Aspergillus flavus

 

D. Nelson

 

August 8, 2009

 

167 sequences

 

>CYP51F1  Aspergillus flavus

100% to CYP51F1  Aspergillus oryzae

AFL2G_06478

MGILAVILDSVCERCSGSSLWMLSTVALLSILVVSVVINVLRQLLFKNYKEPPLVFHWFPFIGSTISYGMDPYRFFFNCR

EKYGDIFTFVLLGKKTTVYLGTKGNDFILNGKLRDVCAEEVYSPLTTPVFGRHVVYDCPNAKLMEQKKFVKFGLTSDALR

SYVRLITEEVEDFVQKSSALQGPNGVFDVCKTIAEITIYTASRSLQGKEVRSRFDSTFAELYHDLDMGFAPINFMLPWAP

LPHNRKRDAAQKRMTETYMEIIKERRKAGSKKDSEDMVWNLMSCMYKDGTPVPDEEIAHMMIALLMAGQHSSSSTAAWIV

LHLAASPEITEELYQEQLRILGHDMPPLTYENLQKLDLHAKVIKETLRIHAPIHSIIRAVKNPMPVEGTPYVIPTSHNVL

SSPGVTARSEEHFPDPLEWKPHRWDEAIAVSSEDEEKVDYGYGLVTKGTNSPYLPFGAGRHRCIGEQFAYVQLGAITAAL

VRLFKFSNLPGVQTLPDTDYSSLFSKPLGNSKIQFEKREPVTKA*

 

>CYP51F2  Aspergillus flavus

99% to CYP51F2  Aspergillus oryzae, 1 aa diff

AFL2G_02771

MASFTLVSAYAAAGLLAIIVLNLLRQLLFRNKTDPPLVFHWIPFLGSTVTYGMDPYAFFFSCRQKYGDIFTFILLGRKIT

VYLGIQGNEFILNGKLKDVNAEEIYSPLTTPVFGSDIVYDCPNSKLMEQKKFIKFGLTQAALESHVPLIEKEVLDYLKTS

PNFKGTSGRVEITDAMAEITIFTAGRALQGEEVRKKLTAEFADLYHDLDRGFTPINFMLPWAPLPRNRKRDAAHARMREI

YMDIINERRKNPDRETSDMIWNLMHCTYKNGQPLPDKEIAHMMITLLMAGQHSSSSISSWIMLRLASEPAVMEELYQEQI

TKLSPDGRTLPPLQYRDLDLLPLHQNLIKETLRLHLSIHSLMRKVKNPMPVPGTPYVVPADHVLLASPGVTALSDEYFPN

ASRWDPHRWENRVEKEDEEDIVDYGYGTVSKGTSSPYLPFGAGRHRCIGEKFAYVNLGVIVATMARHMKLFNVDGKKGVP

ATDYSSMFSGPSKPAIIGWERRFPEKS*

 

>CYP51F4 Aspergillus flavus

99% to CYP51F4  Aspergillus oryzae

AFL2G_10953

MSWPRIGAYALLAFVAIMALNVTYQFLFRMLNKTRPPLVFHWIPFIGSTIHYGMDPYGFFFSCREKYGDIFTFILLGRPT

TVYLGTQGNEFILNGKLKDVNAEEVYSPLTTPVFGSDVVYDCPNSKLIEQKKFIKFGLSQAALEAHVPLIEKEVEDYLAM

SPNFHGTSGEVDIPAAMAEITIFTAGSALQGEEVRSKLTTEFAVLYHDLDKGFTPINFMLPWAPLPHNKKRDAAHARMRS

IYIDIINKRRNAGDNVPEKLDMIGNLMQCTYKNGQPLPDKEIAHIMITLLMAGQHSSSSISSWIMLRLASQPAVVEELYQ

EQLANLERTGPNGSLAPLQYKDFDNLPLHQNVIRETLRLHSSIHSLLRKVKNPLPVPGTPYVIPTSHVLLAAPGVTALSD

EYFPNAMAWDPHRWETQAPQENNKDDIVDYGYGAMSKGTSSPYLPFGAGRHRCIGEKFAYLNLAVIVATMVRHLRFSNLD

GQTGVPDTDYSSLFSGPMKPARIRWERRAAKSG*

 

