Aspergillus clavatus P450s

 

David Nelson

 

August 7, 2009

 

102 sequences

 

>CYP51F1  Aspergillus clavatus NRRL 1

         XM_001273213.1, ACLA_005420

         89% to 51F1 S. fumigatus

         61% to 51F2 A. fumigatus

MGLITDILDGVCKYCSTQSIWMLGGVGLLSLLAVAVVVNVLRQL

LFKNPNEPPLVFHWFPFIGSTISYGIDPYKFFFDCRAKYGDIFTFILLGKKTTVYLGT

KGNDFILNGKLRDVCAEEVYSPLTTPVFGRHVVYDCPNAKLMEQKKFVKFGLTSDALR

SYVHLITDELESFVKSSSAFQGPKGVFDVCKTIAEITIYTASRSLQGKEVRNKFDSTF

AELYHDLDMGFAPINFMLPWAPLPHNRKRDAAQRKLTETYMEIIKARRQAGNEKDSED

MVWNLMSCVYKNGVPVPDEEIAHMMIALLMAGQHSSSSTAAWIVLRLATRPDIMEELY

QEQLRVLGSDLPPLTYDSLQKLDLHAKVIKETLRLHAPIHSIIRAVKNPMPVEGTPYV

IPTSHNVLSSPGVTARSEEHFADPLEWNPHRWDEHIVENDEDEEKIDYGYGLVNKGTN

SPYLPFGAGRHRCIGEQFAYVQLGTITAGLARLFKFRNLPDIEGIPDTDYSSLFSKPL

GKSVVQFEKREPALKA

 

>CYP51F2  Aspergillus clavatus NRRL 1

         XM_001271578.1

         ACLA_046180

         81% to CYP51F2 Aspergillus fumigatus

MLSLTLFGLYLVSATAVVILVNVVYQHLFRLRNRTEPPMVFHWI

PFIGSTITYGIDPCKFFFACREKYGNIFTFILLGQKVTVYLGVEGNEFILNGKLKDVN

AEEVYSPLTTPVFGSDVVYDCPNSKFMEQKKFIKFGLTQSALEAHVPLIEKEVLDYLE

TSPRFQGTSGLVDIAAAMAEITIFTAARALQGEEVRSKLTAEFADLYHDLDRCFTPVN

FMFPWAPLPRNKKRDAAHVRMRAIYVDIINQRRRDGGEDTQKSDMIWNLMNCSYKNGQ

QVPDKEIAHMMITLLMAGQHSSSSIGSWIMLRLASQPEVLEKLYQEQLDKLAQGGPGS

NLRPLQYKDLELLPYHQHVIRETLRLHSSIHSILRKVKNTLSVPGTSYVIPPGRVLLA

SPGVTALSDEHFPNASRWDPQRWENQTTKEDSGEMVDYGYGAVSKGTASPYLPFGAGR

HRCIGEKFAYVNIGVILATLVRHLRLSNMDGKEGVPATDYSSLFSGPMKPSIIQWGKR

SNDLSK

 

>CYP52G8 Aspergillus clavatus

83% to CYP52G2

ACLA_081330

MAFPLVTIAAVAVALRLLWVLVSKWQNAQNARRLGCGSTPLYPSDFIGISVLKEALKADKAKQLLQLIERRVALMSDREG

RYVSTFRLRQIGREMYFTTDPKNIQAVLATQFKDFELGAPRRNAIHSLLGTGIFTSDGEEWSRSRALLRPQFTRGQISDL

ELEERHVQNAMRAMRVVNDKWTDAVDIQSIFFRLTIDSATEFLFGESVESQLSALNGGGTPADQFPYYFDRSQWYCAQRG

RFEKLWWVVNNRESRHAEKEVHAYVDRFAQNAIKTAQEGKLATDDSSRYVFLHALASVTQDPVELRSQLLNILLAGRDTT

ASLLSWTMLLLARHPAEFQKLRQAVVDEFGTYDQPRNLTFGALKSCQPLQHCMNEVLRLFPVVPGNRRIATKDTTLPRGG

GSDGSQPIYVRKGQPVAYSMHILHRRKDIWGPDAEEFKPSRWVDRKVGWDYVPFNGGPRICLGQQFALTEAGYVLVRLLQ

RFDAIEDVQPHLEIRYALNLTSAPADNVTVRLREASK*

 

>CYP52H5 Aspergillus clavatus

84% to CYP52H2 Aspergillus fumigatus

ACLA_054640

MLAPAVTLLVAVYAAFLILRYFQQLYHHRKQARALRCQPVASGNPGFFGIPAFLRLGQAVKEKRWIEHITEQYGTYGNTF

TQVLLGRRLLSTIEPENLKAMLATQFHDFGLGTRHREFYPLLGDGIFTLDGPGWSHARGLLRPQFTRDQVADLDLMDGHI

SRLIELVPKDGSTFDIQRLFFLLTIDSATHFLFGESVGSLHGGTDTGLLGKSAVGNAQGFAEAFNTAQEYLLTRSRALDF

YWMVNPKEFRDANKRVHEVVDHYVQLALESRRNPEKKKQSGGRYIFAEALAAENDNPKVLRDNMLNILLAGRDTTASLLS

STFFYLARHPNVWTKLRHAIVEEFGDSENPRNEITQTKLKDIPYLRYVLNEVLRLNPPVPANFRVANKDTSLPVGGGPDK

KSPVYVPKGTVVTYSVYAMHRRTDLYGQDADQFRPERWEENGRRGWEYLPFNGGPRICLGQQYALTEASYTVVKLLQRFD

TIENADPGLLVPIQLSNLTMSHDTGVNIRLYSSKGYN*

 

>CYP53A21 Aspergillus clavatus

90% to CYP53A12

ACLA_074210

MITEILTPQNTGYVLLGLLTAYYIIPYLQTWHLHDIPSPGFAAFSNLWLLLQARQGHRFLKVDEAHKKHGKLVRIAPGHI

SIADDGAIQAVYGHGNGFLKADFYDAFVSIRRGLFNTRDRAEHTRKRKTVSHTFSTKSIGQFEQYIHHNIELFVKQWTKL

SKLNGNPRSGYATIDALNWFNFLAFDIIGDLAFGAPFGMLEKGKDFAEMRKTPDSPPTYVEAIEVLNRRGEVSAALGCFP

RLIPYAKWIPDRFFKDGLQAVENLAGIAVARVNERLKPEVMANNTRVDLLSRLMEGKDSNGNKLGREELTAEALTQLIAG

SDTTSNTACAILYWCMQTPGVITKLQKVLDEAIPADVDVPTHSMVKEIPYLQWVIWETMRIHSTSSMGLPREIPPGNPPV

TISGHVFYPGDVVSVPSYTIHRSREIWGPDAEQFVPERWDPARLTPRQKAAFIPFSTGPRACVGRNVAEMELLVMTATVF

RLFEFEMQQDGPMETREGFLRKPLGLIVGMKRRAAHASV*

 

>CYP56C3 Aspergillus clavatus

53% to CYP56C2

ACLA_064250

MDVFFSEWSKTATGWSLLLFLGALPCLFGLYLCFVAPPRHPQQIPSVPFWVTLLPFFFDVDQQETFQQYIAKPLQTHGAI

KMFFAGRWNVIVQRPAMLAEIFRNEHIYHKSGNQEKIPHSVLAEYL (1)

GSNIISARGDEW

RRYRAVIQPGLQTSFDSSAVFRHAQRLSAVLLGLQERNRRQGVPVQGVLQRYSSANLLRCVLGLSDLSMIKMDQDAPLHS

IQTSLKRYLFQPIFLNFPVLDWLGWAIPSRRQARNLIQDFSTELQMQIVQAHPPGSSTTSVGGRLATAWRDGTLTTQQFR

DNLNVLYVAGHENPQLLLTSALYLLGKFPKVQERLRAEIEQYGTIDEGDTPTVSWERLPYLSATILECARLFPPISQLIN

RRVATPTWLAGNLHLTPGMYVGYHSYATNRDPTTWGPDADEFRPERWGHTHEQIFAAYRRAKARAEFITFHGGPRACLGE

KFALLQMRVSLLVLVRSLSWTLDPEWTDQMMPAGPLHPRGLRLMFITHDKDAAT*

 

>CYP58P1 Aspergillus clavatus

49% to CYP58H1

ACLA_013370

MASFAMDKDQILVGVLLYISGVIVYRLFLHPLSRFPGPKLAAISSLPEFYHDVLRGGRYIWEIERMHEKYGPIVRINPRQ

LHIKDPCFYDEIYAGGSRRRDKYAEYVNALAADNSSAT TVDHTHHRIRRGFISPYFSKRSVLQFEATISEKLAMLTARLE

EASHAGSVLNLQHVFAALTADIIMQYAYGETHGYLAHESFRNDLVDAVATQLDLLHVNRFFPGLVRLFKDAPPWLLRAVG

LKIADVVEVKLWIRELAAKALARKGRAGGRARETIFDALTAETVPPEEKTLDRLEVESTVIFAAGTDTTARALAVASFHL

MQNQDVLRTLREELKRVMPTPTTSVSWLQLEQLPYLSGV VNESLRLSYALVTRLPRVAPDETLKYGDYMIPPGTPISQSA

YFVHQDPTIFPEPQRFHPERWIRAAEKGENLKRFLVSFNKGSRQCLGINLAYAELYRTIAAVARRFDMELYETTLEDILV

NRDLGFGQPETGRFQVQARVTGIVKE*

 

>CYP61A1 Aspergillus clavatus NRRL

NZ_AAKD03000006.1

87% TO ASPERGILLUS FUMIGATUS CYP61A1, 52% TO CYP61A6 A. clavatus

ACLA_030640

468671  MANINGSFVSPSADATLSPQFFQSAEFLPAILNGFTIWKALVTLFIAAVIYDQ (1)  468513

        LRYFYLKGSLVGPTFKLPFMGPFLQSVNPK 468315

468314  FHEYKAKWDSGELSCVSVFHK (2)

        FVVIASTR  468135

468134  DMSRKIFNSPAYVKPCVVDVAHKLLGADNWVFLDGKDHVEFRKGLNGLFTRSALSCYLPE  467955

467954  MEECYNQYYKRFLKKSKANQYKPEPWMPEFRELMCAVSCRTFVGHYITDEAVQKIADDYY  467775

467774  MITAALELVNFPFILPFTKAWYGKKASDMVLQEFSNCAAKSKARMAAGGEISCIMDAWVK  467595

467594  SQLDSAKYREKIANGVPPEEAGKPSHLLRDFTDYEIAQTIFTFLFASQDATSAACTWLFQ  467415

467414  LMADRPEILDKVREENVRVRNGDITAPLSMDLLDQMTYTRAVVKETLRYRPPVIMVPYLV  467235

467234  KKDFPITDSVTVAKGSMIIPSVWPATHDPEAYPNPDSFDPDRWITGDADKHPKNWLVFGT  467055

467054  GPHYCLGQTYAQLNLMAMIGKASMEMDWVHTPTPESEDIKVFATIFPQ  466911

        DDCHLTFRPRA*

 

>CYP61A6 Aspergillus clavatus NRRL

AAKD02000011.1

77% to CYP61A6 Nectria haematococca

ACLA_008020

        MDTEIANVSRAAAQSGSPQAWT

669433  PQPSSGQNTLLDCLAGWSTWQYLVTFLLGIVVYDQ  (1)

669274  VMYLKRKGSIAGPAFKIPLMGPFLQAIHPKFDAYLAQWASGPLSCVSVFHK  (2) 669122

669053  FVVLASDRDLAHKVFKSPSYAEPCIVPIAKDIIGHKSWVFLQGKAHAEYR  668904

668903  RGLTPLFTNKAMATYLPVQEKVFTDYFDRFVTASQANRGRPMAFMSMFREINCALSCRTF  668724

668723  FGDYISQKAVKRIADDFYLATAALELVNIPLSMYIPFTKTWLGKRTADAVHVEFAKCAAA  668544

668543  CKANMATGAKPTCIVDHWVLHMMESKRYHERVAAGETDVEKPTNLIREFTNEEIGETLFT  668364

668363  FLFASQDASSSATTWLFQILAQRPDVLDRLREENLAARGGDRNRPFDLPMLESLSYTNAV  668184

668183  IKELLRHRPPVIFVPYLATKNFPVTPDYTVPKGSMVIPSCWPALHDPDVYPNPEVFEPER  668004

668003  WISGDAESKTKNWLVFGAGPHECLAKRYVPLSMAAMIGKAALELEWTHHATEKSEEIRVF  667824

667823  ATLFPM (0)

        DGCQLVFSKRV*  667698

 

>CYP65T8 Aspergillus clavatus

69% to CYP65T2 Neosartorya fischeri

ACLA_062600

MLHLRERAAIANVTGVVSVLYSARSVIKRAGSFPDVGHDPKYRAVLLDLIVKMFLALGTALALYLGYILASAIRNIYFHP

LRDIPGPKSWIAFPLLQHLSAIRGRLDLDMHHWHIKYGAAVRFDPTSVSFITADAWRDIYGHGHKQLPKVLNSGSNTQDI

ISANDADHTRHRKALAHAFSAKGLQAQEPIVTGYVDQLIARLRDVAASGLPADMVKWYTLTTFDLIGDLAFGEPFGGLES

SEYHRWVAAVFGFIRVIPFLKGMDEYSVLFRVILSFLPRSFLQMRTDQVEHTKRTVQKRLRTRRHDRSDFMDSMLRHRGD

KDGLSEEELVANANILIIAGSETTATLLSGVTYWLLQTPAAMERVTREVRTTFASEAEITFNNVTAQLPYMLACISEAFR

LYPPVPGGLQRWTETPTRISGYEIPGRTKVSVHQAGAYWSSRNFHQPDSFIPDRWLPEAKDDPASSFFSDQRDVLQPFSV

GPRNCIGKNLAYTEMRVILARVLYNFDLQLCEESRDWKDQKTFVLWEKKPLMCRLTARRE*

 

>CYP65Z4 Aspergillus clavatus

81% to CYP65Z3

ACLA_049200

MAFWLHYILESISLWAIFKLGLLVALSYLAPHSIYAIYFHPLSQYPGPKLAAISPIPLLVWEIRGIVHSKVKDLHDQYGD

VVRIGPNALVYRTPQAWKEIYGHRTRKGQRTFAKDPALYVPTPNGVNAIITAPESDHIRMRRLVSHAFSDKALRDQEPLL

HTYADLLVEKLQACIESSRSGVIDITRWYNYTTFDLIGDLAFGEPFDCLKDSKYHWWVSIMLDAVKLSVYLKILWFFPFL

APLTKLLVPRSLHQRREASFQLVVDKVDRRLQRQTDRPDFISYILRNKDDESRMSREEIDANAATFVLAGSETTAALLSG

CTFNLLKNRRVYERLVSEVRDRFQDPAEISLSSIATLPYLNAVLEESLRIYPPIPAMLPRLVPEEGAMINGAYVPAGTSV

SISLWSIFHSSTNFAEPDAFVPERWLKNQADENEADNPFAGDKKEALQPFSYGPRNCLGQHLANAEMRLILTKVLWHFDM

DLCPESEDWAEQESYNLWCRPALNVKLSAADGGNRETMM*

 

>CYP65Z5 Aspergillus clavatus

76% to CYP65Z2

ACLA_073680

MTSMSMSHLLEPLSMVCGIILLVSPLSLAFAVKTLAVPVAQSLYNIYFHPLRRFPGPKRASCSNVCYLWWTVSGTIHWKL

KELHDQYGEVVRISPSILVYRSPNAWRDIYGHRKHDTTSFVKDPDYYIPSPNGEHILTANDADHARERRLLSHAFSERAL

REQESIVQQYVNSLILKLQEYAASGSAVDMAKWYNFTTFDIIGDLAFGEPFDCLRDNRYHPWVWMIFQSAKASVFMRLLH

LYPRLESLVKKMLPKKFVRMRNEHWQMSKEKVGRRLSLQANRPDFMSYILKYYDERGMSRQEIEANAGVLILAGSETTAT

ALSGCTFYVLKNPEVYNRLVREIRTSFQRQEDITFLSVARLPYLHAALEESLRLYPPVPGILPRKVPAGGASVDGQYVPG

GVTVSTASFSAARAKSNFADPDSFIPERWLKNRDPKFESDNREASQAFSLGPRNCLGKNLAYAEMRVIIAKLLWNFDLSL

HSDCYDWDNQASFIIWQKPALMVDLKPIRG*

 

>CYP65AB2 Aspergillus clavatus

82% to CYP65AB1  Aspergillus oryzae

ACLA_066730

MLFPVETLTIVYMLGVFALLKTFYNLYLHPLRSYPGPWLARASRWYYSYYLKRGILPQKTKEWHDRYGPCVRIAPDELSY

NTAEAWEDICGHRTGERTESFEKDLTFFPPAPNGVDSIVTVHRRFRRLLSHPMSDKALNSQQDIIGGYVDQLIHELRRRC

DEPGVVDMVRWFNFTSFDILGDLAFGESFGCLGSGVMHPWIELIFTSIKSVMDMQIIRRVPGLFTLILTVAGLRQNQDLQ

DQFMFCQKKARERCSKETSRPDFMTYILRATEEKGMTQEEIEANAQILIMAGSETTASALSGTLYCLLKNPSALQKLRAE

IHAAFQHESDITMRALQGLEYLNAVLQESMRVYPPVPCTFPRTTPRGGAMVCNRFVPAGYIVGVNQLAALTSAQNFARPL

QFAPERWLGDEQYQHDIRKAYQPFSYGPRNCLGKNLAYAEMRLVLTRLLWNFDLELMPESEDWHSQQKIWMMWDKGPLNV

RIRRLRP*

 

