLPPDHCEVEPDCC

SSVPRDQSPEYKLRTWIVSAREGPSLQFRPRNVKVP

 

#37 45% to 548C1, 50% to 548B1

 

>CYP548H1 AP007171.1 BAE64607.1 [Aspergillus oryzae]

14 P450 genes and 2 pseudogenes on this contig

MQAVALLRHVPLFAYVTAVPVALLAYVLAICIYRIWFHPLAKYPGPLLAKVTNLYGGYYAWKGDLHIDMM

RCHEKYGNYVRYAPNRVLFNTNTGLKEIYAYSKSFQKSAAYGAMVHRAPNTLTLIDKKQHGRKRRIIGQG

FGDAALRGFEGTIMSLVRKFCDELAKDISGRKAGEWSTPQNMGKWSNYLTFDIMSGIIFGESFDLIGSPK

NREIVKCIEDSNVRTGVLSQAGELSTRRLDRWLFPQAIQGRNAFIRFVNILLKKRMSAKPLKRHDAFSFL

LDAVDPETQQGFTPAEIGAESTTMIVAGSDTSSTAIASTFFYLCRNREWYEKAKEEVRAAFPGPDDVALG

PALNNCVILRACIDESLRMSPPASSSLWREVLDDGVIIDGQVVPRGYDVGTCIYAIQHNPDYYPEPFEYR

PDRWLDPVPEKVQLARSAFSPFSIGPRSCLGKGLAWTELMLTMAYMLSKYEFRSAPGEDEKVGGGHVDMG

AGRQREGEYQLRDHVTAAKDGPIVQVSFR

 

#73

53% to 551A1 43% to 551B1 Fg CYP53 clan

>CYP551A2 BAE62699.1 [Aspergillus oryzae]

Note 551 is not in the tree on part C where it belongs

MEDTFNLTVLGGVIVLYSLGLVIYRLYFSPLAKFPGSKLAAATGWYEFYFDYWIGGKYVFEIERMHQVYG

PIIRINPHELSIRDPDFYNEIYVTENKRRSNHYDLFARGIGMDDARVESHIVTVDHNLHRKRRKPLEPFF

SRAGIARLEPALVEMSLKLESRLRQYEGKHTVVTLDHAFSAFSGDIIRRVCFNKDDFGDLFMDHPDFSPD

WYNLIHNILRHFPVFTGFPLIARIVTYIPESILLKAFPQGQSLNRLKDVALQRITHVMNSKATELKDTHR

EVSLFHHIVESDMPESERSPERLVQEAQVLLSAGTVTTARTIAFASFYILARSEIKAKLQAELRDAMDGW

PEKVPTFMDLERLQYLQAIIKESLRLSYGIMHRLPRVSPDLPIQYKDFTIPVGTPVGMSSYFMHTDPTVY

PDPMTFRPERWLGAIDPAMHRNYVPFTRGSRNCLGMNLAMAEISLILAVLYRPNGLKLELYETDETDVMI

AHDFMAPMPKVTSKGVRVLIR

 

>CYP567D1 AN3281.2 AACD01000055 revised

N-term may be wrong 41% to 567B1 53 clan

MSASWVDEPSSLLGIFEVVFVL (0)

TLVYVSTRILYNIYFHPLAAFPGPLLARASM  (0)

AWRIYHSMGGRFHRAIDEQHRRYGPVFRVSPNELSFASVASWKDIYGHRAT

GKPPLIKSKFYEIYGAGFGSLCIGSERDPEKHTRMKKSLSPAFSLRSLGD

QEVIVSQCVDRFVSRMGEPELNAGGLNMTKWYEMVAFDILGEL (1)

AFGESFHSIED (1)

DHLYFITVADNFRHFPVVALIAKLLSPFLDSIRKKHTGYTRNKVAQ (2)

RIRSSSPRKDFMANLIGKVESNEMSREELTAHASTLV ()

IAGGETVATFLAATTFYLLRDD

AVYQKLKAEIRGQFNTYEEITCATAQNLPYLQAVISEGLRIYPPGSQGFP

RISPGASIDGIWIPAGA (0)

EVYTSAWTVTHDEANFHDPHTFKPERWIDPDCADIKEASQPFSLGPRACLGRN (2)

VAYMEINLILARLIWTYDMELVNKSMDWESESSLHVMWSKPELKVDLEVSTLGNCAAGGD*

 

#36 59% to 567D1, some errors

 

>CYP567D2 BAE64652.1 AP007171.1 [Aspergillus oryzae]

14 P450 genes and 2 pseudogenes on this contig

MDRVVWLGLAVA (0)

286366 LTALYWVHLVIYNVFFHPLASFPGPFWARASFLYPNILASDMANVAYFHWPCSSRHRIS

TQSSWWALTDPPIYSNIINPGL

RLGDIVRISPNELSFASVESWKAIYQPKSAPLVKSEFYEIYGSGFNSLCIGSE

RNPETHSRMRKSLAAAFSTKALLEQEDIIQGCVNDFIEGIRSQTTVNFTKWFEMLAFDILGEMAFGESFHCIEN

EHLYFITILDNLRRYPLIAAIGKTILPHLTVSVRNKHTNYSRRKVA

HRLQSSSPRADFMSRLIAKVEDEEMEMEELTAHASTLV

IAGGETVATFLAAVTYHLLSTPN

AYQKLRDEIRARYNHLSEITSTTALQLPYLQAVISEGLRIYPPGSQGFPRNTPPQGIVVKGTYVPGNVEV

YTSAWTVTHDARYFHDPYTFKPERWLDPNCTDNKDASQPFSLGPRGCLGRNFAIVEMSLILCKLHFQFDA

ELVNPFQEWESASQLHVMWWKPDLPVRFIPCTRDH

 

#53

 

>CYP573A5 BAE58632.1 [Aspergillus oryzae]

MVLAGEDLVAMFTVTHVILALGAYVALRFAYQIVYYRFFHPLSVFPGPFWGSVTRLWIAWHNLRETEVPT

VYALTKKYGPVVRITPTLLLVSDPTKLPDIYHRNADKTGHYITGSFGETESLFNIRSHKTHAAFRKHIAG

PYSFSNVTRMEPLVDARIDDWLNKLDETFASTGAKFDFAWWAVYVAYDVISEIGFGAPFGFIEQGKDVGG

LIQGFHDGLPAFGLLARLHPFTSWMKTTFMKKYLVAKPEDNTGIGVLMRFRDRLIEQRLREIAEGKDVGR

VDLLQTFIDARTEDGKPLDMDYLKAEVLLVLLAGADTTGTVFQSLVNHLLVNQEVYERMMEEIDTASRKG

LIPETIPQYDAIQEHLPYYVACVRETLRLNPPAPNIFPRYVSEPGIELFGKFAPAGTEVTGNPWIMHRDT

ALFGEDAEEFRPERWLDPEKAKLYNKYIFTFGYGTRVCLGRDIAMEELFKGPLQPSARFEVKGGIGYWRD

MWVSINRRPAVKPL

 

#54

 

>CYP577A4 BAE58995.1 [Aspergillus oryzae]

MTITLVAIATGIVAFILYYICWSLFSSPLARIPGPKSFALTKWRLAYEDYKGTRTRKIHALHERYGPVVR

IGPNEVAFNSLSALRAIYGAGSGFERTNFYSMFAIYGRKNMFSFNTVKQHAERKKLFAHAYAKSAMLKGI

NASMIETKVRKYMEFLEREGRSQDIFTTLHYFSLDNITEFLYGDFGKTACLDGIEEDRALLHDILATGSR

TLSWLTVHHPKLTAWLYSRTGFLGCVARQFYPMQRPTPYTSIKLHATKAFQGFADASVAEKAKQSSLISK

LWKHHRSMKDGGLDNLDIASECADQLDGGIDTTSDTLMFTIWSLSRPEHWGFQQKLIDEVRSISEHDLNP

EGIPRVEAADKLPYVEAVIKETLRLFAPLPASEPRSSPEATTIDGYLIPARTVVSISPYTLHRNAEVFKN

PLEFNPDRWLDPSQDLTEMNRFFWAFSSGGRMCIGMHLAMAEMTTFVAALYRKYTTEPRGGFGTISPGIT

SRFEVFYDEGCSDMRVCFP

 

#15 62% to 578B1

 

>CYP578B3 BAE66519.1 [Aspergillus oryzae]

MTSATAIAIGILLAAFVYKYLVHPYCLSPISSVPNAHFTSPISNRWIEKQRNAGKEVLTIYNLHQKLGPV

VRLGPDELSVNSLSGLKTIYTGAFEKHSFYSDVFINFQTPNLVGMIHNNPHARQKRMLSRIYSKSYLQES

RDLRDISKIILSQRLFPILRRVAKSGEAINVLPLFQAVGMDFTSSYLFGTKNSTTYIFHLPEWQQWLEEY

EKFKYMSVQDRYMGFIESWCLSLCRKVENNDQPNDVPIATNAVVYNQLRQSLEKDPDSRPLELAIASEVL

DHLVAGHETSGITFTYMMWELSQHPELQAELRRELLTLTPNLRSLPISDNAVDLPSLPSPSAIDALPLLD

AVLRETLRLHSPAPAPLPRVTPASPTGVSIEGYHNLPAGVRVSSSSYSLHRIEEVYPQSSDWLPERWLKP

EPGKIHDMRRLFWPFGSGGRMCLGSNFALQEIKLVMAAVYTNFTTSIVDDEGIEQDHAFISLPTGRKLML

RFTPIKEA

 

#55

 

>CYP578C2 AP007155 Aspergillus oryzae RIB40

71% to 578C1, NOT IN GENBANK PROTEIN SECTION

MAGSPIVAISAIVLTITLLYKCIVYPVFLSPLSKIPNAHWTAPISPAWMLWKRFRSQNNR

TIQAAHERLGPIVRLSPSEISINCVEGGIKTVYTGGFEKHEWYPRVFGSLG (2)

TVSMFTMISSKPHSVRKRMLSNIYSKSYLQSSPHMRLISESILFDRLLPIIQEAVSSD

APIEVHDLNQGLTIDFVSAYLFGLANGTNWLQDAPFRRRMLHYYQGRKPYEFYHQEVPNL

VSWTKSLGIRLIPRWCDEANEMLDAWCLDLCDKAEQCLQSTEVSVEPVVYKQLQQAMIKQ

SSQKENTDESLKQQRLDIACELYDQLTAGFETSAVALTYLFWELSRHPDVQEELRA

ELLTLEPKILFPRSSASRGLPQAKAVDSLPLLEAIVTETLRLHAPIPGIQPRVTPYPSC

TLAGYSDIPANIRVNAQAYSLHRNPDVYPDPETWQPKRWLKGVNSDSDLEERRRWFWAFG

SGGRMCVGSNLALQ (1)

EIKLVTAAIYSNYRTSIVDDDNIEPIDAYTVKPRGDKLVLKFEAA*

 

>CYP578C4 AAJN01000108.1  Aspergillus terreus NIH2624

58% to 578C1, 34% to #158

       MAVSAFTVVALVSLGLFVLYRVIIHPAFI

17000  SPLSKIPNAHWTAPVSPVWILWKRYTSQNNRTIQAAHEKHGPIVRLSPNEISINCVENGI  16821

16820  KSVYTGGFEKHDWYPLGFGSL (1)

       GHRTVSMFTMTGSKPHSTRKRM  16641

16640  MSNIYSKSFLQSSPHMRLISENIVFSRLLPIFQDAASSGKHLEMHDINQGVTMDFVSAYL  16461

16460  FGLANGTRFLQDEAYRKKMLHLYHSRKPFEFFNQEVPNLLSWTKALGIRLIPRWCDDA  16287

16286  NDILDRWNLELCDKAEASVGSTELDAEPVVYKQLKQAMLKHTSKEDNQNS  16137

16136  VPDTPEKQRIEIACELYDQLTAGFETSAVALTYLFWELSQHPELQTKLREELLTLDPSIR  15957

15956  YPATSKILPSAKSVDSLPLLDAIVTETLRLHAPIPGIQPRVTPYPSCNLAGYTGIP  15789

15788  ANTRVNAQAYSLHRNPEVFPEPETWQPERWLKDGNSSAELEERKRWFWAFGSGGRMCVGS  15609

15608  NLALQ (1)

       EIKLVIASVFTNYRTSIVDDDGIEAIDAYTVKPRSEKLVLKIEVA*

 

#158

 

>CYP578-un1 BAE55033.1 AP007150.1 [Aspergillus oryzae]

29% to 578C1, probable pseudogene, last exon may be wrong

MTQWIALLLVAICG

YLALRLRSSSLSKIPAAHWSARFSPIWILWKRYTGKELHTLVDAHQKHGSIVLVGPQD

LSVSCYQDGIRRVYDSGYPKPAPFYSMFNYYR ()

QQNAFTSLDRSEHGLRRRRTAALYSKSAL

1613568 MQSQHLRDITRSITYDRLLPKLNSVAQGNGRIDGLDLSYCICVDYLSSFIFGYSNGTNYLSQPKSAIDVW

RFHYENLMCQESFFVQETPSLYKLLRYISIDLLPRKYTESADFLGRWMSDMASKADRATDRKRSTGLPLA

LEDEPVVYDMAKEAVRKDSPHLSEGDQRKQVASEMFDHIC (?)

Missing I-helix motif here, 7aa

LVLGYAFWYLAQHPDAQQRIQTELNSQGID

MRSRETVTNSSKRPRAVELDSLPYLRAVIDECLRMRPTSTPLPRITPSNRKVSVAGIDGIPPGTRINTFQ 1614560

WFVHRDPQKWDNAHDWNPDRWLTRGNTDNKNEREDVLWAFAS

GPRMCLGNNWTYY (1?)

LTTLNSTAMQHILATICSSFNFTALPREENQCWPGSPEDELPIRVCLRN*

 

#18 79% TO 584E2 55% to 584G1, 73% TO 584E1

 

>CYP584E4 BAE62566.1 [Aspergillus oryzae] SHORT

MISSING N-TERM

MIMNSSHYPVALLAGAPARTTVNRYIFTTDGDHWAQSRAMIRPNFVKDQVAHLDIFEELMADLLALIPTD

GTTVDLQDLFFCYTIDSATEFLFGHSVQSLKKRLSGVKLDDNDFASSFNYAQDAIAKNTRLGPLRHFFRD

TKAEHCNQVCHELVEQFVEKALKYRANYDEEKAATDDDKKQRYLFLQGLAQQTGDPKRIRDELMNVLLAG

RDTTASLLSNMFFMLAKNPHIWNKLREEVASLEGRAPTYEQLRNLTYLKYCMNESLRLHPVVPSNARFAI

NDTVLPVGGGPDGNAPVFVPKGSIVAYSVYSMHRREDFYGPDANEYRPERWADLRPSWEYLPFNGGPRIC

VGQQYALTEAGYVTVRLAQQFSVLESRDPGPWEENLTLTLCSRNGTKVALRH

 

#17 60% to 584E4, 51% TO 584E1

 

>CYP584E5 BAE65988.1 [Aspergillus oryzae]

MELLPKLVILLLAALGIASVSIRRFLNRRQFARRCGCQPVARSFSKDPFLGLDTIPGTIRAIRQHRVLGR

SCEIFRAYGNTFTVKELHQSAIVTIEPENIQAVLSLNFKDYTLRHRLELFMPLLGRGIFNTDGQHWASSR

ALIRPSFAREQVANLSLLERLMQDLFVLLPRDSTTVDLQELFFRYTIDSATDLLFGQSVGALKKSQSGLA

FADALQYALKAIPVRDMLGPLNAVYRDRKTDECNRICRDFVQQYVEEAVYAAGPKKEEKESRTTETKRRY

ILSHELASRTSDKQRMVDELINVLLAGRDTTGSLLGNLFFMLAKNPVIWAKLRAEVAVLQNRPPTYEELR

GLRYVQCCVNESLRLHPVVPTNKRKAMRDTVLPRGGGNDGLSPVFVPAGTLVGYNIYAMHRRTDFYGPDA

KEFRPERWEDGKLQPRWGYLPFNGGPRICLGQRYALTEASYVLVRMAQEFRGLESRDPGSWEEGLVLTVC

PRNGTKVGLIP

 

#19 55% to CYP584E4, 49% TO 52H1, 44% TO 584B1

47% TO 584E1

48% 584E2, 49% TO 584E2

>CYP584G1 BAE59590.1 [Aspergillus oryzae]

MAVSLSFLTYLFLIVAGVYLARKISRAVQIRQFKKRHGCLPPPRDHHKDPVLGLDEVRSMLRVFREDYLM

EYTLEKYRRHGNTFATSVLGDDDIFTAEPENIKTILAVKFKQFDLGETRRRTFHPLLGDGIFAADGPQWE

HSRTLLRPSFTRTQIAATDLHERHIQRLISRIPRDGSTVDLQELFFNLTLDTATEFLFGESVESLRLGSS

AGSSSFAHHFNVAQDEIAFSMVIAPFDQLIFRPRFRESVREARGYVGNFVKKAIEYRHSLDAEKHAGDTT

DSQSRYVFLEELAKETDNPSDITDQILNILLAGRDTTASLLSMVFYNLARRPDIWDLLRSEVATLDGKCP

SFEELKQLKYLSWVINETLRLYPVVPSNSRTANEDTFLPVGGGPDGKSPVFVAKGQRVAYDVYVMHRRHD

IFGPDAEEFRPERWETIRPGWGYLPFNGGPRICLGQQFALTEASYTTVRIVQSFKEITSRDPEPYRERLA

LTLASRHGTKVAMVPA

 

#148

46% to 595A1

>CYP595B1 BAE58469.1 [Aspergillus oryzae]

MFGQIFSSVFAWTLIAILAGLYRFTTKQRPIFPVVNDYRGDFFRRKAYREYNQNAKKLIVDGLAKHGSPI

TLRVPDGLKIVLPSALSEWVKTNRDLDHQELIREEYFAGFPGFEAQDTLHAPDGMLIKLLRTNLSQNEEI

VPTVNRHIGPALQHYWGDSGIWHTIDWEDDTTGIISRAAASIFVGPEKAADDEWQTVVQAYVREYFAAVS

ELHTWRASLRPIVQWFLPHASACRRLLHQSRAIMQEVVRKREREAQAAEDQGLVAPRYNDVLAWTMQVPD

NKHPAGDIQLALAMAALFTTTELFKQILINIARHPELVEPLRKEIKTSLLGHGLGLTALAKMELLDSVMK

ESQRQIPVTVGLERKVIRDTSLPDGTKLPKGSHIMVDATDMWNPEVHVNPEVFDGYRFLKRRHAGDKASQ

FVQSSREHIVFGGGRHICPGRFFAGTELKLCLAHILLKYDIRLKEGYYPQPMVLGVYAIVDPMTQLEVRR

REHTEDLVF

 

#145

72% to 613C2, 51% to 613A1, 50% to 613D1, 39% to 613B2

>CYP613C1 BAE56604.1 AP007154.1 [Aspergillus oryzae]

MLWILVAVVVIVGISSPFTRRITIEILSTILD (0)

90386 RYLRSRFPIFSVDGSRTLPTCPYKWPNGQGDVAKFLQGIENRDLWEKEHGQ

IYRIWSGMKSEVVLTQPSHLQAVFRDSNKHSKAENNNSGYL MSELLGQCVGLVSRERWRTLRAVTEIPFQ

HDKMPSYLELIQRHTRHHFDRLLASGDLRQERIHPAQDLKMLPFWVVAEIFYGECDAEMKTELQQLCVLR

EDLFKRMIQGGIVRWQWSKYLPTATNRALAEFQRRWRAFNQRAYDRACQQQRILPIVLMIEAAREGSTSV

EQIYQTIDEALFANLDVTTGGISWNLVFFAAHSDIQERVRQEVLSATDHDAYLLSSSTLLAACISESARL

KPLAAFTVPQSAPTDRIIGGYNIPAGTNLVVDTYALNIRNGFWGADSQCYRPDRFLEHRATELRYQYWRF

GFGPRQCMGRYVADLVIRTLLAHLVAHYELGWVEPDPGKNSTWQRDLESWITIPDLQLRCVQRRND

 

>CYP613C2 AAKD02000041.1 Aspergillus clavatus NRRL 1

note: a (-) strand sequence 72% to 613C1 is upstream of the pseudogene CYP-un3

49% to 613A1

MPWIILALPVLVLVTLLPRKVTNSIFSAIID (0)

24668 KYLRWRYPIRSIDGTHTLPTCPYQWPNGQGDVGKFLQGIENRDAWEKEHG

KIYRIWSGMKPEV (2)

VLTQPHHVQSVFRDSNKHSKAENNNSGYLMSELLGQCVGLISQEPWRHLRAVAEVPFQHD

KAPAYVQLVLRHIRQHFSSLHVHGDLQQGRIHPAQDLKMLPFWIVAEIFYGEIDIAMREE

LQQLCLIREQLFRRMIQGGLVRWRWSRYVPSATNRELTDFKSRFRRFNQQAYQHACNQNK

WSLPIVSMTEAAQSGKVSLEQIYQTIDEALFANLDVTTGGISWNLVFLAAHPEIQNRVRD

EAQTATACEAYLLSSSTLLAACVLESARLKPLAAFTVAQSAPTDRTVEGYCIPAGTNIVV

DTYALNIHNEFWGTDSQSYRPDRFLKHRATELRYQYWRFGFGPCQCMGRYVADLVIRALL

AHLVENYTMGILDGDEDKWKRDSESWITLPDMQLKCEPRDVPMTKL* 23208

 

#144 50% TO SEQ 145

47% to 613A1, 48% to 613C2

>CYP613D1 BAE58578.1 AP007155.1 [Aspergillus oryzae] short at N-term

         MGFSIQHGLTKPEILYPFLFGIFAVASLCIATLLFPASFSAASRVISWVLS (0)

4127460  IYLELKNPIRHTETGRNIPGPSYVWPNGQGDIEKYVQGRSRSEQWQRKYGNVYRIWAGMTPEV  4127272

4127213  VLTRPEQLHAVFKDSDKHTKATNSDSGYF

MSRILGQCLGLMAGPRWKLLKGTAAPPFMHPTAVRSIGRIQEHVRAHFHDLETNGNLREGRIHPVQDLKM

LPFFIVAEANYGSLTPAMKSELDSLAPARENLMKFVLFGGLARFNISRFFPTEANRQLRRFRSQWRAFNR

AAYERAREKHPSAMVVQMYDAVHKGVLTEEQVAQTMDETLYANLDVTTGGLSWNLVFLAANPACQARLHE

EISALTPAEEEGYISRNGTYLAACVLESSRLRPALPFTIPQSAPTERVVDGYRIPAGTNYVVDTWGLNVR

DEFWAPDNSTYRPERFLNSSNTDLRYHFWRFGFGPRQCIGRYTADVVIRAILLHLVKHYELQMLEEGDFT

QDPECWITHPDLQVKPN

 

#98 53% to 617D1, 63% to 617D2, 54% to 617D3

 

>CYP617D4 BAE57429.1 [Aspergillus oryzae]

MMGLPWATVYIVIAGYAIAKSTFGNFILLSILVSLLKVFYNWVLYPDFFTPIKKIPSPPGRSWITGNSDT

VFLEAPYEHMRKWLENVPNDGLIRYYVSINLERILPVGPRALKEILVTKSYDFPKPEFIRASLKRLAGEH

GLLLVEGDDHKKSKKNLLPAFAYRHVKEMYPIFWSKSIEMVRVMDEDLRKKADPTDNVLRMGAYASRAAL

DIVGVAGMDHDFQSLRDPNNKLVRTYQNLMSEPPLYMKIIFLLTLLLGDPAVVHDLPLERNRSIERSSET

IRDVARQMIRQKRAKWESGSSTAEDIDIVSVALRSGNFTEEELVDQMMTFLGAGHETTSTALQWCVYVLC

KHPDVQTRLREEIRANLPPISTENPQPPAATDIDNLPYLNAVCNEVLRYHPSVPATIRCASRDTTIIGEP

IPKGTLFLIAPEIIGKSKELWGPDADKFNPERWLGPGRANNGGADSNYANLTFLHGPRSCIGQGFAKAEL

ACMVAVVVGKYHMELKNPNAPLEIRQQATVCPKDGVLAKFTNIEGW

 

 

#92 52% TO SEQ 30, 48% to 620E2, 46% to 620E1

 

>CYP620G1 BAE59625.1 [Aspergillus oryzae]

MMYTLSTLVFLAGILGLYVLLNSKAPRAPLPPGPKGLPIIGSVGSDLPRGGRDWEHWLKHKELYGPISSI

TTAGHTHIILNDANVATELLEKRSARYSSRPRLVMANELSGSDIFVTTQNEHAIVRALRKRILSQLRSEE

VLLSFYPQVDTLIRRFLLRTLQKPEELIGNIKTGIGGVILKVVYGYTVEFHDRDPLVDLVGETAVAFGRI

NQPTGYLVDSIPAPLSVKYLPSWFPGAGFKKEAREYRRGFDTLLNWPFTFARRQMEEGNYEPSFVSRLIE

QRGSLLSLEEEVKIKHAAAAVYQAGYDTTASTITSFFLAMALFPAAQHKAQEEIDRVVGARLPTPEDRGK

LPYVNALINEVLRWNPVAQIGIMHAATEDDIYEGYLIPKGAPIVPNIWAIAHDPDVYSDSMSFKPERFLA

SDGHTPERDPHTLVFGFGRRICPGRPLTDFNNFLTIARSLAVFQVQKATKDGKEIDPIVDYQGGIIGHLS

PFEVSIRPRSAEHEALIRSIEVEDSISRGDSAALESVRV

 

#29 69% to seq 31, 53% to 620E2, 49% to 620E3,

48% to 620G1

 

>CYP620H1 BAE60302.1 [Aspergillus oryzae]