>CYP51F4 Aspergillus flavus

99% to CYP51F4  Aspergillus oryzae

AFL2G_10953

MSWPRIGAYALLAFVAIMALNVTYQFLFRMLNKTRPPLVFHWIPFIGSTIHYGMDPYGFFFSCREKYGDIFTFILLGRPT

TVYLGTQGNEFILNGKLKDVNAEEVYSPLTTPVFGSDVVYDCPNSKLIEQKKFIKFGLSQAALEAHVPLIEKEVEDYLAM

SPNFHGTSGEVDIPAAMAEITIFTAGSALQGEEVRSKLTTEFAVLYHDLDKGFTPINFMLPWAPLPHNKKRDAAHARMRS

IYIDIINKRRNAGDNVPEKLDMIGNLMQCTYKNGQPLPDKEIAHIMITLLMAGQHSSSSISSWIMLRLASQPAVVEELYQ

EQLANLERTGPNGSLAPLQYKDFDNLPLHQNVIRETLRLHSSIHSLLRKVKNPLPVPGTPYVIPTSHVLLAAPGVTALSD

EYFPNAMAWDPHRWETQAPQENNKDDIVDYGYGAMSKGTSSPYLPFGAGRHRCIGEKFAYLNLAVIVATMVRHLRFSNLD

GQTGVPDTDYSSLFSGPMKPARIRWERRAAKSG*

 

>CYP52G3  Aspergillus flavus

99% to CYP52G3  Aspergillus oryzae

AFL2G_05445

MIPLLILAALAVVFRLVWSIFTSLRHAQNARKWHCGAIPTYPGDILGINTLKEVLRADKEKLIPVLSAQRVETMTAREGR

YVSTFRLRQMGRESIFTSDPKNMQAILATQFKEFELGSLRRNSLHPLLGSGIFSTDGEAWSRSRSLLRPQFTRDQVSDLD

LEERHVQKAMAGMLADPATKWTPEIDIQSIFFRLTIDSATEFLFGDSVESQTAALSGSRIIEDKFPSYFDRGQWYAAQRA

RFEKLYWIVNNKESRETDRFVHAYVDRFVDAALAAVKEGKIDPEKRNSDHYVFLHGLTTATQDPVELRSQLLNILLAGRD

TTASLLSWCVLLLARHPDIFQKLRNTILADFGDYRNPRNITFSSLKSCRYLHYFMNEVLRLYPIVPGNRRVALKDTTLPR

GGGPDGSEPVYVRKGQPVVYSVFVTHRRKDIWGADAEVFNPDRWEDLKVGWEYLPFNGGPRICIGQQFALTEAGYVLVRL

LQRFDQIVDARPEREIRFNATLTSAPWENVIVRLREGA*

 

>CYP52G4  Aspergillus flavus

99% to CYP52G4  Aspergillus oryzae

AFL2G_00228

METWFTPALVAAIVAARLLFSLYSAWRHAQRARSLNCQEAPLYPSRDPFGVATLLETLRADRDKFLPKLSQKRVDLISSQ

QNRYVSTFRVRQAGRENFFTVDPKNIQAMLATQFNDFFLGDMRRNAGAPVIRSGIFVSDGADWSHSRSLIRPQFTRTQIN

NLELEERHVQNALRAMPTQSNGWTSEVDIQTILFRLTLDSATEFLFGKSCNSQLTALEKDAGEMSDSFLNSFDRCAWYLA

ARLRFERLYWIVNNKEFRECTRVVHELVDGYVHAALQRAQQAEKPADPERGSHYVFVDALTATTQDPNQLRDECLNVLIA

GRDTTASLLSWNILLLARHPDIFQRLRKEIIERFGTYSEPRDINFSSLKSCQYLQHFINETLRLHPVVPFNRRCANKDTT

LPRGGGKDGNSPVYLQKGQPVLYSSYVLQRRKDIWGEDAEEFNPDRWYGRKAIWEHIPFSGGPRTCIGQQFAITNTSFVL

VRLLQRFDSIEDVYPEREIRYGVTLTNCPADRVTVRMHQAEL*

 