>CYP65AM3 Aspergillus clavatus

92% t0 65AM1

ACLA_077670 MAIGTLVMDIAMRAERLATPRAILGIAAGLTFIYLLSKVIYALCLDPLRHIPGPRFNAVSMIPYARHLLAGTTVQNSVSL

HRRYGDVVRISPNEVSLICGETAFPDIYGFRTGKMKGHLNMAKDPVWYVTPSNGAPSILQANDEDHSRGRRVLAHAFSDK

ALMGQEPLVQRYVNQLIDRLKEVTSANDEPVDMVKWYNWTTFDVIADLLFGEPFGCLQDLSTHRYVALLFESLKSLRMIY

ILAYYPWLRFLGNLIVDKGLIQKRKEYATWVSTQVTKRINTATPRPDFMSHILANNDTRGVKLTRAEIDSNATLMTTAGS

ETTATLLSGATYLLLTHPRVLRTLQHEIRSEFPTYESITLEAVAKRTPYLNAVIAEALRFFPPVPVGFIRRVPAGGEMVS

GYWMPEGTVVSVSHYAAYHSERNFGDAESWVPERWLGDERYVHDKRAAFQPFSFGPRSCLGRNLAYAEMRLILAKMVWSF

EMELAEGSRQDWLQRCRVMRLWQKPELEVRVRARVVA*

 

>CYP68L4P Aspergillus clavatus

ACLA_047580

AAKD03000015.1 117585-116726 (-) strand mid region is 63% to 68L2

MLLDIKTQFSRLVPFSIAGVLALSALFIFLTLPRKSLLPMVNRKGPWEIRSYRVQNKCVQDARKSIKTGLSK

 

EAMQWMEECAKGRPYDAAVAQISFSLAAIHTTSDMLTQVLLDLSEHEQLIQELREEIVTVIRSEEWKKTTLYRLKLMDSVLK

KSQRLKSIGVATMRRLAEEDIKLSDGKLVPKGTSLLVFNETMWDPSVYPNPETF

 

ILLKYDIKLAKGCKPTMRMNGLSMNADYFAKVSVKRRQEETLL*

 

>CYP68Q2P Aspergillus clavatus

~73% to 68Q1 Aspergillus oryzae

pseudogene adjacent to CYP5117A2P on opposite strand

ACLA_064150

ISIARITEPLSQESTSALRDIFTNDPD ()

LAAQGKEAVPFDDAIEWFEQMAWSKNITYDPEIVQLFLSTVAIYTTSDLLTVTLLDFARN

PEIIEPLREEITAALEHGGWRKTSLTEMKLLDSVLKESLRLKPIAV ()

VSMRRVVMDHVKLSDGTVLTKGTKLAVSSHHMWDPSIYKDPEKWNGQRFLHRRDVPGQDK

DAVFVATSERHLGFGHGKNACPGRFFASSELKVVLCHILMKYDIELPPRAVVRHHYSGAS &

ADPEARLLIRRRSVPLPAGFE

 

>CYP68W1 Aspergillus clavatus

42% to 68D1

ACLA_055740 removed small intron

MFRENLGPIFLTALPAILLSYFLSVALPSLRLQWKTSHIPIINKKKGEWSDSNAVKRCAHNAQAILQEGHEK (0)

YTGPFQLIGSFGRRIVLPPELGEHVKTDPRFTASEVVRQTMAGSLPGFEGLLPVMEAGAPNVFIQMIRS

KLTSNLGKFTQHLAEETQAAFDEKWGTSTEWHEVDLLASLRDIVTQVSTRIFLGPELCKNKEWLDNTQAYTDNVFKAVRS

IRRFPAWSRPYVQWFLKDCSRIRQQVKRAEEIIEPIIAKRLEEIALAQKGLAEMPNDAITWMHQVAQGKGKDYHGAHIQL

SLSMASVHTTSDLFSNILLQLCRHPEWIEPLLQEAQSVRSEGGWEKTSLYRMKLADSVMKETQRIKPLGVLLSHRHVSDD

VILPDGTLIPKGAIVATNMSRMWDPEFYPNPEEWQPDRYLKRREEPGKEHSSQFVTTTMESLGFGIGSHACPGRFFASSK

IKLLLNHVLQNYEFERVDTGKDATPFFVEYVTNPKAKLRVRRKEISS*

 

>CYP504A11  Aspergillus clavatus NRRL 1

           XP_001276373.1, ACLA_003600

           74% to 504A3

  1 MTLQTLAFAV VAAVYLVIRY LNRTDVPKIK GIPEIPGVPL FGNLLQLGDQ HATVAAKWAK

 61 QYGPVFQVRM GNRRIVFANS FDSVRQLWIK DQSALISRPT FHTFHSVVSS SQGFTIGTSP

121 WDESCKRRRK AAATALNRPA VQSYMPIVDL EATASIKELL KNGQNGAVEL NPTAYFQRFA

181 LNTSLTLNYG FRIEGNVDDQ LLREIVDVER GVSNFRSTSN NWQDYIPLLR ILPKTNREAE

241 EFRERRDKYL TYLLDILKDR IAKGIDKPCI TGNILKDPEA KLNEAEVKSI CLTMVSAGLD

301 TVPGNLIMGI AYLASEDGQR IQQKAYDEIM KVYPNGEAWE KCLVEEKVPY VTALVKETLR

361 FWTVIPICLP RESTKDIVYN GATIPAGTTF FMNAYAADYD ADHFKFPEKF IPERYLDVGE

421 GSGTPHYGYG AGSRMCAGSH LANRELFTAY IRLITAFTMH PARDPTDRPI LDAIECNDIP

481 TALTTEPKPF KVSFKPRDAK TLQRWIEESD ERTREL

 

>CYP504B12 Aspergillus clavatus

89% to CYP504B5

ACLA_026760

MAITAALSFVQYSILHYPLQSFAAAVLIVPFIYVIANEFIRASVRVPGFEGPRGLPLIGNLAQIRKNAAEQYRIWSKTYG

PVYQIQLGNIPVIVVNSAAAAKVLFGQNAQALSSRPEFYTFHKIVSNTAGTTIGTSPYSESLKRRRKGAASALNRPSVDS

YVSHLDVESKAFVAELYKYGHSGKTPVDPMAMIQRLSLSLSLTLNWGVRVASQEEDLFNEITHVEEEISKFRSTTGNLQD

YIPLLRLNPFSSNSRKAKEMRQRRDKYLGALNRDLDDRMEKGIHKPCIQANVILDKEAKLNSEELISISLTMLSGGLDTV

TTLVAWSICLLSRRPDIQEKAARAIHIMFTEDKPLCDSGDDQKCAYVAALVRECLRYYTVLRLALPRTSIRDITYDGKVI

PKGTVFFLNAWACNMDPEIWSDPEEFRPERWFEQPDAPMFTYGMGYRMCAGSLLANRELYLVFMRTLNSFRIEPHDDVDW

HPISGNSDPTSLVAIPKKYKVRFIPKNAKALARDLF*

 

>CYP505A18 Aspergillus clavatus

87% to CYP505A13 Aspergillus fumigatus

ACLA_037140

MTESKTIPIPGPKGVPLLGNIYDIEQEVPLRSINMMADHYGEIYRLTTFGRSRVFLNTHELVNEACDEERFSKVVTAGLN

EIRNGIHDGLFTAHFPGEENWAIAHRVLVPAFGPLSIRGMYDDMYDIATQLVMKWARQGPHVPIMVTDDFTRLTLDTIAL

CAMGTRFNSFYHEEMHPFVEAMVGLLQGSGDRARRPALLNNLPTSENAKYWSDIEFLRKLAQELVDNRRQNPEDKKDLLN

SLILGRDPKSGQGLSDSSIIDNMITFLIAGHETTSGLLSFLFYYLLKNPRAYQKAQEEVDAVIGRRKITVEDLSKLPYIN

AVMRETLRLRSTAPLIALHAHPEKNKEDPVTLGNGKYVLNKDEAIVIVLDKLHRDPKVYGPDAEEFRPERMLDEEFDKLP

KNAWKPFGNGMRACIGRPFAWQEALLVVAILLQNFNFQMDDPSYDLHIKQTLTIKPKDFHMRAALRHGLDATQLGIMLSG

SVDSVPPESAGAASRSRKPQAAAPPSGQLKPMHIFFGSNTGTCETFARRLADDAVGYGFAAEVQSLDSAKENIPKEDPVV

FITASYEGQPPDNAAHFFEWLSGLKGKELEGINYAVFGCGHHDWHATFHRIPKAVNELVGERGGNRLCDLGLADAAHSDM

FTDFDSWGESAFWPAITSKFGGGKSETGTKATSNLQVEISSGMRASTLGLQLQEGFVIENQLLSQPGVPAKRMVKFKLPS

DMTYQCGDYLAVLPVNPSSVVRRAIRRFDLPWDAMLTIRKSSQASKGSTSIPLDTPVSAFDLLSTYVELSQPASKRDLNV

LADAAAADADVQAELRYLASSPSRFTEEIVKKRLSPLDILIRYPSIKLPVGDFLAMLPPMRVRQYSISSSPLADPSECCI

TFSVLNAPSLAAASLPPQEQEEAEQYLGVASTYLSELKPGDRAHISVRPSHSGFKPPMDLKTPMIMACAGSGLAPFRGFV

MDRAEKIRGRHSSIGSDKEIPETAKPAKAILYVGCRTKGKDDIHAAEFAEWAQLGAVEVRWAYSRPEDGSKGRHVQDLML

EDRAELVDLFDQGARIYVCGSTGVGNGVRQACKEMYLERRRQVRQEKRERGEDVAEDDEDAAAEQFLDNLKTKERYATDV

FT*

 

>CYP505J1 Aspergillus clavatus

46% to CYP505A15

ACLA_032390

MSEIPQPPGLPYIGSLLEIDPKYTVKSLRRLGDIHGPIYRLSIVNITRIVVSNHELFDELCDESRFVKSVSGPLSQMRNL

VHDSLFTAHPNEQNWGIAHRIIVPAFGPVPIQDMFHGIYDIASQLILKWARQGPSKPINVQEDCTRFTLDAVTLCAMGVR

LNSLYSEEKPPFAQAMDGFMRESNYRAQRPAFATRLLWWYRQQYDRDIDFIRKFAKELINARRKNPTENQDILNVLIKGR

DPETGRQMSEESIIDNMVTFLIAGHETTSGGIAFLLYYLVKSPDVWQKVQNEVDAVVGSGRITSKHLSKLRYITACVRES

LRLWPTIPVIAFKPKDRQNPTVIGKDKYSLMPGQTIIALLPAIHRDPDVWGEDADEFRPERMVDEELSALPKNAWKAFGN

GARSCIGRPFAMTEMVLITALLAQNFDVEQHDPDYELDIDQIVTLRLRNFFLRVKPRPGIDAVQLANRLFNDQEAKSRPG

PEATMTPAVRDKLKPITVLYGSNTGTCESLARQFSRDASRYGFNPTMLPLDSALEKLPTDWPVIILAASYEGQPAANAAK

FVSWLQKIKKPILSGVSFAVFGCGNRDWTATFHRIPKLIDRLLSDAGAHRLLELGLADVSSMVVQETFETWYGNQLWPAL

RAKYTISELRPLPSKLTVEFTNHLRQATNGQEFIEASVIENKLLTASGVKAKRHLELALPPNAEYTVGDYLHILPMNPPV

TVQRAMGFFRLAEGTYMKVTGGLSTVLPIGKEISVEEALSRYVELSQPATQKILERISLSTPVLTEREKLSHQAASSTSL

QDKRISILDLLEHAPSSTISFADFISMLQPLRARPYSISSSPLNCARSCSLTVSIVDNPEPTARETRVLGISTHYITRLK

PDQRILCSIRPSNSGFTFPDNPETTPMVMICVGSGIAPFRAFVQERVCRAEKGQKLAPGLLFIGCKSPKHDRLYGSELDQ

LEEAGIVTVRYAYSGLPYRKHVQDKLWDERETLVDMYKGEARFYLCGPVELRDSVLAVARRIYMATVEANGEVRGEDEYQ

NWLAKMNKGRFAADTFA*

 

>CYP531D6 Aspergillus clavatus

72% to 531D2

ACLA_059870

MTVLTYLLPTSWWGFIPVVVGVFVLTRAVWDALLSPLSAFPGPLAAKVTDFWRAAQAYGGYIDRKYNVLHRKHGSVVRIG

PNALSIGDPNLIRVIYSTRNPWKKSDMYKPNDVLINGHRMSNLFNTQDEHWHNQNILPIRPLWGMGKVLEYESLIDETLN

LFTGKLRARFTGSNGRTICPIDEWLGYFAWDVTANISFGRHYGFIEQEKDVDNLITDSTKGLIYFAPVSQIPWVDRLLDK

NPIVRIGPKPTLTGVLYTFGVVTEYQTQLKEKKSRLNAVAHTLDKYVQLKDSYPDIVDDNQIVNWLMLSILAGGDTTSAT

MRAVVYFLMKTPAANRKLAAELDAAKLDIPAQWRDIRELPYLDAVIRESMRLNPGIAMNFERIVPAEGFTLPDGRFIPGG

TTVGINPAVTNRDPGVFGGDVDVFRPERWLRGAGEDQAQFQARHRRMKDTCDFVFGGGGRICMGRYLAMLEIYKLIATLY

SQFEIQLVDPNHEWKYRNAWFVYQSDMPVIIRPRQRD*

 

>CYP539D7 Aspergillus clavatus

68% to CYP539D3, one frameshift = &

ACLA_082210 revised

MIEDLIAQMPLGMATLYLLGAFFLICLLRKAQVSTQISMLGYRAPRVGFRLPYAIDFIYKALKAHNIHEDLEFWHQAIRT

AKGASKIDHVKTAEVDGGVSNRVILTKDPENIKALLTGQFADYGKGEPFHREWKEFLGDSIFATDGELWSRSRHLIRPMF

ARERIVDTEIFEKHVQHLIPLLAGSDAPGGSKKVDVGSLFFRFTLDAATDYLLGQGTDSLQNPETRFAEAFRYVQSRQSE

LFRLG (2)

VFSFILSKRKFRQELKVMDSFLQPYIDRVLSLTPSELDQKLTKQESFLDALARFTRD

PRVLRDQLVAVLLAGRDTTAATLSFCVFELARNPHVVAKLRQEIDARLGLGPKGRKPTYNDLKEMKYLSAVLNETMRLYP

VVPFNVRYSLRDTTLPRGGGPDGLSPIGVRANTRIIYSTMIMQRSAENYDPPGSPTYFDPEKW (&)

PERWLSAWQPRPWHFIPFNGGPRICIGQQFATIEMGYTIVRILQAF

ESVCALPANGKNRVEDPVLRFEVTLSPGSELNCVFVREGEGQRTGH*

 

>CYP539D9 Aspergillus flavus

75% to CYP539D7 Aspergillus clavatus

AFL2G_09153

MIEELLHQMTPGKASVLFLGVFIVLCLVRKVQVSMHIKRLGGRAPQIQFRFPY AMDFIYNSLNANRAHRDLEFFGNAIKT

AKGASQIDSPKTAEVSAGISSRFIFTRDPENIKAILAGQFADYGKGEPFHNDWKEFLGDSIFVTDGELWSRSRHLIRPMF

VRERIVDTEVFEKHVQHLIPFLSGGNSPAGSKIVDVGPLFFRYTLDAATDYLLGQGTDSLQNPTTSFSEAFGYVQHRQAD

LTRLG IFKFLLSLREFRRNLKIMDNFIQPYINRVLSLSTAELDQKLSKQDTFLDSLARFTRDPRVLRDQLVAILLAGRDT

TAGTLSFCLFELARNPQVVAKLRQEIESRLGVGAKGRKPSYIDLKEMKYLNAVLNETMRLYPVVPFNVRLALRDTTLPRG

GGPDGLSPIGVRADTRVLYSTMLMQRNPENYDAPGSPGYVDPEKFHPERWLSGWQPKPWRFIPFNGGPRICLGQQFATIE

MGYTVVRILQAFREIKAFPVSGKSVVEDPVLRFEVTLSPGSELNCLFVPEEASPTK

 

>CYP540B17 Aspergillus clavatus

85% to CYP540B7

ACLA_013210

MPTQQFYLSGEPISSARTIELDGMQSLDDLRNLIAAHFAIVEPSGIDFQGRDTCLTDIPEITSSASPVAITVDGHAVRDV

PSPAPLPLVGNFFQVFPDHLGNHQRLFEQFGPLIKTTTLGRTVYQTNDPAISAIVLNESDFFTKKINEAHPLYSLRTPVA

GIFLGDTDTPEWRVAHKFIPPALGPKAVRHYAPTMQKTVEDACQVFDELDERGEAWNVYQFMLKLGSQAVGKLTLGLDFQ

HFTDVDAPIHEMVHAIAEVLSLNKKVTSKGDWYANLPFGDPKRLKMLKARIEQMVEESIENAGRGGVEDLPLQDAALRAS

NMVDYAIRATDNKGEKLPKSSLIWALVVAAAAGFTTTSSLLSWLIYGLVTYPGMQDRLLQELIDHGFTDDTEITADFTDQ

LPFLDKYIKETQRRHNPSFQPGRTAKVDLVLPGGYRIPKDAVVIPALHHIHNNPAVWDNPARFDPDRWDTDEVKKRHKAA

YIPFPTGPRMCIGFNFALQEVKVFLPKLIYKYKFSREGDGPIEYDPMFQLIRPNNLYVRAEKRVKWPPKSE*

 