MMLVVSLLLGLTGLYIIRWTLGERKTLKRLPPGPTSKPVIGNLLDLPSPGTPDWLHWLKHKELYGPISSV

TIFGQTIVILNDRQTVIDLMEKRSGLHSSRPQLPIAEITDWDDTLGLIPYNSRFRAYRKALHQEMGTPAS

ILKYHDIIDMETHRLLFRILENPEDLVQHIRKEAGSIILRVGYGYVTEPHARDPLVDLVDKAMEDFSQLV

LPGAWLVNFIPMLKYLPSWFPGNGWQETAKAYKKRVTAMRDVPYTFVQRQIKKQNHVPSYVSSLLEQGNV

EPGSEEEIVAKWSAQSLYGGGAETSVSSLACFFQAMVLNPNVQKRAQEEIDRVVGTSRLPDMSDRENLPY

INAVVKEVLRWHPVTPLGVTHAASEDDTYNGYFIPKGSILVSNIWAIAHDPELYHDATEFKPERFLGVNG

RTPEYDPHLLSFGFGRRICPGQHLAAANLYLAIARSLAVFDITHLVKNGKEVPVTPEFTTGIISHPAPFE

LSIRVRSPEHEKLIRAVEKSYPWEKSHAEELQLKI

 

#31 69% to seq 29, 49% to 620E2

 

>CYP620H2 BAE61267.1 [Aspergillus oryzae]

MLVLVSLVLCLTGFCLLQWALKERKIVKGLPPGPRPKPIIGNLLDLPPPGALDWLHWLKHKELYGPISSV

TIFGQTIIIINGHRVANELMEKRSGVHSSRPHVPIAELAGWQYTLGFIPYDSRLRAYRRALHQEMGNATS

ISKYHNILDMETHRLLFRILKTPDCLMQHLRKEAGSIILRITYGYITEPEAYDPLIDLVDKAMEDFAQVI

LPGGWLVNFIPMLKYLPSWFPGCDWQRRAKAFKQRAKAMTDIPYAFVKQQHEQQKHIPSYVSRLLEQNNI

KLGSEEELVVKWSAQSIYGGGAETSVSVFACFFQVMALHLNVQKKAQEEIDRVVGASRLPDLSDCKNLPY

INAVVKEVLRWHPVAPMGVAHASSKEDIYHRYVIPKGAILVPNIWAMAHDPDFYHNAMDFEPERFLKSGR

NEQNPEYDPHQFIFGFGRRTCPGQHLVSANLSLGVARVLAVFNITNAVRDGKKVPISPEFSPGVISRPAP

FELSIQVRNAECKRLIEAVGMKFPWEESHAEALAQLRI

 

#30 55% to seq 29, 56% to 620E2

 

>CYP620H3 BAE55186.1 [Aspergillus oryzae]

MPLPTLGSVLLGLAFLYFVKLVLLRKKTLAPLPPGPKPKPIIGNLRDLPRPGQQEWTHWLKFKELYGPIS

SVSMFGQTIVILNDHQAAFDLMEKRSAIYSSRPRLVFAAEIVGWEDVITLQGYTNRFRSYRKAMHRVLGT

KELMSRFNPLQDVEVRRFLLRILQKPDELIQHIKTEVGAVILKIAYGYNIEPHGRDPLIDLVNDSMENFS

AVVKPGTWLVDVIPLLKYLPTWFPGAGFKRTGYEWRKTLLATIEKPYQLVKQHMRQGSYPPSYLARLLEQ

IDGEPTAEEELVSKWTAGALYAGGADTVTPTASSLSSFFLAMALYPEVQRKAQKEIDRVVGPNKLPTFED

RDTLPYIDAMVKETLRWHPVGPMGVAHLVTEDDIYEGYLIPKGALILPNIWGFTHDPKIYRDPETFRPER

FLGDNPELDPHTLAFGFGRRICPGRLLADATIFLTIAQSLTVFNFSKPEGEGDLKAEFLPGVISHPAPYR

LEITPRSAAHEALIRSVEVEHPWEESHAKELEKVEC

 

#28 50% to 620E1, 53% to 620H1, 56% to 620H3, 49% to 620H2

47% to 620G1

>CYP620H4 called CYP620E2 but changed BAE62129.1 [Aspergillus oryzae] revised

MASLHLASIAIGVLTAYLLTKLLTFKKPPAPLPPGPPPKPIIGN

LKDLPQNGERDWEHWLKHKELY (1)

GPISSITVLGQTFIILNDQKLAVELLEQRSKWHSDRPKMFFAAEM (2)

SGCGGILGLIPYSDRSRAIRKAMN

KEIGSKVAVSRFNALQEAETRRFLLRVLEAPEELRNHIRTEAGAVVLKLAYGYTVEPH

KQDPLVDLADVSMYYFSLVCRYGAWVVDVFPSLRFLPSWFPGTEFKRIGQRSKEAFDN

FGGKPYNFVKHQMSQGTHHPSYLSSILESEEIEPGSEKEYVTKWSAASIYAGGADTTV

STMASFFLAMALYPEAQRKAQEEIDRVVGNSRLPTFADRDNLPYINATVKEVLRWHPV

VPNNLPHLSTHDDMCQGYFIPKGSIVISNIWGFAHDPDVFHDPMTFKPERYLGDNPEP

DSHRISFGFGRRICPGRVMADAAIYLNIAQSLAAFNIGKKVVDGKEVEPRVEFQAALI

SHPEPYDVSIKPRSSVHEELIRAVEEEYPWEKSHADELVNIKV

 

>CYP620H4 AP007164.1b Aspergillus oryzae CYP64 like

formerly CYP620E2

second P450 of six on this accession

seq assembly modified at cyan region

CDS             complement(join(1111497..1111884,1111943..1112214,

1112271..1112515,1112568..1112719,1112780..1112971,1113193..1113425))

53% to CYP620e3

MASLHLASIAIGVLTAYLLTKLLTFKKPPAPLPPGPPPKPIIGN

LKDLPQNGERDWEHWLKHKELY (1)

GPISSITVLGQTFIILNDQKLAVELLEQRSKWHSDRPKMFFAAEM (2)

SGCGGILGLIPYSDRSRAIRKAMN

KEIGSKVAVSRFNALQEAETRRFLLRVLEAPEELRNHIRTEAGAVVLKLAYGYTVEPH

KQDPLVDLADVSMYYFSLVCRYGAWVVDVFPSLRFLPSWFPGTEFKRIGQRSKEAFDN

FGGKPYNFVKHQMSQGTHHPSYLSSILESEEIEPGSEKEYVTKWSAASIYAGGADTTV

STMASFFLAMALYPEAQRKAQEEIDRVVGNSRLPTFADRDNLPYINATVKEVLRWHPV

VPNNLPHLSTHDDMCQGYFIPKGSIVISNIWGFAHDPDVFHDPMTFKPERYLGDNPEP

DSHRISFGFGRRICPGRVMADAAIYLNIAQSLAAFNIGKKVVDGKEVEPRVEFQAALI

SHPEPYDVSIKPRSSVHEELIRAVEEEYPWEKSHADELVNIKV

 

#81 48% to 620E2, 46% to CYP620H3

 

>CYP620J1 BAE60640.1 [Aspergillus oryzae]

MSYMVLGLAIGVIFLYFIRSFLARTKSFAPLPPGPRPKPIIGNLWDLPPQGTRDWLHWLKHKDLYGTYSQ

HRHIATTDRLRKNSGKAQLAPSPSWRSVPPYTHLDRRAPLPICKHRLFTTYTAGYGDIMTILEYSERLRT

TRKVAHQQIGSNKAISRFSHIQDAEVCRYLLRMLRDPGNWLEHIKKQVETGAVILKITYGYTVEPHGRDP

LVDLAEDAVGKFSLAMVPGAWLVDSIPICExxxxxxxxxxxxxxxxx

SSFYSVMEHVEAVRGQQKQMTQGSNVPSIISYYLESENIQ

PGSEEEHLVKWATATLYGGGADTTVSTMMCFFLTMALYPHVQRKAQEEIDRVVGATRLPGFEDRGNLPYI

DALLKEALRWHPIVPMGVAHMAMEDDMLEGYRIPKGAAILSNIWCVRPRTPYFLLLTKLPCRAFTHDPNE

YHDPMTFKPERFLSDNGHTPERDPHLLAFGFGRRVCPGRNLADSNLWLTIARTLAAFNIAKPIRDGKEVD

IQPEFQAGLISHPEPFDVDIKLRSAGHHELILAGEKQYPWEESHAEELRRAIAVL

 

#27 51% to 620E2, 51% to 620H3, 43% to 620E1

>CYP620K1 BAE64937.1 AP007171.1 [Aspergillus oryzae]

14 P450 genes and 2 pseudogenes on this contig

MESILLFLTISLVGLYLVGSHLSKKHSLGHLPPGPPRKPIIGNLTDLPSHDVCDWEYWLKHKDLYVYSAT

TSSSSMTPASHETYSRSALPSGPPDPVGTLSRAGWNKILGTLAYSDPSFKDMRKAIGHQIGSKTAASRFN

AVQDLEVRRFLLRVLEDPDNLLQHIRKVAREAGAIVLKIAYGYTIEPHGHDPLVDLADEAMATFGLAILP

GTWVVDFIPILKHVPTWFPGAQFARMAKQFRKSAAAFSDVPYAFVKRRLAQRDFEPSFLAGLIRKNEEQP

GPGSYEETVIKWAAASFYGGGSDTTVSTMSSFFLVMAQYPHVQRKAQAGIDCVVGPDRLPSFQDRENLPY

IYAMVKEILRWHPVLPMGTAHASVMDDTYEGYTFPKGTLMVPNVCWVVQSLGDNSAFTHDPSTYPDPHTF

KPERFLSYEGHEPEANPYYLVFGFGRRVCPGRTLADANLYISIAQSVAAFTITKPIRDGKEVDLRAEYQS

GAISHPVPYNVTITPRSPRYEELIRAVETEHPWEKSHSEELRLV

 

#139

47% to 628A1 Fg, 45% to 628B1

>CYP628C1 BAE61392.1 [Aspergillus oryzae]

MDTLWVLAFSSGVATHLLLYRSGEWDIKAPSIVKIYTLLGATLVYLERADLL

DGFPVSTRPKWGIAVILYHIFGVYAS

MLFYRAFWHRLCGFPGPFLARLSNFYVTSLSAKRLHLYEEVQKLHQQYGDYVRLGPTELS

IADPQAVKALYSGQAKVTKGPWYTVLEPRVSLQMSRDKKEHARRRKVWDQGFSSK (1) 891591

891531 ALRDYEPRVSHYARQLLEAVR

KNVGKPMDMAKW

FNYYSFDVMGDLSFGKSFNMLAGGQDTYFSTQLHADMKSIGLFSHLTWLFPFFKRIPILNKDYLKFWDWV

GGRVEERIK (0)

891143 NEPDRPDVFSWILDAFQNGPKTKQDHLDLHGDAYLIIVAGS (2) 891021

890959 DTTAATLTNLFFHLAADHTWQAKLQEELDALPDLTQEKVTNVKLLDALINETLRLH

PAVPSGTQRLTPPEGLQIGDKYIPGDVMVCIPTHTLFRDERAFVRPDEFLPQRWMTQPELVKDASVFIPF

NAGPYSCVGKQLALMELRRVTAEILTRYDVEFAQGQTTEDFLDGKRDTFTLVTAPLKLVFRER

 

#56

 

>CYP630A3 BAE62007.1 [Aspergillus oryzae]

MPGIYVLAAAGALALGVGYVVILPIIHYFYDPKGFRKYPNFAPLAGITDLPYCYLSSCGYRSKDLYEAHK

NAPILRIGPNNLSFGRIGAVKDIYGHNTPCIKDIKYAMTWGSHTHLFDVIDKADHAAKRKRMSSAFAIKN

SERWEHKVANVTGRLVKALDAHCTLPLLPGQTEPQAADVTLDYNKWINLFTIEAINLIALSSTLGLLEKG

SDEVTAQRKDGTTYPARYRKSQDSTAHAQSLFVWDYKYFHWLSRLSKLVPKYRQMWKDGEPWGDVIYHQA

VTRLQRYQSGEKLDDFFSSLMEDKAGHPNNLEWGEIVAEVGAIINAGADTTAIALTQVLDILIRHPKYLQ

RLREEVDSTLDADEVVAPYDKVKNLPFLRACLDEALRLIPPTSAGLPRRTPPEGAQILNEWIPGDTSVSM

TSYSAHRDPEIFPVPEEYNPDRWMDLDNRKRMEPYFVPFSTGARGCLGRNITYLEQTVVLATLVHRYDFA

VPANWKLGRFEAFNLIMGEMPMKIWRREKA

 

#13 59% to 630B2

 

>CYP630B11 BAE66547.1 [Aspergillus oryzae]

MYSLLLIVTLHFLLIYYIIIPIINYFRDPKGLRKYPNLTFVSGISDLPLIYYSHKGIRSRVLFEAHKKHP

VLRIGPNKLSYADPVAIKDIYGHGTKCTKDVFYSALSGSHYHLADVVDKEDHARKRKVLSNAYAIKNLEG

WEYKVADMTQRIIKAFDERCTSPLPKGRNPDPQDLTIDYRMWTNLYTIAAIANIGLSEDIRFLDQGNDII

SSEAKDGTVKKVHFRDCLYANASATSTLVWAYDWYEALVRVSKLVSSTYRQKWKLAEDWDGIVNNRATTR

WKRYEKGEKLDDFFSALMEDKAGAPNNLEWGEIVAEVSIMMNAGSDTTGISLNNVMLLLLKNPHCLEKLR

EEIDGVLEDDEVIAPYDKVKHLPYLRACLDENMRMYPPVSFHVPRRTPQEGTMIRGEFVAGNTSVGISAY

VVHRNEDIFPDPDTYKPERWLGDKGRDLQPYFVAFSAGARGCIGRNISYLEQTVLLASLVHRFEFALPSP

SWEPVRHETTNFNSGPMPLKVWRRASRVYEDN

 

#14 57% to seq 13, 75% TO SEQ 69, 77% to 630B2

 

>CYP630B12 BAE65338.1 AP007171.1 [Aspergillus oryzae]

14 P450 genes and 2 pseudogenes on this contig

MWSALSIAPYALVLGLFSLLYFVVFPWVEYIRDPKGLRKYPNMNPFSGMSAVPFMLLASRGFRSKELQEL

HRTKPVIRTGPNMLSYGDVRAIKDIYGHNTKCIKDPSYIVTAGTHYHLADVVDKPDHARKRKVLSSAYAL

KNLETWEHKVSDKVEKVVAHFDKVCTAPPSAAVAAGKMAPDPKDLTVDFRAWTNFFTLDAIADIGLSEKL

GFLDSGSDVCIAERKDGSTYEVNLREALYPTARKQSLILWNYEWYPVLNKMVNIIPFFNRMQNSSDNWDN

IVWRRSMNRLRRYEAGEKLEDFFQAMMEDKNGRANNLEWGEIVAEMNIMMNAGSVTTAIAIANVMYQLLR

NPQSLKKLQEEIDAVLDADEIVAPYDKVKHLPYLRACLDESLRIFPPTSHGLPRETPPEGMEILGEWVPG

NTSVSMSAYVAHRDESVFPKADQYIPERWLGEEGKALQPYLIAFSAGARSCIGRNISYLEQTKILATLVH

RYDFALPYPGWELKRLETMNLILGDMPVKVWRRNVQEA

 

#69 75% TO SEQ 14, 62% to 630B7

 

>CYP630B13 BAE63103.1 [Aspergillus oryzae]

MLSLVLVAPYAAVGGLCTLLYFFVFPFIEYIRDPKGLRKYPNLHPISGMSVLPFMFMASRGARSQELSEL

HKKSPVIRTGPNTLSYGDVRAIKDIYGHNTKASKDPSYIVSAGTHYHLADVVDRADHARKRKVLSSAYAL

KNLETWEYKVSDKIERLVKHLDKCCTAAPVSGGRAFVPSSEDLTVDIRAWINFFTLDAMADIGLSEKLGF

LDKGNDICVAERKDGSTFECGLRDALYPLAIKQCMVLWNYEWFPIINKLVDVFPYFRNLQKKGDAWEHII

WRRSSERLRRYEAGEKLNDFFQALMEDKNGRPNNLEFGEIAAEVNIMMNAGTVTTAIAITNVLYQLIRHP

EAMAKLREEIDGVLGPDEIVASYDTVKHLPYLRACLDESLRILPPTPHGLPRQTPPEGMEILGEWVPGNT

LVSISAYVAHHDESVFPQPHKFIPERFLGEAGKELGPYFITFSAGARSCIGRNISYLEQTKALATLVHRY

DFALPYPDWEPKRFESMNHILGEMPIKIWRRSFDG

 

#82 43% to 630B2, 48% to 630C1, 44% to 630B5, 43% to 630A3

 

>CYP630D1 BAE60571.1 [Aspergillus oryzae]

MALEKLFIVVFLCFALRPLLLYFYDSKKLRKYPNQNFLSGVTNLASIRERQRKFRTRELYLQHQKHPIIR

VAPNMLSFRDVKAIKDIYGFGSPCQKHEIYKLQNSEGHMNILNVIDREDHNRKRRMLSHAFSTKNLESWE

FKITDKVEKLVAQFDRRAHPPAWKNEPSQQNNTTVDVRYWLNLFTVDAIADIALSERLGMLESGSDVVKV

GGPGEEDSAHRFIEDMHEAARVKSKIIGTLDWYYVLKQVSSFLSSRCRSQWDCGGNVGQIVEHLAGKRLR

RHEDGENIDDFLSCLINDKAGKSRNLDIGELKAETSILLDAGSETTAIALTHLLYYLIKNPDCFVKLRKE

VSGAIAGDKVAPYAKVKSLPYLKACIEESLRLSPPLPRGLERVTPAAGAYIMGEFIPGNVGVSVPAYVAH

RDPDLFPEPEAFLPERWFNNENIGKMRDAFIPFSAGGRACIGRNITMIEQQILIATLVHRYDFSLASPDW

TLQNEEAFNLWPVELPVKIWERDLEA

 

#74

39% TO 630D1, 37% to 630B1

>CYP630D2P BAE62696.1 [Aspergillus oryzae]

AP007166.1 Aspergillus oryzae RIB40

Downstream from CYP551A2 (BAE62699.1) (145541-147583)  note: two other genes between these

This gene is a pseudogene missing the top half

136724  VQTTEYYRSLQEHGKDGCFDNTIFDSVLRSFAEIQEGSNLTKVQTEKLVDEAFAI

MFAGSDTTAFSLTITLVYLCKYPEKIVKLRREVQCLRDFKVQDIQLATISQMPYLDAVIREANRLSSPLS

TVLPREVPSTGCVISGHFLPKGTVVGFHLDDINRNPKFFPEPNDFIPERWSGEEGKKLQRWFVPFSKGSR

RCIGMDFAFVEMKLAVAAIISRFEIWLDNPNVTLNSREMFVKIPEDDLRIRLRAITV

135844

 

>CYP630D2P AAIH01000541.1 Aspergillus flavus NRRL3357 pseudogene

same gene as Aspergillus oryzae BAE62696.1, 97% identical

runs off the end

418 VQTTEYSRSLQEHGKDGCFDSTIFDSVLRSFAEIQEGSNLKVQTENLVDEAFAI

MFAGSDTTALSLTITLVYLCKYPEKMVKLRREVQCLRDFKVQDIQLATISQMPYL (0)

DAVIREANRLSSPLSTVLPREVPSTGCVISGHFLPKG (0)

TVVGFHLDDINRNPKFFPEPNDFIPERWSGEEGKKLQRWFVPFSKGSRRCIGMDFAF

VEMKLAVAAIISRFEIWLDNPNVTLNSREMFVKIPEDDLRIRLRAITV* 1301

 

#23 52% to 631B1, 43% to 631A1

 

>CYP631B2 BAE65443.1 [Aspergillus oryzae]

MRRALHVAQVRGLATGQCRPRVQASRSIIRPREEPFRSSVMLILLGLLCLYTGLYVARTYWRLRHFPGPL

VARFTDLGRLWWVKTSRSHHHHMGLHSRYGQYVRLGPNMISISDPDAIPLVYPIRPGVPKSDFYRSMMPY

TRKGRSLPLVFNTRDEDLHKRLKTPIAHLYSLSNILTFEAFVDQVLEILFRQFEERFVPDQAPFNLGNWL

QYFAFDVMGTMSFSRRYGFLEKGRDDTGLLSAIWAFMKAAAPVTQMPWVDLVWNKNPFIALFRATPAQPI

LNVVLSRINDRRNELYSTTSTPEKVNERDFLSRFMHIQSNSDTIPPWAVTAWSFSNVIAGSDTTAVAMKT

LWY

NLLLHPATMHRLRKELVQAQQQSKLSHPFPAWNEISGLPYLNACVNEALRIHPPFCLPFERIVPAEGMTIGD

HFFPGGTVIGMNPWVINRHRPTFGEDADAWRPERWLEDPARTRQMEN

TLLSFGAGRRVCLGKNIALLELKKLTSALVLHYE

LEIVNPEKFQSQNFFFFKQEGLYAAVKRRSAGSPELYPDDAVPH

 

#156 52% TO SEQ 23, 56% to 631B1

pseudogene

>CYP631B3P BAE56559.1 AP007152.1 [Aspergillus oryzae]

24632 NLLTHPATLQALSSELITANLTLPYPKWNEVCDLPYLDACIQEAVRLHPPF

ALVLGRVVPAGGVTVLN

HYLPEGTLVGGNPYVVNRHAETFGPDVEEWRPERWLEGEGRKRLEQS (0) 24285

FDAGRRVCLGKYIGILELKRLVPFLVLKYD (0)

MKIIDPERFSVENGFFFKQRGFYCNITRRKEGSDRDKADPK*

 

#138 46% to 653A1, 51% to 653A2,

 

>CYP653B1 BAE61541.1 [Aspergillus oryzae]

MDYMDYLKEMGLAWHWVPIFVGLLAFYFIMERSTANASRTSLPIVKHFKLLPPFFNRILYVVKAPFLIYY

GYEKYKSKPFRILKLDGDLVVLPQKYLEEVGGLHSRQASLVGAKYKNILGGCTNILINSELPARTVSEKL

NPVLDRQIPRLLFELHHAFSAVVPYCEGRYVPINLYHMILKLVTHSTSRIIIGQRLCRSEQWINTITKCT

YDVRIAVKQLQLVPRFLRRLVAPFLPSVQRLETQLRWIAEQLILPMIQHRRRRELNDPSYKKQEDFLQWM

MDLADNDLDRDPMNLAYGLMITMALAVVQTSTMLITHAMYDLMVHPEYLEPLREEIHETLTNGWIRASLS

DFGAQRRLDSFLHESQRLNPPSEVSAQRVLGRPLTLSDGVTLPKGTHVCFPSGPMSRDPTVVPDPLTFDG

FRWCKDLNAPDGSLTDVSPANLHFGFGGQACHGRFFGAVIAKAVMSRLLAEYDLKFEEGQSGRPENIVNG

EQIMPSISTKVLIKKKNVDI

 

#117 40% to 653A1 45% to 653A2, 41% to 653B1

63% to CYP653C2 from an indole-diterpene gene cluster

note the other P450 in this cluster is CYP698A1

The ortholog of 698A1/paxQ (698A2) is 4 genes upstream of this gene

>CYP653C1 BAE65194.1 AP007171.1 [Aspergillus oryzae]

14 P450 genes and 2 pseudogenes on this contig

1897240 MDKLTATLAKVNYPSEVENGSMLLVVTLVILFLWFIIPSPVKRSNVSVPTVTLFNPYLPEFLSRVWFNST

AATVIYKGYRQHKDRAFRLLKPDGDIIVLSNKYVEELRQLPLTTLNALEAVFEDHVGKYTTILNDSHLHT

EVIQKRLTPAISRFIPRIIDELDHGFAVEMPECEDKWALIRPYEVFLRLVARAGARVFVGPEICRTEKWL

TASIDFTKNIFMTITLLRPIPSFLHPIIGPMLPSSRSLDTQLRYVQDELLGPEIVKRRQRQASGDPDYEK

PDDFLQWMIDLAQNDKEGDPGNIAHRLLGLTSMAVVHTSAMSITHGLYDLITMSQWLEPLRQEIQEAMPD

WKSSSYSSLVSLRRLDSFLKESQRFNPPGELSFHRVVKKDLVFSDGLRLPKGTHICMASGPIGMDTKYVS

DPTTFDAFRYVDGDKAQSQFVHTSATSMHFGLGRYACPGRFFATFVLKAILSRFLVEYEFRFGPDQVGRP

KNMLLGDKIVPNTSVDVYVRKRTGSRSTA 1899076

 

>CYP653C2  Penicillium paxilli

           GenEMBL AF279808

           paxP gene

           part of an indole-diterpene gene cluster, also includes CYP698A1

MDLSDFHISTPLRYFHEEASLLWKLGVFAVLVYFLLPKPTYKTN

VKVPTVKYMGPWMPEILSRIFFNSHAPTVIYKGYEKFKTSAFKVVKPDGDLVVLSTRY

AEELRQMPSTTLNALEATFTDHVGGYTTILTDSHLHTETIQKKLTPAIGRLIPRMISE

LDHAFEVEFPTCDDQFASINPYTVFLRLVARVGARIFIGDELCREEKWLQASIDYTKN

IFLTIALMRPMPGFLHPIVGRILPSSRSLKDQLSYIQQDLLGPVIKERRRLEASSDSE

YKKPDDFLQWMMDLAQNENESHPDNLSHRLLGITSMAVVHTSAMSMTHILYDLLTMPD

LIEPLRDEIRNEIKDWNKATQADLSRLIIMDSFLKESQRLNPPGDLSFHRVVKKDLTL

SDGLFLPKGTHICMAAGPISKDPDVVSDPDTFDAFRFVKQRTATSGFVSTGPNNMHFG

LGRYACPGRFFAAFVIKLILSRFLMDYDFKFETEHKERPKNLLIGDKIVPNVATPILI

KRRATKA

 