>CYP52H3  Aspergillus flavus

100% to CYP52H3  Aspergillus oryzae

AFL2G_05134

MLAQIAPLFGALCITFLVLQYLQRLYQQRKRAQSLGCQPAAQGPSGIFGIRSFVRLLNEVRHKRWVEYIAGQYGRYGNTY

TQKALGKWMVSTIEPENIKALLATQFNDFGLGTRHREFYPLLGDGIFTLDGPGWSHARGLLRPQFTRDQVADLELMDGHI

SRMIDLIPQDGSSFDIQRLFFLLTIDSATHFLFGESVGALESSNSASLLGRSSVGSAQGFAEAFGTAQDYLTTRSRAMHF

YWMVNPKEFREANQRVHEVVDHYVQLAIQSKNNPDKKSDRYIFAEALAADNDDPKVLRDNMLNILVAGRDTTASLLSSAF

FYLSRNQDVWKKLRQTIIDEFGDSQNPKGEITQAKLKDIPYLRYVLNEVLRLLPPVPLNFRVAAKDTSLPVGGGPDGRSP

VFIPKGQVVAYSVYAMHRRTDLYGPDSHSFRPERWEENGRRGWDYLPFNGGPRICLGQQYALTEASYTLVKLVQRFDTLE

CADPELKQPAILSTLTMSHDRGVKVRLSSSVPKC*

 

>CYP52K1P  Aspergillus flavus

97% to CYP52K1  Aspergillus oryzae

small 6 aa deletion and frameshift = &

AFL2G_11704

MLTLSFSALLGIALAWAIHRLAWKYSRLK (0)

AICVKRDNKLATQYGCEQPPRLRNWWPLGIDRLIQIWTADSEQRLMDLFTFPFKDV

GYTLEQKFLGTIAFGTIDPENLEAIMTNIN (0)

VFSFGLRRHILFPLLGDGIFTQEGK

SWRHSRELLRPQFTRQHYRDLNIFRPHVDR

LLHYLTGNGAATDLQPLFFRLTL

DTTTEYLFGKSVNSLMPGEATKGQSFANHFDMAQNYVVQRFRLLDLYWLIGGPKFWRSCSAVHRFIDEIIDARMDSTEKD

KDCNSKYIFFDAVARDSRTRRDLRDQLTNVLLAGRDTTACLLSWTFHCLARHPDVLGRLNVEIASVVGTNTDLTRDDFKR

MPYLDQVLRE

VLRLYPPVPVNTRTAHKTTILPT

GGAKDGTKPFMVREGENVAFCVYAMHRREDLYGPDAGQFRPERWDEDLPLFQNERTATWGYLPFNGGPRACLG (1)

QDFGFVEAAYT &

KYPNVKPDMYKGDIQGRKWLGWSSHQPEGIEMVTEEGQKMTIVLSLGDGCRVTLGR

 

>CYP53A13 Aspergillus flavus

99% to CYP53A13  Aspergillus oryzae, 1 aa diff, N-term extension deleted

AFL2G_03223

MIAELLTPTGAAYVLTAAVFVYY

ILPYLQLWRLRDIPSPGFAAFSNLWLMLQYRKGNRFVTVDNAHKKYGKLVRIAPRHVSIADDEAIQAIYGHGNGFLKADF

YDAFVSIRRGLFNTRDRAEHTRKRKTVSHTFSMKSIGQFEQYIHGNAELFVKQWNRIADTQSNPKTGYATIDALNWFNYL

AFDIIGDLAFGAPFGMLEKGQDIAEMRKSPNDKPSYVQAVEVLNRRGEVSATLGACPSLIPWAKYIPDRFFRDGLEAVEN

LAGIAVARVNERLRPEVMANNTRVDLLARLMEGKDSNGNKLGREELTAEALTQLIAGSDTTSNTSCAILYWCLRTPGVIE

KLHKVLDESIPKDVDVPVHAMVKDIPYLQWVIWETMRIHSTSAMGLPREIPAGNPPVTISGHTFYPGDVVSVPTYTIHRS

KEIWGPDAEQFVPERWDPKRLTARQKAAFIPFSTGPRACVGRNVAEMELLVIVGTVFRLFDFEIQQDGPMETREGFLRKP

LGLMVGMKRRSVAV*

 

>CYP55A5 Aspergillus flavus

99% to CYP55A5v2 Aspergillus oryzae, 2 aa diffs

Supercontig 11: 146268-147914 (-) strand

AFL2G_09432

MQLEPVYPRFPFARPSGDEPPAEFHRLLRECPVSRVELWDGSHPWLVVKHKDVCEVLTDPRLSK (0)

VRQRDGFPEMSPGGKAAARNRPTFVDMDAPDHMHQR (2)

SMVSAFFNDAYVESRLPFIRDTVQYYLGRLIRAGEDGKEVDLVKHFALPIPSH (0)