>CYP540E1 Aspergillus clavatus

41% to CYP540D1, 42% to CYP540A3, one frameshift

potential pseudogene

AAKD03000007.1

ACLA_003960

MATKSLYLEGRPPEETLCSVDISGLKTLDDLKYRTASIFGVALPKSISFHNESGLLSSMDDISTTVTKIGVHVDDSVIRV

PHGPRELPFVGQYFEIHPDHLGNHERLFQKYGNVIKTVVMGRTVYLTNDPRVTEVVFGENEFFTKKTSDFNHPFFWVNDN

MALLVGDTGAPAVKLAHKFIPPSMSTAAAQHYMPILQHAIQDSFAVFDQLDDRQAAWNTFQFMFKLSGQMIGKVALGMDL

DHFQTVDTQPHQIMHLLGESIRLTRQASLSHPYLVYLPFSA

VRCLRNTKKT &

LVSALYQTVSPSLISEAPDLPMAQ

AAIQSTCIADYLKRAVDEDNQKMPKEYILPNLVSILAAG

LSTTSSVGSYLLYLLAHHQDMQSRILQELINNNVTPTASWDYKTLMSLPFLDSFVKETLRLHNPAFQPARYAKKDVIVPG

AYHLPAGAVVNPVFFSLHRNKDYWENAHRFDPDRWLAADVQKHRTAYTPFAVGPRRCVGFNLANLQLRLMLAMLIFRYKF

VDVSPEPVVNDHEYLLDRLVNCYVRAVRRTSWPEKEL*

 

>CYP541B4 AAKD02000007.1 Aspergillus clavatus NRRL 1

note only 215bp from CYP661B2

66% to 541B1, 79% to CYP541B2

ACLA_002550

578942  MPTPIPQPPGLPILGNLFDLKPGNTWGSFNKLAVKY  (1) 578835

578761  RPIFKISVVGHDIVFVTSAKLLEEICDEKRFRKCVTGPIVEIRQAVHDSLFTAYHNEESWG  578579

578578  IAHRIMAPLVSPDAVAEAFAGMRETTKDLIQKWTAGPRQRVNVCNDLDRLNHAANMLCFF  578399

578398  DQRIHCLEGQEPSVIKAMDAATNEAMRRAARPKLLNWLIYQRRFNAYNRTMRDYAAEIVA  578219

578218  QRRAYPTDKKDLLDALLHGKDPQTGLALTDSQHLDEIINIFIGSATSPNLVSFALYYLMK  578039

578038  HPQEITRAREEIDGVVIDQLEHRHLASLPYCEAILRESLRLCATAPGFNIEPIPGQE  577868

577867  EPVLLAGGEYQIPNKQPMIALLSAVNRDPEVFEEPDAFIPERMVGENYERLPAGVKKGFG  577688

577687  NGKRQCFGTRFAWEWCFMVLVTILREVNFDLADKQYQTAVEGINYNGAFSTKPLGLFAVT  577508

577507  GPRQRL*  577487

 

>CYP547C6P Aspergillus clavatus

65% to CYP547C2

RSPMGSCWQVSLLPSLRAGIAGRFRFEMQDPKQQIHIADAVTAKPVEGMHLKMSRIEGW*

 

>CYP548C4 Aspergillus clavatus

82% to CYP548C2 A. niger

ACLA_093770

MLSPQVVSSFALRGLLLGLFALCCTTVGFVVHRLFFHPLAKYPGPWLAKVSNLYAGYHAWKGDLHLDMWKCHEKYGDFVR

YGPNSLLVNTATGLHDIYGHGKNFRKAQRYAAMVHRAPNTLTVIDKKKHGKKRRVISQGFSDAALKNHEVVINEQIRQLL

AQLKTGEGGKAVSVGSWSSPKNMGRFTDYFAFDVMSNIIFGVPWSTLRTPTYRFVPEVIEKSNVRVGVLAQAPEVTFMRL

DKYLFPEAIKARDIFIRFVEEMLNQGIQVAATTGKGVFATLANATDPETGLPLRKRELGGESATLIVAGTDTSSTALAAC

FFYLSHNRSALERATAEVRSTFQSPEDIRMGVEMNQCVFLRACIEESMRMSPSAASSLWREAEEAGATVDGHYIPPGVDA

GTCIYSIHHNPAYYPQPFTFRPERWIASECHTVKGDVSLARSAFNPFSIGPRSCIGKSLAYVELHLALANVLWAFDLRLA

SGDLGKTGEGVENAEYGRHRVNEYQLYDHLTAAKHGPYIEFSPRV*

 

>CYP548D6 Aspergillus clavatus

82% to CYP548D2, small deletion in lower case region

ACLA_098250

MFVHTLLANLSVGDVAVRVSFLLSALSIAWVVYQRFISQLCFIPGPFLASITPWVQLYHGLKGDRHLWLHRLHQKYGTHV

RVAPNFVSVNTARGLHDIYGHGKRLRKANFYNAFPAIKGVYNTHNAIDKTMHGRKRRVLSQAFSDHALKSMEDVMLLHVR

QLCaalaggsaagqka

VFNLGDYFSYLTYDVMGELCFGKSFDMLVSSGKRKLIELVDRAANRHYV (0)

CGLWMPLDTWHLDQI

FIHKLTNDRWNFIMNSRVEANARAKERAQAGREAKKDFFYYLLNAKDPETGKGLTTPELWGEANVLMIAGSDTTSTTLSA

TLFYLVRDPRALALLQKEVRDAFTSVEEIITGPQLNELVYLKACLDEAMRLAPAVPGAPPREILEGGASVDGVFLPAGTD

CGTPTYSVHRQAEYYPEPETYIPERWIEGATCKTATESWQVSKEAVEVARRAFCPFSIGPRGCIGKSMAFMEMRLTIARL

MFLFDFELADRRGEDEKGQLALVDHFTSAKYGPNVVVRKREM*

 

>CYP548G1 Aspergillus clavatus NRRL 1

AAKD02000022.1 ctg02_1099423829560, whole genome

65% to 548G2P 39% to 548A3, 41% to 548A2, 42% to 548A4, 40% to 548A5

in the CYP53 clan part A

ACLA_043850 GENE MODEL REVISED AT N-TERM

MILAVHNLLDSLTVYSWRLLTTGASLGLFFL (0)

IGLSVYRLFFHPYAKYPGPLLAKLTSWYAVYHSYVGDLHTDIWRCHQKY (1)

GDVVRYGPNRIVIDSEYGLK (1)

AIYGHGANVHKSKGYERVSFIPKVHATL

CTLDDARHKFYRRLMNQGLSDTNIRRMDNKLKSIASLFASSLGEPTDRFHKSEDPAGDGWSVPKNMSHW (1)

CDYFTFDVMSELVFSKSYNLLTDSTNHWIIEGVLGQ

MQRFGFLLQLPELETLKLNHLFFPEARRRAIRFSAKAREIMQERQSRQKEELNDILGNLL

AAKDPETGEGLPNAQLWVDTNLLIIAG (1)

SDTSSTGMAALFFYLSRNPTAYDRVIKEVRAVFNNPEEVAQGPLLNSCIYL

RACISEAIRLCPAVSGALWREVLDGGLSIPEMNIHIPA GCEVGTGIWSLNHNEKYFPDPF

AFRPERWIAEESGDEAVTLAKSALASFSVGPRNCVGKGLAIIEISLAIAAVISQYDFRKA

ETRCTEVGEGKGEFKGQFQTSWAFTSLKDGPYIQFRKYMPGSN* 306652

 

>CYP548S1 Aspergillus clavatus

45% to CYP548A2 Magnaporthe grisea

ACLA_062280

MALSPSAIAGATALFGVVYLVVVSVYRLYFHPLARYPGPWLAKVTSLYAAYLSYTGEIHLEMWRAHEKYGDVVRFGPNRL

LFRTSTALKDIYGFGQNIRKAAAYHQFPTKFAYSTHNAVDKEMHRRKRKLVNQAFSKNALKIWETSQLQQIRIMCNELIQ

PSSTPSLSEKQGWSSPKKMSDYALYLMSDIVSEAVFGTSFRTLTEQTNRHVLHLVHKSYEWIGIIFQSPTISKLGLDGYL

IPQLARARQALRDDFRVLMRDRINSQTEKRDIFSIYSEYTDEKTGESFPLSEITSEALLLFGAGPDATSTSLTAAFFYLA

RNKAAYDKVVAEVLSTFTDVEEIVGGPKLNSCHYLHACIDEALRMNPVNGGALWREVVSGGATIDGHSIPAGADVGVAIY

SIHHQADYYPDPFTYRPERWIASPETGVTPAAVDAARKAWSPFSIGPRGCVGKSLATTLLHISLARVLFLYEMQLPKDER

LARVGEGKPGLPFPRNLTSELQSKGTFSSIVHGPMLEFKRR*

 

>CYP551C2 Aspergillus clavatus

75% to CYP551C1

ACLA_076840

MEASLHFPIDASLRAAVAVISAGAFYLLNLVIYRLFLSPLAKFPGPKLAAVTSWYELYYDLVHKGKYLFEIEKMHDKYGP

IVRINPFELSIRDSEYYDELYVAGSVRPTDRYEAFVEGIVDFKGSHIATIEHDLHRKRRKPLDPYFSRLGVSRLEPMLGE

LTEKLIVNRFESFKRTGKVVRLDHAFTAYSGDVINRLCMDDPPDVLVDDPEFSPWWYNMFHNGIATLPLFMGLPWLIHVV

RLIPVSILAKLDPGTQTFNKFKMMCDDHLRVAKREKAAQGSKDTSMMDARPTIFRHLLNSDLPPSELTDDLLSKEAQVLI

GTGTITTAGSLCFICYHIVVNPAIKKRLQEDLKLIMANYPAKKPTWAELETATYLQAVIKEGLRLSFGTMHRRTRVSPKQ

PLQFRQWTIPAGVPVGMSAYYAHRDPSVFPRPDEFLPERWLSNVTPEMSRNYVPFSRGSRRCLGMNLAYAEINHVIATLF

RPGGPDFKLYETSEKDVKPAHDLIVPLPSLESKGFRVIFR*

 

>CYP567D3 Aspergillus clavatus NRRL 1

XM_001273850.1 89% to A. nidulans CYP567D1

ACLA_063960

MSASWGYEPTSWLDIFTVVFVL (0)

ERHANGTELQILVYVSTQSLYNIYFHPLAGFPGPLVARASL (0)

AWRIYHSMGGRFHRAIDEQHRRYGPVFRVSPNELSFASVASWKDIYCHRATGQLPLIKSKFYDIY

GAGFGSLCIGSERDPDKHTRMKKSLSPAFSLRSLGDQEAILSQCVDRFVSRMGEPELN

AGGLNMTKWYEMVAFDILGELSFGESFHSIEDGKPHFWSSLVKDHLYFITVADNLRHF

PVVALIAKLLSPFLNGIRKKHTGYTRDKAARRIGSSSARKDFMANLIGKLESNEMDRE

ELTAHASTLVIAGGETVATFLAATTFYLLRNDAAYQNLKAEIRGQFNTYAEITSARAQ

ALPYLQAVISEGLRIYPPGSQGFPRVSPGASIDGIWVPAGAEVYTSAWTVTHNEANFH

DPHTFKPERWIDPDCADIKEASQPFSLGTQACLGRNVAYMEINLILARLIWMYDMETV

NKSMDWESESSLHVMWSKPDLKVHFRQARP

 

>CYP567E2   Aspergillus clavatus NRRL 1

           XM_001273844.1

           ACLA_063900

1     MDQFKGQPAWVLIGVSGLMGIMIWIARLLIQAFVSHPLAHFPGPRLSALSNLNYSWAYMG  180

181   GRQPYDILNLHAKYGPVVRVAPNELSFNTPQSWKDIYAPRKGRPTFIKSDFYDGGNFADQ  360

361   ASSVVSERDPAKHRAMRKFLAAAFSERSLREQEGLVTQVIDDFIDQVGQRGNSKEGVDMT  540

541   MWTNLLTFDIIGQL (1)

      AFGESFHGLETGNLHFWIAVVTESMGQAGLSDFLKRFPIIGHIFLK  720

721   LNPRWLNKLMDGAIKHQTYTIDLVKRRIQQKTNRKDFMSHLLAERNASQISDIQLAAHAS  900

901   DFVIAGSETTATCLATVIYYVGRNPRILKALQEEVRSAFGRPEEINGQSTSS  1056

1057  LKYLHAVCLEALRIFPPLALGLPRVVPEGGEMIDGYFVPAKTIVSTNPFAASLDPANFDA  1236

1237  PWVFCPERWLRLSAEDQLEASQPFSMGSRSCLGQGLAWLELRLTLAKLYYWYDLKLVDDE  1416

1417  LEWHGDVAMHLLWVKPKLMTQVTPRAK*  1500

 

>CYP570K1 Aspergillus clavatus

49% to CYP570C1 Fusarium graminearum, 47% to CYP570D3 Nectria

ACLA_061370 revised

MILPSFKIGETSVSVQVLLVTLLGLSLVSLAQRFVAWRRLSHIPGPFLASFSNLW

LAWHAHRGTLPWAIKDVTDKY (1)

GPLARVGLNVAVNANPESVVKILQPRSGFIRALDYQAARFRPGSDNILSMRDEKAHKTLKLKTTAGYNGK

DVEGLEGQIDRVVESFVDLIERKYLSTPSDYRTVDLARITQYFTLDVIMSVAFGKNFGHLESDSDVYRYLSMTESFMPVV

AIVLVYPWLCNVLESKFLKMMAPKDTDKQGMGKVMGFAKEVVSERFGPNRIVRKDMLGSFIAHGMTQEEANSETLVQIVA

GSDTTATAIRAIFLHVISSPHIYSTLRKEIDNAGPISSPITKAEAENLFYLQAVIEEGLRFWPPIGLLASKLVPNGGATI

NGFFMPEGSNIGVSIMGIQRSKDIFGEDADEFRPERWLNIGEGEAEKAREKKMRGTVDLVFASGKYSCPGRQVAMMELNK

IFVEVLRKYDITLVNPSQPWTSFYAGVWMQKNLRVRFSKRTDSVIA*

 

>CYP573A9 Aspergillus clavatus

76% to CYP573A3

ACLA_008360

MGLGESFLSQVTVTNVTLGLVAYVVLKFVYQIVYYRFFHPLSVFPGPFWGSVTRLWIAWHNLRETELPTVYALTKQYGPV

VRITPTLLLVSDPTKLPEIYHRNADKTGHYITGTFGETESLFNMRSHKTHAVFRKHVAGPYSFSNVRKMEPLIDVRIQDW

INKLEDKFAQTGKGFDFAWWAVYMAYDIISEIGFGAPFGFVEQAKDVGGLIRGFHDGLPAFGFLARLHPFTSWVKTTFLK

KYLVATPQDDSGIGILMRFRDRLIDQRFRELEANKDIGRIDLLQTFIEARTEDGSPLEIEYLKAEVLLVLLAGADTTGTV

FQALIHFLLTHPAAYRRMMKEIDSVSAQGLLSDPVPQYDEITAYLPYYVACVRETLRLNPPAPNIFPRYVSEPGLDLYGR

FAPAGTEVSGNPWIMQRNPAMYGEDAEEFRPERWLDADKAKVYNKYLFTFGYGARMCLGREIAMMELYKGPLQFFRRFNI

TPMIDKPAARFVIKGVLGSTGICG*

 

>CYP577A8 Aspergillus clavatus

56% TO CYP577A2 Fusarium graminearum

ACLA_067130

MESYMVKSFLLGVSLSLLYLIGKVFINLFQSPLRSIPGPKLFAITKWRLAYEDYRGTRTRYMKTLHDRYGDAVRIGPNEV

SFNSLSALRTIYGAGTVFQRDTFYRMFDAYGKQVMFSFASSKDHRARKKLLNHAYSKTSVLSPNNASMIEEKARQFMDLI

EKEAKDGSLEIFAALHYFSIDAITKFLYGKSAGATTALTASQDRSLLDDILDPDRRKLSWFTIHFPTLTNWLYSRTGLLE

SLLTDLGLLPMRKPSTYTGIRAHALAAAEHLSQSTTESLDVNASIAERLLVAGRTADPKGVPMDHLDVASECADHLLAGI

DTTSDTSMWAMFALSQPENQIFQDKLRAEVRSLGEEVTTDRVVSAIAADKQPYLDAVIKETLRLFAPLPGTEPRFADTDQ

IIDGYSIPKGTVVSMSPYTLHRNARVFQDPTRFNPDRWLGDAEAVAEMKRWFWAFSSGGRMCIGMHLAMAEMTTLLASVY

RTYKTEITPGFEGVSPGVTARYEVFSDEQFPRMEEHVCWVKFVKE*

 

>CYP578B6 Aspergillus clavatus

75% to CYP578B2

ACLA_060810

MSHFHLAVIAAGSLSALLLLFYKLLLSPYFLSPLSKIPNAHFTAPISSAWINRKRRHGQEVLAIYTLHRKHGPIVRLGPR

ELSVNSLAGLRTIYTGAFEKHAFYRDAFVNFFTENLVGMLGNRAHARQKRMLSKIYSKSYLQDLGDLRGLAAVVLARRLL

PVLRGCAVTRAAVNVLPLFQAVGMDFTSAYLFGTANGTVYVSDLSAWGKWLAEYERFKNATLRERYMGFIETWCLAMCRR

MQRNDHPNDVPVATRGVVYEQLRSSLEKDPDARPLELAVASELLDHLVAGHETSGITFTYMMWELSQRPRLQAELRRELL

TLTPSLQDPLVATSEGPVPALPSPAFIDALPLLDAVVRETLRLHSPAPAPLPRVTPCCPGGTTIEGYPHIPGGIKVSSSA

YTLHRIGEVYPQPLEWLPKRWLSPGPGKIHDMRRLFWPFGSGGRMCLGSNFALQEIKLVMAAVYTNYSTSIVDDEGIEQD

HAFISLPKGRKLMLKFTPVEIRVE*

 