#122

40% to 654A1 just upstream of #121

>CYP654B1 BAE64653.1 [Aspergillus oryzae]

286826  MDLFPRDYLFAGLAVFIFWWIIDHSRHKQRYIRNVPIVGGKANLKRNRQKFVTNSLQILRTGYEE  (0) 287020

287082  NNDELFYVPTPIGERLIIPGRYLEELKSADMAVVDFQATFLE (0)  287207

MFEGAYTTLGTHSRLLPQVVRAQLNQYLPDVLPEIQFKVALQIHREIPFNAITECFAKSDWTVINVTELM

AVLVARVSSRMFGGPALSQNREWIEASLRFAHDGFNAAQKLKMWPDTLKFIGQHFIPEVRSIKNTYKIAE

RAIIPLLDEREVDKSKKAHDLLTWMYDQAQGAEKDKKFIAGTLLKVSFAAYHTSAAAPTQLLFDIAAMPE

HIAPLLGEYLSAPRDNNQNISVKGFAQMVKLDSIMKESQRFNPLLLLTFERIIKRDFTLSDGVVIPANTW

IGCAAQAIGMDRKLYPDPDTFDAFRFVAKEEATATSTSVPATKAHYTSANPGSMAFGYGQHACPGRFFAM

MEIKAIIGEILSRFEMRLADGEMRPPSVTFETQHLPHPAGKVLFKRRRCT

 

>CYP654B1 AAIH01000140.1  Aspergillus flavus NRRL3357

99% to CYP654B1 Aspergillus oryzae

      MDLFPRDYLFAGLAVFIFWWIIDHSRHKQRYIRNVPIVGGKANLK

      RNRQEFVTNSLQILRTGYEE (0)

      NNGELFYVPTPIGERLIIPGRYLEELKSADMAVVDFQATFLE (0)

4806  MFEGAYTTLGTHSRLLPQVVRAQLNQYL (2)

      PDVLPEIQ (1)

      FKVALQIHREIPFNAITECFAKSDWTVINVTELMAVLVARVSSRMFGGPAL  5162

5163  SQNREWIEASLRFAHDGFNAAQKLKMWPDTLKFIGQHFIPEVRSIKNTYKLAERAIIPLL  5342

5343  DEREVDKSKKAHDLLTWMYDQAQGAEKDKKFIAGTLLKVSFAAYHTSAAAPTQLLFDIAA  5522

5523  MPEHIAPLLEEYLSAPRDNNQNISVKGFAQMVKLDSIMKESQRFNPLLL (1) 5669

5722  LTFERIIKRDFTLSDGVVIPANTWIGCAAQAIGMDRKLYPDPDTFDAFRFVAKEEATAT  5898

5899  STSVPATKAHYTSANPGSMAFGYGQHACPGRFFAMMEIKAIIGEILSRFEMRLADGEMRP  6078

6079  PSVTFETQHLPHPAGKVLFKRRRRT  6153

 

#119 60% to 655A1 partial C-term seq

 

>CYP655A2P BAE65179.1 AP007171.1 [Aspergillus oryzae]

pseudogene

14 P450 genes and 2 pseudogenes on this contig

1863432 QGDVVQVNNNVMHRD

KDVWGEDADEFKSERWFGLRPYWDFVPHSGGPRRYPAQLLVTTEASYVVARFCQRSKAVENRDVNGYIPI

MRAGPVDSNGVKIAVTPV* 1863121

 

#152 49% to 655A1 C-term is wrong

 

>CYP655B1 BAE56825.1 AP007154.1 [Aspergillus oryzae]

MNNAISEPRITPSLRPSPKMQAPTLTSASAEGSDTTAHGCGGCTHFACQPIIMFTLTEYFIAACVWLVLY

KVGNLLWNRHH

YFKQQKARGCGEIKHYRHRDPILGLDFVYTLSKAFKEHRWLPWQQELFAAQGVKTFQAN

FLGSRAIYTSESENMKAMSTTYWREFGLEPLRRGSGAADPVAGPGVSTVDGPMWDFSRNIIKPYFTRDGY

SNLARLEVFVNRLLDLVPTDGSTFDMQPLLQRWFLDTSSEFLFGKTVDSLTHPENVKVAKAMVDTMRGIR

VRLTMSKLMFLHRDPVWMENVKIVRDFVDERIDASLTQLQDVKSGKGTSCTENQPDGRTDLLWDMVQQLQ

DKEALRGQIMAVFIPSNDTTSILISNAIYALARHPHVYQTLREEVLALGDQEITFEKLRG

717492 LRYLRYVINE (1)

717406  THRLYPNGIQMVRIALEDTTLPVGGGPDQSQPIF

717304  IQKGDIVHANRYLMHRDPDNWGPDAEVFRPERWGDVRPLWKFVPFGGGPRICPAHVLVDT  717125

717124  EASYVLLRFVQRFRTLEPRDERPYKAIMRIGPSNLHGVNVAVKTA*  716987

 

#79 52% to 657A1, 60% to 657B1

 

>CYP657B2 BAE61082.1 [Aspergillus oryzae]

MGKDGLSTDGLIQNAWSGSSELVWPLLATVLVLCCIATRIISGFQSRVDSKTEQPQSVKTLPYWFPWLGH

SLSFVWDHVSFTEKSRDYMNASVFGSYMGGTKHNTIVSPSMIKSIMQSKATTSAPLVNRALKAFGDDLGS

LRDLNTTDYQVFHHKLPNLLMREPFITEASETTIQLLKREVPNFVTFCRSVVDQTLWERGSDVEVVDDNG

DKPACEANLFDLVRGFIGNITTTTLMGQAILEAFPSLLDDLWVLDNRFPLLAIGVPRWAPLPGVPAAYAA

RDRILNSLAAYQQAFLQWDDGIDPGVKFRDLEDVSEPLKQRIRTSKNLGLSPRSSAPGHLSLLWAMNVNS

SNIAFWYLVRLYNDPTLLEEIRKEISPYVKAHRPSREETGFPFEEPPRISLNLKGLLDSCPLLKASFYET

LRLDSADMSFRKLTSDLTITESNEDVTNSDRTKPHSYKVYKGESLILHHGVLQNDSRCFSNPSQFDPLRF

IITDPETGEKKANMHTIHPFGGGMSGCKGRTFAERQLLAFTAAMIVMWDIEPMDGSHFTVPRHRQSSGAY

LPKNDIRGKTLWNVNNHGVVVFIRGGRHYLAPPMADRDLSFCITCRIYIVQNIHI

 

#131 61% TO SEQ 132, 40% to 660A1, 47% to 660B1

 

>CYP660C1 BAE63219.1 [Aspergillus oryzae]

MSDILSIIGLTLLVAFLTSVVFFVQRRKLDPREPPLASSAIPLVGHLASFLYYGLEYFAIARCVTRTIPS

LDGVEMLTAKLVSAVRRSRNAMSFGPLFANVAENGGGINGRGMQLLRDKEYGGQGVGQQTADSMHPALLG

SGLDQMNGKMIAVLKTIIDELASQPDNVVDLYEWCSHAVTVASTDAVYGPLNPYRSESNRRAFWAI ESNL

SLLMMNVVPWITARKPWKGREQLTQAFIQYYQADGHLDSSQLAYTRWKVQHEAGAAIEDIARLEALTALG

ILSNTVPTCFYFLFDIFSRPDLLGKIRDEILDGAFSVDSAGVHTLDLADIRERCPIFVSTFQETLRTRSN

SGQLRVVQKDTLLDDHLLVKAGSIILMPAAVINKHPSVWGADAGTYDPERFSKIDPAQKRSKASGFMSFG

SSPHICPGRHFASGEILALVAMILVRFDVRPVRGTWVEPKGNTKAVAASLPPAVEKVEVKFSETSKFAGV

KWEFRLTPGKGTFGLITG

 

#132 61% TO SEQ 131, 38% to 660A1, 56% to 660B1

 

>CYP660C2 BAE56717.1 AP007154.1 [Aspergillus oryzae]

382760  MSGSTTIVGLSVVAILASLLFTQRAKLDPREPPLVSSTIPLVGHLISFLIYGIGYFAT  382587

382586  ER (2)

VYIIASPDLLPSVRQNRSTMSF  382413

382412  NPLFTAMAQRAGGIQKPGLQLLREEELGGQGLAKKTVEVMRPALLGNKLDHLNEQMIHAL  382233

382232  KHIVHQVASSPTLPFDLYEWCSDALTVASTDAIYGPLNPYKSEAIRKAFW (2)

DFESNLSLLLVDTLPWLTCRKAWKGREQLVQAFIQFYQADGHLSASSLAYSRWKAQQEAGASLEDIA

RLEILTGIGILSNTVPSCFWLLFDILSRPELLSAIQDEIHQNALSIDSTGTHTLDLADIRGKCPTLLSSF

QETLRTRSNSGQVRVIYQDTLLNDRWLLKAGSTLLIPAPSINKNNSTWGSDAGDFDSQRFTKIAHQTHKK

SKASGFLSFGLSPHICAGRHFATGEILALVALLLVRYDIRPIQGSWTEPKTNAKAVAASLPPAAEKFMVT

AVERPEYKGLEWRTTVTPGKGTYGLIIGLDIYLQLSSVGEEMRRG

 

#57

 

>AP007151.1 Aspergillus oryzae RIB40 genomic DNA, SC005

CYP666A2

50% to CYP666A1 Aspergillus nidulans

join(3144893..3145283,3145344..3145394,3145416..3146254,

3146318..3146493,3146532..3146865)

model wrong, frameshift at 3146521

3144893 MLGIILFSLFISYTAYLGLCFLRHWSLARKIGLPYVSFPISSHN

        ILFLSLFETRFVPYVINTWLSPKLADFIYGSAFKTRWAARDRLHRRYGGVYMLITPSV

        STCMVCDASVASQICMSRHGFPKPIKQY (1) 3145283    

        GALEMYGPNIVT (0)

3145445 SEGSQWAHLRRHTATPFNERNSALVWEETIRQTKEMVQYWEDEYSRSSSASEFILTDTRED

        ILKFTLNIICSVGYGVKLPFRPGLENSTESAEGLFKDAITPLPGYHFTFRSAMEYLNK

        HITSMFIANGLLPKGIPRSVLPFFKKDFDAFDDIGRYLRALVSTAETKETLSQNLIDG

        LVRSKQKIDKDQGLDPELTEDEILGNLFVFTIAGHETTAVSLRFALVLLALNQDAQEY

        LYEGIREATYDEPRNPVEWDYRRVYPKLVSPLC (0)

        LETLRMYPPVSGIPRWTGDSAVN

        ITYHNQPYLLPPHVYVNVNASGLHYSEEYWGPDAAV FDPKRWDKR  3146521

3146521 NTRSFLAKNKEGGLSGPGLEYDTIHK

        PVRGSYIPFSDGFRSCIGKKFAQVEFVVAMAIIFREYRVMLAKSNERETEDDLRRRAE

        KALGESTAFITLSMRDEVPLLFQKRCVSKA* 3146865

 

>CYP666A2 BAE56143.1 [Aspergillus oryzae] assembly errors

MLGIILFSLFISYTAYLGLCFLRHWSLARKIGLPYVSFPISSHNILFLSLFETRFVPYVINTWLSPKLAD

FIYGSAFKTRWAARDRLHRRYGGVYMLITPSVSTCMVCDASVASQICMSRHGFPKPIKQYGALEMYGPNI

VTVRCPNVFRVSANVSQSEGSQWAHLRRHTATPFNERNSALVWEETIRQTKEMVQYWEDEYSRSSSASEF

ILTDTREDILKFTLNIICSVGYGVKLPFRPGLENSTESAEGLFKDAITPLPGYHFTFRSAMEYLNKHITS

MFIANGLLPKGIPRSVLPFFKKDFDAFDDIGRYLRALVSTAETKETLSQNLIDGLVRSKQKIDKDQGLDP

ELTEDEILGNLFVFTIAGHETTAVSLRFALVLLALNQDAQEYLYEGIREATYDEPRNPVEWDYRRVYPKL

VSPLCVMLETLRMYPPVSGIPRWTGDSAVNITYHNQPYLLPPHVYVNVNASGLHYSEEYWGPDAAVFLAK

NKEGGLSGPGLEYDTIHKPVRGSYIPFSDGFRSCIGKKFAQVEFVVAMAIIFREYRVMLAKSNERETEDD

LRRRAEKALGESTAFITLSMRDEVPLLFQKRCVSKA

 

#58

 

>AP007157.1f revised Aspergillus oryzae RIB40 genomic DNA, SC023

CYP671B2

join(618168..618393,618483..618641,618711..619251,

619318..619721,619797..620050)

sixth P450 out of 8 on this accession, one stop codon

55% to CYP671B1

MDFISFLHQENFKEVLETDLLQLGVS

AALLGVLLHITIFRTSFCVENHIYNLLGLYATVVLFLFYAYFTITVLSL

MQALGRVALLTTLFNTSLNTSISIYRLFVHRLHPFPGPFACKLT

RFYSAFLAAKNIQYNVELKRLHKQYGDFVRT (1)

GPR*ISILRNTALPLSYGPQTGCRRSTWYGHVDVDDTK

ICMALSHDFNDHRRRRRAWDRAFSIISLSVYEPRVIAQAKKLMAQVEANQGKPLDATT

WSMLFTFDIMGDIGFGKNFGNLTTGKAHPAISAIRDNMRVIAVVSHLPWLLNMLGKIP

GAAAGYQGFFKWCTDQVETKRK (0)

SWDHDEYPQDII

SWILKAFIDNDVSAPPSEPALHDDSRVVVIAGSDTTALALASIIYFLAKHPQILQKLQ

AELDNAMPNGPRSWTYDKAKTICYIDDIIHESLRLRPSVSGGGYRVTPAEGLQIDEVF

IPGDVNVFVPQQLIQTDERYYKFSKEFIPERWGEKKVEWGTDKAPYFLFSLGIYGCVG

KNLAMLSLRVAVSTLAQRYDIRFRTGDILERCIGYIHHFSAAFASCVSPKEIVNTTPF

LRLLQVFFILHISGVKVRT

 

>CYP671B2 BAE58815.1 [Aspergillus oryzae] assembly errors

MQALGRVALLTTLFNTSLNTSISIYRLFVHRLHPFPGPFACKLTRFYSAFLAAKNIQYNVELKRLHKQYG

DFVRTALPLSYGPQTGCRRSTWYGHVDVDDTKICMALSHDFNDHRRRRRAWDRAFSIISLSVYEPRVIAQ

AKKLMAQVEANQGKPLDATTWSMLFTFDIMGDIGFGKNFGNLTTGKAHPAISAIRDNMRVIAVVSHLPWL

LNMLGKIPGAAAGYQGFFKWCTDQVETKRKVLSPRYAFGLAVDETSVYPDATQQSWDHDEYPQDIISWIL

KAFIDNDVSAPPSEPALHDDSRVVVIAGSDTTALALASIIYFLAKHPQILQKLQAELDNAMPNGPRSWTY

DKAKTICYIDDIIHESLRLRPSVSGGGYRVTPAEGLQIDEVFIPGDVNVFVPQQLIQTDERYYKFSKEFI

PERWGEKKVEWGTDKAPYFLFSLGIYGCVGKNLAMLSLRVAVSTLAQRYDIRFRTGDILERCIGYIHHFS

AAFASCVSPKEIVNTTPFLRLLQVFFILHISGVKVRT

 

#77 43% to 673B1, 37% to 673A1

 

>CYP673C1 BAE61747.1 [Aspergillus oryzae]

MTLLQNIVSETPLAAGSALLTAIIVAYVIYQRYLHPLAKYPGPFLASITDLWQVHQFLSLQQPYNLTALH

ERYGPIVRYGPDKLSITHESAVPTIYQKSAKSMPKTEFYDAYGAAHPNVFGMRDEVMHSVRRRHMSHSFS

LSYIKEMEEYLDLNIRILKDKIRYHSEIGEVFALKKALHYYMIDVLGELAFSRSFGVQEADDESRIPPVI

EHSLLAAVTGAWPTMTMTLKRWLPYMPHAGLRRLFAGRKACADLASSSVQRRLRDLNDGESSVGVQNRKD

ILTNLIKAKHPETGERLTQTDLETEAFGFIIAGTHTTSATSTLLFYHLLHNPDFMRKCTEEIDSNLPSLG

PSETAYSITAAEASLPFLRNCIRENFRITPVFTMPLARRITDPAGVTIEGEHLPQGTSVAVCNHAFHHNP

VVWGEDHNIFNPNRWNDPNVGAKARLLMHFGLGGRQCIGKAVATTNIYKLLSTLLKEFTFELADEQERVD

VDKGLYKGRIPKLFSVGISDLQGPLLVRARVR

 

#106 63% to 675A1

 

>CYP675A2 BAE55129.1 [Aspergillus oryzae]

MDLLRLRDRSLLGQGALVAFVTYWAVWIIYTRWFHPLAKFPGPFWASVTRAWTLLHVLHGDAEKRQMKLH

AKYGLVPPGDILEPYLSSIGSVVRIAPNELVTSEPEAIQTLYGARSFTAKATLGYVRTQYYPQQRLIGVA

RFPDHFSSEGGKQHGERRRIVSHVYTMTSILQSEKYIEKCIAVWLEKLGQMADRKESFDLWIWTRMYAYD

VIGELYFSKMFGFLQAGHDHLGYIDATEDLVPIQFLAANMPTYVRGLFMLTGILFPKVRRALRALGDLTD

ATNAMLKDRLAAIQSDSEDKPQRHDILGKLLEISQKRGKELDFVLDDIKMESFGAFFAGSETTALTLSGI

LYHILRNRSVYEKLTAEIDTAVQCNQLSTPHISYNDAIKLPYLTACIREGIRMHPITGVSFPRHAPSSGC

TIGGYYIPPNARIGVNPGVMHFNKTVFGEDADQFRPDRWIDGDVSKMDRYIMQFGMGARTCLGKNISMCE

IYKAIPELLKFYTFELAGDEDMQTTSYWLYKPVAIDVNVRRR

 

#121 56% to 682B1

 

>CYP682B2 BAE64654.1 [Aspergillus oryzae]

MTLISLSLLALSLWIIIRVLVIIYRLAWHPLARFPGPKFAAATSAYEFYFDAIKGGQYTFEIGHMHKKYG

PIVRISPHELHINDPGFIEELYPGPGKPRDKYAYATGQFGIPDVCSLVLTPYDLSSVFGAVSHDLHRMRR

GALSPFFSKAAVTKLEPVIYSAVDKLISRIEEVVESTGFVDLTMAFSCMTTDIVTQYAFAESSRFLENPD

FTPNFHEAILAGTRMGSWARHFPILFPVLRSIPIDILSRMSPETGVFLRWQESMRKKVSEIWQDQSALPV

KDKNVSPFGSTIFHELFHSDMPDSEKHPGRMWQEGQIVIGAGTETTAWTLTATTFFILDNPNILSKLRKE

LAATMPNRYEKPSCRELEALPYLIIIQEGLRLSFGVATRLQRINSEAPMIFRQKKTNDTIEEKVWEIPTG

TPVGMTAALVHLNPELFPDPHEFRPERWLDQDGQLHRGLDKYILSFSRGSRQCIGINLAYSELYMGIGIL

IRRLGDRMQLFETDRTDVDMVEDCFVPVPRRESNGVRVRLSAQ

 

#105 68% to 682D1

 

>CYP682D2 BAE55187.1 [Aspergillus oryzae]

MVHPSVLVEALVMFRPIAQFLLFPPFCMFQFLFQPWIIALAGAGYLISLAVYRLWLSPLAKFPGPKLAAL

TLWYELYYDIYCEGQYTFQIIRMHEKYGPIVRISPWELHISDPDYYEVLYSRDSPRNKYEYYTRQFGLTK

TAMATVDHYHHRLLRSNMNPYFAMTRIRKLEPLIQGLVDKLCDRLREFKGTGTPVALQYPFTCFATDVVT

DYTMGAGFHYLDEPDFVPRWSRTLSGVAKSGVYIKPFPWLIKVFNALPESWLSWLNPEMDLTFHFQRRCR

EVIASIMEEQNANGYDKVKSQFSHPTFFHDVLNSNLPPEEKSPERLWQEVQVVVGAGAETTGKALTWTMF

YLLHSPDKLQKLREELNQLDPDRTATLLDFEKMPYLTSVILEGLRLSYGLSTRLQRVAPDRALQFREWSI

PAGTPVGMSSTLMHHDERIFPDSHKFIPERWLDLEQRKHLEKYMVAFTKGSRQCIGMNLARSEILLALPK

VLRELDFELYETTLEDVTLAHDMFLPFPKMDSKGVRVLIK

 

#59

 

>CYP684A2 BAE62328.1 [Aspergillus oryzae]

MDSGFIRDNIPAIASIAVLVYVLSVVYRSQRSHLSYLPGPWYTKFTDLPLRYKVVTGQRPRYVHALHDKY

GPVVRIGPDEVDVSDISGAREIHRIGSGFLKSPWYSLLNRKDTQSIFTTTDPKFHNAHRRLLSSPMSELS

LKSMEPLIDARVRLTIQKMQEEMKTRGVADVYKWWFFMATDIIGEITFGESFRMLEKGKKNQYVKDIEMI

SVIGGIRASFPILVKLATLLPLPIFKEVNASGNRVFGYATESINRYKRLLAENPENPKPTVFTKLYNAGE

EGLPDNEIRDDAQSFIVAGSDTTANTLTYLVWAVCRDPQIKKKLVDELAEIRDDFTDEDLRSLPYLNQVI

NEALRLYPAVPSALPRSVPPKGTTMGGHWIPGGSTVSTQLYSLHRDPVAYPDPEKFEPSRWASPTKLMKD

AFMPFGAGSRNCIGLHLAKIELRLATGYFFRYFPNAKLSSKYDFNDNDMEQMLFFLMSPKGKRCLLEV

 

#118

 

>CYP698A2 BAE65190.1 AP007171.1 [Aspergillus oryzae]

61% to CYP698A1 with some assembly errors

698A1 is from an indole-diterpene gene cluster

note the other P450 in this cluster is CYP653C2

The ortholog of 653C2/paxP (653C1) is 4 genes downstream of this gene

14 P450 genes and 2 pseudogenes on this contig

probable GC boundary after VTAE

frameshift after VETIL

1893711 MSRLLERTLDRFTGLLEYQPTYPFAAPTWVYLVGAILIQQLATRWYRYYKSW (0)

VNVPVVGGHGIIGSWIAAFWWTARARSLVNEGYQK (0)

HGDFAFQVSTPTRWEVFICNDEMVREYRNFTDERFSANAVTAE ()

LFEAKYTVPGAAEGVHKVPVPIVAKALTWQRTRAATKTDPYFEEFVKELQHAFDAETKFENED

WNDLCCFATGTRIVAHLTAKSLVGYPLSRDTELINLFAEYGNAVPTSGFFIAMFPQILKP (2)

FAAKFCSAPKISARLDRIVMDELRKREANPRSEPQ (0)

DITDWIMFWSRTYPGTYTDQDIARSVVSAVFGAIHTTTQ (0)

VLVHCLMDLAIRPEYIHPLREEVETIL

IGDNQQWTKEGLESMEKLDSFVKECQRFNPLDA (1)

GSLARRATKDFTFSKGLHIPE

GTFVFTPNSPVLFDEKHYPDAQQFDGYRFYRLGRVTGRPLEYKFIAANLKYLQFGDGRHIC (2)

PGRFMAADEIRLLLAHILVNYDIRPKDDGERPPNWTF

KKILFPDMKGMVQLKRRSINISQPN* 1891669

 

>CYP698A1  Penicillium paxilli

           GenEMBL AF279808 note TG boundary at intron 1 not AG

           PaxQ gene

MDFVLSALQRDSWGIAAIILVSIWALHSFHRSRKLQ (0)

IPVPYVGKCGILGPWISALQWESKARELVQEGYEK ()

HGNFAFKVALLNRWEVCICNEDMIREYKNLMDNQFSAIAVTSE ()

LFQIKWTAPGTEEGAHKISIPLLGKALTWQRNRSAAQNDPYFSEFV

EEFLYAWKEEVPVPENGDYELPCFETGARVVAHLTARSLVGYPLCRNPEIVNLFTDYG

SAVPTSGFFIAMFPEIMKP

FVANFCSAPRISKRLQAILLEEFAKR

REEGGIEST ()

DIMGWLRNWTDQNEPGVYGDLEITSSIIATIFGAIHTTTQ ()

VLVHCLFELATRPEYVEPLRVEIQSA

LEEHGGWVKEGIEGMVKLDSFIKECQRFNPLDAG

SLARRATKDFTFKNGLTIPE ()

GTFVFAPNGPILFDDTLYPEARQFDGYRFYNLGQKTGKPQDFRFAATNQKYLQFGDGRH ()

TCPGRWMASDEIRLMLAHILMNYDIATKDNKGRPENWIFKKILFPDMKAVVILKARK

SVSA

 

#60

 

>CYP5042A2 BAE62162.1 [Aspergillus oryzae]