IIYDILGIPIEDFEYLSGCDATRTNGSSTAAAAQAANK (2)

EILEYLERLVDKKTTNPSHDVISTLVIQQLKPGHIEKLDVVQIAFLLLVAGNATVVSMIAL (0)

GVVTLLEHPDQLSRLLEDPSLSNLFVEELCRFHTASALATRRVATVDIELRGQ (0)

KIRAGEGIIASNQAANRDPGVFPDPDTFDMFRK

RGPEEALGFGYGDHRCIAEMLARAELETVF (1)

STLFQTLPSLKLAVPKSEIQWTPPTRDVGIVGLPVTWDRD*

 

>CYP56C1 Aspergillus flavus

98% to CYP56C1 Aspergillus oryzae

AFL2G_06061

MTLLRITPAKSKRLRVLVGPMRSSVNPASILWHPRGHKRSVFFPKSEQPTSRKMVMHGLCIIIGKALAVGILFLSICIFS

RIVPPRFPRNIPAVPFWVTLLSLVRDIDQEDIYRRHIQKPLQTHGAIKIFFAGQWNLLIQRSSYLNEIFRNEDVYQKSGN

QKKIPHSVLAEFL (1)

GDNVISSRGTTWRLYRDIITPGLQGHFDAGLIAANAEELCSSLLAFQNT

VGNCGVPVQNLLQQFTIANVSQVLLQANHKPTKGDESSLHQLQLAVKREIFKPIFMNFPVLDRLGKLIPCRVRARNVVEQ

FSAALQYGVRHGQGTPNASNLGARLMAARDGGVLTGKQFRDNLNVLFVAGQENPQLLLISMLYLLAKHPDVQSRLRREID

ACSTLDPSNVAFSELPYLTCVIYESLRLLSPISQLINRRTSQDVILGNQIYIPKGTYVGYNCYSTNRDPAVWGPTADEFR

PERWGQSNTEISQCYRQRRARAEFVSFHGGSRACLGEKFALLEARVALFVLVSRLSWSLDPEWPDRKTPVGPLYPRALRL

IFTERK*

 

>CYP57B3   Aspergillus flavus

100% to CYP57B3   Aspergillus oryzae

AFL2G_00227 revised

MIGTVLDTVLGNPQGAVGGLFVGSFVIFWVVP FLYNLFFSPLRNVPGPFWARFTILWEFSQLMKGRSHEEYIKLHKKYGP

VVRVSPKRYSVIDPQDVKKIYGFGADFPKSEFYDSLGDPKNIFTVRDNEDHKDRRRKVASLYTMSSMVAYEDAVDRMTTL

CIKKMTDLAASRKLISIPKFMQFYAFDVIGEITFDQNFGMMENMGDTQGIIKEIHAMNNTIGIMGLLPELQSTWRAAQKV

LFSGTAMGKLTEYIWSQYWKHRNTNSGAKQKSQYDTFLRKVLELEAAHKVGRMNVLDSCGSNIGAGSDTTGITLSAALWY

IYRNPDKLAKLRHEIDTMTAEGRISDPVTYKQAQEMPYLNAVIKETLRVHPGVGTILARVVPKGGITLTGGYYVPEGTHI

GTNAWPLHYSETVYGPDADQYRPERWLEDKPQPDYRDSMMFAFGSGSRTCIGRNISLLEITKVLPQIVRKFDLKFEEKKD

PWDAWCAWFVYPKYKCWIEPRKPVENVA

 

>CYP58B2P Aspergillus flavus NRRL3357 pseudogene

AAIH01000612.1

missing first 29 aa, two frameshifts and one stop codon, bad boundary at 1273

AFL2G_07229

  76  LRKIAGPKIAPITHLY*HYYDAVKGGKYIWKLDELHRKY  (1) 192

 255  GPIVRFNPNEVHIQDSHYYHHIYAGGAKKQDKDPEFPAVPLFPGV TVTTIKHNHHRLRRG  434

 435  IIKSFFSKKYVTGLEYVIQSEVNLLASRFTEAYHHGTVLDLKYVFAALTSDLTTHYVYGTNLKX  623

 626  LAEPDFKNDFLAGMDSVDPWIPVLLVFGRLLKLAGYLPACLVSAGEFLHLWT  781

 783  LSERRVGEILDPQDNGTMGDQKTLLQAMATADVPEEEKTATRLQMETLNIIAGGTETTARALAV  974

 975  GVFHLAHKPSLLLQLRDELRTVMPFPDSLASCTQLEQLPYSYL (0)  1103

1163  AGVVNESLRLAFGFIIRPARVYPNDPLVNEDLVIPFP (?)  1273

1362  TPISQSAYFVCMDPSIFSQPDDFNPDRWVQAARDGNKLHRYLIVLSKGSRHCLGIN (2)  1529

1599  FALAEIYLAIATVARRFDLVPYQTTVEQLQMKRDLGFTAPEKGPFTVRAKVTGLAD*  1769

 