>CYP578C5 Aspergillus clavatus NRRL 1

NZ_AAKD03000006.1, 80% to 578C3

ACLA_030420

415154 MGVSTVTSLSIVSVFLFIAYKTIIYPAFLSPLSKIPNAHWSASVSPAWILWKRFRSQNNR 415333

415334 TIQAAHERLGPIVRLSPSEISVNCVEGGIKTIYTGGFEKHDWYPRVFGSFG (2) 415486

415548 TVSMFTMTGSKDHSVRKRMISNIYSKSFLQSSPHMRIISKTMIYDRLLPILYEAATSDTP 415727

415728 VDVHDLNQGLTMDFVSAYLYGLKNATNFLQDTSYRQRMIYLYQCRKPFEFYHQEVPNLIS 415907

415908 WAKSVGIRLIPRWCDQANEILDTWALGLCDKAEACLSSTKLEDEPTVYRQLRQTISKQLP 416087

416088 AKDDPESYAQNPKQQRLEIACELYDHLTAGHETSAVALTYLFWELSKHPELQKALREELS 416267

416268 TLDPKIVYPPPSASAELPSAKSIDSLPLLEAIVTETLRLHAPIPGIQPRVTPSPSCTLAG 416447

416448 YKDIPADTRVNAQAYSLHRNPEVFPEPENWEPKRWLKGINSPSELDERRRWFWAFGSGGR 416627

416628 MCVGSNLALQ (1) 416657

416708 EMKLTVAAIYTNFQTSVISDDNMEAIDAYTVKPRGEKLVLKFQTI* 416845

 

>CYP584E10 Aspergillus clavatus

75% to CYP584E2

ACLA_032820

MASHRFSLLLVAVLLAVYILSVLHRKWTQYRFARAHGCQPPVRLPLKDPFFGLDLMLQAIRNSREHKSLERTVRRFDTYG

NTIATRRFATRMIFTREPQNVKTVLSLRFRDYGLGRRINTFGPLLGHGIFTTDGDHWAQSRAMIRPNFVREQVADLHVFE

SLLVDFLALIPADAATVDLQDLFFSYTIDSATEFLFGHSVQSLKKRRAGGRDAGSEDDFAAAFNCAQQAIVNGNRLGPLR

FLFPDRRAEAARRVCHALVEQFVDKALAVRATPDEEKAQPPAAEKKRYVFLDGLAQQTGDRRRIRDELMNVLLAGRDTTA

SLLSNLFFMLAKHPRVWARLRAEIATLDGRPPTYEQLRALTYVKYCLNESLRIHPVVPGNARFANTDTVLPLGGGPDGQA

PVFVAKGTVVVYSPFAMHRREEFYGPDAEEFRPERWADLRPGWEYLPFNGGPRICVGQQYALTEAGYVTVRLAQRFSVLE

SRDPGPWEESLALTLSSRNGVKVSLRE*

 

>CYP584E11P Aspergillus clavatus

pseudogene ~70% to 584E3

ACLA_051510, ACLA_051500 (join)

MSILAAVVFIYRLARNCETSCLYGNTFTVQELQRRAIAVIEPENIKTVLSLNFKDYGIRYCLELFRPLLGEGIFNTDGDH &

AASRALIRPTCA & DPADLRLLEGLLQDLMVLLLRDGTTADL*ELFFRYT

IYSATEFLFGQSVGSLKKKKEEDSSSLSELGFVEAFHYAQKAVLTRVMLGSFTAVY

RDHKADVCNRICRDFVQQFVEDAVQAAEGRRKEDDLLGEERMKTKEKRIFSYELASQTSDK

RRILDELMDVLLAERDTTASLLGNLFFMLAKNPAIWEKPRREVDVLQNRSPTYKELRRLKYVQCRVNEYIDLSP

ERWEDGELHLQLLPRWEYLPFNGGPRICIGQRYALNEVSYVLVRMVQKFRGLESRDPGPWEESLA*

 

>CYP584M1 Aspergillus clavatus

44% to CYP584E2

ACLA_055810

MWQYLLGSILLLVALHLVKRVEQWRNRRRYAQKYSTKDPVRISDIRRPEGGSYTKETVQAFRKHQGLELLRKRHEACGYT

FESHTLGGRIVNTSEPENIKAVLATHFQDYSLGFRQAALGPLLGKGVFTTDGQEWKHSRGLVRPNVEKAHVTDLSILEKH

IRQLLAHIPRDGRTIDVQDYFFKLSFDNSTEFLFGESVRSFEAAENSEEARFAAAFDFASGETIRRLQYGPFLPLYFNRD

FTKACKVVHRFVDNVVAKALARRASRKAGEKTGNYNFLDGLMDSVTEPKRLRSETLNLMQAGRDTTAGMLGHVFYLLARR

SDVWAKLEAEVATLEGRAPTYEDLQQLTYLRQVMNETLRIYPVAPINSRVAVRDTILPTGGGPDHKSPIFIPAGQKISFP

VYVMHRRKDIYGPDANEFRPERWGEPNFRPGWAYLPFNGGPRVCLGQQFAMTEVGYTIVRLVQTFKAVIQRDFSPYKEHV

RISASVYGGVQVGLIPRD*

 

>CYP586C6P Aspergillus clavatus

~50% to CYP586C3

EDWKRLRQPFNSGFAPQHLMSLLLCVL

IGLLAMDDDFHA*CEASQQSEIYKALYTS

IK*KFLELQDGSTEKKKSRSILSGSVQDIESLDDQLIEKISASLKSFYFIGYQKTSTVL*

WVFYSLSCTPHALRAVQKILDGIFGLHRQYAVKTELFNISHHE

 

>CYP603C1 Aspergillus clavatus

51% to CYP603B1

ACLA_078710

MMITLFTLAVVSIGFFLWWLLTVQPAVTKRALKHIPELRFEDNDTPERYTQDSRSLLFRGYDKYLRHGIPFQMRHPIEEL

GPQVLLPMKYLDEVKYASTSLFSFPLFSEKVFLLNYSNAPRQTDAAAHVVRVDLTKNLGALANGMYQEAIEGLNQSLSAS

EEWNTLPAYDFLSSLTAQVTALALVGPELCRNREWIDISLQTTFAIFNAAFTIRSQYSPRWRWLARWQSDAPKRMRAMRA

RAVELLAPVYQDRLAAIKEHDFGAFADCLHWSLRGNGGETSLTRIAEQQLFLTVASMHTTSSTLTAVLFDLLIRPEYCAE

ITKEMQEALTECEGKWTLQEVAKMRKLDSFMKESQRVHPIGFITAQRMTVRPHTFKDGLHLPAGVIFQFPADAVHHDPAI

YPRPDQFAGYRFLHLRETVDANRYHFASVSDTMLGFGAGSHACPGRFFTSLAIKLILVVLLTQYEVKLADCDGSRPANGF

NDFNMGPSREATIMIRKRSGL*

 

>CYP605B2 Aspergillus clavatus

53% to CYP605B1

ACLA_078670 revised

MWSLQSNIIEPYQVLRQSLEPLKLSRWQMTKLIARSMVNEISP

MVNEISPRTLVLLAVTCSLLVLYFSTRERQPVMPRELPVVKAKSYHFEDIIVEGRKKYPDRPYLAVNNRHSFVVYPPSCF

DEIKRLPEHSASAKDFFHTMNAGDWTYVGHETTPLLKTIIADLTRVIPARVNKRQQDTRMAFESIVGYAPEWKEIGLLMT

TFEIVAKINACAFVGRELGTNNKWVKAVMQSPLVIHVAVLIMNACPALLRPLLAPLAFLPTKMNQWDMRRLLTPMLQEDM

AIFKETKDRSELLRPKQNGKIPLTAMLLSRYKQGEATIRQLIVDYILISFDSTPSTASALYHVICELAAHPEAADVLRQE

LDEVMVDGKLPQTHLQELKRMDSFLRESFRLHPVSLFSLQRVLAKPVKLSVGPTIPAGAIIAVDAAAINRSPSLWKDPDE

FDMNRFHDLRQVPGNENKFHLLNTGSDSPGWGDGTQACPGRFFANSTLKIAFAYILQNYDVKRKEGSSPPKMTPLANGTW

APDDKAAALFKSRN*

 

>CYP606C1 Aspergillus clavatus

43% to CYP606B1

ACLA_061240

MAIITKIVAGLICVYIVRKLLFPSVAHLPKGLPIIGAKDSDWFPFLQAAWRNALNLQGNLLEAYAKHKDQAAILPIAGPG

GQTFVLLPASETKLVTDQPSTVLSLREVIVQGLLYEYTISDNFIVSNPTHTKLITTTLTNQVPNLLPGLANETIRGFEQQ

WGTNTESFRDVTIWDSMGAIVSRATNYAFVGLPYCRDSALLDAGIGFARALPFSQLLLSFTWKPLRPLASFLFTLPCRYY

ENRFTQILIPEIEHRLHHSFNPPSSPCSGETSGEAEKKNDFLEWCIEQAKESGDPRMWQPRTLAGRILLMNLVSIHTSSL

TIVNVMLDLASSTPEVLEELRAEVKQVLDTCGGQWTKLALSKMEKLDSVLRESARLNTLVAVGLRRRVVAKEGFTTTSGV

HLPYGNFCAVHNLGVVHDPNVYEQPDTFKPFRFVGLRRDVNSNDPNKDHVQRARLTFPATGCDYLAFGNGRQACPGRFFA

ASELKLMLAYALMYYDLEMMDSRPPDRWIGILRIPSSNAQLRVRRRKGTVEPSMNNDNLV*

 

>CYP613C2  Aspergillus clavatus NRRL 1

          GenEMBL AAKD02000041.1

          note: this sequence is upstream of the pseudogene CYP-un3

          72% to 613C1, 49% to 613A1

          ACLA_066860

MPWIILALPVLVLVTLLPRKVTNSIFSAIID (0)

24668 KYLRWRYPIRSIDGTHTLPTCPYQWPNGQGDVGKFLQGIENRDAWEKEHG

KIYRIWSGMKPEV (2)

VLTQPHHVQSVFRDSNKHSKAENNNSGYLMSELLGQCVGLISQEPWRHLRAVAEVPFQHD

KAPAYVQLVLRHIRQHFSSLHVHGDLQQGRIHPAQDLKMLPFWIVAEIFYGEIDIAMREE

LQQLCLIREQLFRRMIQGGLVRWRWSRYVPSATNRELTDFKSRFRRFNQQAYQHACNQNK

WSLPIVSMTEAAQSGKVSLEQIYQTIDEALFANLDVTTGGISWNLVFLAAHPEIQNRVRD

EAQTATACEAYLLSSSTLLAACVLESARLKPLAAFTVAQSAPTDRTVEGYCIPAGTNIVV

DTYALNIHNEFWGTDSQSYRPDRFLKHRATELRYQYWRFGFGPCQCMGRYVADLVIRALL

AHLVENYTMGILDGDEDKWKRDSESWITLPDMQLKCEPRDVPMTKL* 23208

 

>CYP617D7 Aspergillus clavatus

77% TO CYP617D5

ACLA_043510

MGLVGNHLGVLYLAVAAAVFFKPDYAVWGSRIATVILLFTAITVSKVVYQLFLYARFFTPLKHFPTPSNRHWLRGNAPSV

LVDTPHAQMKEWAKNVPNDGIIRYYIVGNMERLTVTNPTALSEILVSKAYDFAKPLVIRQALARVLGNGVLIAEGDVHKF

QRKNLKPAFAYRHVKDLYPVFWGKGAEMARRIRKELQDRKSPEDNTIQVRNWASRSSLDIIGLAGMGQDFDSLRDPENTL

SRSYEMIFATPGLGTKAMFMLGILLGDATWLAKLPTKRNKLIDAGCRNIRDATRRMIDDQKRKMQDPTAEARVDIISVAM

RSGTFDDETLIDQLMTFLGAGHETTAAAVQWAIYALCKNPAVQTRLRAEVRANLPPINLDAPTPIDAGTVDSLPYLNAVC

NEVLRFHPSVPNTVRVALKDTTLLGKPVPKGTQVVIAPELINHMPDFWGEDGGQFNPDRFMAPGMANTGGASSNYAFLSF

LHGPRSCIGQGFAKAELACLLAALVGSFEFELRDPAAPLEVREGATIAPRDGVLARFTPLDGW*

 

>CYP617D8 Aspergillus clavatus

78% TO CYP617D2

ACLA_090250 revised

MVTMIPWPAVYLATAAGVYLRPQYTIWGSSIATFILLSIVITTIRVVYSLILYPSFFTP

MKNIPSPPTRHWFTGNTSSYLIRTPFEEMIEWARTVPNTGLIRYYIVGNKERILLTSPKALGELLVQKVYDFPKPEMVRL

SLSRVTGKHGVLLVEGEKHKKQRKNLMPAFSYRHIKDLYPVFWSKSIEMVKLIESDLRRRADTEDNVIRVSEWASRATLD

IIGVAGMDHDFGSLRNSQNELTKHYERLLSEPSVGMRIIFVVGILLANLQVIQSLPLKRNREFRESSQFIRDVARQVIRE

KESKMKDGQSAPGSGIDIVSVALESGAFTEEELVDQMMTFLAAGHETTSTALQWSIYALCKHRDVQTRLREEVRSNLPAI

SAENPEPLSAATLDSLPYLNAFCNEVFRFHPSVPGTMRETARDTSLVGYPIPQGTRILISPEVVNHSKELWGPDADQFNV

ERWLGPGRANTGGASSNYSFLTFLHGSRSCIGQGFAKAELACLVAATVGRFEMELKDPEAKLEVRLSATVAPKDGVVAKF

TPLEGW*

 

>CYP617E3 Aspergillus clavatus

77% to CYP617E2

ACLA_098900

MIGFEMSAILAFAVYWMVLYPRYFTPFRNLPTPPQRRILTGNYPALFPDNSWLPLRKLAENTPNEGLLRIYSALSGEVLL

VTSPPAIRDMLTVNAFDFAHQDLVKIAIKRFTGSNLGFLSNEDFKLHRKNMMPAFKVSHIRKLSHIFWQKSQEMVRCMAD

ELRLNPDTSINFREYVSRATLDNIGLAGMGHDFNALKEPENNLRTHYRKLILDPTKVFNWVGLLSRYFDMRILLKVPLRK

LVEISKSANYLRGITGEVIQQRKEKLVADEDLRDKDIITVALASGVFEEDHLIDHVMTFLTAGHESTATAFEWTMYELGR

QPEMQKRLRAELNEAIGSDLAMTDFEKRVQSLPYLNAFCSEVLRCYPFSPIIVKVAKQSTTITGERIPKGTIVLYSAEVT

NHDKRLWGPDADVFNPDRWMGEGNAKSGGAISNYAMLTFGAGPRNCIGLNFARATLECLVAAVVITFDIEPANPDTAGKL

KFGQTKKSAEGVYGRLKLIRP*

 

>CYP617K1 Aspergillus clavatus

50% to 617D2 Aspergillus fumigatus

ACLA_053190

MDTILDFFHHLHAPLMALAIVTVCILRMIHLMILYPTFLTPLRALPTPLNRSWARGNYTNPTASPISQLQHWRAKFPNAG

LIRYYLPGNQERVLVTSVEALNDILVTKASHFTKPMAVRKRLSYITGNGLLLSEGGVHKTQRRALTPAFSFRHVKELYPI

FWRQAMKMADCIESDMTTNIGKGIEVVEVRKWATRATLDIIGLAGLGHDFGSLQNPDNEILRQYQRMRQEPSRVETLLEG

LLSFILPYFDRVVSMLPTRRATIIVEASQCIRALCGKLVQDKKKQNCERLEGQCDIATVALKSGVFTDSELVDQMMTFLA

AGHGTTSHALQWTVYALCKHPGVQERLRAEIRYHLGSPINLNRAVSASDIDGLEYLQAVCSETLRLYPPVPTTTRKSLHE

TMLGGYPIPKGTLFTISPAVINVDPALWGPDSEIFDPERWIGKGRANSGGSRSHHAFLTFLQGPRSCIGATFARGELACL

VAALVGRFQMELEDPKKNEELTKRGVGAAPADGVRVKFKLVDI*

 

>CYP617L1 Aspergillus clavatus

47% to CYP617A1 Fusarium graminearum

ACLA_062310

MTPAQVFTDSTASLPLRILAISSIAWIIWKVLLYPKIFSPLRRFPGPKDSHFLHGQLWRILSEPVGVPMRDWINTIPNDG

IIRITTIFNQERLILTSSEALSDALVTHNYDWDKPEQMKKGLGRIVGQGVLLASGNVHKAQRKHLLPAFSFRHVKTLYPI

FWEKSCEMVEAITKATTNADNTNNKTSISITDWLRRAALDIIGLAGFGQDFDALGKPHSELNNIYEKVFDQPQNENVMKA

IETLENIFPVAWLGSLPLQHNRDVKKASMAIRQAARKVIRSQEQFKTKTASSILSGNSLLSIASRSEYFTEDNLIDQIMT

FLAAGHETVSTATAWALVVLCRQPAIQERLRKEIRSQLPSPSQGTSTFNAQILDALPYLHAVCNEVLRFYPPVPLTRRVC

VRDTTIQGERVPKGTNILIVPAALNVSKKLWGEDALEFNPDRWMGSGKNNGGASSNFANMTFLHGPRSCIGASFAKAEFA

CLLASIVGRFNFKFSDPDYKAEVLSAGITSRLKHELLLTVEVVEGW*

 