MGASIHAHISAAANESPITAAFVSIAACLGLIFLIIQEIFKPVGKRRSPQGKKWKLPPGPQGVPIFGSLL

YLQKVREDEEHRIHKDLAKYGEMTTLHLGSKTWILLNSKRVVSEIIAKRGSLTNGRSPMPIASGIVSRDG

RSLLLPPAQWMEKRRVMHSLLSGTAMKQYGSWQELESTQMLAEYLFQPERWYRHHYRYANSVVHRIALGE

RLVKSGKELAELQDVVTHFVGSIGTSLVDWFPELDKLPRMLQPWRKHWEKLGDWNEEVYKSWWIPAREKV

ENGTAPPSWVRDVLLHPDTKFTGNDQEAMYVALQLLEAGSDTTREALNIFAMAALCFPDKFQKAREEVDS

QCSTTKNFRLPGIDDLGNMPYICAMIKELLRWRPIFSFTPDHVLTSDMEFEGYNFPAGVGFVINEIPVCN

ECEDPEDFKPERWLDGHETDAAHGLWQFGGGRRICVGYRLAFQGLFINVARLVFCYNYEAAGPYDSKRLN

HHKTVEPFPVKVTPRSEQHTSLILEEGARLGVLEDAKRLI

 

#61

 

>AP007157.1h Aspergillus oryzae RIB40 genomic DNA, SC023

CYP5042B1

complement(join(1170838..1170975,1171028..1172102,

1172148..1172220,1172254..1172488))

revised to match to 5042A1 and 5042A2 but stop codon encountered

MTQLSIETFVVFTAFGLLWLSYEYFRPGSILSRFASMRSKLPPG

PPGLPIFGNMFQFTRARDAGLWGPFVSPGFLPSAASLRQYGPMTTLHMGFQTWVVLNGP

*VATDIINKHGKITS

ERPDMPIAGDLVSHGLRTVIRPTAAWTEGRRVMHHLLSGSVLRIYGNWQEIESLQML

SAYLREPKHWYAHHYRYSIAVLYRLVMGENLSKTQDELNDYQKVTMEITLSSLNSMVD

FFPRLDRWIPIYLQWWRPYWAKMGDFHHSVFKSWWDPIRDAVRQGTANPGFVRDTLLH

PDMRYKGTEEEAMYLATSVIAAGSDNTRMALNTFIMAMISHPETMARARQQLDAVCIN

EDGTLRLPGMADFDRLPYLAAMVKEVLRWRPTTPVTPQHQLTEDLEYEGYRFPKGTCF

VVNGIALGQVCDNPDQFDPSRWLDGNEGNIVHNLWAFGGGRRICVGYRVAQQALYVAI

ARIIFCFDLCADGPIDTRKLNHFHIHNEPFPVRVTVRSAKHEFLIKEEAEKASTAF

 

>CYP5042B1 BAE59001.1 [Aspergillus oryzae] assembly errors

MTQLSIETFVVFTAFGLLWLSYEYFRPGSILSRFASMRSKLPPGPPGLPIFGNMFQFTRARDAGLWGPFV

SPGFLPSAASLRQYGPMTTLHMGFQTWVVLNGPERPDMPIAGDLVSHGLRTVIRPTAAWTEGRRVMHHLL

SGSVLRIYGNWQEIESLQMLSAYLREPKHWYAHHYRYSIAVLYRLVMGENLSKTQDELNDYQKVTMEITL

SSLNSMVDFFPRLDRWIPIYLQWWRPYWAKMGDFHHSVFKSWWDPIRDAVRQGTANPGFVRDTLLHPDMR

YKGTEEEAMYLATSVIAAGSDNTRMALNTFIMAMISHPETMARARQQLDAVCINEDGTLRLPGMADFDRL

PYLAAMVKEVLRWRPTTPVTPQHQLTEDLEYEGYRFPKGTCFVVNGIALGQVCDNPDQFDPSRWLDGNEG

NIVHNLWAFGGGRRICVGYRVAQQALYVAIARIIFCFDLCADGPIDTRKLNHFHIHNEPFPVRVTVRSAK

HEFLIKEEAEKASTAF

 

#32 45% to CYP5053A1, 44% to 5053A2, 39% tp 5053B1

 

>CYP5053C1 BAE64935.1 AP007171.1 [Aspergillus oryzae]

14 P450 genes and 2 pseudogenes on this contig

MVTFWTGRRPTIWICDAWAADELLNKRAAIYASRPRMVVFSELGAGQSNMVNMYYGDRWRLHRKLTHMGV

GLQQVRNYRGFQNDESKVVALDLLREPREYVSHFERYATSVVSIIGFGRRVSAYTDPIITEVVAVMQRAA

ELNVPGKSFPMLMESFPFLAKFPNWMAPWKHGLGNGQGRGRPFFYALAEEAASGPEAKQCYARKLFEEVP

KHNLTKMEISSLAGNLFGAGSDTSSSTLVTFVLACCAFPETLPKAWEELDRVVGPHRSPTFEDESDLPYV

RAFVKEVLRWRSVAIIGGQPHAPIKDDRYKVRCTSLNSVLGWLIPRNTWVQGNVWAIHHHEREFPEPDRF

NPERYFEESPVHRPFPVDKGYMTFGWGRRVCSGQGLAEQGTFITIARLLWGFDIRKALDRHGNEVPVDIF

DFTNGLNMRPNSFECRITPCNQEIRSTIEREGLQALQDLSQYDGETKYRMSTYYNPEKL

 

#151 73% to 5061B1, 45% to 68D1, 41% to 68L1

68% to 5061B4

>CYP5061B5 BAE57341.1 [Aspergillus oryzae]

MPVLATFLESHYFFQGIAVALALIFVSNFYRELADGLPYRKIPLVGRSRWEISNTKAKKLFVTSAKDLMV

QGFSQGRTVFQAMFTAGPTIVLHPRYVDELKNHPHLDFGEAVRKSFFGATIPGFEPFNNQTKEDIVIEVI

NKKLTHTLGQLTIPLSKETAAVLTDKLPGSDEWKPFTFAQEIPHMVARLSSLVFLGEKICRNETWLDVSV

NYTIDAFNAARELRDLPAVARPFIHWFMPSMQKLRHHRKVAAEIVQQEIIKRDMIREGKLPEENPPRTHA

DALDWFREVAAGRPCDETVSQIGLSVAAIHTTSNMLTNVMYDLTAHPEYIQPLRDEIKAIVEQDGILKKT

SLTKMKLMDSVMKESQRTNPVSIAFFNRIATEAVVLSDGTSIPKGANVVVSAHVMEDESIYPNAKVYDGF

RFYNKRQVPGNEHRYQFVTTSPEHLGFGHGMHACPGRFFANNEIKILLAHLLLKYDWKFADRVDRPKSFL

HGTEIICDPTVKLLYKSRQPEVDLSALGEGTTD

 

#62

 

>AP007159.1 Aspergillus oryzae RIB40 = Aspergillus flavus

CYP5064A2

join(1096818..1097070,1097124..1097466,1097500..1098547)

This gene seems to have an AT boundary instead of GT at intron 3

49% to CYP5064A1 partial seq.

1096818 MDFGGILLHLEARSMATVLIAGLLVYWVGSAIFLAVVHPLAKFP

        GPKLAAASDWWLVYHEWFLGKSLTDILFDLHQNY (1) 1097052

        GPVVRYGPYR (0)

        LHFSSMQAYSDIYNVKSKWDKDPEVYKAIVDTSSAFGLRNYH

        EAKERRDLIWPFYSRQSVQRMQKAINRQ (0)

1097494 ISFLVDQLDKQNQEGKLSNMS

        MAFRCLAQDIMADICLGKSFGTLEERDFGSPLIHALDEGLESYVLMKSFPTLRNILYS

        ISAMVTLPGEAEFATYGTIVADHVTRGIQQPDTIPPNTMLGFLVPTSSNTAKEAPQPK

        LSQGHMTEELQTFVIGAGETVASAMVQGLSGILQSPDLYKNVYEEIVQVW PETDGPVP

        PIEVLEKLPLLTAVIKEALRLTHGVVTPLARVISAGGACIDGHHVPGGTSVGTSHVFI

        HMSSDYYDAPDEFRPERWLGSSSDKHLVAFSKGPRGCMGINLAWCQLYLVLATLVRTV

        QMEYPADLNDIKIKWKDCFQPLYYGRPLQVRCTRAEGHS* 1098547

 

 

>CYP5064A2 BAE59846.1 [Aspergillus oryzae] assembly errors

MDFGGILLHLEARSMATVLIAGLLVYWVGSAIFLAVVHPLAKFPGPKLAAASDWWLVYHEWFLGKSLTDI

LFDLHQNYGTINVPYGGLQDLWLDMDRIAYVVQSLTWESALEANSLVKLHFSSMQAYSDIYNVKSKWDKD

PEVYKAIVDTSSAFGLRNYHEAKERRDLIWPFYSRQSVQRMQKAINRQIGYRELFRTRTFLVDQLDKQNQ

EGKLSNMSMAFRCLAQDIMADICLGKSFGTLEERDFGSPLIHALDEGLESYVLMKSFPTLRNILYSISAM

VTLPGEAEFATYGTIVADHVTRGIQQPDTIPPNTMLGFLVPTSSNTAKEAPQPKLSQGHMTEELQTFVIG

AGETVASAMVQGLSGILQSPDLYKNVYEEIVQVWPETDGPVPPIEVLEKLPLLTAVIKEALRLTHGVVTP

LARVISAGGACIDGHHVPGGTSVGTSHVFIHMSSDYYDAPDEFRPERWLGSSSDKHLVAFSKGPRGCMGI

NLAWCQLYLVLATLVRTVQMEYPADLNDIKIKWKDCFQPLYYGRPLQVRCTRAEGHS

 

#63

 

>CYP5068A2 BAE57974.1 [Aspergillus oryzae]

MELIIGLCLLAPLLFLYTPLRRFIGLNASELPLPPGPTLLSGPFPEKDIAKTFQKWNKKYGPIVSAKIGA

QQFIILGSRRAAQDLLERRASIYSSRPASKFLDKYLHKGLASAFMPYGAQWRLHRRLGSSLLSERASTAY

RQLQDFESKRLLHEFLSTNDFSEAFLSYTSDIMFTLVYGKGRGKDDSDHKMLYQINEMATFVLQKASFGT

ILLDLFPMLDWLPHCFLTWRKKAEELHYKTKEVYTECGNIALGGDCWNWSHEVSQRSEAKELPWEDVCYA

LGELYVAGIHTTKMVLEILIMVCVLHKEVKQKAQAELDSVVGEDRLPSPDDLEKLPYIRAIVSELLRWRP

ISPIGVPHAVIQDDEYMGYRIPAGATVVANQFGMNMDEATFDNPAAFNPDRYLNNPDLPVSAFGFGRRIC

PGHRLARGSLLIVTSRLLWAYDITSAQGDADLGDEYSPSSVKAVFQPRSVKHEQVIKKEWEESDKDEKRI

LERIRDRI

 

#71 39% to CYP5068A2, 41% to 5068A1

 

>CYP5068B1 BAE63024.1 [Aspergillus oryzae]

MVSYEWCLDSFNPFGITRNSLCFFFLVALCLCWSSSAWSSKQQRLPPGPPALPVIGNLHQMPRRNRWRAL

QRWHKLYGPIISLRLGQRIAISLGTHKVARELLELRGNNYSSRPRFVVAGDYVSEGLHSILLPYGNQWRI

HHRIQRELLTNHRTQAYRYLQDIESKQIVYDMLKSSDFVGHFRRYTSSVMFTLAYGKRLESPGRHEIAEA

SKITENISLAADQAKNMIVEVYPVLDYIPRCFAPWKRIGTRLHAQTVQFFEQQMLEGLRSPAWNWSKHII

ALNETKDLSNKEIVYILGALYEAGSETTATVLQIFVLASVLHPECIGHAQLELDESVGNDRMPTFEDMPR

LPYLNAFIKEVLRWRPIAPLGIPHAPSKIGEFMGYSIPEGATIFPNNWTLDLDDAVFRDPYAFKPERWLE

DPNLPLSTFGFGRRACPGKQMAENSLYIAIARLIWGYNFHHAYENGLRVELDPWDMKEGVVSPPATFSAV

LSVRSSVHQRLIELEWDSAEKDVNGILGQIESLMGSRAAAQKDSSA

 

#85 76% to 5069A1

 

>CYP5069A2 BAE60165.1 [Aspergillus oryzae]

MDLYKAVVLDLHLSPGLISAIHKPTVLVGIACALFFSQLLFWTAKYSHKKTKGLADLPGPSGWPLIGMGL

DLPVRPRELLNRWAAQYGDVFKVRVGWYNWVFFNSPDAVKEVFDRQAAVTSGKPPLPIAQDYCLRGDGVL

PMTYNAKWKRLHAFLKQLLSAKASAAFIPSQEFEIKQLLADLSHEAGKNSTDFYMHIRRMTFSIVMTSAY

GLRIPKWDCQEVRDVYGNMRMLSIILSPGMFWIDMRHWDNLKDRITAGNRPRLLRQGPHRGLEEETVSWL

ASAVPEAGPETTASALNGLIRYLAMFPDAQARAHDEVTRVLGDTRMATLADEPNMPYIRAVIKETLPTVP

HGDVHYRDHLIPKGTILLANLNTLHWDPERFPHPFHFKPERYLNHLHRSAVYAAGGDILARDNFTFGAGR

RICPGIHLAENGLFLAVANITWAYEFKLPLDDQGEEIPLDITDEGFMEGAIRVPKQYTVRILERNAARSR

LIRSEWDQAQQAGYVLRGSHVDVNGGVGGGSKTAAS

 

#64

 

>CYP5070A1 BAE58765.1 [Aspergillus oryzae]

MALFTFRLLPLVCTASIAIYVLSRFMHFETKSTGALTYSITFIIYLLYWLYIYPYHLSPLRHVPTVPGCP

LWGHVFEIFNAEIGAVQQKWHKTHGPIVRYFYPFGKEILSVVDNSALKHILVEASYNYEKTASNRKFLSR

LFGEGILTAGGKVHAQQRKALNPAFSISAIKALAPAFWDYSCSMSSYWEQDIKESSDDSVSLDISDWASR

ATLDIIVAVGFGAKIDTLHNSTAPLIEAFRTVFRFDAVAKLLAVLHILFPIVRYLPIKENREVDAAKRTL

FEFASGLIQEKEANINSTGNNILSQLVRGDRKPQAAGEDIFSRVICDQIATFLGVGQDTSATWLSWTLHL

LSKHQHMQVKLREEIRSHFPFLFRGATHEKIDFTEVDVDRLPYLNNVCRESLRFIPPIPFVSREAARDER

LGEYFIPKGTVIHIPINTIHRMPEYWGPNSNAFDPDRWNCLPASYTNNAFLPFTQGPRGCIGRKFADTEV

KTILCCLLSKFQFSPDPAVQDPEELKRYRIVQKSQYGIRLKVSKLDG

 

#21

 

>CYP5075A1 BAE65911.1 [Aspergillus oryzae]

MLLLLLETLALAYVAWSLVAMEINYRRACAMKIPLVRLCIDPQNLLWVILEPHLWPWLDRLPINWGNFGR

YSRRGWYFADRGESHRRYGPIWALVTPKEIYINVADSEAIHDIFQRRTDFIRPVEQYTVLEVYGPCISTA

NTTDWPRHRKVLATPFNESVMSFVWDESVEQTRQMIDIWASPDLDKISSVAKDTRTLSLNVLAAIGFRKS

YPFRSGNGNSHREQSDSVSYRDALQTVLDNAILLMIMPRRLLSLSFAPESWQQLAKAATDFKQHMVRMLD

EEVQALNEGKAGSGGLMTSFVRAMNLKQEDARSKGLTTDEIFGNIFVINFAGHDTTANTLSFGLLLLAAY

PEVQDWVAEELLLLTNTKGQYADLFPKLNRCRAVMLETLRLYPPIPSLPKWTNDQAQPLKVGDRTIMIPP

KVGINPSLLTMHIDPQHWEDPLEWKPSRWITPTKLVRAISIEDEQLITPVRCTYFPWSDGPQNCPGNKFS

QVEFVAVIASLFRHHRISPVANAGETFQQTRERVLATTRDVDLQLLLRMKDAERVHLKCRRV

 

#146

42% to CYP5075A1 missing C-term

>CYP5075B1 BAE58484.1 [Aspergillus oryzae]

MLLIIAVALLGWTLYSVFCLVGNIRRIQKIGIPYHVIPCSPVNPLWILLEPLIFFILGLLPFEFGRIKHY

GRRTWQFTDKAQSHMRMGDAWAIATPNEIFVYICDADAITDIIARRADFVRPIELFTLLNVFGPNVATTE

GADWQRHRKIVAAPFNESLNSFVWREALTQAQSMLTTRATAGPSGGLGTDTRTLALNVLAATGFKRSTRF

QSAQEAQSEDPRSYAQSLKTVMLNTFLIMLIPPSVLKFPIFPSWCRRAGEAVEDFKQHMLNMFNTEKTLL

DQGKPGTGTLMSSFVRESTVDPKSNKTVLTLDEILGNIYVINFAGHDTTAGSLTYVLFLLAAYPNIQEWI

AEEIRTVFPNPDRDTWDYKEAFPRLKRCLAVVVSTRPNPPL

 

#65

 

>AP007151.1  Aspergillus oryzae RIB40 genomic DNA, SC005

CYP5076C1 = old CYP5066A3

complement(join(1085860..1086053,1086107..1086208,

1086271..1086569,1086625..1086746,1086798..1087521,

1087687..1087712))

locus_tag="AO090005000422"

         MDIKEKPTLYAFA

1087673  LGILIHILYFRIGEHHLYPARYIYGYFGSFIGVAAFLYLVEELPVHSASYRSLYL  1087509

1087508  IFTHLLGLYSSLVLYRLLYHPLRHFPGPFLSRVSVFWLSVQLRHKTLYRKLADLHNEYGD  1087329

1087328  FVRVGPSDLSIIHPKAVNTIYGFKSACTKSAWYDSSAPLRSLHSHRNRAAHDKHRRTWTP  1087149

1087148  GFTDRALHGYEKRIQVYRQKLINQIKSMEDSKPLNINTLFTWYGYDVMGDLAFGQSFDM  1086972

1086971  LVKSESHWAILMIHSMLKPMEYLMPIWFFRLLLSIPGTTKAFWKFNEYWGQLFKMRMA  (0)1086798

         TKQEIPDISACLLEPLKGRAPTPDEFNVLLGDASLIINAG   (2) 1086627

1086568  DTTATTLTTIIYELARRPGEVQKLRTELVSCTTDPNGEYTQESLAILKHLNGVINETLRI  1086389

1086388  HSPVPSYIPRKTPPEGINIDGTHVPGNMNVSCPQWVIGR  (2) 1086272

1086209  SESVYQNAQNFIPERWYLYPKMIKERSAFAPFTT  (1) 1086108

1086054  GPYTCVGKPLALMNIRATIARLITTFDMELPPGDDGRALERSMREHFSI  1085908

         YMAKDIQVHFQKRAI*

 

>CYP5076C1 BAE55487.1 [Aspergillus oryzae] assembly errors

MDIKEKPTLSLYLIFTHLLGLYSSLVLYRLLYHPLRHFPGPFLSRVSVFWLSVQLRHKTLYRKLADLHNE

YGDFVRVGPSDLSIIHPKAVNTIYGFKSACTKSAWYDSSAPLRSLHSHRNRAAHDKHRRTWTPGFTDRAL

HGYEKRIQVYRQKLINQIKSMEDSKPLNINTLFTWYGYDVMGDLAFGQSFDMLVKSESHWAILMIHSMLK

PMEYLMPIWFFRLLLSIPGTTKAFWKFNEYWGQLFKMRMATKQEIPDISACLLEPLKGRAPTPDEFNVLL

GDASLIINAGGDTTATTLTTIIYELARRPGEVQKLRTELVSCTTDPNGEYTQESLAILKHLNGVINETLR

IHSPVPSYIPRKTPPEGINIDGTHVPGNMNVSCPQWVIGRSESVYQNAQNFIPERWYLYPKMIKERSAFA

PFTTGPYTCVGKPLALMNIRATIARLITTFDMELPPGDDGRALERSMREHFSIYMAKDIQVHFQKRAI

 

#22 66% to 532C2 = CYP5078Ax

 

>CYP5078A5 BAE65602.1 [Aspergillus oryzae]

MIDAASVVILIIGLIVARLVTNRFRLSGIPGPSLAAYTRLWKLYNAWKGDHHHTEIALHRKYGSLVRIGP

RHISVSDPKAIPIIYGVNKGFTKTAFYPIQSISWDKKPQMNLFSTRDELFHRDRKRPIASAYSMTSILEM

EPAVDSYTELFLSQIRKMVEEKAPIDLGMWLQYYAFDVVGELSFAQKLGFLEKGEDVDNMIEAIRGMLTY

AMICGQIPEAHKVLLGNPLFPILLPQMETWDQVVVFTLKAINRRASLQRDGDLGKDEIDEAIGGKDMMSR

WLAIHNADPTRLSTRDLMVHLSANVFAGSDTTAIALRSILYHLICHPDKMAKVRAEIDTADQEGKLSNPI

SYQESNTHLPYFGAVMKEAMRLHPSVGGNLERHVPPQGVTICGHYIPGGTNVGINPWVVHRDPIVFPQPD

SFIPERWLDSTPEQLKEMEKAFLNFGAGSRSCIGKAISLMEMRKILPQLLREFDIHLHQNKSWKTRNVWF

VQQEEFICDLTPRVRS

 

#66

 

>CYP5080B2 BAE62337.1 [Aspergillus oryzae]

MYILLLLPVLIVSYHVLHLIYITLTTKSLLSVPGPFIARLTKLWYFDRVRRGHFEEDNVRLHERYGPVVR

IAPDHYSISDRAAVKLVYGTGTKFTKSAWYEGWKHPSPERWTLFPDRDVRRHAETRKRFSGLYSMSSLVH

YEEFVDHCADIFSQRLTEYAQREGSLNLGHWFQCYAFDVIGEITFGKRFGFLDQGDDIEGTIAALQKTMV

YSTLIGIYPEWHPRLFELLSHFSWSGAGGRTYIMRYVQEKIRRHSEPAKRDPEQGTLQTQDFLEKMILAR

DKDPEKVTDYHLFMMGLSNVIAGSDTTAISLSSIMYHLLHYPAVLEKLRREVDDFTAQGRCSARVTFKES

QEMPYFQAVMKEALRMHSATGLPLWRVVPAGGAEISGYYFPEGTTVGINTWVAHYDEEIYPDAKKFRPER

WIEAEADPERLKIMNEMYMPFGLGSRTCLGKHISILEMSKMIPRLIRDFDFTTTSQKWSTENYWFVKPTD

FVVKVRRRTSSAKQA

 

#67 42% to 532F1 = CYP5080B1, 41% to 57A3, 42% to 57B2

42% to 5038A1, 43% to CYP5080C2, 43% to 5080C1

in the CYP53 clan part B

>CYP5080E1 BAE63486.1 [Aspergillus oryzae]

MNDERIVLTQDKGQSYTAQLLYLIVAGYIAHTVYYAYWGPTARIQGPWLARFTRLWELLKVSKGHFEQVN

IDLHKKYGPIVRISPNTFSISDPSAIKQIYLGRTTLMKSKFYEPFGDPLDPNLFSETDIKKHAQSRKAVA

HLYSMSFLVTYEGSADRCNVQLCAKLRDFARHRTAFDVPTWMQFYAHDVIGEITFGEPFGMMAKGQDEHG

IADSIDETIAYASRMAVIPELHRWVSWFGRVAHLKTPFHNIQKYILEQIDSRSGSDSVGIDFLKKLLTLR

EDDKITQLDIEKTVGNNIMAGADTTAISLSAVIYSLLKNPGTETKLREDIDTLAAAGKLSNPVTFEQARH

MPYLQACIKEALRVHPAVGRPLLRVVSPEGLTIAGQYFPGRFQGNSRYQCLVAHYNEDIFGRDATTFRPE

RWLESDKEKLSVMEQSLLAFGAGVRTCIGKNLSMLEMSKVIPELYRQFEFELSESEGAWMTWNNWFVKPA

FECYVRLREGV

 

#38

41% to CYP5087A1

>CYP5087B1 BAE63940.1 [Aspergillus oryzae]

MSPRGKMVQPIETPRQAFLAHPLTVILVGIILSLLVRRLLWNLKQRELERLHGCERLHNEGGCLRYDFLG

IAKAIKLGFHFRRRTSLPYTNALFKRYGETYASNVLGYRLIFTCSAENIKHLLSTAFADFDSSPLRKPLF

QPITPDGIFTLDGPGWKKSRDQLRSRLSNLRKIVDLNQCERHFQAFLQHVPPNGQAFDVQACAFALALDM

QTLFSLGESVDALSFCQSREKKQFLEDLLFVKEKIVQDGFRGPLRYLYPKRRFLHCCKRARRYVIAHVSR

QLTGCSSMSEKAEGAQPTNAEEE

VSLLADQALSILLANDSMSTTLSGLFFCLSQDERVVKKLTASILDTV

GLEPPTWGQLGTLHYVRWVLQEAMRLFPAVVFNARVANKNSTLPTGGGTNGNSPVLIRKGEIVVFSTWAR

HRLGKDFGENPDEFYPERWEHLSGDMIGFIPFNKGPRACPGQH YAMIVLTYIVARIFQTFSTVSNYDTRE

WTERISMTLENENRVLIGLS

 

#141

57% to CYP5089A1

>CYP5089A2 BAE60720.1 [Aspergillus oryzae]