>CYP58D2 Aspergillus flavus

99% to CYP58D2 Aspergillus oryzae

AFL2G_03972

MGVISVVTFLASAKEHFIISILLLFPIALILRTIYRLYIDPLHH

IPGPKLAAISHLYEFYHDVVRGGLFIWEIEKMHQEY (1)

GPIVRINPREVHIKDPYFYDELYAPAHGWRDKDAKSVEIFSSPTALVSTVDHHTHRMRRKLLTSFFSRRSIERIE

PVIHESISRFLDSLITAYEEDSVVELIDRLQALTGHVITQYAYGEDYGLHEPQNIGKGIVKVVQEGTEQIHLHRFFPLIQ

RFLRLIPSFFMTQLFPARAAMYDLLHGVRKKSIEVLKQKDVCTPTERTTMFHALTAPEVPPEERTLQRLEDEGLVLFAAG

TETTATTLGVAIFHILSDPMVLTKLRKELEQVMPTPEGLATWRELEKLPYL

NGVIHEALRFSGLAMRQQ

RVSPTEVIKYKDYAIPPGTPVSMLQYFLH

TDPALFSDPEKFYPERWMLAAERKESLSRFLVTFGKGTRSCIGMNLAYAELHTALAAIVRRFDLELYETTAEDIRFVRDK

LLPRAKNGPWRVRVKVVGIRKD

 

>CYP58E2  Aspergillus flavus

100% to CYP58E2  Aspergillus oryzae

AFL2G_06877 revised

MLDTISESRPNGLATLGVVVATFATYLALKALYNLYLHPLRKFPGPKLAAIGPYYEFYYDVMKDGMFLWEMERMHQVYGP

IVRVNANEIHIRDPHYYSTVYAGNHRSTDKYHDAVAAFSVPQASLATIHHKVHRLRRSILNPYFSKAAVTRLESAINERI

ERMCSRLEETMHYGQVVDLDAGFAALTADIVTTYFYGQNFDYLGNEGFKFQVRDAILGLIQFYHFTRFFPWIANTIKKLP

IPIMRLIHPGAAYLVSSQEEIKDSIRASLDKGNKADAKSVIVQALEDPTIPPQERTLDRLGDEGTTIIFAGTETTAR

ALSVGMFHILNNKTILK

KLREELDTLPGVSSGVYSHVQLECLPYL (0)

TGAVQESLRLSHGPAIRLPRVANDKALKYGDYIIPPG (0)

TPVSLCTVLVHQDPCIFPDPHRFDPERWVKASKEGVNLDKFIAAF

TKGTRQCLGINLAYAEIYLTFAKLIRTFNMEIYDTTVDDLTVHHIRLTGAPKQGTGEVKVKVTEKIL*

 

>CYP58E3 Aspergillus flavus NRRL3357

AAIH02002155.1

Identical to CYP58E3 Neosartorya fischeri (partial seq, upstream part in a seq gap)

VVSAREANKKMVLNYLNKPDEEKNAMKDARSKSVIVSALTDPNVPDAEKTLDRLLDEGETIIFAGIDTTARTL

AVALFHLLNNKDVLMKLRKELQAIAKSDGQQWTTTELEAVPYM ()

RGVVQEAIRLAYGLVVRIPRISPHEALQYNGFVIPPG

TPVSQSTYLVNNDASIFPNPQAFDPERWVKAAQDGVSLDKYMVSFSKGSRGCLGI (2?)