>CYP619C2  Aspergillus clavatus

          EU678354

          Olivier Puel

          Submitted to nomenclature committee April 28, 2008

          65% to CYP619C1

          ACLA_093640

MDFTQVPPSYILGVLLSSTSILFCLKYLLRSGYRPPELPSGPTT

VPLFGNELQVPKADAHFQFTKWAKQYGGMFSLKRYMNTTIVITDRKLMKSLLDKKSNI

YSHRPASLVSHLITQSDHLLVMQYGEEWRMLRKIIHQYFMEPNCEREHWKVQEAEAKQ

MLHDFLTMPEDHMLHPKRYSNSITNSLVFGIRTATVHDEYMDELFYLMDKWSLVQELG

ATPPVDSFGLLRILPQWMLGNWKNRAVEVGDLMQALYSKVLDQVRARRQRGVYRDSFM

DRVLDNLEKTPLTENQLRFLGGVLMEGGSDTSSSLILTIIQAMTKYPEVQAKAHAQID

AVVGSERSPSWSDFAQLPYINMIIKESHRWRPVSPLGVPHAVAEDDRVNNTLIPKGST

IVLNVWGMHHDPDRWSEPEHFQPDRFADYPALASTYAASGEWDKRDHYGYGAGRRICP

GIHLAERNLFIGVAKLLWAFEFSEPLGSRSDISAESGASQGFLHCPKDYGCAIRLRAP

EKRETIMREFEEAQGVFSRFD

 

>CYP619C3  Aspergillus clavatus

          EU678353

          Olivier Puel

          Submitted to nomenclature committee April 28, 2008

          55% to CYP619C1

          ACLA_093630

MEPMLLLILVAAVVLLFVRWAFVYGHRTSNMPKGPPTLPFIGNI

HQIPTQYTHIKFTEWAAKYGGLYMLKVGNGNMAVVTDRRLVKEVVDRKSGIYSHRPHS

FVSHELITKGNHLLVMHYGDQWRTFRRLIHQHLMESMVDSQHVKIVNAEAIQLVRDYL

VDPEHHMAHPKRFSNSITNSIVFGIRTADRNGSNMKRLYKLMEEWSEIMETGATPPVD

LFPWMKMLPQWMFSNYVNRAKAIGVQMETLYTDILNKVIKRRNGGQNLGTFMDRVLDG

QEKNDLPWHQLAFIGGVLMEGGSDTSSSLTIAIVQALILNPAVQKKAHAEIDAVVGSD

RSPVWEDLEKLPYINMIIKEGHRWRPILPLCFPHALGEDDWVDGKLLPKGTVVVINTW

GMHMDPSQPDDPAAFIPERYANHPQLAPEYAAGKWENRDHYGYGVGRRICPGIHLAER

NMFLAIAKLLWAFEFQRGGGKIDSDPVTGYHNGFLYCAKDYPCRPVVRNKTIRATIER

EFATATKEVFSQFTEG

 

>CYP620E6 Aspergillus clavatus

63% to 620E5, 61% to 620E1 (subfams 620E overlaps with 620H)

ACLA_072970 revised

MESLAVHALLGLTVLYVVNRLFLTKRTPAPLPPGPSPKPIVGNLGDLPPSDAHHWEHWLKHKELYGPISSISVFGQRIVI

LNEAKVAFDLLEKRSVIHSSRPEQVFAGKMVGWENSLAVQTYSDRFKSYRKAMHRVMGSKSVVSEFDSLQDVEVRRFLLR

VLRDPAGLVQHLRTEAGAIILKIAYGYTIDPHKPDILVDLADQALGEFSKAAAPGKWLVDLVPMLKHIPTWFPGAQFKRT

AQEWKARVVATAEQPYAFVRQQMKLGSHKPSYVSSLLEARPLGSHSEEEEWVIKWSAMSLYTGGADTTVASLASFYLAMA

LYPDVQRKAQDELDRVVGCNKLPTFADREQLPYIDALVKEVLRWHTVGPMGLPHTSTQDDIYEGYFIPKGSMFLPNIW

AFTHDPNVYKDPMVFNPERFLGPTPEPDPHTIAFGFGRRICPGRILADRTVYLGIAKSLAVFNFGK

STEDQQPLFLPGVISHPAPYKLNITPRSPEHEELIRSVEIDHPWEESDAAALRNLEY*

 

>CYP621B1 Aspergillus clavatus

42% to CYP621A3

ACLA_013420

Supercontig 76: 1359064-1360557 (-) strand no introns

MESLILLVLIILPASVLIYKRLTPRNLPPSPPGDFFLGHLRRIPSSHAEYQYAKWSRTYNSDILSLRMLTRCVIVVNSVD

AAHALLKKPTAADRPRFALYEIMGWGITLTFLRSSSPRFKLHRRLLQRSFSPSMCKDYRPIQMQEIRAAVAQIRSHPETW

EVSLRRFAIAVVMRIGFGMDSAQAGGFVDLATAVEEATGRGGVPGFSVVDAVPALRWIPVCVAKRVGMLWGLVHAQQMRG

AVEEFHNGPWGMMEEKLRAGTGETGSSFLGMHLREGKVGVEDLKGAAGTIAIAGGNTTFATIVVCILNLMLQPGVQARAR

AELDGVLGVDARGLPLRLPTFEDRERLPFLERVIQETTRWAPLSPLGIPHAMSAEESVGGLTIPRG

AVVYANAWAMTHDE

RVYAEPERFDPDRYLRGEPLPEGPFGFGRRVCPGQHLALTGVYIAMATLLATVSWRCPVDEAGREKRPEVQFSDGLSGVP

DRFECEMQARDAESKEVL*

 

>CYP646A4 Aspergillus clavatus

82% to CYP646A2, 79% to CYP646A1

ACLA_044680

MTAAMLFNLNVSTLSATALVCMLVCLIVKLFETSPVPKNIPWVLSRKGFLQRAAERFIGVNPIGFIQEGYEKYSKNKQPF

VMPSVNEGDEVILPKEFSNTVLFAKESEYSFKAHIVDFFQLKYTSWPLAFAEKYDFFVKLVSKDLTETLKSKCVATSLAD

EARSCLTDIWGEDTENWVEVPLYSTMEKAAARMINVLAIGPGESHDTGLLNAMTNCSNAIVFGANVIKAFPSFLHPIVGP

VVGLVNRYQEHAFHTRMKPIIDAKIKEQKEAYDSEKLKEHLKTKGSLLDLLIQAGLRSKWPVELDTMWLAYRMFMINFPG

VHTSGISASSALLDILSYPNDEGFGDMLQDEINKIAAGSDGSWTAAELEQATLLESAIKESLRFNGINLLSPTRKVVAPE

GATLPDGTFLPYGTKIGIPQYAIHRDSDLYPNPNEYNPYRFYKEHATADELRQNSMTNTSDTYLVFGHGRRQCPGRWVFA

HIFKLLIAEIFLKYEIKPLATRPKIHRWGRFQLPPLTVKLTIRRKKDTVAVFK*

 

>CYP653A3 Aspergillus clavatus

76% to CYP653A2

ACLA_002050

MIPLWPIILLFCSSVYFYFNPPGEKSNDIPTIRYSHFLPDFVNRLIFIVAAPQLIKRGYDKCKNGPYRIIKADGDLVILP

AKYLAEIRHIPPSRLSGVDAQFENILGKYTNVLVESHLPTKTVIKRLTPGI

GRVLPRILNELQYAFHVEVPDCDDKWVSV

NLYDMILNILTRATSRVIVGETVCRNPKWLQTVTNYTVNLGITVMLLRPFPEFLRPMIAKVLPSVKKLRTQLRYVQKELF

IPMILSRRYSEKNEPAYEKPDDFLQWMMDLAEDDFDKDPANLSQNLLIVMSLAVVHTSTMLMTHTLFDLIIRPEYAQSLR

EEIAATLPDGWDNATQAAFASQRRLDSFMRESQRFNPTGE LSTHRMVKEDMVLSDGLVLKKGTHICFPSKPMGMDSSIVK

DALTFDGFRWCDDPENKNASLVSIGPSNMHFGYGRQACPGRFFATNTNKAILSRLIADYEFKFEDGRKTRPNNILLGEQI

MPNMYTKVLMRKREFV

 

>CYP654A2  Aspergillus clavatus

          XM_01273842 note stop codon in genomic seq AAKD03000032.1

          ACLA_063880

1     MILELSPVTGGAALLLQASALLSLALLLLSRVSGRGRNRLIPGVYVTGLNGGKVPLSQAR  180

181   QNFIHGCADLMLEGYQKTKGGLFYVPSPAGERLMIPTKYLDELKNAANEEVDFTASFSEM  360

361   FEGKYTTIGQKWHLHPNVVKQSLNTSLGMVIPAAAAAESSDYFYATSHNRANRADYARYW  540

541   QPVRMADIFTQIISRASNRMLGGKALSRNRNWTDTSINFTTDTWLASQQLKRYPAWLRPI  720

721   LQHVLPEMSRVRRHFTVARQFICPIVQERSESEKGTIKPLDLLQMLWDGAGPADQTPEFM  900

901   AYTALAISFAAIRTSSSVPTHLLYDLCAQPEYIAPLREEIESVLCEEGSLLTKTALSKLV  1080

1081  KLDSLMKESQRFNPLSLLTFGRVIRSDRILHDGLVVPKDTIIGVPVHAISQDADFYPSPS  1260

1261  TFSPFRFVPSTPGEKTAGFVTTNASSSLSWGYGKHACSGRFFAAN  1395

      *IKLIMAYFLLNYDFQFAGDRTERPANYSFELQNMPDETVEVLVRRRKDRDL*  187174

 

>CYP657B3 Aspergillus clavatus

72% to CYP657B1

ACLA_027250

MGDPGVFSSSLLQSLLSNDPRELIWPTLLAIIVFSCLATRIITGFQSWPEKGAGAGLPRLIRTVPYWVPWLGHGISFGWD

HVVTHQESRNHMDEAVFAIIMGGTRHNIVVSPSLARAILSSRSTSSVSLINYALEKIGGDKGAIRGLSSSDHHLIHHNNP

NLFMREPFLTDASKDATSLIERETPNLVTFCRSMVDQAPWERGSEAEVIDGHDKPISTVNLFALVRNFVGHITTSVFMGQ

ALLEAFPDLLDDIWVFDSHFLALSLGAPRWLPLPGVSAAYAARDRILENLAAFHQAFVSWDDGNEPAVEFRDLEDVSEPV

KQRIRKFKELGLSAKSSAPGHLSLLWAMNANSPNAVFWHILRIYSDPALLEEVRKEIAPYVKVSRPSREETGFPFLEPPK

ISLDSDGLFKSCVLLKASFYETMRLDSASLSFREVTTDLTVTESLEDAAAAGLTQPRTYAIKKGENVSVVHGAVQRDPRF

FSNPDQFDPLRFVITDPETGEKRAEMHTISPFGGGVSGCKGRAFAERKILLFSAAIISMWDIEPVEGSEFKIPRHRRSTG

QFAPKNDIRVRMSTRV*

 

>CYP660B2 Aspergillus clavatus

69% to CYP660B1

ACLA_098770

MTLSLVVVALLILAISIVGLRHAKHDPREPPIVHNGVPVLGHVVGFIRHGINYYAQQSAKHGLDAFTMDMLFTKIYVITS

PTLVVASRRHHRTMSFEPFITGAAKRMAGLRGPGLDLLREKQFGGKGVHADVMHAMRPSLEGAALDRMNEKMIRLLVESV

DELPTVGSFDFHEWCRSAITIASTDAVYGPLNPYKAKELQDAFWDFEANLAPLLMDFAPWLTARKAWKARELIVARFLNY

YRADGHLDSSQLTYTRWEAQHRGGATVADIARLEAAAAFATLSNTVPAIFWMVFDIYSRPALLEEIRAEVTRHAVHVDAQ

GAHVVDLTDIRENCPLLVSTFQETLRLRSNTVPVRVLYEDTVLNDQYLLKKGGILQMPATTINRAPSIWGRDAAEYDAHR

FIKIHQSSDSRKTANGFLSFGTSPHMCPGRHFATGEILALTAMLVVRYDLAPKSGVWKEPKINLRAVASSTRPPATAVPM

TAMVRKEFEGVQWTFRVSEGKGRYGLIIG*

 

>CYP661B2 Aspergillus clavatus NRRL 1

AAKD02000007.1 ctg02_1099423829543, whole genome

ACLA_002540

gc boundary After GKNT?

82% to CYP661B1

575568  MSLFYIFAVPLSLIILYLAWYLHVPWNLPRLPRIPFYVSILGLWSDMGQDEIYER  575732

575733  WLRAPLEKHGAVLIWFAGRWSILVTRPDLLTDMFRNEDLYAKAGSQKKIPWSVIATLVGD  575912

575913  NIINSHGDTWKLYTSIMKPGLQKKTFDSRPLLVKSRRFVDKILEDQATAGK-QGILVNAY  576089

576090  VQKWAVDVMGVSFLDMDLQ  (0) 576146

576245  SLEKPHGAVRLESIQSVIKMTLFRPLFFNFPDLDQFAWLLSSRKRAYEIMHEFGDTLAD  576421

576422  KVLAQMDDATAKGQKPEEEQVVHMLVAAYRDGRLTQKQFKDNLKIVFLTAHENAQQLVNS  576601

576602  MFWEIGKNT (0)  576628

576739  EVQTRLRAEILATGTSNPTADIVNPLPYLTSVIYELMRLYPPVSQLINRVTTAPAMLGGQ  576918

576919  IPIPARTFVGWNSYGVHVNPQVWGADAQEFVPERWGSTVSEMHARFRRETVRGTYIPFNA  577098

577099  HSRKCLGQAFVLLQMKILMFELLRRVEWRVDPGYKLKMTPVS  577224

        SHSSFCFVFFYYVACEV* 577278

 

>CYP663B2 Aspergillus clavatus

60% to 663B1

ACLA_078190

MISIYILVGLVLLRLLYEYHRDRNLPPGPRRLPFIGNIHQVPQSHPWRVFDAWSKRY GPLMRAQFGRQTLILIADTRIAR

ALLDKRGAVYSDRPRMVMAGENVTRGMHMLLRPYDARYRLHQRMEAPVLSPRASATYTPLQELESTQLLTDLLRSNNFTI

HIQRYTASLVYGLAYGFRLPTGAEPELLTLRRILHNFGHVARVGTWLVDAIPLLNYLPAWLAPWKRSANALFELEADLHR

RNMDTALHNKPWNWTKELARSPHATPMSPLEFAYDLGNLTTAGYDTTASAMRVFVLAAVTAPAFIAAAQRELDTIVGPDR

LPSFADKENLP YIAAVVEETLRWRSIAPGGPPHATSAEDEYMGYRIPKGATVMPLHWSMSMDAGDFPDPLAFQPERWL

AAPQQQQQQGGDGKGNEHE

RFTSFFGWGRRMCAGRHIARNSLYILIARLLWAFEIRAAEGPDGRPKHVDDMAFDDGLVSSPE

PFEAVFVPRSEAVRRVVEGEWAGLEKDMEVVMGGIRERQRAIGLEVRV*

 

>CYP666B3 Aspergillus clavatus

71% to CYP666B1

ACLA_066120

MIISSLILGLLGLYAVDYFRRLLKNIRLARRTKLPYIVLPVSGSASIPLKILCGFKWFADAINYHLPGWLADIVNDATYD

FRWTVKDRRAKELGNMYLIVTAEKIDCNVTDASVVTQICNARQSFPKPIWQYKILDLYGPNLVTCEDQAWAHHRRHTAPP

FNEKNNALVWQESIRQTTEMIDHWQRLHSPDDKQGFVVANTRDDFLNLTLNVLSGAGFGVRLPFKPSLQNPIDGPDDIFQ

DTAIPPKGFGFTFRSVMAYMNVNIPTVVLANIVLPKWIPRALVPWLKPDFEAHRDLKAYLQRLIATAAPEKTANSSPNLI

KGLLLSRNQDAGSSTTKDSGLTDLEIIGNMHIFTIAGHETTATSLRFAFLLLALHQDVQDWLYESILVAAQGEPADVAKW

DYSRMFPQLIAPLCIML ETMRLYPPVVTVPKSTSENPYPLEYHGKEYILPPFTNINLNSSSLHYLEEYWGPDAAQFYPQR

WDARNQESFLAKNTLTPGLAGPGLEYATVHKPTRGAFIPFSDGFRACLGKKFAQVEFVVALAVLFRDYKVELADDGPGAR

LDAERVLRESVAVLTLAMRENIPLRFRRRSHCDGL*

 

>CYP667A2 Aspergillus clavatus NRRL 1

AAKD02000032.1

91% to 667A1, one in frame stop codon

ACLA_063860

178399  MLPLLSSAFTILAALFLYKVIRLAHNVRLARKTGLPYTITPLLETEVLALLFNPLLRYLY  178220

178219  RGYLDRGKGWPRWCRFFVKDWAWEDKRQAHDDLGDLFLCVSPEGIICYSADATMGRDVLS  178040

178039  RRNTFTKPRDKY (1)  178004

177920  KILEPYGMNVATAEGKTYQFHVRITAPPFGDLSGVNSLVWRETIHQTKRLTEAWAKSPPI  177741

177740  EIQKDVNALTLAIISLAGFGRRLEWSKDGENEGIPAGYQLSFLHALQDTLHFMVPILLFP  177561

177560  RWVLIIILNKAALAHAQLDRYLRDIIRDQRAKLSADINHADKESRGNLLTAVVRASMVFD  177381

177380  SEPPSAKSSRLSGERRQGFTEDETMGNIFIYLLA (1)

177209  GYETTANAIIYGLAVLALHQDIQDQVIEEIDSAHARAQSANRSELTYEDDFEFLEYTYGFMYE  177021

177020  TFRLFPGVTLITKMIHQSERIITQGPDGTPKSYDLPAGTRVYLNAPAVHYHPKY*PEPYK  176841

176840  LDPNRWRSSQGEKHVVASDKTRQMKGTLLTFSDGSRACLGRKFAQAEYVAFFATLLRQYR  176661

176660  VSLAPGSDPAVVERDLFGKSAGTITLAPLGNVRLRIQPR*  176541

 