MVSSTAFIVVQVALAALAAHVIYQCYFHPLARYPGPFLARFTNLWRLFTFFGGQHHLSEQHLHDKYGHVV

RVAPNWLSFSDLHDFDAIYGFNKSVEKDDFYLFGRPRDNRVPSVFALKTDADHRQRKRKVVGPALTTAKI

TRYESVVTKHVDLFFTRADAASASRQDGEMAAVNLAPLAHRFTMDVMLELIYGPDVVSHPYTDSATGADM

CSAMRKLVKMAWSFSLCPSYGWIMNSRLISGVLRTLTTSKQGGPTGMMALMTSSHTMIFRRPEQVSLPGQ

PGIVKSWLDIPLDDSSRMTQDEVFSEAVNLVFAGPGSVAAALTAMVYQLGTQEGQLWQEKLRKEADVEAP

PFSLELQAVVKETLRHCASFPTAFPRVIRRGAETIVSTLPAPLPIGTTVSANSYILGRSRKIWGHDADQW

LPQRWLGDESQRREMEAKLVAFSKGSRGCVGKELAWLVLAKAVMAIIRRWKFVSVGELRGKSYLEMQYDD

CWIEYEELA

 

31 seqs have no matches on first pass to An seqs and Af seqs also Mg, Fg, Nc and other fungal

 

 

>CYP5093A1  Leptosphaeria maculans

           GenEMBL AY553235.1

           sirodesmin biosynthetic gene cluster, SirB gene

           note: a second P450 SirC exists in this gene cluster

           Sir C = CYP5082B1

MSTLQDFQIAPAILHRVTVRDASAILFCTLLTVFLFISQGTVRG

VKRVGKSRLRTLVTGETPLRFDLEKYGYLGYQQFSKKANKPFLVKIYGLDHYVLPVKY

LDSLKTVDHHRLSFAQSLNDF ()

26242 LNVDASLGDLVTHSDMEIAVVTKHLNPRL ()

TTLTPVLVDEANFAFEKELGKLE ()

TWKTVNALFLSAFLTNRTSGRVLVGDLCRDDNYLHAMMKYTES

VFSSGVAFNGIPLGPFRKIVYYLGARQHRRDLDNAAALVLPEIKRRMAAQAEDPNCRK

ENDAIQWNLDLPLASPKEGLPLRHAHRVLHLSFAATGTVAILITHMIYNVLMYPEYLE

PLREEVMACTKAHGGWTEKAMNEMWKLDSFIRETLRVQPPSVFTAYRTVKNQPFTFPD

GFTLPVGSRITFPTLPVGLDPENYESASEFDGFRFFRKREEARLAKKAYNWGATKIDS

SFLPFGYGNQACPGRFFGVRKTKILFGKLINDYDFSWAEPRSARPENIVIEGQILVNP

TPEIKIKSRVAAGM

 

#68 no strong matches

35% to 546B1 Fg, 36% to 546A2 Mg

>CYP5093A2 BAE63236.1 [Aspergillus oryzae]

MDYIHSLPSNPALGLSCCIIFILLAIVLHDVYMWKCLPPGPPPIPLIGNKFQIPSKHPWIKFEEWSNVYG

PIYTIWLGRRPTVVISDPSIASELLEKRSTKYSTRPRFVTMGEIYWDMASILVQPYGKEWLIRRRLLHSA

LTPRALDNYTPLQEAESSRLCYQLLESAHEWEPLFDRLASSIVFAVSYGHRVDSAQSPVIKQRLDFMQYA

SSLNVPGAHLVESFPVLKHLPDWIAPWKAEIKRRGRLEAEANMTLVRVVQQDVESAKESPGAEPLFNSLT

KQLLETRDSDPTAFPLSERDFSYIPASLFGAGSDTTSSTLCSAMLAIVTNPRTMEVAQLELDSVVGRDRL

PTFEDIPNLPYLRAFSKEVLRWRPVAVLGGTPHACSEDDYYRGYYIPQGTVMLGNSWAINMNPKYYPNPD

QFNPLRFLDMDPHLLPYLPKEYTASAEQEKGSGHPSKLGHSSFGWGRRICPGADLATNTLLITLSRLLWC

FDIRPIPGQTYDTLDYTNGFNIRPRSLHLSLQVRSDQHRQVIERGYEVATKFLERLSPFDERMQGNS

 

>CYP5093A3 AAJN01000232.1  Aspergillus terreus NIH2624

75% to 5093A2 no introns, 36% to 546B1, 35% to 546A2

49905  MEHLRTLLSSTLVWGAGCGILLIVLGILVHDVILWKRLPPGPPPFPLIGNKLHVPSKHPW  49726

49725  IRFRDWSKIYGPIYTIWFGRRPTVVISDPTVAAELLEKRSTKYSTRPRFVTMGEIYWDMA  49546

49545  SILVQPYGKEWLVRRKLLHSALTPRALDNYKPLQQAESARLCYQLLQHADRWEALFDRLT  49366

49365  ASIVFAIAYGHRVDDFRSPVVRQRLEFMQYSSSLNVPGAYLVESFPILKDLPDWMAPWKA  49186

49185  EIKRRGRIEAEANMNLVRVVQRDIESANEAPGTAHIFNSLTKQLLEIRGQDPASFPLTDR  49006

49005  DFSYIPASLFGAGSDTTASTLCSAMLAIVTTPMVLEMAQAELDSVVGYDRLPTFEDMRNL  48826

48825  PYLRAFCKEVLRWRPVAVLGGTPHACSEDDFYNGYYIPKGTVILGNSWAINLNPEYYPNP  48646

48645  DHFNPLRFLDVEPHSLSYLSEQYLSSTKQEKGTSHPSKLGHSSFGWGRRICPGADLATNT  48466

48465  LLITLSRLLWCFDIRPVPGRTYDTLDYSSGFNIRPRNLHVKIKVRSDHHGGVVEREYGDA  48286

48285  SEFLETLPPFEDSLPEHSPIKM* 48217

 

>CYP5093A4 AAGI01000340.1  Phaeosphaeria nodorum SN15

60% to 5093A2, no introns, 39% to 546A2, 37% to 546B1

        MPLESVFKL

211788  PAYIWASLIFAIPLVALLHDVWVWFRMPPGPTPIPFLGNKHQLPKSKPWIQFQEWSKTYG  211967

211968  PIFTIWIGRKPTIVISDPIIAVDLMEKRSTKYSSRPRMVAMGEILWDGASILVQPYGKEW  212147

212148  STRRKLLHQALTPKALRLYKPVQTAEASRLCSQLLETPANWEKLLERFTSSIVFSVAYGH  212327

212328  RIDSLNADVIYQRFKFMHVAASLNVPGKYQVESFPILKHVPDVLAPWKAKIKAQGREEAA  212507

212508  ANMALVDVVRNDMARAKTRGEDIPDSLCKLLLEMKETEHIPLSDRDFSYIPASLFG  212675

212676  AGSDTTASTLCTAFLALVTHPETLQAAHSELDAVVGTNRSPTFDDEKDLPYLRALVKEVL  212855

212856  RWRPVAVLGGTPHASTEDDYYEGYYIPAGTTVLGNSWAINLNEEYYPNPHLFDPMRFLDS  213035

213036  ALSEKLKAPTGLTGKAHPAKTGHSSFGWGRRICPGAGLAENSLIIALAKILWT  213194

213195  FDILPVKGVKYDTFAYTEGFNIRPKSFRCEIRIRSEVHRKVLEEDFKSAEGVLERFTPFG  213374

213375  E*  213380

 

#154

 

>CYP5093B1 BAE56598.1 AP007154.1 [Aspergillus oryzae]

45% to CYP5093A1

81343 MASESSIPLYDCLIIGGGIAGLSSALSLVRTLHTAVVFDEGIHRNDQAPHLATVPTWDSQDPKRFRDAAK

LNILSKYSTVEFANVKLEKFNKALGKPFLTKVFGHDYVVLPSKYFDDIKRASPQSLSFFQALSDGLNMEA

SVGHLYASTTEIDVVVKHLNPRLTQLTPLLCDEAEYAIEREVGALPDWKKFNVSNLIAAIVHRTTNRILV

GKELCRNEEYLAITTKFSRSLFISGIFWNFVRLGPLRKLVAWLTIGLHLRDRNAAAKVLLPHVLARRQEK

EAGVDVATKYPDALQWTIDTAPSFPGDDEPLHQVYHMLHLTFAASSASGVGVTQCLLNVLAYPEYLEPLR

DEISTVVARHGGWTDKALSQMALLDSFIRETMRLHPAGS (1)

FMDDHFRFHDGLTLPKGTNIIAPALAIHYDP

DNYEDAHRFDGFRFARYRQKQGENHRWLASTIDQKFLQFGYGNHACPGRFYAIRKIKLVLAKLIMDYDFK

WAQPRPVHDRPEDFAIEAQLVAAPDAEILIRSRNLSN 78253

 

>CYP5093B2 AAKD02000026.1 Aspergillus clavatus NRRL 1

82% to CYP5093B1

366479  MASEQVPLYDCLIIGGGIAGLSAALSLVRTLHSAVVFDEGLHRNDDSPHLATIPTWDSH  366303

366302  EPKTFREEAKLNILTKYSTVEFADVKLEK (0) 366216

365065  VNKALGKPFITKVFGHDYVVLPSKYLDDIKRASPKSLSFFQALSD  364931

364878  GLNMEASVGHLYASTTEIDVVVKHLNPRL (1)

364727  NKLTPLLFDEAEYAIRKEIGPATEWKSFNVSNLIGAIVHRTGNRILVGPELCRDEAYLAAT  364545

364544  TRFSRSLFLHGIFWNFVRLGPFRKLIARLTIGLHLRDRDAAARMLLPHIHSRRQEKASGV  364365

364364  DVAAKYPDALQWTLETPSSFPGDDDPLHQAYQMLHLTFAASSASGVGVTQCLLNVLAYPE  364185

364184  YLGPLREEIKTVVARHSGWTDKALSQMALLDSFIRETMRLHPAGSCK (2)

        TVMDDQFRFHDGLTLPKGANIIAPALAIHHDPENYTDGSKFDGFRFARYR  363825

363824  QKQGDSHRWLASTIDPKFLQ (2)

363709  FGYGNHACPGRFYAIRKIKLVLGKLLMDYEFQWATPRSVNSRPEDLAIEAQLMVAPDTE  363533

363532  VLIRSCRA*  363506

 

#33 no strong matches

36% to 681A1 An, in CYP53 clan part C

>CYP5094A1 BAE64919.1 AP007171.1 [Aspergillus oryzae]

14 P450 genes and 2 pseudogenes on this contig

MASLTGAAAVLLAFILAYSTALTIYRLFFHPLARFPGPRLAAATKWYEFYFDIIKSPGGQFFKELSRMHD

VYGPIVRVNPDEIHVRDAAWFEVLYAPNPTKRNKYRPSAEMAGLTLGIHGTVDHDLHRRRRMAIAPMFNK

QSILSAEHLIKQHIDELTDVFESYLGTNNPINLQTTFLAYTTDVLYHYMFDTDAGYQRDSGAAQQWRHSM

DAVAQATPFLKQFPSLLSRVALIPLPMLIWVLKRIQPDVAGLLGTHQLMASIVSKYMASKPEEDQDELIA

TKAVKPRTLFHAIEASSLPPHEKAPTRLAQEGLTVLFAGGETGSRLLAHTVYHLLKNPEILEKVRKEILD

AAGDSNQLPDMKALEALPWLTASVRESLRLRAATTSRLPLVTEKPLAYADWVIPPNTPVSMSHGDILHNE

DIFPDPMKFMPSRWFNASPQQNRLFVPFGKGTRMCVGMNFAYCEIYMSLAVILARFDLELYDTRWERDVH

YTRDCFLGEPDPASPGIRVKVVADHKTFTRS

 

>CYP5094A2 AAKD02000032.1  Aspergillus clavatus NRRL 1

77% to #33, 35% to 681A1

260809  MTSSLPIPLQVLNLG

260854  LSFIFAYLTSIIIYRLYFHPLARFPGPKLAAATKWYEFYFDIVKRPGGQFFQELNRMHEIY (1) 261036

        GPIVRVNPDEIHIRDPSWFDVLYAPNPTKRNKYWPSAEMAGLTLG (1) 261228

261296  THGTINHDRHRRRRMANAPMFNKRSILSTQGLIKQHIDELVEVFASKSGTDEPVDLQTTFL  261478

261479  AYTTDVIYHYMFDTDAGYQRDPKVARKWRHSMEAVAQATPFLKQFPNLLSNLLRIPLPIL  261658

261659  IWVLKRVQSDVAGLLETHQ (0)

        LMAKIVSKYMATKATEAQSETDEE  261838

261839  SKKVKPRTLFHAIERSSLPPDEKQPPRLAQEGLTVLFAGGETGSRFLAHTVYHLLCNPDI  262018

262019  LDKVKKEILDAAGESNEVPDVRTLEGLPWL (0) 262108

262165  TASVRESLRLRAATTSRLPLVVEQEMVYQNWVIPAN (0)

262345  TPISMSHPDILHNDSIFPEPLRFRPARWFTATEQQNRLFVPFGKGTRMCVGMD (2) 262503

262562  FAYSEMYLSLAAILPRFDMELYETDWERDVQYSRDCFLGEPDPRSPGMRVKVVAD  262726

262727  NKAFALTETAMVS*  262738

 

#160 44% to CYP5095B1

41% to 682D2, 36% to 551A1, 34% to 551A2, 38% to 682D1

note 682D1 probably has a small intron after the KYG

>CYP5095A1 BAE66500.1 [Aspergillus oryzae]

MGFTQDLVSVIRPSIESPLAFCATTVVAVALYVLVLGVYRITLHPLAKFPGPKLAAFTQWYETYYEFFKS

PGGQYLFHYRKLHEKYGPIIRLSPFEIHIQDSSFFEEMYSQSLPWDKPKELEHRFGNANGLFPTHKHEVH

RHRRAALNPYFSKRAINNAVPMMQEQITKLCDRLRREYQGTGKVFRLDWMMGCIASDIIVRYCVDRGYDF

FEAPDFKSPFIQALFDLLDGVHMITQFPWVATLFNSLPQGLVETLQPGMKSVHHFHKEMADQVAHILSNK

EKRNGSEQTNVFNALLDSDLPPEELTLTRLQQEAFTVIGAGFDTTRYALSVAGFHIINTPSIYQRLREEL

KTAIPDPSNMPSLTDLEQLPWLTACIQECVRMSYGVSQRAFRISDHITLTYKNYVIPPGTVVSMDNYSVA

HDEEIFPESFTFKPERWLGDPLAPDGKKLTRYLVSFGKGTRSCLGINLAYAEMYLTIANVFRNFDFELFE

TDRSSVDCYRDMFLPHVKLGSQGVRVKIN

 

>CYP5095B1 AACD01000118.1  Aspergillus nidulans FGSC A4 new not in known set

44% to #160, 39% to 682B1

73084  MTMIDLNPDLSFTAKSVALLLFIALGL

73115  LYTTIQVVYRLYLSPLSRFPGPRLAAATGWYEAYFELVHKGGGQFLFEIRRMHEVY (1)  73282

       GPIVRINPFELHIADPAYYSTLYTSTLNLDKASHIQHRFNAPTAAF  73474

73475  STPEHALHRRRRAAISPFFAKRRIDEQAPMIQSHVNVICHRLSEEYAGTGKVLCVNELYG  73654

73655  SYVTGVIMTYAFNRCPRFLEEEDFVSAFGKSIQGLKEFVHWAQQFPCLPRILQNVPPVLM  73834

73835  GALFPAMQASLVFQE (0)  73879

73939  EMRMQAHAVLSGHGQKGTIFHDLLASDLPRSELTLPRLKDEAMSIVGAGIETTK  74100

74101  MASVVTTFHILQNPRILQKLQDELDSAIPDPTAPPSLSVLENLPFLAACIKEGIRLGYGA  74280

74281  TGRSPRISRTESLRYGAWSIPVGVMVSMDSYHMHHDESVFPDSYAFVPERWLDGARGPDG  74460

74461  TGSLNKYLASFSRGTRMCVGINLAYAEITIVLARLFRGFVMELYQTTRKDVDCYRDLVGM  74640

74641  EVVRGSRGVRVKVVGRRE*  74697

 

#78

39% to 682D2 but only 33% to 551A2, 32% TO 5095A1, 36% to 5095B1

>CYP5096A1 BAE61439.1 [Aspergillus oryzae] in the CYP53 clan part C

MMPTFFQAVCSTCIALAIYTASLAIYRLFLSPLAKFPGPTLAALTGWYEVFFDVLLGGQFMWEIERLHGK

YGPIVRINPHELHIKDPDYYNTLYAGPTRRRDKYLWFLSVGAPTSTFATPESDHHRLRRGMLSPFLSKQA

VRDLEGVIKAKLDLLCEHMKKAMRSGEAVELHAYFVSFAVDVVSTCAFGESGCFEELRRERLDDRWKNVV

TGAFGKLLLTRHFPWLVVVFRFLPVWATALLTPVVRHIDYMEKGVENQMQHVYAMNKDGVKENGIFSQLM

HNLKLPLKERVLYRLADDAKFLMVAGIDAPSQVLAITMFHVLRSPLVCRELREELQDKTAHSRDELCLNT

LEKLPYLTAVIKEGLRVSAVVTSRLPRIAPEETLEFRGWKIPPGTPVSMSSHFILRDPAIFPDPLVFQPE

RWLKQSTTGSSLDRYLVPFSKGSQGCLGPNMAHAWLYLALATLLQRFEFSLFETTEENIRTVRDCFNGQT

KPGQNNIRVKVLTEFI

 

#80

 

>CYP5097A1 BAE60821.1 [Aspergillus oryzae]

MDLTLHLILFLCFWACYLLFEKQLQQRSPLPPGPTPLPIIGNILQFKRKQAVWETISQWSDQYGPIMSFK

VASRTIIVLSTNQAIRDVLEKTPVNSSRPRFIGVNENLTRSMMPIFLPISDKWKAIHRVQLSLVNSRSAK

GIAEIQLLTAKQHLFNMLENANYDIADHINRFTSNVVSTVLFGTNIGSVSQAKSNGKFGLADQFIASICV

EHALVDLFPILEHIPGVARLGASKGNAWFESIRQQYTEDIQRAINSPTWSMIKAAHQQKIGGMSEDAFRM

WNVEMEFALGMTSSMMIANLVAMAVSHSHEFRQVQSEIDRVVGPERLPTADDLAHLPRLHAFVKEGIRVA

PIVPFSVPHAAVEENEYMGYRIPVDAIILPNQWHINREPKYFEDPAEFKPQRWIDNPNLPGPALVGYGIR

ICPGRQTANNGLLIVLALMAWGFDLNHAGGVKEPPNVLETLIMKLPTSSIRYSCRSSVHRDLIQKEWLAS

DDDPSSILNTLGSSLGF

 

#86

 

>CYP5098A1 BAE60012.1 [Aspergillus oryzae]

MGLILAFAVILLSTCWFLWYSRKAVFDRLPPGPRPLPFLKSRQELRQTRQWEALDDLHRQYGPLVGMTWG

GRPAVLIGKREIAKDLFGKRGSIYSSRARLVMGLDIMTGGDHVFFLPYGPKWKKLSRIQATFLNRPAVKH

YRPLQELESLHTLQDLLHSDDYEACFSRFQASLTHALAYGTRLHSATDPQLTELENIARTFISAATNSHW

MVDSFPILKYVPACLAPWKRFGQQIHAQTVSLFQGKMAVAEHTRSWNWVKHIRALKHTSGVTDHEMVYVI

GSIYQAGVGIITATLRLFIMACVLHPEAVKAAQDELDRVVGSDRLPTLNDLGHLPYVEAFVKEVLRWRPL

VLAATHSVTQDDDYRGYRIPRHAVILSNQWAMDMDREVWDSPEQFRPDRWMSDRKRMPSAFGLGQRMCAG

QYMAMESLLIMASRMLWAFTFEHAWEGGKRVEIDSWAFHEESLFLVPKPYRARIQPRDPHRLHVIQSTWQ

AAEKDIDPLLDQIGREIHTASA

 

#100

 

>CYP5099A1 BAE56799.1 [Aspergillus oryzae]

MEHHTWALFVDKLDYKAVFGLLLTIIIAVVTTQILHVYTKCCPGIPSIPFHISVYDAYRRVSEIGFHNSR

LRPVLETHGAVNIWNSGQWAVLVTKPEYVVRILRNERVVAKGGFYGKVPHSTLAGLFGENIIDSHGELWK

QFTGVMKPGIQRPHSISSLKVASSKLIATFKREQQHAPSDRGVVIDDIIERWAIDVFGESFFDVDFGALN

GGTVRAQDALLAILWNLGGHLIHHFPMFERIGWPLRPTRPHCFSMIRELEEALIDITEKLKYPETPPDRF

EKVIYRLKRARDDGLMTDFHYRSNLKMMFFAGHENVKFAFIATLWELSQNPQMQEKLYREIAAHIASSSD

GDDLKSLPYLTAVLAETLRLYPPVSQLINRKTLEPVYLGNGITIPQGMWVGWTAYGVHTDPNTWGPTAHE

YQPERWGDDVHAIQRAISQQQVRGSYIPFNAWTRSCIGSEFALLQLRVTLYEIVRHFEITSAPDYRYSIK

VIWSCAFLLRHRIYGRCSRVYGSSEGGC

 

#113

 

>CYP5100A1 BAE65915.1 AP007174.1 [Aspergillus oryzae]

29% to 639A1 very poor match to other P450s

C-term on gene model is not a P450 seq = MFS transporter

AEIFTPAVRQESDLDRKSNVTGGFLHGAVLISLLQYLPLLYQAVQLETAILSAISLLPIVIIGVV

IAAASMLMVPLFGGYVWVLRVGLDHTHPGNRLAGPV 1255617

1252988 MPAISLSLIGIGVVAVGTVWALWALTRKLQVPNNYPNAPRSLPYSIPFLKSTIPFVLDGLNLFRQAS (2) 1253188

1253239 LYCQDRWPLRVDLLNGEVYIVQGAKNIASIFSTPGLTVTQAYGIALKHCFGMEQKAVDAYLADTSGSWHRPIP

GSQTPWHGRVSYHTHENLVRGLLGAGLDPTTERIERLLLASLEGAVSRTSEWTYGMDLTEFFETHLGSAI

LQALYGPLLVTKNSDFNRNLWRYDKQIMRLAKRLSSWLIPEAYRLRDELLGAIMRWHQQATLLSETIPSC

ERTSGGEADPYWGSAMMRERNKMLLSIEGQDAKSVASTDLGFIWA (2)

SVTNVVPSTMTLCTHMYRDHSLVEN

IRLAALNCIRPGATLRFDLNKLGKQPLLLSMYAETLRFGVQIHIPRCSPHQPLSVAGVTIPPDKMIFINT

SLAHTDESVWNTRNGEHPLDTFWAQRFLIDPKDEGSGPTRKECSQPLESTPRGEYKRMDGQGSSSGQFTL

EGLDGSWIPYG (1) 1254606

1254672 GGQHACPGRILAKRIILLASSMMATMFDIELLAPNSLQFGSPRFGFGVRKPSAQVPFRI

RRRKSVSQDPFIC* 1254893

 

>CYP5100A1 AAIH01000177.1 Aspergillus flavus NRRL3357

98% to CYP5100A1 Aspergillus oryzae

22528  MPAFSLSLIGIGVVAVGTVWALWALTRKLQVPNNYPNAPRSLPYSIPFLKSTIPFVLDGL  22707

22708  NLFRQAS (2) 22728

22785  LYCQDRWPLRVDLLNGEVYIVQGAKNIASIFSTPGLTVTQAYGIALKHCFGMEQKAVD  22958

22959  AYLADTSGSWHRPIPGSQTPWHGRVSYHTHENLVQGLLGAGLDPTTERIERLLLASLEGA  23138

23139  VSRTSEWTYGMDLTEFFETHLGSAILQALYGPLLVTKNSDFNRNLWRYDKQIMRLAKRLP  23318

23319  SWLIPEAYRLRDELLGAIMRWHQQATLLSETIPSCERTSGGEADPYWGSAMMRERNKMLL  23498

23499  SIEGQDAKSVASTDLGFIWA (2)

       SVTNVVPSTMALCTHMYRDH  23678

23679  SLVENIRLAALNCIRPGATLRFDLNKLGKQPLLLSMYAETLRFGVQIHIPRCSPHQPLSV  23858

23859  AGVTIPPDKMIFINTSLAHTDKSVWNTRNGEYPLDTFWAQRFLIDPKDEGSGPTRKECSQ  24038

24039  PLESTPRGEYKRMDGQGSSSGQFTLEGLDGSWIPYG (1)  24146

24215  GGQHACPGRILAKRIILLASSMMATMFDIELLAPNSSLQFGSPRFGFGVRKPSAQVPFRI  24394

24395  RRRKPVNQDPFTC*  24436

 

#114

 

>CYP5101A1 BAE65910.1 AP007174.1 [Aspergillus oryzae]

first exon may be wrong

MGRSRSTDWR  ()

NSSALFARAKKEFRHKLCALRIAGQDMVMVTTAAQIAAIDKDSPTFAFEPFVDLVYDEIA

TVSRESKPLLWRTPAEGYKSLFPSAKQMTAAHTGIHLLHKQLTQPDAMHRFMTNSLVHVNNTLQWDSFYN

TSVLAATADVKVVSLECLCRDVIIDAQLTSFFGPRILEIEPDIRSFLKAWDSISWKVSYRLPSFLAKHAT

QLRDHLIEVLVKYYAFPAEERPGSVSFVNDVYDDYKQAGIPDRDIAGIVFTILWGLNSNVNAISYWMIAH

LMNNPTVVNEIREEIAPMMRALDSSPTIDGTILADVSKDPLLNSCPIMNSTFNETLRFTATGSSFRETTR

DTTMDGRRIPKGTKNIIPQRTQMMHSAAFGPDPETFDCYRFYRNKSLLRKVEFRGFGGGTTLCSGRVVGR

HQVLAYLALLFWRYDLEVIGPDQEVLGVRGKGFPRLDEAKPSLGPGKPIDGDDQILRLTRRNV

 