NLAYAKLYLGIARVATSLDMELFETTEKDIAVYHTRGFAFPKEGDGAVKAQVTGLCK*

 

>CYP58F1  Aspergillus flavus

99% to CYP58F1  Aspergillus oryzae

AFL2G_09007

MALLVILGIGLVTYLVFLSIYRLYFHPLSHIPGPKLAAITHGYEFYHNIIRGGLFIWELERLHEVYGPIIRINPREVHIK

DPDYYDDIYASSARKREKDPVLVAQFGLEGSGFSAIDQETHHQRRAPVAKFFSKRAIENQEHLIRDSLNKLVGHFQEACR

AHTVVSLDAAFAALTSDVIHQYAYGFNPNNLDKEGFNAKVRDGINGLFQLAHLLYFFPILQTLMNVMPLPLLQVLNPPAF

ALASQKKELYEQGAAALEKANSKAGSGTLIDTLAAPSMPEHMRSAHRLMNEGFALVIGGTETTARSLALGAWHLFTREDI

RNKLREELKQVMPTPDSQPTWNDLEKLPYMSGVISESLRLSTGIANRSSRVAPTEALVYKDYTIPPGTPVSETNYFTLMD

PEIFPDPHAFDPERWIRAAAKGQRLDRYLVNFSKGSRMCVGLNLAYAELFLVIATIVRRFDIELYETPKSNIDFARDFGT

PYPDKGNFSVRALVTGVISE*

>CYP58G1  Aspergillus flavus

99% to CYP58G1  Aspergillus oryzae

AFL2G_09004

MNLPLIWIGLFTAVSYLVIRSIYRLYFHPLSNFPGPKLAAVTHLYEFYYDVVKGGKFIWEMQRMHDQY

GPIVRINPRE

IHIKDPYYFDPIYTSKGQAKDPYIVRTFATPLSTAATVEHDRHRY

RRDLVNPFFSKRSVMGVDYIVQDKVDK

VCKRLTQVHEKGTVVSLDDLFAALTADVISHYAYGESLGFLDTE

NLKNEFRDAV

ASAGLLCHFARFFFVVSMVAETMPALVEWMQPSSKGLWEAKRMIEQMARSSLEKDREKNANSRKTIFDALCAESVRPEER

TVARVRDEAMVVFGAGTETTARVLATGSYYLYRDKPRLEKLRAEIETVMPDSTDHVSLTQLESLPYLTAVINESLRMAHS

VTMRLPRISPTPLAYKDYIIPPG

TPVSQSVYFMHMDPTLFPNPDY

FNPERWLEASSKGERLTKFLVPFSKGSRICLGMNL

AYSELYQMFATLVRRFDLEIQTPPESVRITRDFIIGLPDDADYLKVHSLVTNAL

 

>CYP58H1  Aspergillus flavus

98% to CYP58H1  Aspergillus oryzae

AFL2G_07403

MDEFTISAGSLCLLLLVVGFSIQSIYRLLFHPLRKFPGPKLAAISHL

YEFYYDVICNGSYLFKIEQLHQKY (1)

GPVVRINPREL

HINDPYYYEQIYAGSSRIREKDPRFIGVFTTPLPMVATVGHEHHRVRRGLLSSYFSRRALKKAELIIDQKVDRLLVRFHS

AFKCHAVLPLQRVFAALAADIVSEYCYGASQGYLEQKVFQNQMIDAVNYVMSMCHINKSIPIIPKLLRCVPVGLMEKLGL

QMADVIGVRNLIRREAAKSLDKEWLSHDTNVLSKNVFDAIAAADVAPQEKTLRRLEEEGAALFGAGIETTARALTVAMFH

LISDETMIRKLRDELKQVMLSPASRPTWAELEQLPYLTGVVNESLRLSFGLVARSPRVSPIESLAYGEYVIPPGTPVSQS

AYFVHMNPQVFPEPESFNPERWIKAAEKGQYLSRFLVAFSKGSRQCLGMNLAYAELYLTLARIVRLVDMKLVGTTIDNIR

VGRDLGHPAPKAGNFEVKVEVMGIASKS*

 

>CYP58J1 Aspergillus flavus

98% to CYP58J1 Aspergillus oryzae

AFL2G_06095

MDSPRLWTGLAGLITYLIVISVYRLFSHPLRNIPGPKLAAVTHLYEWYYDLFLGGKYLFEIERMHERY (1)