>CYP676A3 Aspergillus clavatus

73% to CYP676A2, 63% to CYP676A1

ACLA_060010

MGVFALTTGLESPSTPGFWVLAFLSLVATFAVKRKYSTALRDIPGPFLASFSSLWKVYQVWKGHTEEEMIRLHKKH

GYFVRIAENEVSVSHPDAVRQILHAKIVKGPMYAIFSIPDYHYVNQMSELNPRRHIEKTRNVAAGYALSNIIKSEAYVDTLLQL

LKTRLDGLSESGTPVEFDRWFNYFAFDVVGEVTFSKSFGFVESGTDIRNAIANTRALALYIALMNPYVRLHNLTLGNPLL

SRLGIQPSSHIFDTCLAAIDARKNNPDSRNDMMERWLHVRATYPDRMAENEVFAVAVANIGAGADTVSATLQALVYHLLR

SPGHLQRLRAEIDAAKAKGELSAVVQYAEAQRLPFLQACIKEAYRFHSAVGLGLPRVVPKAGMTIAGRHFTEGTILSVNP

WVFHRNPALFGADCDTFNPERWLDKERCAEMDSYLIHWGAGYNQCPGRNLAHFEISKLAATLFRDYEIEQIHPKQEWMFE

NHFTVVPYNWPCRIRRR*

 

>CYP678A2 Aspergillus clavatus

59% to CYP678A1 Aspergillus nidulans

ACLA_059710

MSDVARWLVDCCFSCSRGWLLLWSL

VVLVAHRLIQHLFFHPLRHIPGPWSATLCGWYEFYTNVWLDGQWCK

TYPYLHEKYR SPVVRVGPDHVHIKDIDTYEK IFRNGTNFYKDHTFYTCADNDGSIFSLCDRDAHRARRKALS

PRFSKQAAEADAPGILQQLRRMEAFIVRQSDEGKDCNINDLFRTFAINIVGKTLLGDCGDLVTYEDSKPELLDIVDGMSM

MIPTLRFFPYLAAINSVVPSFISNLLVPAGVLNFKKICEDYTRSRMDKPIRSDIERSSASVIELLVAHSHDITGGPPNLD

YLAAEAFTFIDAGVDTAGRTLAAAVYHILRDPIIEKKLRDELDKSDAWTSGALEVDVRKLWNLPYLNAIIKEAHRIWPAL

PGPLPRVVPPEGLQVDSYFIPGGTIVSATHHSLHFDEDIFPEPNRFNPERWLRNDRTDLDRYLNPYSRGSRACIGINLAQ

AELLLAVADMFRLLDLELCEPIPSGLTWKDHFVAEPISPILIRARPREVSF*

 

>CYP680A5 Aspergillus clavatus

ACLA_032120

63% to 680A1

AAKD03000006.1 895518-893676 (-) strand

MFLSSLPDIPHLAAIIGAVSVVRFIWVVIYRLYFHPLSKVPGPLLA

RAFFFYSFWYNYHDGRFYLQIEKLHQQY (1)

GPIVRITPDEIHLSDPENLDKVYYVRSRYGKSAPFYNGFGVNSSTFSTASHELHRVKRAALNPFFSRKMVFELEDVV

QQKAKKLVTRMQKAFVSSGRIDLHYAYRAISIDVITDYAFNNCFNSLDKEDFGAEFFTVIRDTVPALWFFQQFSFLHDFA

LNMPLWAARLCNQMLAKLMCYRADLKDQVLRVQASVSSGEKVERKTIFHQLLRPDAADAYTVPTTKQLADEAYVIVTAAA

DTTGNALTIATYNVVTNPKIYERLTAELKERFPDPEAEMDFAALEKLPYLTAVIKEGLRLSFGVVGRLPRVVPQPGAEFN

GYQVPEGTVVSMSSWIMHHNEGLYPNSETFDPERWLNPVTYNTLDKYLFAFGKGTRQCVGMQLAYSELYVTLGRVFRQFD

DLKTRKRTKEELIYDDYFSSYHPEAYSKFIFERASR*

 

>CYP682C3 Aspergillus clavatus

82% to CYP682C2

ACLA_003860

MELIRLLRSHPVAALALLGSGYLLGVILYRLYLSPIARFPGPKLAALTHLYEFYWDTICCGQFTFQIGRLHEKYGPIIRI

SPTELHVNDPTYYEVIYSRDSPRDKYGYYQRTLNAPLAILNAIDHYRHRQLRAHLNPFFSTLRIRKQEVAIKALVDKLCR

RLGEFQNSDTPVNIEYPLTCYTTDVITDYTMGDGYHYLDEPDFIPQWHGTLNGTAKTMVFIRPVAWALPFLLALPESVTA

WLNPGMELFFDFQRRCRRMISAIATAHRESGGKMAQDGGRLTIFDDILNSDLPARDKSEARLAQEMQVLVSAGAETTAKA

ITYILFYLLNDPPTMQKLKQELATLGPDPSLVQLEQLSYLTGVMLEGIRLSYGVTARLPRIAPYNALQFGDWTIPPGTPV

SMSCLLMHHDESIFPQSHLFKPERWTDPAERKRLEKYMVAFSKGSRQCIGIHLAKAEILLAVSTLLRRMDLELYETTVED

VQVKHDIFIPFARMDSKGVRVLIKG*

 

>CYP682N1 Aspergillus clavatus

39% to CYP682M1, 42% to CYP682G1, 41% to CYP58E1

some overlap between CYP58 and CYP682 families

ACLA_061270

MMSSDLSSFLIHCTFKDVLLGGISLYLVYGILLCIYRLTLH

PLAQFPGPKLAAATFWYEFYYDLFPHKLRYLWKIEEMHKKYGPIVRINPIHLHINDPNYLDEIYAGGKRKRNRDPWYYRS

ESNGPLGWSVFQTVDHDVHRMRRAALNRFFSKRSVQEHEQMIIDKIEILCGRFAEACRTGDIVSLTFACGALTMDVISAY

AFGAETDNLTRQDFAAEYLEAYSKLSQLGPVGRQFPWLAKACLTLIPSSLVHRISPAAALIPRNRLFFRGIIEESVRQQE

AGKGNKGKSIFQDILRSNLPPSEKAPARLAAEANLLVIAGTETTARALSLVLFHILDNPQTVLQLREELAPLMPHPDSRV

SVAALEALRFFPAVITEGIRLSHVVSSRMPRYAPEETLRYGKWIIPAGARVMQSHYLHHMNPDIFPDPYTFNPHRWLDNP

ELKQNYFMGFGKGSRICLGINLVHAELYLTIARLMTRFDMRLHETIRERDVDVKRDCIIGLPSLEGQGIRVRITQDRAG*

 

>CYP5058A3 Aspergillus clavatus

91% to CYP5058A2

ACLA_004750 revised the N-term

AAKD03000007.1

1145440  MISLYHMSWLALVAFILQYVAGIWSSRQRRQGAKIPPGPK (1) 1145321 GWPVLGSAPALAAVDINGIIGIFKKWAEQYGSITQFSAMGDK

QVILTEEKDARELFVRRGIKYSDRGAPHAVEYISMKQNPGFRPKDDGWRRQRSMIQSAINITSINKYQRLMDDEATFTVN

ALLQSPDSFHEEFLRYSYSVLTSSLLGFSVHSPSDPFIHHNETFTAELMNSFRPDCFPSNVFPALRKLPTWLLPSLRTME

RLRKEYVGEMWAFRRKIEKLVKDGSATECIYKHFLLNRDQYSVTDEESVHTFQAMIDGGTRSPHNNLLTFIFLMMEFPEW

QKKLQDEVDKVVGKDRMPSYTDIPNLPTVRAIVKEAVRYRSIVAEMGIGHCLQTDDIYEGYFFEKGTVFNAIFASILMDK

NIYPDGKLFNPARWLEPGYPTYKEPLTTYPNCQRFPAFGYGRRACPGVEFAERTLVIMFAKLGWTLNIKWPTDKNGKELR

ENLQYEPVPAPRPLKFGCKLEARDTDRTKIVEKAAKHLSLQ*

 

>CYP5061B3 Aspergillus clavatus NRRL 1

AAKD02000005.1 ctg02_1099423829616, whole genome

78% to CYP5061B2, 73% to CYP5061B1, 44% to CYP5061A1P

ACLA_082520

591865  MALISELLESRYLLQGIALAFFLVIVSHFYQELADGYPYRNIPLVGRSRWELSNGKAKDR  592044

592045  FVKSAKELMAQGFSQ (0)

592170  GRTVFQLMFTHTPMIVLHPKFIDEIKSHPHLNFDEANKK (0)

592344  AFFGSKIPGFEPFEGLDKDHILLDVINKKLTHTL (1) 592445

592496  GNLTIPLSQETAAVVKETMPPRTD (1)

        EWQPLMFAREIPYLVAR  592675

592676  LSSLVFLGEKICRDKEWLNVSVNYTTDAFIGARALRLWPTITRPVVHWFLPSTRRVRKHI  592855

592856  RVAKKIVQDEIQKRELIRQGKLPAEDPPRTHADALDWFREVAAGRPFDETRNQIGLSLAA  593035

593036  IHTTSNLLTNVMYDLVAYQEYIQPLRDEIRAVMEEDGSLRKTSLTKLKLMDSVMKESQRM  593215

593216  NPVSI (1)

        AFLQRLAKADLTLSDGTYIPKGATLIVSAHAMRDE  593395

593396  SIYPDANQYDGYRFYNKRQEPGNEHRFQFVTTSPEHFGFGHGIHACPGRFFASNEVKILL  593575

593576  IHLLMKYDWKFAEDKGRPQGFMHGTEIICDPRVKFLYKARTPEIDLSSLGEGLAA*  593743

 

>CYP5063A5 Aspergillus clavatus

76% to CYP5063A2

ACLA_004470

MTATVLAFLAAGLLSLLCIHVHARKDSKQIKLPLIGDLHRSPIEKPLVNWDSWARENGPIAVPRLFGLIPIVVLNSYEAV

TELFSRRSQWYSNRPPSVSMEMITGAGPGQCRFTLMHDYDEHLKLHHRILSPSLGAPAAPRYQPVMELESNQLLLDLVNL

LRKSADGTTDTTSTDAVYPLLERTQSSVILALHYGMRIPNGKEKVLHEIIEIQTQITHLAANPRLPDLMPALRHLPAILS

PWKRVADRLFAAQTDLNMRLFRHGRDAAGWNATKQAISAAKKYTSSASPPIPDLDLAFTLATSIQGGMETSPRQLLWLFI

AALHSPSFVARAHTLFDEVVGRDRLPRFADRAQLAFIDAIAHELFRWRPIAPGSIPRRADRDDEFQGVRIAKGVTLMANA

WAIGRDDKVFDPALGDLQDFVPDRWLRQTDADNEGVQLRTDLPLPVFGQGRRICQGRRVAIDGTFMQVASLLWAFDIEPV

DGTEAVDPWAMMVVGFMTTPPDVPFKLKPRGDWVLKVIQREWKTVEKDLDKVMGAAIDLEK*

 

>CYP5068A3 Aspergillus clavatus

72% to CYP5068A1

ACLA_044830

MESIQLAIAIAVLVSLAIYCWRLNPGRVAKLCLPPGPTLLSGSLPGKDIATTFQKWSREYGPVVSFSIGGRTFIILGTRQ

AAQDLLEKRGNIYSSRAPSVWMDKYLYKGLAAAFMPYGAEWRLNRRLHGSLLGVHQTNAYRYLQDIQSKYLLHEFLSTDD

FSHGFHQYTSNVMFTLVYGKERGRDNGDHRRLEQINDMASFILRGASSWTLLLDLFPILDRLPRFWWTWRTEAATLHDKT

KAVYRECCETALTADCWNWSREVTGKRDIMALPWDHVCYSLGELYVAGIHTTKMVLDIFVLVSVLYPTVVSKAQRELDSI

VGSDRMPSFDDLDQLPFINAIISELLRWRPISPIAVPHAVMQDDEYMGYFIPRGATIVANQYGMNMDESIFGDPTRFRPE

RYIENPELPVAAFGFGRRACPGHRLARSSLFIVISRLLWGYDITSADKQGPLESSSPSSVKAAFHVRSPRRQGIIEQDWD

LAEKDDGVILDEIQSRFRRT*

 

>CYP5076D2 Aspergillus clavatus

61% to 5076D1

AAKD03000015.1

ACLA_048760

MYSSILTIAGILSHLLYFRHGDHHLLGVTYLQLFVFAVASTTLYYQYIHDLPWSSALTTTSHIFFRYLAGLYSSLLVYRF

FLHPLRRFPGPRAARLSGFWSFTPKHTNHTTLLALHRQYGPIVRAGPAELSLILPSAVPAIYGNQSACVKDSVYDLVLPS

QPLQNCRDRAEHAARRRIWSPAFSDKRLRGYEQRIRVYRQQLVDQLHHLADTPVNICKWFNLYSFDVMGDLAFGRGFDSL

ATGHEHWAILLLVEGMKQVGLFFPPWAAQLLLAIPGASKGWWRLLDFCSERLDQRIREGERVDAETDTYFPDISESLLAP

YKERAPTLQERRDLDGDVRLIVVAGSDTTAVTLSSIFYELVRHPGEMAKLRAELAPYATGADDGEFLGSQIAHLDHLNGV

INEALRLYPPVPGLLARRTPKEGIVVDGVYIPGNMTVSCPQYVMGRSELCYERADEFIPERWYKSPELIKDERAFAPFTI

GPYSCIGRPLALMNLRATVARLVITFDVEFAPGEDGRAFVEKAQDNFVLYPGALNLTFKKR*

 

>CYP5078A6P Aspergillus clavatus

pseudogene 74-85% to CYP5078A4

ACLA_060970

AAKD03000012.1

VH*PFFPSLRLMPHISLGDPSVIPIIYSLNKGLQRY ()

MNLFSARDEIFHREQK ()

TFDVVRELTFAKKLEFLEEARDMDGIIEAIQGMLTYTSLCGQVPEAHP ()

162515  RDVIVHLSTN

162490  AVHASDPEKRRHCSSFNEFLAGSDTDAIALWAVFYLLLQNPTGMTKLLVEIDDA  162651

162652  DRNGRLSNSISYRETTTHLPY

IQAVLKEPMRLHPSIGLILEREVPKGGVTICDKHILSGTIVGINAWVLHRDARVYPDPDSFVPER *IDSDPQ*LKKMEHSFFTFGSGSRTCIGKNISLIEMHKIIP

QLLREFETRLHSPEKEWATRNVWFVQQEGLICDLVRRRDRQ 163153

 

>CYP5080D3 Aspergillus clavatus

61% to CYP5080D1

ACLA_044480

MLSMLSILFIVLTSFLIRSILASIRSPCRALPGPFLGRFSNLWYLWQMKRGDFHKKNIQLHQTLGTIVRIAPNWYSVSDP

TALKTMYGHGTKFEKSEWYDAWNLGKNKSLTNLFSERSSTKHARDRKKVAALYSMTSLMAYEPFVDDCVAIFEQRLREFA

KQGCFIDMGHWLQCYAFDVIGEITFANRFGFLDAGNDVGGIIKSLDTSFTVASYLGLYVWLYPLFVRISIFLGLGQTYVQ

QFTAHHVQEAKATMGNHSSNLPAHMAMKLTQAQMANPDSLSDWDILVSAGANVGAGSDTTAITLSAVLYHLICSPEYLAK

LREEIMRSGIGQNPTFQQAQAMPYLQAVLKEALRIHPATGFPLFRVIPKGGAVLAGHFFPEGTNVGVNSWVAHYDTNVYG

PDAAVFRPERWIESSPEQLKLMERNYMPFGLGSRTCIGKNISLLEMSKLIPVLVRDFDFELGDGLRENEWETRDRWFVKP

RNFQVRIIQRA*

 

>CYP5083A3 Aspergillus clavatus

59% to CYP5083A1

ACLA_042090, AAKD03000004.1

MQAIIL (0)

SLFFFVAYVIYRTYFDPLANVPGPRFAKLCP (0)

SWIISILWTNKVNYSIDEQHRKHGMILDIPQCAFLPLPFRAAI

LTGTGDVVRLGPTELSFSTISAHDTIYNTDAATFTTPGSIQCCGRNLIHPGLTFVVQRSVAEQKELRKIFAPAFRLALTG

GIETNITNRFNELLAALDIRPGMSKCMNLTHCLEQLEWNLIGDLGLGQPVPDSLRGGWTGYKNHQHMIGAAYELGSFLLT

RRGFPKILDIVGKIWPQILLEEGFLSNLAIKQRTEGKNTFVSQALPYKSEKFPLMGTEMPGNVIGIMVASYETSESTLRA

TLCALLSNPAYYKALQHEIRSTFSTLESITDSQLVGLRFLNGCVNEGLRLWPGLNGKFTSRLSTGGVIDGVYVPAGYIVS

ADLYSIQRNPKYWHEPDSFKPERWFDGQNKDELRAFRPFSVGPRSCPGRQMALQKVRLTLSKFAFSFDMEFVNPDFDWQR

DVPSGFLWGSADVMVRISRSDPPQAIDERVAAA*

 