>CYP5101A1 AAIH01000177.1 Aspergillus flavus NRRL3357

99% to CYP5101A1 Aspergillus oryzae

12856  MGRSRSTDWR ()

       NSSALFARAKKEFRHKLCALRIAGQDMVMVTTAAQ  12677

12676  IAAIDKDSPTFAFEPFVDLVYDEIATVSRESKPLLWRTPAEGYKSLFPSAKQMTAAHTGI  12497

12496  HLLHKQLTQPDAMHEFMTNSLVHVNNTLQWDSFYNTSVLAATADVKVVSLECLCRDVIID  12317

12316  AQLTSFFGPRILEIEPNIRSFLKAWDSISWKVSYRLPSFLAKHATQLRDHLIEVLVKYYA  12137

12136  FPAEERPGSVSFVNDVYDDYKQAGIPDRDIAGIVFTILWG () 12017

11949  LNSNVNAISYWMIAHLMNNPTVVNEIREEIAPMMRALDSSPTIDGTILADVSKDPLLNSC  11770

11769  PIMNSTFNETLRFTATGSSFRETTRDTTLDGRRIPKGTKIIIPQRTQMMHSAAFGPDPET  11590

11589  FDCYRFYRNKSLLRKVEFRGFGGGTTLCSGRVVGRHQVLAYLALLFWRYDLEVIGPDQEV  11410

11409  LGVRGKGFPRLDEAKPSLGPGKPIDGDDQILRLTRRNV  11296

 

>CYP5101A1 AAKE02005071.1 Neosartorya fischeri NRRL 181

98% to CYP5101A1 Aspergillus oryzae

runs off the end

  17 QQMTAAHTGIHLLHKQLTQPDAMHEFMTNSLVHVNNTLQWDSFYNTSVLAATADVKVVSL  196

 197 ECLCRDVIIDAQLTSFFGPRILEIEPNIRSFLKAWDSISWKVSYRLPSFLAKHATQLRDH  376

 377 LIEVLVKYYAFPAEERPGSVSFVNDVYDDYKQAGIPDRDIAGIVFTILWG  526

 594 LNSNVNAISYWMIAHLMNNPTVVNEIREEIAPMMRALDSSPTIDGTILADVSKDPLLNSC  773

 774 PIMNSTFNETLRFTATGSSFRETTRDTTLDGRRIPKGTKIIIPQRTQMMHSAAFGPDPET  953

 954 FDCYRFYRNKSLLRKVEFRGFGGGTTLCSGRVVGRHQVLAYLALLFWRYDLEVIGPDQEV  1133

1134 LGVRGKGFPRLDEAKPSLGPGKPIDGDDQILRLTRRNV  1247

 

#115

 

>CYP5102A1 BAE65870.1 AP007174.1 [Aspergillus oryzae] heme signature very altered only C is conserved

1128173 MVVCVITVLILGFLASVRALCNYTRLSTVPGPLFTGLSDLWRTYARSTSDYGCSLAGLHMKYGKVVRLGP

RSISVSDPTAIFPVYNGRPSER (0) 1128448

(?) YEGIIDQ

AANNLITSLRQRPLVRLTTLLQGFATEFINRLVLEESATQVMPFSAQGASCHWYNRTGKWLKLPMIEYVL

LRSPAARLKRRRGISFVPRKVQGGINGSQSSRAMNDGGISYNISLPRSYSNADGAYACIAMAFVSTFSSL

LKHENVMTRLRSEIDTAFSKGLLSDPPRWQELGKLRYLDAVIKESMRQLPSLGYNREVVTPPEGAIVAGY

YIPPGTMMELHSEALRDDPGIYGEDVHTYRPARWLTADLRQRWAMNQNLQQLSTSINDCPKVRVTWLELKKIVVLILLKFNVGLFSVTNSAFD* 1129557

 

>CYP5102A1 AAIH01000069.1 Aspergillus flavus NRRL3357

99% to CYP5102A1 Aspergillus oryzae

27804  MVVCVITVLILGFLAFVRALCNYTRLSTVPGPLFTGLSDLWRTYARSTSDYGCSLAGLHM  27625

27624  KYGKVVRLGPRSISVSDPTAIFPVYNGRPSER (0) 27529

27475  YEGIIDQAANNLITSLRQR  27296

27295  PLVRLTTLLQGFATEFINRLVLEESATQVMPFSAQGASCHWYNRTGKWLKLPMIEYALLR  27116

27115  SPAARLKRRRGISFVPRKVQGGINGSQSSRAMNDGGISYNISFPRSYSNADGAYACIAMA  26936

26935  FVSTFSSLLKHENVMTRLRSEIDTAFSKGLLSDPPRWQELGKLRYLDAVIKESMRQLPSL  26756

26755  GYNREVVTPPEGAIVAGYYIPPGTMMELHSEALRDDPGIYGEDVHTYRPARWLTADPRQR  26576

26575  WAMNQNLQQLSTSINDCPKVRVTWLELKKIVVLILLKFNVGLFSVTNSAFD 26423

 

     1: P  S  E  R  V  T  F  Y  D  T  S  P  S  Y  L  C  T  D  *  F 

     2:  L  V  K  E  *  R  F  M  T  H  R  R  R  I  Y  V  L  I  D  F

     3:   *  *  K  S  N  V  L  *  H  I  A  V  V  S  M  Y  *  L  I  S

        CCTAGTGAAAGAGTAACGTTTTATGACACATCGCCGTCGTATCTATGTACTGATTGATTT

    121 ---------!---------!---------!---------!---------!---------! 180

        GGATCACTTTCTCATTGCAAAATACTGTGTAGCGGCAGCATAGATACATGACTAACTAAA

 

 

     1: R  S  Q  Y  L  N  M  A  I  G  S  Y  S  P  K  A  R  S  R  S 

     2:  V  A  N  I  *  T  W  R  S  D  R  I  H  P  R  L  V  H  E  V

     3:   *  P  I  F  E  H  G  D  R  I  V  F  T  Q  G  S  F  T  K  S

        CGTAGCCAATATTTGAACATGGCGATCGGATCGTATTCACCCAAGGCTCGTTCACGAAGT

    181 ---------!---------!---------!---------!---------!---------! 240

        GCATCGGTTATAAACTTGTACCGCTAGCCTAGCATAAGTGGGTTCCGAGCAAGTGCTTCA

 

 

     1: R  P  I  L  K  V  V  *  *  A  R  W  I  D  G  G  L  W  N  Q 

     2:  D  R  Y  *  K  *  S  N  E  Q  G  G  S  T  E  V  S  G  I  S

     3:   T  D  I  E  S  S  L  M  S  K  V  D  R  R  R  S  L  E  S  A

        CGACCGATATTGAAAGTAGTCTAATGAGCAAGGTGGATCGACGGAGGTCTCTGGAATCAG

    241 ---------!---------!---------!---------!---------!---------! 300

        GCTGGCTATAACTTTCATCAGATTACTCGTTCCACCTAGCTGCCTCCAGAGACCTTAGTC

 

 

     1: R  C  D  M  K  A  S  L  I  R  Q  P  T  I  *  S  L  L  *  D 

     2:  D  A  I  *  R  H  H  *  S  G  S  Q  Q  F  D  H  F  F  E 

     3:   M  R  Y  E  G  I  I  D  Q  A  A  N  N  L  I  T  S  L  R 

        CGATGCGATATGAAGGCATCATTGATCAGGCAGCCAACAATTTGATCACTTCTTTGAGAC

 

>CYP5120B1 AACD01000093.1 Aspergillus nidulans FGSC A4 new not in known set

this p450 belongs to a group of sequences without Cys at heme region

weakly similar to CYP532

38% to AAJN01000022.1

        MVAWA

214086  VLLLAVVAATLLHLLYNYSRLKSVSGPILAAFTDAWRANAQRSSSSSEYGRLLKELHRKY  213907

213906  GVAVRLGPGFVSLSEVGDITRVYHTLLQDE (0)

213714  YESSAADTAMRNLVHTVRRCRTVDMTTLLHFFADEVNTRLFWSACA  213577

213576  PSAASSASSRTHRIQPSFSFFATIEELVLRGPVALLKRERLSCYCLSGDVSAKIYGNE  213403

213402  LVLPTGPSATRKLAISAPDGLILAASIQIITKAFVSVFFFLLNNPLIMRRLR  213247

213246  QEIESIPRFRNRTKLPSSRDLGGLYYLDAVFKETMRLVILQSQPMEVRVTFESLYISSKH  213067

213066  VPRGTVLSWHPHVVLTNDAIYENNLYVFRPERWLTPNRQRQTLMEASLLPFMVCRIHYPK  212887

212886  LEAAWLLLKKTVVVLLREF  212830

        CDVSLSWLLCSSLSISLRSRHDSFGGLLTSSFL*

 

     1: Y  H  T  L  L  Q  D  E  V  C  L  S  G  P  P  A  L  E  W  W 

     2:  I  I  L  C  S  R  T  R  S  V  Y  L  D  P  Q  P  L  N  G  G

     3:   S  Y  S  A  P  G  R  G  L  F  I  W  T  P  S  P  *  M  V  D

        TATCATACTCTGCTCCAGGACGAGGTCTGTTTATCTGGACCCCCAGCCCTTGAATGGTGG

 

     1: I  A  N  W  I  *  V  R  R  L  G  Q  E  A  P  L  P  E  H  Q 

     2:  *  L  T  G  F  R  *  G  D  L  V  R  K  P  P  Y  L  S  I  R

     3:   S  *  L  D  L  G  E  A  T  W  S  G  S  P  P  T  *  A  S  D

        ATAGCTAACTGGATTTAGGTGAGGCGACTTGGTCAGGAAGCCCCCCTACCTGAGCATCAG

 

     1: T  V  Q  Y  E  S  A  A  D  T  A  M  R  N  L  V  H  T  V  R 

     2:  R  C  S  M  R  A  P  L  I  L  P  C  A  T  L  S  T  Q  Y 

     3:   G  A  V  *  E  R  R  *  Y  C  H  A  Q  P  C  P  H  S  T 

        ACGGTGCAGTATGAGAGCGCCGCTGATACTGCCATGCGCAACCTTGTCCACACAGTACGC

 

Note if A. nidulans seq was modified by adding red bases the

Protein seq would be

ATTAGTGCACCCCGACGGCCTCATCCTCGCTGCGAGCATTCAGATTGTATAACGAAGGCTTTT

I  S  A  P  R  R  P  H  P  R  C  E  H  S  D  C  I  T  K  A  F

Red region would differ and would resemble the related sequences

 

>CYP5121B1 AAKD02000042.1 Aspergillus clavatus NRRL 1

39% to AAKE02000008.1   Neosartorya fischeri

       MAAFG

82938  ILLSAVLVLGGVLLRNYVSLNTVRGPLLAGISNLWREFLQSAPEYGRRLESLHRKY  83105

83106  GQVVRVGPNTVSVSDPSLVAWIDLSDRGTVN (0) 83162

       QLTSTFLRAVRKQRTINLAVFKLFAADIVQHM  83430

83431  CSNDIIQPRASQVPFATDPFIPTESSYVSSFLNSLLLKCPIAMLKHKRNGCLPI  83592

83593  CGFVPESVKRPNAYQPVAGEYQRSGNVSLVAIGVECMEATFASVFYFLSTH  83745

83746  PATLSRIKREIDTIFSMASFSEVLHQTKSYALPYVEAVMKETLRHVMIFDYQHQVPPG  83919

83920  GVMVGEYDLPQGTVIQYHADTIRHNSTTYGEDSALFRPERWLLADTTERKRMEEGLIPLR  84099

84100  ICFRNDSQTRAAWRSLKMIIALVISKFDV  84186

 

     1: N  M  V  R  W  F  V  S  G  R  I  R  S  A  S  L  I  L  L  S 

     2:  I  W  S  G  G  S  C  R  A  E  Y  G  Q  R  L  *  S  F  S  R

     3:   Y  G  Q  V  V  R  V  G  P  N  T  V  S  V  S  D  P  S  L  V

        AATATGGTCAGGTGGTTCGTGTCGGGCCGAATACGGTCAGCGTCTCTGATCCTTCTCTCG

 

     1: S  L  G  L  I  F  R  I  E  G  R  *  M  Y  V  I  A  L  P  D 

     2:  R  L  D  *  S  F  G  S  R  D  G  E  C  M  L  *  P  F  P  I

     3:   A  W  I  D  L  S  D  R  G  T  V  N  V  C  Y  S  P  S  R  Y

        TCGCTTGGATTGATCTTTCGGATCGAGGGACGGTGAATGTATGTTATAGCCCTTCCCGAT

 

     1: T  Y  C  F  A  D  N  A  E  T  S  F  G  N  D  I  G  T  A  T 

     2:  H  T  A  L  L  T  M  L  R  R  P  S  A  M  T  *  A  Q  Q  Q

     3:   I  L  L  C  *  Q  C  *  D  V  L  R  Q  *  H  R  H  S  N  R

        ACATACTGCTTTGCTGACAATGCTGAGACGTCCTTCGGCAATGACATAGGCACAGCAACA

 

     1: E  S  S  V  D  P  Q  Q  Y  A  S  P  H  E  Q  R  I  E  Q  L 

     2:  S  H  L  S  I  L  N  S  M  H  R  R  M  N  N  A  L  S  S  *

     3:   V  I  C  R  S  S  T  V  C  I  A  A  *  T  T  H  *  A  V  D

        GAGTCATCTGTCGATCCTCAACAGTATGCATCGCCGCATGAACAACGCATTGAGCAGTTG

 

     1: T  S  T  F  L  R  A  V  R  K  Q  R  T  I  N  L  A  V  F  K 

     2:  Q  A  H  F  *  E  L  F  A  N  N  E  P  L  T  W  Q  F  L  S

     3:   K  H  I  S  E  S  C  S  Q  T  T  N  H  *  L  G  S  F  *  V

        ACAAGCACATTTCTGAGAGCTGTTCGCAAACAACGAACCATTAACTTGGCAGTTTTTAAG

 

>CYP5121A1 AAKE02000008.1 Neosartorya fischeri NRRL 181

42% to AAKD02000042.1 Aspergillus clavatus

1210404  MAVFAALLLLLCVFGGILWNYTRLNTIPGPLLAGLSDIWSQCLKSSPRYAYRLQRLHRKY  1210583

1210584  GEVVRIGPKTVSVTDPSNIFWLDAACPQRSK (0) 1210676

1210852  DLVLDFLKAIRKQRTMKLTVFRDFATDIVGRMFVGDLEDDRAAPMRTGSNQMDRCRFTTS  1211031

1211032  LDHIMFKNPVAKLKRKRNKSLRWVSCAVTHSRWDDASIFEVLPETGRKTFLQ  1211187

1211188  AETREYGGPYASLIVKGADCMVAAFVSVFRHLLKCPTAMSQLQHEVDNAFRNLTLSD  1211358

1211359  ILQQETELHALSFLDAVIKESMRLALRFDYLRDVPAGGLAVLGHYLPEGTVVQFHSEA  1211532

1211533  LRNNRTIFGEDVSDFRPQRWLQADLDQWQRKQMEALLFLRPNMPNSAKARAAWLELKRA  1211709

1211710  AALIILKFDV  1211739

 AGCCCTTCCCGATACA

AGAAGTCGTTTCTTGAT

 

TACTGCTTTGCTGACAATGCTGAGACGTCCTTCGGCAATGACATAGGCACAGCAACAGAG

AGCTATGTGGATGAACCAGAAGGAGCGACTGTCAATTCTCAGCTCAAAAGCAATCATCGT

 

TCATCTGTCGATCCTCAACAGTATGCATCGCCGCATGAACAACGCATTGAGCAGTTGACAAGCACA

GTTTACCTAGACGAACAGACAGACGATGGACCTCAACATAATGATAAAAAGGACCTGGTTCTCGAC

 

     1: C  S  V  F  I  A  N  M  A  R  W  F  A  *  G  R  R  R  S  A 

     2:  A  A  S  S  S  Q  I  W  R  G  G  S  H  R  A  E  D  G  Q  R

     3:   Q  R  L  H  R  K  Y  G  E  V  V  R  I  G  P  K  T  V  S  V

        TGCAGCGTCTTCATCGCAAATATGGCGAGGTGGTTCGCATAGGGCCGAAGACGGTCAGCG

 

     1: S  L  T  P  P  T  F  S  G  W  M  P  P  V  H  K  G  R  R  Y 

     2:  H  *  P  L  Q  H  F  L  A  G  C  R  L  S  T  K  V  E  G  I

     3:   T  D  P  S  N  I  F  W  L  D  A  A  C  P  Q  R  S  K  V  F

        TCACTGACCCCTCCAACATTTTCTGGCTGGATGCCGCCTGTCCACAAAGGTCGAAGGTAT

 

     1: S  S  L  P  F  Q  A  D  G  L  Q  A  E  I  *  K  S  F  L  D 

     2:  H  H  F  L  F  K  Q  M  D  Y  K  L  R  F  R  S  R  F  L  I

     3:   I  T  S  F  S  S  R  W  I  T  S  *  D  L  E  V  V  S  *  *

        TCATCACTTCCTTTTCAAGCAGATGGATTACAAGCTGAGATTTAGAAGTCGTTTCTTGAT

 

     1: S  Y  V  D  E  P  E  G  A  T  V  N  S  Q  L  K  S  N  H  R 

     2:  A  M  W  M  N  Q  K  E  R  L  S  I  L  S  S  K  A  I  I  V

     3:   L  C  G  *  T  R  R  S  D  C  Q  F  S  A  Q  K  Q  S  S  C

        AGCTATGTGGATGAACCAGAAGGAGCGACTGTCAATTCTCAGCTCAAAAGCAATCATCGT

 

     1: V  Y  L  D  E  Q  T  D  D  G  P  Q  H  N  D  K  K  D  L  V 

     2:  F  T  *  T  N  R  Q  T  M  D  L  N  I  M  I  K  R  T  W  F

     3:   L  P  R  R  T  D  R  R  W  T  S  T  *  *  *  K  G  P  G  S

        GTTTACCTAGACGAACAGACAGACGATGGACCTCAACATAATGATAAAAAGGACCTGGTT

 

     1: L  D  F  L  K  A  I  R  K  Q  R  T  M  K  L  T  V  F  R  D 

     2:  S  T  F  S  K  P  S  E  N  N  V  P  *  N  *  L  C  S  E  I

     3:   R  L  S  Q  S  H  P  K  T  T  Y  H  E  T  D  C  V  P  R  F

        CTCGACTTTCTCAAAGCCATCCGAAAACAACGTACCATGAAACTGACTGTGTTCCGAGAT

 

>CYP5120A1 AAJN01000022.1 Aspergillus terreus NIH2624

36% to CYP5102A1

33059  MVTLAIVVLFVLIASIRLLYNHVRLNTIPGPVLAGLSSFWLHAQPSSQLPNSLLQLHE  33232

33233  KYGTIVRIGPDLVSVSNPATIVLIYTRRSRNR (0) 33328

33462  YEGLVDPALRNLVHTLRRYQTLDLASFLHFFAADFLSRLTTLHPAGANNA  33611

33612  RRHEPTERGLPGFFAECLLLRGPISRLKRQHGCPFICREVRSHFTGQPTSISSRTLFK  33785

33786  SEDHPSPMEEHLDCIAKTFVSTFRFLLKYPAVMRKLRREIVAAHNHNNLSPLPLW  33950

33951  SELGELKYLQAVMKESLRLSHVHRVHEVKSPAGGVTVSGYYVPQGTTIRCHPLVVHNNA  34127

34128  QIYGDRPQVFDPERWLNNDLQRQKCMTECLMLFQQHVFENPTIYAAWWELKKAIVVVLMW  34307

34308  FNVSGIQQ* 34334

 

     1: D  L  Y  A  A  I  A  E  *  G  E  S  S  C  K  C  V  E  E  * 

     2:  I  Y  T  R  R  S  R  N  R  V  S  L  H  V  N  V  S  R  N  D

     3:   S  I  R  G  D  R  G  I  G  *  V  F  M  *  M  C  R  G  M  I

        GATCTATACGCGGCGATCGCGGAATAGGGTGAGTCTTCATGTAAATGTGTCGAGGAATGA

      1 ---------!---------!---------!---------!---------!---------! 60

        CTAGATATGCGCCGCTAGCGCCTTATCCCACTCAGAAGTACATTTACACAGCTCCTTACT

 

 

     1: Y  Q  S  L  S  S  *  S  T  I  Y  N  A  Q  R  L  V  M  S  I 

     2:  T  N  L  C  L  A  K  V  Q  Y  T  M  P  S  D  L  S  C  P  S

     3:   P  I  S  V  *  L  K  Y  N  I  Q  C  P  A  T  C  H  V  H  P

        TACCAATCTCTGTCTAGCTAAAGTACAATATACAATGCCCAGCGACTTGTCATGTCCATC

     61 ---------!---------!---------!---------!---------!---------! 120

        ATGGTTAGAGACAGATCGATTTCATGTTATATGTTACGGGTCGCTGAACAGTACAGGTAG

 

 

     1: R  P  K  P  S  A  A  D  S  P  T  H  S  S  M  K  G  S  L  I 

     2:  D  R  N  R  L  Q  Q  T  V  Q  R  T  A  V  *  R  A  R  *  S

     3:   T  E  T  V  C  S  R  Q  S  N  A  Q  Q  Y  E  G  L  V  D  P

        CGACCGAAACCGTCTGCAGCAGACAGTCCAACGCACAGCAGTATGAAGGGCTCGTTGATC

    121 ---------!---------!---------!---------!---------!---------! 180

        GCTGGCTTTGGCAGACGTCGTCTGTCAGGTTGCGTGTCGTCATACTTCCCGAGCAACTAG

 

 

     1: Q  P  C  A  I  W  S  I  P  S  D  D  T  R  P  S  T  W  P  A 

     2:  S  P  A  Q  S  G  P  Y  P  P  T  I  P  D  P  R  P  G  Q 

     3:   A  L  R  N  L  V  H  T  L  R  R  Y  Q  T  L  D  L  A  S 

        CAGCCCTGCGCAATCTGGTCCATACCCTCCGACGATACCAGACCCTCGACCTGGCCAGCT

 

>CYP5121A2 Aspergillus fumigatus Af293

         GenEMBL AAHF01000006.1

         80% to CYP5102A1

2336635  MAVFAALLLILCVFGGILWNYTRLNTLPGPLLAVLSDIWSQCFKLSPGYAYRLERLH  2336805

2336806  RKYGEVVRIGPKTVSVSD  2336859

         PSIVFWLDAACPQRSK (0)

         NLVL

2337098  NFLRAIRRQHTMKLTVFRNFATDIVGRMFVGDLGDDRAAPIGTRSNHIDRCRFTTSLD  2337271

2337272  HIMFKSPVAKLKRKRNKGLRWISCAGTYSRWNDASIVDVLPETGRKTILQAETRE  2337436

2337437  YDGPYDSLIVNGADCMAAAFVSMFRHLFKCPTAMFQLQDEVDNAFRNLTISDVLHQET  2337610

2337611  ELHALPFLDAVMKESMRLAMKFDYRRAVPAGGLAVLGHYVPERTVVQFHSEALRNNRT  2337784

2337785  TFGEDVSDFRPQRWLQADLDQWQRTRMEEALLFLRPNIPNSAEARAAWLELKRAAALIIW  2337964

2337965  KFD VSTVGSPAEVKLIYLSCILSTMRKCSSKMLSLQSKN  2338081

 

     1: D  A  A  C  P  Q  R  S  K  V  F  I  T  S  S  P  S  R  W  I 

     2:  M  P  P  A  L  K  G  R  R  Y  S  S  L  P  L  R  A  D  G  L

     3:   C  R  L  P  S  K  V  E  G  I  H  H  F  L  S  E  Q  M  D  Y

        GATGCCGCCTGCCCTCAAAGGTCGAAGGTATTCATCACTTCCTCTCCGAGCAGATGGATT

 

     1: T  C  *  D  S  E  V  V  S  *  *  L  C  G  *  T  R  R  S  D 

     2:  H  A  E  T  Q  K  S  F  L  D  S  Y  V  D  E  P  E  E  A  I

     3:   M  L  R  L  R  S  R  F  L  I  A  M  W  M  N  Q  K  K  R  L

        ACATGCTGAGACTCAGAAGTCGTTTCTTGATAGCTATGTGGATGAACCAGAAGAAGCGAT

 

     1: C  Q  F  S  T  Q  K  R  S  S  Y  L  P  R  R  T  D  R  R  W 

     2:  V  N  S  R  L  K  S  D  H  R  I  Y  L  D  E  Q  T  D  D  G

     3:   S  I  L  D  S  K  A  I  I  V  F  T  *  T  N  R  Q  T  M  D

        TGTCAATTCTCGACTCAAAAGCGATCATCGTATTTACCTAGACGAACAGACAGACGATGG

 

     1: T  S  T  S  *  *  N  Q  E  L  G  S  Q  L  S  Q  S  H  P  K 

     2:  P  Q  H  H  D  E  I  K  N  L  V  L  N  F  L  R  A  I  R  R

     3:   L  N  I  M  M  K  S  R  T  W  F  S  T  F  S  E  P  S  E  D

        ACCTCAACATCATGATGAAATCAAGAACTTGGTTCTCAACTTTCTCAGAGCCATCCGAAG

 