GPIMRINPPEIHINDPKYYDEIYASGTHRRNKDAEFVSFTGLLLSSASTTDHDLHRYRRGLMNNFFSKKSVRGISYFVEEKVH

NLMQRFEAFYRCNKVVRLDDAFAAMTSDVITHYCYGKSWDYLDYANLRTDVRKAVHDLTCSVHFNRIFPIFLAVLKKLPL

RWLYAIHPGRSVVLDIQKTIYEQSAEAIHGDKYKIGHNDAVDKHKTIYDQLTDPSIPAEERSLQRLQDEGLLLISVGTET

TARALTTACFHIASDDQLRTRLREELRTVLPTPTSSVTWSELEKLPYLTGTVNESLRLGGFLTTRSPRIAPDEPLTYKEY

TIPPGTPVSSSSYFGHKNPNIFPEPERFSPERWISAGRSNDHLFKYITSFSRGSRICAGMNLAFLELYMTLAYFVRRFDV

ELVDTTVEDM RIVRDMGVGFTHRGEPTVYGRIVRVCED*

 

>CYP59A5  Aspergillus flavus

96% to CYP59A5  Aspergillus oryzae

AFL2G_07219

MYLSLLIALGVVSFIRFLTAFYQARQEPMPEFKLLAGHFGTLKKTIQGMPSDATLHSIMLKISKQFQSGIFYINMWPFSG

TWMIVSTPSAATQIQKLNLTKPAILRQPLETVTGGPSMMTMHGETWKKWRALFNPGFNPAYIIGLAPNITDEVATFCAQL

RKKAQQGEVFPLESLTTRLTVDSICSVVLDTQLHHQIKDHPLATALQRQINWTSFGTTFNPLKRYFTIRPLVLWYNNKVM

DRIIGGEVDRAYRTPPDHPSKSVISLALREYLQEQASSNSTRSLAEFKRLVAPQLRVFLFAGRNTTSSTLIYTYYLLAQH

PEVLAKIRAEHEDVLGADPAEAQGRIKEDVQLLNKLPYTTAVIKETLRLFPPSASMREGRPDAEIIGADGQRYPTMGCNV

WTLTVALHHNSDHWNQVESFIPERWLVGPEDPLYPVKGAWRAFEFGPRSCIGQTLAMLELRIALAMTIRQFDITPAYDEW

DSIHPAPTAKEVNGHRAYQAERGAGGAHPADGFPCRVKERF

 

>CYP59D1  Aspergillus flavus

99% to CYP59D1  Aspergillus oryzae

AFL2G_11439

MVIAVSDLVGSYGARVALVLALVIVLRFLQEMLKVRLLFYRLRKQGLPMPKWNFAAGNLQMLPDLMKRHPKGSQQSEAFT

LLSYEFASSDNCFYIDVWPFTKPLLVVNSP

(seq gap)

LFNPAFSASNILQ

HTPHIVEEAEEYVEILREHARKGDTFTLDKMTCDYVLDIIGRVAMKARLHSQRG

RNPVAAALRSQVEWHCQDEQMNPFIRWNPMRPIMQWCNGRTMNQYIGAELDKRYEAWTQNKPSTRANSIIDIVLAEYMST

RPVRAALDPEFKSWATIQLRTFLFAGHDSTAATIVYSIYLLSKHPEILSKVRTEHDEVFGSDISAAAGILKQHPELINRL

PYTLAVIKETLRLFPAASALREGQPGVYLQDKNGTKYPTEGLCIWIIHGGIQRNPNYWPDPHAFKPERWLVGPDHPLYPP

KGAWRPFEQGLRDCIGQALALLDVKITLVLTLREFDFQDQYAHWDRLHPRSGPKTVFGERAYQIPQGGSHPVDGLPCRVSLRNQITK*

 

>CYP59D2  Aspergillus flavus

99% to CYP59D2  Aspergillus oryzae

MGANTLGWDGLTSRIAVAVATVCLTSFVYKLIKMRLMFYRLRKKGL (0)

PTPPWNPILGNLAVMAQLQKKGPS

DSREAESFALLSTEAPGCEAGFYVDVWPFSIPMLVVTSPALAVQACQTYDLPKPDVLQPFINPMAGGSDNLFVSNGAHWK

QARELFNHGFSMAAAMSHMTYILEEAQVFVQMLKDHARKGDTFSLDALTCRYVMDIIGNVALNTRFRFQEQHNPIAAAMR

DTIELECGIETSNFLSRWNPRRLYRQWQNGRTMDYLIGVELDKRYKEWRETAKSSSHPRTQSIMDMVIAEYMKTRPQAQQ

QQELDPEFKRWATIQIRLFLFVGHDSEATTIIYSLYLLSKNPEVLIKVRAEHDRVFGAGVSSAYDVLTDHPEKINQLSYT

HAVIKETLRLFPPANGLRGGLPGVSLRDEQGRIFPTEGCAIWIVHTAVHRNPSSWPQPHAFIPDRWLVEPGHPLYPPAGG

WRPFEQGPRNCIGQNISLLGIKASLAMLVRQFDFHDAYAEYDRLHPSTGLKTMFGERAYMIQKGAGHPAQGFPCKVTLR*

 