>CYP5086A1 Aspergillus clavatus

54% to CYP5086A1, 38% to CYP602B1

ACLA_055780

MSFELTLEHAIRLLHSSLTLLTSLVGFIAIVAFATQRSPEISSAPLFTPTKSAAGNRKRRWMYDSVNLLQEGYKMFQGKP

FQIWTTEGAQVVIPPDFVDELKMLPDHTFPSALRHFFLHKYLWPIDQHKLDYGHVVIKNDLNKSMSRVFPELCDEVDAVF

PLEFPEFKGWTPIQVYPKMLRLVSRINGKIFVGPSLYDNEEWITISCNYTKNLFLSSAKLRFFHPWLRPMAQFFIPELRA

VWKCNERAQALLTPVLHQRQAQEASASKGGGGEYKKPNDSIEWLRDLVPGPDKNDPLFHAISQLGIGAVSVNTTCQLLTN

SLFNLAAYPEYLPMLREEIESVWAANNQHWTLASMGQLKRLDSFIKETLRFNGHLTATFQRVALRPITLSDGTTIPPGTY

TFAPTNAVNFDSEVYPDPEAFDGLRFYKLRQASSANESKYQLTSITKTELQFGSGRHACPGRWFASHEIKLVLAAVIRRF

DLRLKGEERPKGMLFQTNQLPDVKAEILFKERRM*

 

>CYP5087A2 Aspergillus clavatus

94% to CYP5087A1

ACLA_024290

one frameshift, probable seq error

AAKD03000001.1

MYTALYLAVFIAVFHYTIVLAINHHRTRKTLSQLVKAHNCSSPKTERPWDILGLIKIYSSTKHLLNETALSNVSALFVRY

GDTYASRILTQRVYFTCDPRNIRHILINRFSDFDASDVRAHLFAPITPHGIFAVDGAEWKEARSLYADIFSATRKIFDLQ

LQEDGFQGLIKQIPRGQAVDLAPVFLKLVLDVNSAFAMGTGLETLNQDQSPEKKEVAEALMYAKKIMARDGFLGPLHYLL

SRKDFYAACETVKVYVEKVVRKEMAAREYRKQSNAATVDDERQKRTQSLLSRILDHTNDVPAIRDAVVTILIAGTDSVAS

MLSTTFFLLARHERVYAKLRQEILDTIGTEPPTYDTIRKATYLRYVFNEAMRVYPPVPFNARTANRDTYLPAGGGPDGQS

GVLIRKGQRVIFASWGSHRSTRSFGADALEFRPERWEGLKSESLGYIPFSAGPRVCLG (1)

1818655 QQYALLEASYATIRIIQT & 1818708

1818708 FERLENRDVRPWMEKIGLNLSNKNGVLVELVR*

 

>CYP5089A4 Aspergillus clavatus

71% to CYP5089A1

ACLA_022220

MALATMLLSLALAACIARVVYLCYFHPLARYPGPWFARFTNAWRFVTFFGGQHHLIEQRLHAKYGRVVRVAPNWLSFSSS

DDFEAIYGFNKAIEKSDFYDFGRDRGSRAESIFSTKTEAGHRVRKKKIVGPALTSSKISAYEPVIDKHVDILLLRLQSAD

PLPEPNGHGPLSVNMAPLVHQYTLDSMLELIFGPTLAAHPYTDTPAGDGICRTLRIMTKMAWSFSLWPAFGWLMNTRLVD

AVLRRPTRNKQGVATGMAGLMGAVMPMLQKNPQQVTQSPQPSIVKNWLDIPASDANRMSPGEITADAFNMVIAGPGSTAA

ALTAVLYHLGSQHGQTWQEKIRDETRMPTVSSPALQAVIKETLRFSAAFPTAFPRVIRHGAETAIPGLPAPLPPGTMVSA

NTFVLGRSAEVWGDDAGQWAPQRWLGDEQQRREMEAKFVAFSKGSRSCIGRELALLVLASAVTGVVQRWRIRSQGALRGK

SFLEMQYDECWMELEPVAL*

 

>CYP5093B2  Aspergillus clavatus NRRL 1

           GenEMBL AAKD02000026.1

           82% to CYP5093B1

           ACLA_066790

366479  MASEQVPLYDCLIIGGGIAGLSAALSLVRTLHSAVVFDEGLHRNDDSPHLATIPTWDSH  366303

366302  EPKTFREEAKLNILTKYSTVEFADVKLEK (0) 366216

365065  VNKALGKPFITKVFGHDYVVLPSKYLDDIKRASPKSLSFFQALSD  364931

364878  GLNMEASVGHLYASTTEIDVVVKHLNPRL (1)

364727  NKLTPLLFDEAEYAIRKEIGPATEWKSFNVSNLIGAIVHRTGNRILVGPELCRDEAYLAAT  364545

364544  TRFSRSLFLHGIFWNFVRLGPFRKLIARLTIGLHLRDRDAAARMLLPHIHSRRQEKASGV  364365

364364  DVAAKYPDALQWTLETPSSFPGDDDPLHQAYQMLHLTFAASSASGVGVTQCLLNVLAYPE  364185

364184  YLGPLREEIKTVVARHSGWTDKALSQMALLDSFIRETMRLHPAGS (1)

        LTVARTVMDDQFRFHDGLTLPKGANIIAPALAIHHDPENYTDGSKFDGFRFARYR  363825

363824  QKQGDSHRWLASTIDPKFLQ (2)

363709  FGYGNHACPGRFYAIRKIKLVLGKLLMDYEFQWATPRSVNSRPEDLAIEAQLMVAPDTE  363533

363532  VLIRSCRA*  363506

 

>CYP5094A2  Aspergillus clavatus NRRL 1

           GenEMBL AAKD02000032.1

           77% to 5094A1, 35% to 681A1

           ACLA_064180 revised

260809  MTSSLPIPLQVLNLG

260854  LSFIFAYLTSIIIYRLYFHPLARFPGPKLAAATKWYEFYFDIVKRPGGQFFQELNRMHEIY (1) 261036

        GPIVRVNPDEIHIRDPSWFDVLYAPNPTKRNKYWPSAEMAGLTLG (1) 261228

261296  THGTINHDRHRRRRMANAPMFNKRSILSTQGLIKQHIDELVEVFASKSGTDEPVDLQTTFL  261478

261479  AYTTDVIYHYMFDTDAGYQRDPKVARKWRHSMEAVAQATPFLKQFPNLLSNLLRIPLPIL  261658

261659  IWVLKRVQSDVAGLLETHQ (0)

        LMAKIVSKYMATKATEAQSETDEE  261838

261839  SKKVKPRTLFHAIERSSLPPDEKQPPRLAQEGLTVLFAGGETGSRFLAHTVYHLLCNPDI  262018

262019  LDKVKKEILDAAGESNEVPDVRTLEGLPWL (0) 262108

262165  TASVRESLRLRAATTSRLPLVVEQEMVYQNWVIPAN (0)

262345  TPISMSHPDILHNDSIFPEPLRFRPARWFTATEQQNRLFVPFGKGTRMCVGMD (2) 262503

262562  FAYSEMYLSLAAILPRFDMELYETDWERDVQYSRDCFLGEPDPRSPGMRVKVVAD  262726

262727  NKAFALTETAMVS*  262738

 

>CYP5110A2  Aspergillus clavatus NRRL 1

           GenEMBL AAKD02000022.1

           55% to CYP5110A1

           ACLA_043300

        MAVQASSSIHHLADLGTSAALTGVVLVLLCGLLIVISDYLDGWQQRRALKGIPIVDEG

        SYMRPLLRWKRFDAAKEYARAYHL (0)

        YSKNGQPYATRLQNDDYGIVMPLNSAKEWRALPHEELSFLHALAE (0)

        FVDMNLYSDVTDRTPIQAVHSCNNTQSL (1)

        NHLNKLLVRNIDNVLPSIFKQPTQD (1)

165619  KWLEVNTFQTIMSLCSTVTMSLLLGPDTPYDPVLHHHVSSFGAAIMESCYGRTAYPRILR  165798

165799  PFAWRFSPQCRGLRTHLSMARARLIPEVARRVAAARKANIEVKDSRPTSLLDALIEAALE  165978

165979  NGSLNRDGICTNEKAQLQILADDLLFFHFELSKPTTVNIVFQMYAIMNHREYMSPLREEI  166158

166159  TKALELTNGEWTVETLKYAPKLESFTKETFRLYDISPCN (2) 166275

166335  FRRVMKPVTLKSIDLSLRPGTILVSPCRDIHQDPDFYENPMTFDGYRFYDTNSNACTPRV  166514

166515  ATTSLTFLSFSHGTGSCPARVLASQICRTIFIKFLVEYDVELANKKMPAYGFTNGPVFLP  166694

166695  NPEVMMRIRPRGNGMQ* 166745

 

>CYP5117A2P Aspergillus clavatus

Pseudogene fragment

63% to 5117A1

(+) strand I-helix to EXXR motif

adjacent to a CYP68Q seq on the (-) strand

ACLA_064140

GATFYLATNTAIFPKLASEIRGTFASDEEITVARASKCNYLAATIEECLRMYPPT

 

>CYP5121B1  Aspergillus clavatus NRRL 1

           GenEMBL AAKD02000042.1

           42% to AAKE02000008.1 Neosartorya fischeri

           this P450 belongs to a group of sequences without

           Cys at heme region CYP5102, CYP5120, CYP5121 families

           ACLA_087460

       MAAFG

82938  ILLSAVLVLGGVLLRNYVSLNTVRGPLLAGISNLWREFLQSAPEYGRRLESLHRKY  83105

83106  GQVVRVGPNTVSVSDPSLVAWIDLSDRGTVN (0) 83162

       QLTSTFLRAVRKQRTINLAVFKLFAADIVQHM  83430

83431  CSNDIIQPRASQVPFATDPFIPTESSYVSSFLNSLLLKCPIAMLKHKRNGCLPI  83592

83593  CGFVPESVKRPNAYQPVAGEYQRSGNVSLVAIGVECMEATFASVFYFLSTH  83745

83746  PATLSRIKREIDTIFSMASFSEVLHQTKSYALPYVEAVMKETLRHVMIFDYQHQVPPG  83919

83920  GVMVGEYDLPQGTVIQYHADTIRHNSTTYGEDSALFRPERWLLADTTERKRMEEGLIPLR  84099

84100  ICFRNDSQTRAAWRSLKMIIALVISKFD (0) 84183

       LQLSCEETPDNTSSTMSCNVLVTFAPRLP*

 

>CYP5148B1 Aspergillus clavatus

47% to CYP5148A2

ACLA_082750

MSVMNDTDTLASVLPLDTISSSLGLAAVAKASSPSLWAITVLAGVTVFAWFRRTWTDAHGHKIPKGPRGLPIFGSFYSLT

RFPELTLDYWAKKFGDLYSIWLGNQLFVIVSDPHVAKDLMVTNGNVFSSRKEMFIKSQNVFAGRGITATPYNDRWRKHRR

IATTWLNQRAVDGYSPVLDRESMSLVKALFVESKGGLVPINPQ (0)

PHAGRCSLNNMTTITFGFRT

DSIEHPLVKQALKLSREFMNCTGPMSNLVDFVP

LLQYLPTPMLRRGKKLHKGLVDTYGGFIKEAERKMLRGEKVTD

CLAKTMIELRHKEDLDDLDMAILASAFMIGGVETTAAIMQWFSALIPAYPEIQKKAQAELDRVVGRDRLPTIEDEKNLPYCHAI

VKEVERVHNPFWLGTPHVASEDFVYRGQYIPKDTVVVLNTWTMHYDPVRHANPEKFNPDRYIRDHLTSAESANLADPMER

DHWMFGAGRRICPGMIVAEREIWLTISRMLWAFDMHEIPGEPIDLK

EYDGLSGRSPVPFRIGLKPRHENVAKILESVEI*

 

>CYP5168A2 Aspergillus clavatus

54% to CYP5168A1

ACLA_060130,

MSPLAYILFGGTIGLGMHHGLFIHGEWHIQAPLIVLYHFTCFSVLLMTISHAEWLIGGYLLSLYTSIAVYRLFYHRLNSF

SGPVLARTTKLWHVWKARHRQNHLVLLDLYQRYGEVVRTGPSEVTVFHPDVFMAIDGPTNKCVKSEWYDLLHPDRALVTV

RVKEVHSARRRQWNRGFSSKALDQYSERILAFIDQLDHCIEKDIAAGRVSEATDLFYWLGFDRMGDFIFSRTFDMLSRQA

WHHIILLLQRALSILGPLSPVPWLIHIAFKLFPRVWVLRDWFNMMTWCEAQMRKRMQVMPDDPTKVPDVAHYLIQDANDS

PQDKGWLTGDSILAIVAGSEPTAAVLVGVFTELARHPQHAETIRREMQQLDIRDARALAQHCPHLDAVIFEALRLYPALP

TGGNRKTLQEGTTIGGTFIPPETTIVAPRFVISRREDCFEQADQFIPERWTTRPEMVRNRAAFAPFGTGHHSCLGRALAM

NDMRLVTARLVQKYNFRFPPGDKGEAVLRDLRDQFTSNPGRLRLIFEVRKKRNPSDSD*

 

>CYP5235A3P Aspergillus clavatus

AAKD03000007.1

mid region is 54% to CYP5235A2

ACLA_002830

RVYQWNRWRHIAGPPATGWTKLWLIRQAWSGRLCDSLYNACREY

GPLVRIGLKWVLCGDPAEIRRIWGMNSGYHRSDWYKAVRLNSEVDNVLS

 

TMQYLTQDVITAVGFGKPAGCLEANSDMYGILETSEALYRPIHMITLLPTLRKILESRPL

NPFHPKPHDGSGVGRFLGYIKDLVDERYDDLKANHTDILQSFIKPGLNRPQVESEALVTVFGGTDTTSTALRNIIFYLST

TPRAYRALQSEIDGAVKTMTRPVIRDAEAKALPYLQA 675906

 

>CYP5272A1 Aspergillus clavatus

32% to CYP526G1   Fusarium verticilloides

ACLA_061300

MDLLSWNNLPSIAIVLAFVLYYVFKRAYPSPYPGIPYNAASARKFWGDSSGLLDAVKITQDPAKFIFQQTRKLNSPVIQL

FLAPFSNPTIIVDDVREVKDILSNRTHEFDRAPRTQDAYRSLLPHCSLVKATGPAFKHQRRFWEGVTGTPFLRRVAEPKM

YRCALGLIDLLRAQAKMAGGLPFYCFDDFDVAAFELIWELVFGTNVDAIKNARSKALCATSDTVQPPSLDSPARIPVIQK

PDMCEAVSFFINTVAKSLKSVFPTWHLWYLRQQPVYKRKLAFKNSTIDGLIESTRSKLAGLSEGQLMELEESSVLVTGVR

RQLLAHIRQGQPVNVPFPASVQAEIHDELFMILVAGHETKAVLLSWSVKFLIANPEKQEKLRKALVDALPKGFNGEQPSV

KAILSTPIPYLEAYMEESMRAANTSPRLVRRTTTDTQVLGYSIPKGVTVILNPYIGTQPLDIPEHLRSETSRNSKGNFAS

YWDVNGMDDFQPERWLAEDGSFNPRQFPHLGFSAGPRMCYGRNLALMEFRVNLVLLVLNFKFESLPKDLDSMESQQRLFR

MPRQCYVRLSPL*

 

>CYP5273A1 Aspergillus clavatus

34% to CYP531D2

ACLA_055650

MLGVLLLFFATAGLAWFLATPFRTGLWHIPGPWWRRYTDFFQALDAYNGRTCQIIQRLHKEYGPVVQVGPRTVIFSNPSM

IEKVYATRAPFPKSYHWRPLRTELKGVHYPSLIGTEDTKTHAALKRPISGIYSMSNVTKSESFINECILQFVKEVDREFR

GKEKPLPVFTWMHFFAYDTIMKLTVSADFGLIRGEADRKGMFRGVDAAQTYRAMAACMPWVHSLLKGSPITKVFEKRMGS

FPRRARELIQSRRANGAARTKDREDLLSQILDTQKKHPNVVDELVVHGYATTPLLAGADTVTIGLTSVVYFVAKHPEVAA

KLHAELKSSGLQMPPPWVLIHKMPYLDAVIRESFRCHPIGAMLSRRAVPPGPGLMLADGHTLPPGTAVAVSGWSTHFDPD

AYGDDVHDFKPERWLKRPSESDEEYAERLHRMSKADLTWGAGDRACMGKNIAKCELYKLIATLYSIFDIQLVEPTKEWKI

KETVLAKQEGVEARITFRPGASLDQLVQGDA*

 

>CYP5274A1P Aspergillus clavatus

pseudogene

25% to CYP639A3   Fusarium oxysporum

ACLA_055770

(+) strand

GHIRNILQFSRVLTNRPMMMFAMRKWFYTPLESMHPYAAGSKKEHLQDLQAGISI*FPSGQ

SLLAMS*RYLAILKRCRARVEIPEKGELVIEDFFTWLQSQVTPLVIKAMMGSC

ILEMYPKPVEDFWEFNFNI ()

XXXXXXXXX

WLIPSAYRTRDQLLANIKAWNQFAHPHSDCSKSGAGDPEWDEFFRTKFRKAREETLKQH

RLDNNAIASENLGLLF

XXXXXXxxx

VFWYVFEALKDQNLQGRLQTKLQACYSLRSSTFDLTQFSTKPLLQSTYIKVLR

LRAATTMTCTKEDSDFQLRPDYVVPQDMTTTIFSSITAQNQEAWLLVQPQSAERPLD

EFWLERLLVH ()

xxxxxxxxxxxxxxxxxxxxxxxxxx

RKRPSTWRG*PSAGWPTVAGQRMRPGCHFAKNEIIGTLGLLLEMFSCELVDQRQAEQVKP

DERWFPYGTSPPTRKVAVRLRRR*

 

>CYP5275A1P Aspergillus clavatus

50% to CYP5100A2 A. niger

no gene model but adjacent to CYP5274A1P on opposite strand

only 33% to CYP5274A1P Aspergillus clavatus

(-) strand

RLCPGRHFAKRKMILTADIMVTLFDGEILADVRTLRMDMRGFGFGTLGVDGPVPVRIRRRKINE*

 