#116

39% to 54C1

>CYP5103A1 BAE65635.1 AP007171.1 [Aspergillus oryzae] removed some seq

14 P450 genes and 2 pseudogenes on this contig

46% to AAGI01000167.1 Phaeosphaeria nodorum

37% to 54A1, 38% to 54B1

MEVQYILGILHNLDLAIWAVLIFIAFVLVTQAHYKAQLAKLPTFETDKGNEKWRRTYSDSARMLYQEGHKK

VSYLFKDQAWIMPT

SDGRKNVVVPGRLLSE

LSKLPETVLSFPTAINKVLEVKYTKVAPDEPFAPYCIK

ADLNPALSRLNPIIYREVENALEDEIPQCEDWTPVFIYRKLLNTVAKVSGRIFVGAELSHNKDYLDTAIN

YTIELGNAVQAVKQMKPWLRPFLAWKLPEVQQLNKREEMAIRFLEPIIQARREASKDPDTKSPMTCCSGS

LLRRIVKMQLLVIFAGIHNTTVTATNVLYNLAVSPEYMQPLREEICKAISDNDGTLTSRALQQVEKLDSF

MKETIRFYPQNSLPSRAKRGQYIPPGTSIEAPLQAIYQDDSNYPDSDTFAGFRFYKIRQGGGATVHARNQ

FVTSNEQNLVFGYGKHACPGRFLAAAEIKMIVSKILLTYGFKNADNWTERYSNYEVGRLNMPERAIPLLF

RKTTAQDSSL

 

>CYP5103B1 AAGI01000167.1 Phaeosphaeria nodorum SN15

46% to CYP5103A1, 41% to 54A1 some gaps in seq

4489  MDVEKLAGLAYTFQTITIASLVFVVLTYAPKLMRRLQLAKLPSMPGKDYATS  4334

4333  ARKLYKEGHQKV (?) 4298

4170  SIGEHSVVVPPHFLPELRKLPDDVLSFAAAIDN (0)  4072

4025  VMETKFTGVDSEDSNTVHTIKSDLTPALPRLNQAVCTEVDAAMREALPSCEDWTEVDIN  3849

3848  DKLLDIISKVSGRVFVGPDLCHDPEYLELGRNYTVYLMEALFAIKRTRPWLKSFVGHRLP  3669

3668  EVKRLRDVEKKAIKFVQPIVRERLEAEKSDPNWQKPDDMMQWLINRYNKDGHVSVEHIAK  3489

3488  CQLGLILAASHTTTMTTTNILYTLVSTPEYVEPLREEIRNAMHGNGGSITTRALQEMVKL  3309

3308  DSYMKEVLRLYPAG (?)

3165  GQYLPPGATVQVPTAAIYTDSENYPDPDTFDGFRHSKLREGGTATDHSRNQFVTTNETNL  2986

2985  GFGYGRHACPGRFFAANEIKMIVARLILNYDMKMPGDATERYPNVDIGRSCIPCPGKTLM  2806

2805  FKRV*  2791

 

#120

 

>CYP5104A1P BAE64914.1 AP007171.1 [Aspergillus oryzae]

pseudogene just upstream of CYP5117A1 about 800bp, missing C-term

14 P450 genes and 2 pseudogenes on this contig

MQQNMIIPSFWTGTAIIGLVACAYVSYQCLLSPLARFPGPFAAKLSKGWRAYKTANGQWHRKLVDLHRKY

GHVVRIAPNELSVGDPSSFRKIYSPAEAGNGFNKAACYSVVQGNRPFDLTGERNEKVHSEQRKLVATAYS

MSSMVHFESKVNVVIETVIHKLEARCRKTIDLGHWLQMWAFEPTRPLLNSLKPDVIGSVSFSQPFGYVES

GDDEGVFKRIQNAMGSAAWLMHAGWLFRLHQKLIPICGNWLAVNDRNGYFFQVACREVSGRINRGGDDKD

IIGQLLETQKIKPQLKDLDISFMMTSNVFAGSDSTSIAFQSIFYLLLTHPAAHDRLMRELREREEKGELS

DPVSFQEAESWPYLQAIIYEAMRLYAPAAFVLDRVVPPEGMMIEDKFVPGNTVVGSSAWVIHRNPEIWGP

DVDTFRPERWLDD

ERYFFAFGGGSRTCIGKSMCSSTAYICFLTNVCFRYQLA*

 

>CYP5104A2P AAJN01000022.1  Aspergillus terreus NIH2624

probable pseudogene 54% to CYP5104A1P

       MKLLALLLDSSAIATLLLA

68053  VTTGYVVYQVFFSPLAAFPGPFWAKVTYWYWAWRSMRGQAHRDLVNLHQRYGSVVRLGPD  68232

68233  YL (2) 68238

68297  ERGKSKSFQEIYS (?)

       PEEAGGKFRKSAVHDTVTGTRPFDLLAQRDE  68476

68477  KIHSGQRRLVASAYTMDSIVYLEPMVDSLIVSTMEKLSTLPGDIDLGGWIQLFAF () 68641

68712  DVIGAISFSRPSGFIEAGDDGGIFRRMQNSLSSISWLMYVDWFYSLYQRLMPVIGNWLAA  68891

68892  NDRNGHFFNFARQEITARKDRAGNTKDMASQLFAVQHTKTELDDTNIAFMMASNVLAGSD  69071

69072  TTSTSARAVIYLLLKNPKSLQRLLDETEERKSDGRLSYPVKFQEAESWPYLQAVMYEAMR  69251

69252  LYPAVGRNLDRDVPAGGLRIGDHWVPEG (0)

       TMVGSTAWAIHRIP  69431

69432  EIWGPDVEDFRPERWLDE (?) 69485

       ERYFFAFGGGSRTCIGR (?)

       VLYYLRLIVLQFVPTLFMRFDVDLVPGTALEEFCG*

 

#123

36% to 682B1 missing PKG motif, frameshift at YIL/PGT, this restores the PKG motif, possible pseudogene

>CYP5105A1 BAE64645.1 AP007171.1 [Aspergillus oryzae]

262325 MTLFQVVETSFILLALWTSVEAIRRLFSHSLSHIPGPRLAALTWWYEFYYDAVQSGQYVFKIQELHKQY (1) 262531

262599 GPIIRITPDEVHINDVGYLDTIYAPSMTRLDKYDYQLRTLRVPGGVGTTADYYLHRIRREALPPFFSKRNV

LWLESVITEKVNQLCGLIAKHAATETPVNLSDAFYGFSNY (2) 262931

VVNNFLFAHQTDVLADEQEAARLRHNSHEL

LKGINMNKHFPWIPDILEALPQLLTRPTMPPGLIDMLELFD (0)

RVRAELITIITRISSNTSGEKESINTGAK

GSVYESVLDSPNLPASEKALLRLEQEGALLTLAGTESPAQTLNIIFYHLLANPSLLTKLREELATLPTLS

TWTQLEQLPYLSAIIEEGNRLSFGVTARTARIQHTPITYTPSAYVTTPDPTHKSYIL 263721

263721 PGTPVSITTLSAHTAESVFPDPYAFLPERWLGD

EGRERRKFQLTFSRGGRKCLGIELARAELYLVTAALVRKFDLVLWETDERDVSFEHDYHVAMPRDGSRGV

RVVARIRGGLALSRDRLTTK 264089

 

>CYP5105A1P AAIH01000184.1 Aspergillus flavus NRRL3357

pseudogene with 4 stops, 96% to #123

38647  MTLFQVVETSFILLAL*TSVEAIRRLFSHSLSHIPGHRLAAFTWWYEFYYDAVQSGQYVF  38826

38827  KIQELHKQY (1)  38853

38921  GPIIRVTPDEVHINDVGYLDTIYAPSMTRLDKYDYQLRTLRVPGGVGTTADYYLHRIRRE  39100

39101  ALPPFFSKRNVLWLESVITEKVNQLCGLIAKHAATKTPVNL*DAFYGFSND (2)  39250

39309  VVNNF*FAHQTDVLADEQEAARLRHNSHELLKGINMNKHFPWIPDILEALPQLLTRPTMP  39488

39489  PGLIDMLELFD (0)

       RVRAELTTIITRISSNTSGEKESINTGAKGS  39668

39669  VYESVLDSPNLPASEKALLRLEQEGALLTLAGTESPAQTLNIIFYHLLANPALLAKLREE  39848

39849  LATLPTLSTWTQLEQLPYLSAIIEEGNRLSFGVTARTARIQHTPITYTPSAYVTTPDPTH  40028

40029  KSYILPPGTPVSITTLSAHTAELVFLDPYAFLPERWLGDEGRERRKFQLAFSRGGRKCL  40205

40206  GVELARAELYLVTAALVRKFDLVLWETDERDVSFEHDYHVAMPRDGSTGVRVVARIR*GL  40385

40386  ALSRDRLTTK  40415

 

>CYP5105A2P AAID01002562.1 Botryotinia fuckeliana B05.10

pseudogene 61% to CYP5105A1, 36% to 682B1

frameshift at KIQ, also after PIMP, one stop, runs off the end

1431  MAFAQLLGTGIILSLILTIAEATRRLYFHPLAHIPGPKLAALTWWYESYFDVIQPGQYVF  1252

1251  KIQ

      NLHKQY (1)

      GPILRNTPDELHIQDVGFLDTVYAPSASPRNKY  1072

1071  EYQLRTLRIPGGVRTTARYDLHKKRRAALSPFFSKRNVLHLEPLINKKVEQLYQMIDKHA  892

891   KEQSPAN*SDLLFAFSND (2)

      VVTNFLFNHQVDVLSDETRAVELRH  712

711   NSHQLLMGININKHLPSIPDFSESLSLSISKPIMP

      PGLIDMHAPFD (0)

519   RVRTELTDIMSSKPSEVSSEKLLGPTKKESVFASILDSAILPPTEKTLLRLQQEG  355

354   SLSVLAGTESPAQTLKIIFYHLLTNPAIIAKLRAELDTAPTPTSWATLEHLPYLSAVIDE  175

174   GNHLSFGVTARTARIADEQLTYTPSSHVTSTTNKGTFYKIPTGTPISITTLSAHTAET  1

 

#124 revised

 

>CYP5106A1 BAE64452.1, BAE64451.1 AP007170.1 [Aspergillus oryzae]

137250 MSFASALILVVAIWCIYVGWPWYRNWKQAKALHVPIVISPISTS

       GAALQSLRYILDRDILPTWITRLAFVRLIQRNSRFQEKFAVHAEYGKLFILVTPATCE

       LYVADVDAAKQVLSRWRDFPKPSSLLGMIFPERNA (1) 137663

       GADWQRHRKLTARAFNEKLHEAVWAESTRNATKV

137909 MTKWNNTKPVYSTRSDMMALSLAVLFKACLNIDGDDKDDTRILAGDVAACQWHLDVVLKGISNPMALGRG

FEGIKKLKRSHKALGELLTEFVEARTIRPKLSAHADLLSSILAPTDHRGLSSDEVTGNLFLFMFAGHETT

ANALIYIIHLMAIFPAWQDWALEEIDQLSHNRADGEEVPSYSQILPQTQRLRAIL (0)

YETLRLYGPVPTLVRQTDPQAQTLVLPEQEVIIPKDTPVNVNTIALHTDPKQWGPDPLAWR

PDRWILQPCDSSLQKVSNELLKYLFAWGDGPRLCPGQRFSQIEVFAVLICFFKS

HRVELVPSRDQTMDQARSHALSLIQNSKVGLTLQMPDAESVGLRWVGR*

 

>CYP5106A1 AAIH01000668.1 Aspergillus flavus NRRL3357

only one amino acid difference

 

#128

42% to BAE63454.1   [Aspergillus oryzae]

>CYP5107A1 BAE63455.1 AP007167.1 [Aspergillus oryzae]

601589 MIGEQYTSIITGFKSALAVSCIAVSLFLLSPWIAYARLPSSIKSPIKAKGPLSALRACLNEISAGAKTST

RGYELY (0)

SKKGQSFAMLNINFRPQVILPPEHVRWLVTQPEDILSHAKASDDADALGYIWPLFDASALHSFS

KVLQIDLTRNVTQTEKDVLEEVQHIMDELVGQTESWKEVNMVQAFERIMYQATQRVYVGLPLCRDSTYMG

YVKGYARSLGTAMVFAAQLTPWPLRQVTALLAGLPVYYYVLRVRSYLSPLFKERMERLKEKGGTQDDNLE

GEPRNLITWMSNGVLSGVGPKSISPSEMVTWLGIL (?)

602662 ALLPTDNLWTTCTNVLLDLLSSESEHAYLHTIREE

ARTVFASSKESGKPVSHGLHHIDSAIRESLRMNSLSPRSLHRQVVRRGGVVLPDGQKVPTGTWLCVLSGN

IQRDEDYYEDAQTYKPFRFVPKLTEAGGDKAPLLPLTNEKYLTFGYGRHAC (2) PGRWFSFQVMKIVIAYILA

NYDIQPLEKRPDNIVFADLNIPHLSHIIRIKRMT 603339

 

>CYP5107A1 AAIH01000006.1 Aspergillus flavus NRRL3357

only one amino acid difference

complement (71337-73087)

 

#129 only 679bp from CYP5107A1 pointing away from each other

42% to BAE63455.1 AP007167.1 [Aspergillus oryzae]

one stop codon, possible pseudogene or seq error.

>CYP5071B1 BAE63454.1 [Aspergillus oryzae] heme signature incomplete

600910 MQIADMAASTTAQILVVSLGLLIFVLLCPWFGYLRLPSSMRWWPSIPSGPLSALRLSLKEYSGSRSSENG

YKAFSKKAEPFAICNPSFYPQVLLPPEQIPWLLSQPENVLSHEKANEDVHALPFLAPAFDNYDHLELIRA

IRTDLTRNIPNTEDAFLDELRHTTNEVLGAPGDNAWKEVNLTVALDSIIFGICLRLFFGVSLSRNRTFVY

YVKIFTRVTGAMMLFVSQLVPWPLKPVVGIVAGFPIYYYWVRLIIYLYPTFKERIQCLRTKKETPPADMV

TWMVDLAISQNPTRKVHISSLIVRLTLININVRLTRSSKVFLPVDVLIAMTDNFFLDLLSSDPDRKYYNA

LRQEAEAAFTNRDKTQPISQSMPYMESTIRESLRLSPLSDRMLSRRVVHKGGITLPDGQFLPRGTWLAVA

AVGVHRDERTYEDPDEYRPFRFLSEDTETKEAKAMLVPVTSEKFLAFGHGRHSC (2) 599384

599313 PGR*FAAHAMKLIIGYILVNYDIEP

LEKRPVNSVVGQTIIPQLDVKIRVRRRE 599155

 

#130

 

>CYP5108A1 BAE63248.1 AP007166.1 [Aspergillus oryzae]

all the best hits are CYP51

but at low 20% range, revised at N-term

1834519 MLEALLFRPSLLSFISAWLGTLGLALLLFSSRRASTKLPPRANGGIYFI

SDILVFLASPVQFVKQATGKHGSVFRIDCLVKQIFYLRGQKWNRFFLEMK

EDTWSFSGGI (0)

1834137

GMFLNKAANPGYFTHGRNLLGSINRGVNRSAALQSYGRLAGEEAHKSLQHWSQMPDVEIFESISRFVHRVI

VRCMMGEDFYDHHVDELYDLLQQMESLVGHPFNLLLPSWVPHLPGRQLAQARNRFAEIFRERLAARQLES

DVWRDSLDYINYTLNDPRTAQLADYYPSHHVVLMFAAHTSTVASIAWTIVE (0)

1833514  LLRHPIYQEEIRESLATMSDIHQCAPLLACLREEG

RRYSGVHMFRTTKQPVSLEGSDYTVPEKSVVLISPYLTHHDPAIYPEPHEYQP

HRWLLPDGRLNPWNGSKEAAFLQFGAGNHRCPGENFAAIIAREFLAALLMKYEIEWGRDGAPADLSRLDF

TKVGSPWLEGDAAVRIRPRVFGS 1832966

 

>CYP5108A1 AAIH01000996.1 Aspergillus flavus NRRL3357

99% (4 aa diffs) to CYP5108A1 Aspergillus oryzae

6424  MLEALLFRPSLLSFIAAWLGTLGLALLLFSSRRASTKLPPRANGGIYFISDILVFLASPV  6603

6604  QFVKQATGKHGSVFRIDCLVKQIFYLRGQKWNRFFLEMKEDTWSFSGGI  6750

6806  GMFLNKAANPGYFTHGRNLLGSINRGVNRSAALQSYGRLAGEEAHKSLQHWSQMPDVEIF  6985

6986  ESISRFVHRVIVRCMMGEDFYDHHVDELYDLLQQMESLVGHPFNLLLPSWVPHLPGRQLA  7165

7166  QARNRFAEIFRERLAARQLESDVWRDSLDYINYTLNDPRTAQLADYYPSHHVVLMFAAHT  7345

7346  STVASIAWTIVE (0)

      LLRHPIYQEEIRESLATTSDIHQCAPLLACLREEG

7540  RRYSGVHMFRTTKRPVSLEGSDYTVPEKSVVLISPYLTHHDPAIYPEPHEYQPHRWLLPD  7719

7720  GRLNPWNGSKEAAFLQFGAGNHRCPGENFAAIIAREFLAALLMKYAIEWGRDGAPADLSR  7899

7900  LDFTKVGSPWLEGDAAVRIRPRVFGS  7977

 

>CYP5108B1 AAJN01000021.1 Aspergillus terreus NIH2624

43% to CYP5108A1

       MLTQELQAIYANNAGFLITSL

70767  LAFALLALAVRSFLRSEKIPLVSAGLPILGNLQKYSLDPVGFIASATRLHGECFAVPML  70943

70944  FGRTIWLRSPQLNKEYLETRE (0)

       DVWSFGDGMGLFLNKIVIPGYF  71123

71124  SHLRSMVGSLSRGISRKATLEYYAQVADEETAKAVDGWTCKSEAEKSVALFEEISFLVHK  71303

71304  IIVRCLMGQDFYDHHVRELYDLLRTMEANVGSIWHTVLPGWVAHGPARRLWRCRQRVQEI  71483

71484  FDFRLRERERSPEEWKKRLDYISYTLQDPATAHLSRFYGAHHTLLMFAAHTSTVASISWI  71663

71664  LLE (0) 71672

       LLRSPHRLQRLREELATHALEQSPFLDALVKETG

71834  RHYSGNSDVRWARKPKTLRTEVASVPESRITIPEGTIVSISPYLTHHDPATWDNADTYLP  72013

72014  ERWLADPDLAKKMNEGGQLRYIPFGAGSHRCPGEKMAILIAKIAVARIVQSCDLAWGEGS  72193

72194  SENTLGGLDFSKVGSPWLKGDVQVRFQ  72274

 

#133

36% to 573A2

>CYP5109A1 BAE63087.1 AP007166.1 [Aspergillus oryzae]

1411903 MSPFIFAVTLTFAILALGILRRRYFHPLSRFPGPFLGSVTSLYQTYWHVHPNKTLHDTELHKKYGPIVRY

SPNGLIVNDPALLPVIYNRRANKTDFYAPVFDTHSTFTRKDYREHVASRKAISHAYSVTNTRLFEPQVDG

ILSELISLLSESATEKRLVDIMDWFTYDVTSLFVCGKPFGFVEKRTDVKGLIQNKNKVLFIIFIMTIQEN

LSWIVRNTRLGRRYLMPHPTDQSGLGVVMAERDRIVDAVIDNDGKVKRHLLVKGSLLSSLMEILGTEGCP

LSLVDVKAEIFFAMLAGSSVTPSQLARVIFHISRNFKVQEKLYEELVAAEQDGRIPPLSAIISDEQAHRL

PFLSACIREAQRYAPTMSQLPRYAPEGTGLELHEQYVPPGTSVSTSPWIIGRNKDLYGEDANSFRPERWL

EASPEEERRWDHFSFHFGYGARKCLANNFGLMQLYKVAAEVFRRFEVKVEGSNEDTVSGGPPASARFRFD

RRARSWS 1413728

 

>CYP5109A1 AAIH01001109.1 Aspergillus flavus NRRL3357

4670-6495, only 3 aa diffs

 

#143

 

>CYP5110A1 BAE58993.1 AP007157.1 [Aspergillus oryzae] gene model revised

1141014 MAIQSTLEMCHLAESGVYLILVTFGVGLLFGLIVLTSDYLDGWLRRRALGDIPFVDEGSN  1140835

1140834 MSACLRWWSRKFDCDKEYAEAYKQ (0) 1140763

1140699 YSKTGKPYATRLKNNDHGIVLPLNSTKEWRTLPHDQLSFLHALSE (0) 1140565

1140509 FADLYMHTNITDRTPLHAVHYCNNTKTL (1)

        SRFNRLMVDATDRALPLIVGKDTES (1)

        EWKRANAFHTILSLCSTVAMSVLLGPEFSMDTSLIQTIM

MYNTAIMPSCAK

RTSYPRILRPFVWRLSPLCRAVKSDLLKTKIKLIPEIKHRIDIARSKKWWLEEGPMSLLDGLIETAFEKG

CLSRSSDRGDDDQQVALLAEEIIFYHFELSMPVVFFIIFAVYVIMNNKEYLTPLREEISEALKLSGGSFT

LDTLNHAPKLASFVKETCRLYDISCCN (2)

FRRVMKPIHLESINLSLKPGTIIMAPGRDVHLDPDYYDNPTTFNGYRFYD

ASRGTCTPHISTTSPTFLTFSHGISACPARVLATQITRTIFIMFLLKFDVELAHEEMPAYGFANGPAYLP

NPSVMIRVRPCQKDVLGV 1139078

 

>CYP5110A2 AAKD02000022.1 Aspergillus clavatus NRRL 1

55% to CYP5110A1

        MAVQASSSIHHLADLGTSAALTGVVLVLLCGLLIVISDYLDGWQQRRALKGIPIVDEG

        SYMRPLLRWKRFDAAKEYARAYHL (0)

        YSKNGQPYATRLQNDDYGIVMPLNSAKEWRALPHEELSFLHALAE (0)

        FVDMNLYSDVTDRTPIQAVHSCNNTQSL (1)

        NHLNKLLVRNIDNVLPSIFKQPTQD (1)

165619  KWLEVNTFQTIMSLCSTVTMSLLLGPDTPYDPVLHHHVSSFGAAIMESCYGRTAYPRILR  165798

165799  PFAWRFSPQCRGLRTHLSMARARLIPEVARRVAAARKANIEVKDSRPTSLLDALIEAALE  165978

165979  NGSLNRDGICTNEKAQLQILADDLLFFHFELSKPTTVNIVFQMYAIMNHREYMSPLREEI  166158

166159  TKALELTNGEWTVETLKYAPKLESFTKETFRLYDISPCN (2) 166275

166335  FRRVMKPVTLKSIDLSLRPGTILVSPCRDIHQDPDFYENPMTFDGYRFYDTNSNACTPRV  166514

166515  ATTSLTFLSFSHGTGSCPARVLASQICRTIFIKFLVEYDVELANKKMPAYGFTNGPVFLP  166694

166695  NPEVMMRIRPRGNGMQ* 166745

 

#147

 

>CYP5111A1 BAE58483.1 AP007155.1 [Aspergillus oryzae]

3848877 MLQDLIATLASGAQMYWASSGVWMRVVLTVSAIWIFWRIWRFTILPLFRPNEPVELPYWIPCKAPYAKMV

EELSLTSSRLCLLTCMMIRTCGKRFGTLEPFSMIIAGDRYYVITSPEDTRPFFADVKAMTTDGFLDRALL

AFGCAPERLHTLWQRNTPTKVNPKGKNLIHLTQDLFKHDLVPGPTLNVLLERYQGALDELLSWDRLVGAY

PSLVSTQTEAISLYDICADFIANANQIVLFDRALLAIDPDMAVEMRTFTDELWKLVHRSRLVDTTEVTRI

LRQYSSAFKSYLQLPPEARPNETPVIRTLLETYAELGIHEDDRAAMLVMICWAGDANAYKAAYWVLAYIL

YDPQLREIIRQETAPAVGPDGKLDWPYLAKRCPRLSSIYHEVLRLTKRDVIVRQVVRDTALAGKRLRKDS

IAVIPTCQLHDNPDTYGADAASFNPDRFLKQPGLAQTTFFPYGGGRHYCPGRYFVEMEIYGLVALMLNRY

EMDLAWAAPFPRRDESLVTLGISRPVPGDDLHVTLNWKEGNKN 3850672

 

#150

35% to 551A1, 34% to 551B1, 32% to 551A2

>CYP5112A1 BAE57727.1 AP007155.1 [Aspergillus oryzae]

1498000 MNTSLDSSTALGFYITLTVVTISVAYVSILALCRLFLSPIAVFPGPPLARLTYLTQWYYDWVKDGQYYLQ

IEEMHKKYGPIVRVTPGELHIRDSNFHSKLYVTGAVRKSDSYHRFTQGTGFEDITFPLLSHDRHRALRGQ

VSRLFTRAGVRQHESRIVARIHVLSQRMCGFMSNGKPVNLHDAFSSLAAGMYNAISVIFHEEPTDYLGDP

EFNTAWYNTLKMGTATIPLLTQLPWLARVISAPVARYILERATPWRIFDDKSRRQMLKSKSRPTIASSDR

SNATVFDNLFKDNLFYTMNEQTFTRSAQ (0) 1496760

LIQQGAVHNVSLSLAMTIYCLLCQPDEQEKLTRELESSFSKYPERSPSFSELESLPHLSACIKEGLR ()

LSVGALVGIPRVSPDVDLVFDTYTIPKG ()

TPVSMTPHWMHMDPDVFPNPNSFDPSRWSSTLTEPEKLSLMGRYFVPFGKGSRSCIG ()

TRLAYLLLYQTLAHLFRPGAPRLLLHETDISDVTPVRGFLFSL

PKKDSKGLRVILVNDSESTNRM* 1495794

 

#155

 