>CYP5276A1 Aspergillus clavatus

31% to CYP503B1 Aspergillus nidulans

possible gc boundary at KVWPF, N-term region not well supported

ACLA_095960

MFPTSLVFGATIVFLLYIAKRLYDAQERYPSHIPIIEPVPGTKNEDVIKAQYAKVWPF (1)

SSAVDVFERLCGRYTFLGSAHPDRP (1)

GWNLLGDQMYAAIKYVQGPLTKNINRMLDKIYGEIDRVLQREV

GNGAGRVVNVDFLTTEVYLHVFEMVLVGDDLGHDEEWLRIFADYPRVAFNAAVRLAKYHWLVRPVVARLIPEMRGLLDYR

QEVYDILRPFHQERLQAMQTPDFKEPDDYIQSFINHAGAERGNTWRLAESISGTSMAGIQTTARVLYQTLFDLVQYPEYL

GPIREEINHAISQEGGSANLSQAGLLSLVKLDSFIKESQKFHYNNLVSSNRKLFRSLTLSDGTVIPKNAYVSIPGLAHAV

IDKTGNTRPFDGFQWAEKKLTAENPSVYNYVFSGQDDLEFGAGLHACPGRWFASIALKSALVRILLRYDFRLPEGQKRPV

DEYNDGLEMEHDVTATLEFLAREHC*

 

>CYP5277A1 Aspergillus clavatus

35% to CYP5068B1

ACLA_063150

MLFAVLLCLLAALLTFIVSCRSSQSREKPLPPGPSKLPVIGNVHQVPRLQFWKTMADFVDRYGPIVSVKLGQQQLIVLGN

QTIARSLLDRKNTKYNSRPHLRVAERAWLGPMVALMPYGPEWRTYHLMQTAVLSSRAVRLYDKIYSTETTQLLHDLLSTN

DYPPRIYRYSSGLAYAVAYGMRMPRGDEFEISEINEIALKFFLAAQPGYWSVDDFPFLRYLPGFLTPWKSYAAHVNQIIS

DGFQRAYSNALQRDSWSWARVLAEQETLRALPKGSISFVVGELWAAAHFSSSNMLVALIRLILYHPEEVQRAQEELDSTV

GVQRLPQLADLDNMPYVRAFIREALRWLPSSGTPHASTEDDEFMGYRIPRGSMVVPHYWFVDMDSDVYMNPLKFRPERFV

NDPKLPLRTFGFGSRICTGQYFAQNSFSMVIMRLLWAYNIRFPDYVDTEAEPIGQLEARIFTMNEKPTEAVFTPRSGAHR

ELIEQAYASLDSVDDALKPLQSIKVNIPKSF*

 

>CYP5285A2  Aspergillus clavatus NRRL 1

         GenEMBL AAKD02000041.1

         pseudogene, 70% to CYP5285A1, 33% to 654A1, 28% to 503A1

         ACLA_066890

         Supercontig 80: 639186-639335 -

         formerly CYP-un3

       MEAFWEHIKTLYWPYMATLAAIVLAVRLLCRRQHPIPIVGSPNEPNFMAALKEGAQR (0)

       YPNSCFQIPTRDIPTVIVPLKDLSTIAYAPEHTLSLGREVYERLMGR

       YTRMPKSHHLAEFVRAGLTKNAVKSVALLQADAEWTVSSQLGQIPRISVSHN (1)

       DWKSFSLFPTLVKLVSLHISRSFISPPLSRDQAW

       IDLTLGYTISTVTVAAKMSNTHWSLRPLRGLILPERREMSRQFQRATALVKPILASRLEEEEVEH

       GDLMQWIIDHYPDQKDDVVLHTQLQLEAVQAATYNLAFQ ()

       LIHFFYDLLVHPEYIEPLREEIQTVSECCGGRWTPSALANLRKCDSFLKESQRLNP

       PFRLPDGSTVPAGTSVSAPAMLANT

28289  DKMLWDDPLVFDGYRFEKLRAIGDNEQKFQLSSTS (2) 28393

28450  TSELNWGYGTHACPGRHFASNQIKVLMAALLLRYDFRFAKDQNSDTEYK  28596

28597  RPSNVVEGVRIMPNPNVEVLIRNRVEM*  28680

 

>CYP6001A1 Aspergillus clavatus NRRL 1

fusion with diooxygenase, P450 (C-term) part may act like a hydroperoxide isomerase

XM_001271947 fatty acid oxygenase PpoA, putative

ACLA_049940

Name revised from 6001A3

MSGKREESTNGGIGKTIAQIEKVVTASLRPLPSKTGDGTYVTEA

VKTGLLKDLSHVDLGDLKTLLEVSKSALTGEAVDDKKYIMERVVQLAAGLPSTSQIGK

DMTNTFLTTLWNDLEHPPISYLGRDAMYRKADGSGNNILWPHIGAAGTPYARSVRPKT

MQSPNLPDPETLFDCLLARKEYKEHPNKISSVLFYIASIIIHDIFQTDRKDPTVSLTS

SYLDLSPLYGNNQDEQNLVRTFKDGKLKPDCFSTKRVLGFPPGVGVLLIMFNRFHNHV

VENLALINEGGRFTKPQESDAQAYAKYDNDLFQTGRLITCGLYVNIILKDYVRTILNI

NRTDSIWSLDPRADMKDGLLGEAAAQATGNQVSAEFNLVYRWHSCISKRDQKWTEDMY

QEVFPGQDPSKLPLQDFMRGLGRWEAKLPGEPQERPFAGLQRKADGSYDDDDLVKIFG

DSVEDCAGAFGVLHVPTVFRSIEALGIQQARSWNLATLNEFRNYFNLAPYKTFEEINP

DPYVADQLRRLYDHPDRVEIYPGIIVEDTKESMAPGSGLCTNFTISRAILSDAVALVR

GDRFHTVDFTPKHLTNWAYNEIQPQESVDQTHVLYKLVFRAFPNHFKGDSIYAHFPLV

IPSENKKILTKLGTADKYSWDRPSFTHPPQFINSHSACMSILADQETFKVSWGKKIEF

LMRHNDQPHGRDFMLSGDKPPNAESRQMMGKALYRNKWETEVKDFYEEITLKLLHRNS

YKLAGTNQVDIVRDVANLAQVYFCASVFSLPLKTESNPRGVFTESELYQIMAVVFTSI

FYDADVCKSFELNQGARAVTQQLGQLTMANVELIEKTGFIANLVNSLHRHDALTEYGV

HMIQRLLDTGTPAAEIVWTHVLPTAGGMVANQAQLFSQCLDYYLSDEGSIHLPEINRL

AKQDTPEADDLLLRYFMEGARLRSSVALPRVVAQPTVVEDNGQKVILKEGQHILCNLV

SASMDPASFPEPDKVKLDRDMNLYAHFGFGPHQCLGIGLCKLALTTMLKVVGRLDNLR

RAPGGQGRLKKLSGPGGIAMYMTPDQSGFFPFPTTMKIQWDGDLPPLKTE

 

>CYP6001C2 Neosartorya fischeri

82% to CYP6001C11 Aspergillus clavatus

NFIA_065200

Supercontig 574: 1021375-1025419 +

MLRRFSSTFKKKGDRESKQNGTAAAVANTNNNDNNKRHSKISAARKSSS

DDDRNEKKGDSVSPFEKYASVLHASRSPIPNQTGDGAYLEHEHTTSLLQDARHLGFKDFKTLKEVIESKLPGGQLIDDK

TMLMERIIQ LVSRLPHNSKHREELTNAFLTELWDSLPHPPLS YMGNDYAYRS

ADGSNNNPTLPWLGAANTPYARTIAPLIIQPGGLPDPGLVFDTLFARQTFKPHPNKVSSVFFDWASLIIH (1)

DIFQTDYKNPNVNKTSGYLDLSILYGDVQEEQNLIRTFKDGKLKPDSFSEPRLQAFPATCCVLMVMLNR (2)

FHNYAVEQLAAINEDGRFTKPADNLSEEEAKKAWAKYDEDLFQTGRL (2)

ITCGLYINITLYDYLRTIVNLNRTNSTWCL (0)

DPRAQMEGSRTTPSGLGNQCSVEFNLAYRWHSAISATDEKWTEDVYERLMGKPASEVSMT

ELLMGLGKYQAELPKDPSKRTFADLERQADGKFKDEDLVNLLVNAVEDVA (1)

GSFGARNVPKVLKNVEILGIIQSRKWNVGSLNEFRKFFGLKPYETFEEINSDPDVAESLR

SLYDHPDFVELYPGIVAEEAKQPMVPGVGIAPTYTISRAVLSDAVALVRGDRHYT (0)

IDYNPRNLTNWGYSEVRYDLSINQGCVFYKLATRAFPNWFKPDSIYAHYPMTIPSENR

KIMKDLGRESHYSWDRPRYTPPRVDLVSYSNAKLVAEQQNQFRAAWDDTVEFVFGKASKE

FKLSQDSAFIQKHADVMSKLLNKEEWHRSVKEFYEDITTKLLEDKTRRFGGLNQVDITKD (2)

VGNLAPVIFASNVFSLPLRSKENSRGIYTEHEMFKVLATLYNCLYFDIDKTKSY

PLYHASQAVGEPLGKALEASVKALGGSSLLSGIFGSFRENNNALKEYGVHMTKQ

LLENGLGAHEIAWAQILPTVIAMVPGQAQA (0)

FTQIVDFYLSKEGSKHLPEIQRLAKQDTKESDEQLLRYCLEAVRL

NDHSGLYRQSETTLAVTDEAGEVTIQPGDKVFVSF (0)

AKANRDASVFPDPEEVRLDRPMNSYISPNLGPHGFLSKETSHIALTAML

RTVGRLNNLRVAPGVQGQLKKIPQPGGYSAYLREDHGSYSVFPT (1)

TFRVQYDA*

 

>CYP6001C11 Aspergillus clavatus

81% to CYP6001C2 Aspergillus fumigatus

ACLA_039980

MLRRFSSTFNKKKGDREPKQNGVATTTTTTTPTTNKRYSKVPEGHKSSSEEERNEKKGGAVSPFEKYASVLHASRTPIPN

QTGDGAYLEHEHTTSLLQDARHLGFKDLATLKEVIKNKATGQLVDDKTMLMERVIQLVSSLPHNSKHREELTHSFLDELW

GSLPHPPLSYMGSEYAYRSADGSNNNPTLPWLGAANTAYARTIAPLIIQPGGLPDPGLVFDTLFARQSFKPHPNNVSSLF

FDWASLIIHDIFQTDYRNPHVNKTSGYLDLSILYGDVQEEQNLIRTFEGGRLKTDSFSEPRLQAFPAACCVLLVMLNRFH

NHVVEQLAAINENGRFTQPRDGLPEDQAKKAWEKYDEDLFQTGRLITCGLYINITLYDYLRTIVNLNRTNSTWCLDPRAQ

MEGNNTTPSGLGNQCSVEFNLAYRWHSAISANDEKWTEKIYEDLMGKPASEVSMTELLMGLGKYEAGLSKDPSQRTFAGL

ERQADGRFRDEDLVNILTGAIEDVAGSFGARNVPKVLKNVEVLGILQSRKWNVGSLNEFRKFFGLKPYETFEEINSDPDV

AESLRSLYDHPDFVELYPGIVSEEAKEPMIPGVGIAPTYTISRAVLSDAVALVRGDRYYTIDYNARNLTNWGYSEVRYDL

SINQGCVFYKLATRAFPDWFKSDSIYAHYPMTIPSENRKIMKNLGREAHYSYDRPQYIPPPVDLLSYPSAKLVAEQRKDF

HTVWADTVEFVFGKASKNFKLSEDTAFIERQRETISKLLSQDEWQRNVKEFYEEITTGLLEEKTRRFAGINQVDITRDIG

NLVPVIFASNLFSLPLRSKENSRGIFTEHEMFNVLAVLYNCIYFDIDKTKSFPLHHASQAVGEQLGKAVEANVKSLGGSS

LLSGILGGSRDNKNALKEYGAHMTKQLLENGLGASEITWSQILPTVIAMVPSQAQAFTQIIDFYLSKEGSKYLPEIQRLA

REESKESDEQLLRYCMEAIRLNKTSGAYREARTSLTVTEETGQVTLQPGDKVFVGFAKANRDPSVFPDPSEVRLDRPLDA

YINHSLGPHGFLSKETSQIALTAMLRAVGRLNNLRRAPGAQGEVKKVPIADGYSAYLREDHGSYSVFPTTFRVHYDV*

 

>CYP6002A3 Aspergillus clavatus

42% to CYP6001A2 (over full length)

up to 71% to 6002A1 in parts

ACLA_078500

MTSLIETSTTGGDKKPHNFLNDARQDLVSQAGRIVPNLKTVQELVQTVLNGGLMDDRRFLIENIIQ

VAASLPNTSNARDKITDTFVRTLWDTLQHPPLSYLGDQFKYRAADGSYNNIM

YPHLGAAGSYYARTVTPQHPRPAVLPDPALNFDTLLAREGPA

REHPSKISSNLFYLATLIIHDLFHTDEHD

GTKLKNSSYLDLGPLYGHNQ

EQQDQVRTFNNGLLKPDTFAEKRLLSQPPGV

CALLVAFNRFHNWVVGELASINEGGRFSLPPGMKSDDPACANAQKKRDNDLFQTGRL (2)

ITCGLYVNIILNDYLRTILNLNE

NPVNSDWKLDPRKSIDVFDKGGFPRGVGNQVSAEFNMIYRWHAAINNQDEAWVNDLCRKIFGPSVDASKLSVSDFLDGLR

RYFRDSAPDGPSLWTFGGLKRRKDGRFADSDIVRLLQEGCDNVA

GAFGARNTPKVIKAIEMLGIQQGRQWGLATLNEFRTFFKLKPYSTF

EEVNSDPSVAGALEGLYGHPDNIELYVGIQAEEAKKPFLPGSGLCPGFTISAAILSDAVALVRGDRFYTV

DYSPANLTSFGFNVADSDSNVAGGGVMYKLLMKAFPGWYQSNSVYALYPFTTPGKTREIMDRYGNIKDLDFGKPSYMPSP

VMATTWAGVTKLLEDQRVCPLWGQRIFQVAGHGSALSEQVSLQEAQRRFITECFEDSEDALEKVRKTYEVIITDLLGEHS

RRLGDTYQVDVVRDVTNLAHAYFCARFFRIPLTEPNNPSPDAYTPRELSDTLSLLFGHIFLDLDPSESSQKRAKATKEGQ

RMGAIMAKVVATAEDNLVNRVLQALVRGTARSPVTTYGTQLIKQLLRGGKSIDEVVWMIIPTAAAMCASQAQMWAHMVDL

YLSDEYISHWPAIQELSRSDAPEAFDVLKKYALEGFRLSPVFGVLRTAVDKTSIMDGGEIRTVEKNTTVFADVAAANRDA

SRFRDPLKIRLDRPADVYIHRGWEPHASLGSMISCTAGAVLLRVLGRMGNVRRAPGPAGEIRSRLVDGRVRVYLREDGTD

WTHFPQNQKILFDRFA*

 

>CYP6002A4 Neosartorya fischeri

71% to CYP6002A3 Aspergillus clavatus

NFIA_045180

Note: this seq does not have an ortholog in A. fumigatus

MAPPTESSSHSAGQNGKQRMFLIDARQDLLSQAGRILPDLRTIHELGQTAFNGGLVDDRKYLIENIIQVTASLPNTSALR

GKITDAFVSTLWDNLQHPPLSYLGDQFKYRTADGSYNNIMYPHLGASGSHYARTVTPQHPRPAVLPDPSLIFDTLLARDG

PAKEHPSKISSTLFYLATVIIHDLFHTDECDGTKVKNSSYLDLGPLYGHNQDQQNKVRTFTDGLLEPDTFAEKRLLTQPP

GVGALLVAFNRFHNWVVGELAYINEAGRFSLPAGVNQDDPRYSSAVAQRDNDLFQTGRLITCGLYVNIILNDYLRTILNL

NENLTQSDWTLDPRKSLEVFDKGGVPRGVGNQVSVEFNMIYRWHAAISNQDEAWANSLCQRIFGPEVDGSTLSVNQFLDG

LRKYFEDNVPGEPPTWTFGGLERQQDGRFADSDLVRLISDGCENVAGAFGARNIPKVMKAIEMLGIEQGRQWQLATLNEL

RAFFKLKPYSSFLEVNSNPAIAEALEALYGHPDNIELYVGIQAEEAKKPFYPGSGLCPGFTISTAILSDAVALVRGDRFY

TVDYSPANLTNFGFNAVSSDFDVAGGGVMYKLLMRAFPGWYRPNSVYALYPFVTPEKSREIMDKYMKFKDLNFDRPSYTP

PPVPVTTWEGATTVLENQKRFHVPWGTHTFQITGHDYMLSGDSAANAEQRRFVNECLYEPKTVLEVVRKLYESITTALLH

EKAFKLRDYYHVDIVGD ()

VGNLAHAHFCSQFFNIPLKDDKDPSPDAYTPRELSDALSLLFGYVFLDLEPTDSLRNRIAAAA

EEQRMGAIMAKSVSSARHSVVRRFMQALGRSEAGPGSYGQQLANRLLREGKSVDEVVWTIIPTAAAACATQAQGWAQMLD

LYLSDKYASHWPAIQKLARSADPAAFEKLKKYALEGFRLSTPAFGVLRTAVEEATIKDGEATTTVHEGDTIFVDFITAGR

DPVKFPDPDEIRLDRPADSYIHHGWGPHACLGRAIVTTAGAALLRVLGRLENIRRAPGPAGEMKSKMVNNAFKLYLRENG

SSWTPFPQNMKVIFDSFK*