>CYP-un2 BAE56589.1 [Aspergillus oryzae]

pseudogene C-term part only

DDSLWTDPTSFDGYRFEKLRTIKGNELKFQYASTSTSELNWGYGTHACPGRH

YASNQIKLMIVSLLSRYEFQFDHEQT

DKKAIVERPPNVVDGVRIMPNPQTLVMVRSLGNVNEGCE

 

>CYP-un2 AAIH01000268.1 Aspergillus flavus NRRL3357

note CYP65AB1 is on the (-) strand from 448-2267

pseudogene 98% to CYP-un2 Aspergillus flavus

      RSSASQISDCPTDWKSVALFPTMVKLVSLHISRSFIQSPLSRNQEWV

      IDLTLDYAISTVTVAGKMSNTHWALRPFKGHFLPETAEMSRQFTRARELLRPTLEARLQQ

      RDEVPNDLMQWIINNYPDQEDDLTLHTRLQLEAVQAATY

      YDLLAHPEYLQPLRDEILSVSESCNGHWTPAALSNLRKCDSFLKESQRLNP

      PFRLPGGSTVPAGVSVSAPSMMVNL

3887  DDSLWTDPTSFDGYRFEKLRTIKGNEQKFQYASTS (2) 3988

4047  ASELNWGYGTHACPGRHYASNQIKLMIVSLLSRYEFQFDHEQTDKKAIVERPPNVVDGV  4223

4224  RIMPNPQTLVMVRSLGNVNEGCE*  4295

 

 

>CYP-un3 AAKD02000041.1 Aspergillus clavatus NRRL 1

pseudogene, 63% to Cyp-un2, 39% to 503A1

       SVSVSRFALSPFRLPDGSTVPAGTSVSAPAMLANT

28289  DKMLWDDPLVFDGYRFEKLRAIGDNEQKFQLSSTS (2) 28393

28450  TSELNWGYGTHACPGRHFASNQIKVLMAALLLRYDFRFAKDQNSDTEYK  28596

28597  RPSNVVEGVRIMPNPNVEVLIRNRVEM*  28680

 

#135 only top part = P450 C-term, 36% to 584E1, 36% to 584A1 , 35% to 584B1

35% to 584C1, 40% to 584E5, 38% to 584G1, 32% to 584D1, 32% to 584D2

41% to 584E3

>CYP5113A1 New fam. BAE62292.1 AP007164.1 [Aspergillus oryzae] revised

MTAETGFVPTVFSLPSESAYSWVW

AVSAGLVAIFVLYLTQGIARRRFAYAHGCQAPPRYAHRDPILGLDSLRDSMQAR

KSDRYFRREQQLHQAYGNTFMSLLLGSWMVNTIEPKNLEVLFSTKFADYEVGFRRRNAFA

PLFGKSIFQSDGTRWQTLRSQLQLCFSRVQTSQLGLLESHCQRLLAALPSDNQKFDLALF

LHRFAADVSTDFLFGESINSLENPQNLDGGALKAFADTHSTCELRWLLGSMSWIWP

QRTFMKNVRLTHRFIQRYVDAALEREVTPPGKASDQQNEQRILFIDQLRQRTQDPIALR

DELTTLYFAGTDAPAALLINLFFVFSKRPDVWDRVRSEVQSLGGKAPDLQQLKGLRYVQD

CIREC (1)

LRLYPPQ

1582777 PSNSRVAVRDTVLPTGGGPDGGSPVLVPKGMMVHLSVYALHHRKDLWGEDADEFRPERWSYEKQTW (0) 1582974

1583043 KYIPFLGGPRNCVGSN (2)  1583093

(?) FGLNEVAYAVVRMAQNFQTITSVDPDEWVEGSSIALESKNGVKVVMCRDA*

 

#127

33% to 548D2, 33% to 548E2, 35% to 548F1, 37% to 548G1,

38% to 548A6, 41% to CYP548H1

>CYP5114A1 BAE63475.1 AP007167.1 [Aspergillus oryzae]

657999 MELPIRYCLGISLAVAGVAFCLYQMFFHPLAKYPGPTLAKFTAARAAYCAWKDDVHLDIWLCRKKYGPII

RYVPNHLCFDTVTGLKDIYLSGKDLRKDKIMGKASFVPNLLTIMDRKEHARHRRLIGIGFSQSAMKSVNE

RLLHHVKSFYHVAYNAGLPDEANGWSHPLTMSDLCSYLTFNVMADFIYGKSYDLIHCPDYRHLLEHIEES

NLRTGVLLYCPQLYIGRLDRKLFPRASTGNKTIHSFINQIIQERKSENGVGQSIYEQLGTQRKSTDHPLT

PEEIRSEAMLLTIAGNDTTSTALCAALFYLGKNLHAYEKLAAEIRTKFSVVDGIGQDETLRNCHYLHACT

YESLRMSPPVGSSMWREVGPGGTSIDGEFIPCGYGVGTGIYSIHHNPKYFPRPHDFIPERWLSEKDGFIC

KEQADIPFAAYILFSAGTRACLGRHLAITELLTTIAALVLLYDFRISHTENGELGCGHALGRHGRTNPGE

FQLYHRVTSGKEGPILQLRPRKGN 656192

 

>CYP5115A1 AAGI01000308.1  Phaeosphaeria nodorum SN15

39% to 5114A1

37% to #127, 39% to 548A3, 37% to 548G1, 38% to 548A6, 34% to 548D2

       MNYLSVLVVAVAVTLLY (0)

43655  LIARVIYLAFFHPLAKYPGPFLSKFTCARASYYAWRGDIHIDIWRCHEKYGDYMRYGPNQL  43473

43472  YVNTPKGLRDVYGPTTSNKFLKSSHYEVMTHQAANTFTHRGGKEHLRRRRIMAQAVSTKA  43293

43292  QLEYEPRLVGHIQKFCNAVFKGEPMNMAKWCNYLAFDSMTDVVFGAQYNL  43143

43142  LGDEKFRYVPEMIEKSNVRISSLVQFPGLTWLRLDKHLFQEAIYARNRFLKFVFRLLSDR  42963

42962  RALSHGTARGVFENPSISLDVYSRLQDARDPVTGEGFGHDEIASESTTLIVAGSDTSACA  42783

42782  TASILFYLANNPHAYARVAEEVRAVRSSRPGHLAAADLAGCKYLRACIDEALRMSPPVGT  42603

42602  GLMREVAAPGGLVVDGHVVPMGCEVGVGTYAIHHSTRAFEDPFVYRPERWLAPDESAHAR  42423

42422  ACFVPFSAGIRSCLGKGLAYTEVTLTIGHLLWLGDFKLVADAELAAVGRGSRK  42264

42263  LGVDGRHREGEYQLYDHIAGQKNGPWLQFTRRAEVQ*  42153

 

#159

 

>CYP5116A1 BAE54596.1 AP007150.1 [Aspergillus oryzae]

This P450 is unlike any other, very low seq similarity

240943

MSLFLVIVVVLLLFLSSPLHRLVHIGLKKPVSPNIDPETYRRIIEGKGLYQEVHNQLNARQSRAIPNKRL

RAVFGIENALTTDNEIHAKRFLRQVKGLINLSPTSWESLSGLVRSAARRSIDGAMANSPDKPRVMLTNLV

QVLVLRVVLSVLFRMETEALEVPDHDLLRLAEAINDAWTSSKDKTHLVSFQDNISLQNSLKTVFPHLNCL

DPQGNPLNLVIPGFETMWRIVLRLFIEISYTSGLYHPEWRGIMTTFAIAPTKDEFERRNGKQNLSAEMLV

NEALRLYPPTKRVYRAFLPVGSDTVEVLNADIEKAQTATHIWGSDAEVFAPGRWGALTPQQKLAFF

PFGSKPFVCPAQAAFGPRAIALVVGALLVELGGEWSLCVGAECTEALVPGVRLSNQRTEYRDLCLARAGPV 242193

 

>CYP5116B1 AACD01000061.1  Aspergillus nidulans FGSC A4 new

37% to #159

363827  MTARSMASTVSLYLILFVLFVLFYRRCYRSSKKPAEFRTTAECRAIIDGSQFPDARKNQLTRL  363639

363638  EARALPNQPLIGAFGIKNAFTTGNEAEAKDFVENVRRLIEVSAVDWHGLAGALQCMLESI  363459

363458  IEENRDGARVKVSLTPTVQALVLRESFWILFQMGEDAHLEFKQLADLGKITNS  363300

363299  TWVRMKEERALEFKDNIVLQACLTAVFANHKTDINILDPGSNPLKLILPSFETVWRIVL  363123

363122  RLFIVLHCHDNEDYKRALLEFVRDPTLTQFRLRPDNAVSVEFLVKEALRLYPPTRR  362955

362954  IRRAFQFPGSSPNNQISNIGRANVEACHLNEEVWGPDALEFMPARWSKMSSVQRRSFLAF  362775

362774  GGPPFLCPASHAFGPMVIGLLAGVMLDVFGKMNGYGKEWVLGSDDERDMSEVHSRERLRN  362595

362594  ERDAYGGLFLDLYSRRIDVSS*

 

>CYP5116C1 AJ883817.1  AJ883817 Trichophyton rubrum CHUV862.00 cDNA

45% to AACD01000061, 45% TO #159

     STSTRHSSHHKCGTS

913  VVLTXFYAXLQTDVDKTQYKDVLKLAEDINRIWISSKSPDEEKRSSYQSETPFHDTLKAI  734

733  FPNTQISSPASNPLNLILPSFETMWRIVLRTFLEINFLTGNRSPEFKQVLVEFFHNPTKE  554

553  QFNQELSPGVSASNVISEALRLFPPTRRVHRHFQGLSSNERTLFAADIEACHRNLRVWG  377

376  SDALKFVPGRWNCLNEQQKSSFMPFGSKPFLCPAKPVFGPRMIALLVGALLCHYTENWEL  197

     SSVSGKYGINMVAEGEYLDRDACAQLYLVRDIRV*

 

#34 40% to 65E1

 

>CYP5117A1 BAE64915.1 AP007171.1 [Aspergillus oryzae]

14 P450 genes and 2 pseudogenes on this contig

MNSISALFSAGGFQWILLSLSLAFIVVYSLFYLAVGLYNLYFHPLARYPGPLLGRASSLWYARSLARGTV

AQDTLKLHEKYGDVVRIAPDELSFIQPENWSAIYGHQLGKDYRELIKDPRYHDTVKPTPTILTGDWDEHT

FYRKILSNSFSEKSLKDQEHILHHFVDLFVQRLKETSAEGTRELNMTDQWNYLTFDVIGFLTYGEEFHCL

TSSKLHDWIEAMLCVAILMSLGQAARHLPFPFDKIYKQWAIPSNVKRQVALHRDLTEVAIPHIPIQYASA

YRLNSRKGDIPYSVLKEHANILTIGGSETTATLLAGATFHLGKNPPVLQKLATEIRTTFVNDGEITVARL

SECKYLLATVEECLRIYPPSPANHTRMVPKEGIVLNDQHIPGGIGVGMPMYAAFRASSNFTYPDRFAPER

WLGDPMYSKDKKGALQPFSFGPRNCLGRHLAYQEIKLALAKLVYHFDLELNPKCGDWDEQKNFTFWVKPP

LWVNLHPVKS

 

#70 39% to 65S2

 

>CYP5118A1 BAE63025.1 [Aspergillus oryzae]

MFVLPTTFMSVSHGIYQLLFLALLATAWRIYSNRFRHPLSHYPGPFFWTISRLPYAVTYAQGTLHRRVRQ

LHDVYGDVVRVAPDELSYRTEQAWKDIHGYSRNFPKDMRFYQTSKNKAPSVVIAPDGVHGRQKRSILRAF

SERAMKSHEHLLRPFVDSLIQKLQHASTSTEGGAVDLTEWYNYIMFDFMAHELFGQSLGCLENGVNHPWV

DMLFGSIKVWAFLSQSKYFPNLSWIIKTAVRLFCRDLLNHRSKKLGCIASKIPEGEGSDSSLPTFNSFLR

ANKGPHSTLSTEEVLSNHSFMMMAGSETTATLLSGCTFFLLKHPQVYKKLTSEIRNRFSSSTEMTFSSLA

NMAYLRAVLQEALRMYPPLPLGMPRVVPPGGAIISGQFVPEKTSVAVASWATYQSSSNFNTPQMFLPERW

LDTGPGDNDVKGAMQPFSVGPRACPGKNLAFGEASLILARLIWEFDLELSPQCSSWAYQRAYIIWDKGPL

LIKLTPRI

 

#88 35% to 5068A1, 34% to 5068A2

39% to 5068B1   [Aspergillus oryzae]

>CYP5119A1 BAE60008.1 [Aspergillus oryzae]

MLPTLPNIAGRINTMATFLLPVAIGTIILLFLYGKYVTSTLIPGPPTLPLIGNLHQLPSDDRRHVLAQWH

KKHGPIISLKFGWSSVVILGNIAVTKELFGKRSLKYGSRPRMVMARDCMTKQMQTSTLPWGEKWKIHNRI

QLSLVGGPKIRSYQSLLDIESCKVLYQLLSTESLVTCFNRFKFNIIYTLAYGKDPDQNESDFHEILELAD

HFTQTLTNATWVVDLFPILNCLPRRLAPWKAVGDDFHRRAMGWFRRNSEAAVKSNSWNWTKHVQFNEDTG

NLSVSEMQYLIGVLFEAGVDSTATVLHFFVLACTLYPDAVTKARQELDKVVGSARLPTPKDLPQLPYVKA

FIQEVLRWRPITAEGLPHFTLEDDKYQGYDIPKGSTVIFNYWSGHMDEDTYQHADQFCPERWIERPDLPL

GVFGYGRRACAGRRLALMSLETLIPKLLWAFDFRSPAGTDHGKSRDPGTEHQGALIKPRSFPVSWHPVSN

DRRLIIERLFQERDKDLDTVLDDIGKAFERY

 

$$$$$$$$$$

 

#161

 

>BAE71333.1 putative monooxygenase [Aspergillus oryzae] NOT A P450

MDPANRPLRVVTIGTGISGILMAYQIQKQCPNVEHVLYEKNADVGGTWLENRYPMAGCDVPSHAYTYPFA

PNPDWPRYFSYASDIWNYLDRVCKFFDLRRYMVFHTEVVGCYWNEDRGEWTVRLRQHASGSEPREFEDHC

HVLVHASGVFNNPQWPQIPGLHDRFQGRVLHTARWPDDYQESQWKSDRVAVIGSGASSIQTVPGMQPTVK

HLDVFVRTGVWFGVLAGNTGSQTKEYSPTERDEFRRNPAALVAHAKAIEDQVNGMWGAFYTGSKGQAMGS

AFFRQRTANLIKDERLREGLDPPFAFGCRRITPGDPYMESIQKENVHVHFTPVVSCTEKGVVGGDGVERQ

VDTVVCATGFDASYRPRFPIVGRDGVDLREKWKECPNSYLGLAVPEMPNFFTFIGPTWPIQNGSVIGPLQ

AVSKYVVQWIKKAQNENLRSFVPRQDRTDQFNDHVQEWVKHTVWKDNCRSCTFLLSPRSQLNLLRTI

 

#7 Not a P450

 

>BAE71334.1 oxidreductase B/ cytochrome P450 monooxygenase [Aspergillus oryzae]

MRRYAILGATGNTGQALLNVLLQSPDNQIHAYCRSASKLNRLHPEITQHRQVKVWEGSLEDVSLLSECIR

GTRAVFMVVAIPDNMPYCTIAQDCTNAVLNALKRLQAEGCQSLPKLIVLSSASLEDSLCADVPPLIHRIL

NIAAGNLYSDLAEAEKTLRAEKHWVSTTFVKPGGLVHDVQRGHTLSTTTAKTPVSFLDVAAGMVEIANVD

DKRYDMMNVSVNAIGDGTAFPWKGVYYMMTGLLFHFFPWTYKYFGDCPMARPKKDI

 

#8 Not a P450

 

>BAE71327.1 cytochrome P450 monooxygenase [Aspergillus oryzae]

MVTYALLGATGATGSSILRHLLHDPPDSLRIQILVRSKIKLLQAFPDLQTRRNPQVHVIQGTSTDADALS

ECLRNATIAFMCVAQNGSPIGTTLCQDSARAIISALQQQQQSEGASYQPCTIVQLRSASLNPALAVQVPV

FVHPIVSFCLFANYADIKQACQYYSEARKQGTLEYIFVDPPTLHDANGTQSTGYRLISTESQATALSYAD

LGAAMCEIAQRRSEFHGRAVGVTATGSVHQTWGVLLRHLLEGGSARLREKIAKNTVVVGIVCSFLVALAY

LM

 

#108 63% TO SEQ 109 oxygenase not a P450

 

>BAE66426.1 [Aspergillus oryzae]

MKGVPSSAEASNSIPGSSLPSQRAHEPLTHKQPTLDHPRKQSVQSISSEHGGMAENFSKITKVVQAARRP

LPTETGDGTYIEPENGGSLWRDLRALGIKDANTLKDLIENKAGGLVKGSGQVVDDKTMLMERIIQLVAKL

PTESRNRVKLTNMFLGELWDSLPHPPLSYVGDKYAYRSADGSYNNPTLPWLGAANTEYARTIEPLKVRPA

SLPDPGLVFDSLFARDTFKPHPNNVSSVFFTWASLIIHDIFQTGHPDENFNKTSSYLDLSILYGDNQEEQ

NMMRTFKDGKIKPDSFSEPRLHALPAACGVILVMLNRFHNHVVEQLAAINENGRFTKPPERILDPVEARA

AWAKYDNDLFQTGRLITCGLYINITLYDYLRTIVNLNRDNTTWTLDPRAHMEHDTVPTALGNQCSVEFNL

AYRWHSTISRKDEAWTEQAYQAIVGKPGSEATVEDLMSGMRRLGANMPKDPSKREFAGLKRQSSGKFKDE

ELVDILTMAIDEVAGSFGARNVPKVLRSVEILGMEQARRWNVGSLNEFRKFFDLKPYQSFEEINSDPEVA

DQLRHLYEHPDNVELYPGIVAEDAKKPMIPGVGIAPGYTVSRAVLSDAVALVRGDRFYTKEYNSRNLTNW

GYEEANYDLEINQGCVFYKLALRAFPQYFKQNSIFAHYPMTTPSANRDIMKMLGREEDFSWDRPSYTPPR

TTLFDYANVRRILEDSSNFRVIWDEATGYVFGKGGYDFMLSGDSPFHANQRRIMKESLYRSQWHEAVKEF

YLEITEQLLSEKSCRVGNVNQIDISRDVGNLAHVHFASNIFSLPLKTKEHPHGVLTEHEMFDVMSIIFTA

IFFDVDPSKSFRLRHMARKAAETLGPLVEANVKAVSSASFLSTLIDGIRSNKNALSGYGVHMIRRLLDHG

LDASEVTWSQILPTAVAMVPNQAQVFTQIIDYYLSDEGKEHLPNIQQLAKEDTPASDEMLLRYVMEAIRL

NGIFGSYRKSHTNLTLDDKNKMVQIKPGDTVFVSFVDANRDPNVFPNPKKVDLNRPMESYIHYGVGPHTC

LGGEASKVALTAMLRVVGRLKNLRRAPGPQGELKKIPRDHGFYTYMRADETSLYALPMRSDLSRKSLRAM

FLDIGMIDMVWPFYHKIEFTMAKSAIE

 

#109 oxygenase not a P450

 

>BAE57912.1 [Aspergillus oryzae]

MLRRISTNFKKSKNDRETKQNGTQNGAQNGTQVNGDKRQSKVSPARKSADQEPSRKAANGASVFGKYAQV

LHASQSPLPNQTGDGATFEQRHGSLVQDLKSLHLEDAATLKQLSMNKIKGVPVDDKTMLMEKIIQIASSL

PDNSENRTKATNLFLNQLWDSLPHPPLSYVGPEYSYRSADGSNNNPTLPWLGAANTPYARSIAPLTIQPG

GLPDAGLVFDSLFAREKFNPHPNKVSSLFFDWASLIIHDIFQTDHANPHINKTSGYLDLSILYGDVQEEQ

DLIRTHRDGKLKPDSFSEPRLQAFPAACCVMLVMLNRFHNYVVEQLAEINENGRFTKPSPDLSEEKAKKA

WAKYDEDLFQTGRLITCGLYINITLYDYLRTIVNLNRVNSTWCLDPRAQMEGNDPTPSGLGNQCSVEFNL

AYRWHSAISANDEKWTEQIYEELMGKPAKDVTVLDLKKGLGKYAMGLSKDPSERTFAHLKRQEDGTFKDE

ELVSILANAIEDVAGSFGARNVPKCLRAVEIMGIEQARSWNVGSLNEFRKFFDLKPYERFEDINSDEEVV

EALRHLYGHPDYVELYPGIVAEDAKQPMVPGVGIAPTYTISRAVLSDAVALVRGDRFYTVDYNPRNLTNW

GYNEVRYDLNVNQGCVFYKLATRAFPNWFKSDSIYAHYPMTIPSENRNIMKDLGRESDFSYERPSFTPPH

VNLVSYPNVKLALEREEDFRVVWNGNTPLASAKGGDDFWSKSLDNDQWRNSIKEFYEDITAKLLQEKSGN

LAGLKQVDITRDIGNLAPVHFASKLFSLPLKTKENSRGVFTDNETFMSMAVIFTSIFFDVDKTKSFSLHH

AARAVAEQLGHSVENHVKSINSPSFLSGIIGNRRNDHNALKEYGDQLIKKLLESGLGVSDVTYSQVLPAA

VAMVHNQAQMFTQIIDYYLSEGKKHLPEINRLSKEDSKDSEDKLMRYCLEGFRLNGTFGSYREAQTDLSM

TEETGNVNIKRGDRVFVGAVKANRDPQVFPDPNEVHLDRPLESYIQYGLGPHTGLGKETTLLALTSMLRV

VGGLDNLRRAPGPQGELKKIHREGGYYVYLREDWGSYSPFPTTFKVHFDGAIPAPKKRLTYLGN

 

#140 oxygenase not a P450

 

>BAE60972.1 [Aspergillus oryzae]

MGWLSTTTKSSWNPFSTGSSGSSLDSGGSLASLAFGSKDQKWFQSVLSKFGFNGVLATVLSFFLYALYLK

FVSHDEKGLQTLIKEKASQYLGKIPGLNKLSFLKGHLPLGKFSKSLIPKATKGALGSIAGSSGGILSKLN

PFNWKIFNKRKIAEEEDDMRYQAGEPYGDPEVLAPTLRDDLKAVGLKAGVQDLKVLLDVVKNKGKPIDDR

DLTMEKLIAIVSSLPRNSKAREKLTGVLIDTLWQSLPHPPMTYLGNKYQYRTPDGSYNNPLQPDLGKAGS

PYARNVPKLKHMHGVPPDPGLLFDLLMARSDETFKENPAGLSSVLFYHATIIIHDIFRSNRFDPNISDTS

SYLDLAPLYGSSLEDQMKVRTKVRGLLKPDTFSEKRLIGMPPGVNAILVMYNRFHNYVADNLLKINEGGR

FSLPATKSEEDKKAALAKQDEDLFQTARLVTNGLYVNISLHDYIRGLANVHHSSSDWTLDPRVKINKIFD

SEGVPRGIGNQVSVEFNLLYRFHSIISRRDEKWMNEFFADIFGQDKKVDQLTPQEFIQGLYRFEQSIPED

PSEREFGGLKRGENGKFSDADLVQLMKDSMEDPAGCFGARMVPKALRVIEILGIIQARKWQLASLNETRD

FFKLKRHETFEDVNSNHEIADLLRKLYDDPDMVEMYPGLVGHGGCTPYTVGRAVFSDAVTLVRSDRFLTI

DYTASNLTCWGYNEVQQDYDILGGSMFHKLFQRALPNWFPYNSLHITQPMYTRKMNEQIAREIGTIDEYT

LDDPSPPPKTVIVTKHSTITKLSKDQANFRVIWAKYLNEMIPGRDFSGYMLLGDKPANTDQKTLVKEILY

SPAEFVQLLSETAVSVAKEQLATETLNLTSELHQVDIVRDVAIPMVTRILADLFCLDLKTPENPNGTYNV

AELYKYIIDVRIFGFNNDDPGLALQRRKWAREGAESLTKTTLRVVSNLPASEKSGKGIVKGAVSTAKSIA

SKIPLVGKLVGDGKGVEGQSTSGSLRWYGYNVAKELIASGKTPAEVADISWMNAVGGVGATIGVFTDVLN

YFLQDENSHHWEEIQKLAASSDLESSNKSLRQYVLEAQRLTSTQRSIRLCAGKAVIDGQSFEPGNLVICL

LGAACKDPDAVPDPEAFKLDRPSSAYIHFNVGPHECLGREIALSCITSLVRVCAGLKNLRAAPGQMGVLK

SITTGTEKHFLNDSWSTLTVDPTTWKIHFEGQGQGIHHPPKIPVTAGRDLNALSNALKKQHQDKLQETVS

KVANGVTAPLTKLIPSNGPSNGASTPGHLPLPINPFQNGNGNSNGVANGNTHPSLLHQAVSSAAAIPQHA

LGTVHDVAHNTVGHLPGGQQVTDFTHGLVHPFAGAVSPGQTQTPPQGQTQPHQGNWFFLPHGMENAAKQV

PGHLFGQTA

 

#149

79% to EAL89712.1   fatty acid oxygenase PpoA not a p450

>BAE58228.1 [Aspergillus oryzae]

MEGARLRSSVGLPRMVTKPTVIEDNGKKLNLKAGQHILCNLVSASMDPTSFPEPEKVRLDRDMDLYAHFG

FGPHQCLGIGLCKLALTTMLKVIGRLDNLRRAPGPQGQLKKLSGPGGIAKYMNPNQSGFSPFPTSMKIQW

DGELPQVER