>CYP60A5  Aspergillus flavus

98% to CYP60A5  Aspergillus oryzae

AFL2G_07217 revised

Bottom HALF (two adjacent P450s in this gene model CYP60B3 and CYP60A5)

MGGDGWPSDGHILLLIVLT

VLTPPSLALYRLWIHPLRSYPGPRWWAIWRGPYILSNIRG

NLVRDLQRLHQQFGSVVRIAPNELSFIVPEAASPIYTSNPEFPKDPMHLPPFHNGTPGILAADHAHHRRYRRLLAFSFSD

KGLRQQRSLIERSVNLLITRLHENCGQGPLDLTLWFNWATFDIIGDLAFGDSFGCLDNVQTHPWISSIQGNVKLIPILNA

FRRYRLDGLLQLLGSRKLLEQRRRNAQFTTDQVDRRLKNSSTPRGDIWDAVLAQKPDGEPPMSREEMISNASAIVLAGSE

TSATLLSGCTWLLLKNPGHLHQLTSRIRSQFTHASEIDSQSVSRVEGLQAILEESLRLYPPVPMQSNRIVPQSGAYIAGG

WVPGGTSVGLQQFVACRSSSNFHRPEEFLPERWQGQGEFAHDRREVSQPFSIGPRNCIGRQLAYVEMRLILVKLLWHFNL

RLDTTQMKDTDWLAEQGIWILWDKKPLWVTLEPRNE

 

>CYP60B3v1  Aspergillus flavus

97% to CYP60B3  Aspergillus oryzae

AFL2G_07217 revised

TOP HALF (two P450s in this gene model CYP60B3 and CYP60A5

MYFLSLPALAIIVPVGYVLLHLGYNLFFHPLRGYPGPLLWRASSL

PWKIALLRGTMHHDLMRYHQKYGDTVRIKPDEISYANAQAWRDIHAHVPGRPEFLKDPVRLPLAPNGVMSILVSDTKNHA

RFRSLFGHAFSDKGLRTQESTIVQYADLLVEVLREVADTGRSAEMVYYFNMAIFDSIGALSFGESFDSLKSRQLHPWVDA

IHKNLKSVAISHVLRSMGIEFLTPYVLPKELRGKRQENYSYAVEKLNKRMKMEGDQGDFWDKVLVKSADDNQRGDGMSAG

EMLNNAAVMVVAGSETTASALSGAMYLLCLSGKIEKSTAEIRKNFASPEDIDLISVSHLPYLTAVIDETLRMYPAVPGQP

PRVVPAGGATVCGRFVPEETRVGVSHLGTYFADYNFTHADKFIPERHLQKTEEPFKYDNYGAYQPWSVGLRNCIGRNLAY

AEVRLTLAKLLWHFDFTLDVDKTGNFLDQKIWSIWAKRELYMFIKTRGTSSSTPQ*

 

>CYP60B3v2  Aspergillus flavus strain SRRC 141

            GenEMBL AF106960

            Bhatnagar,D., Cary,J.W., Ehrlich,K.C., Cleveland,T.E. and

            Payne,G.A.

            Molecular characterization of an aflatoxin B2 producing mutant

            strain of Aspergillus flavus

            Unpublished

            verB gene 85% identical to 60B2

            97% to 60B3v1 ortholog

            99% to CYP60B3v3  Aspergillus flavus strain SRRC 1007

            formerly CYP60B4v1

MYFLSLPALAIVIPVGYVLFQLGYNLFFHPLRGYPGPLLWRASS

LPWKIALLRGTMHHDLMRYHQKYGDTVRIKPDEISYANAQAWRDIHAHVPGRPEFLKD

PVRLPLAPNGVMSILVSDTKNHARFRSLFGHAFSDKGLRTQESTIVQYADLLVEVLRE

VANTGRSAEMVYYFNMAIFDSIGALSFGESFDSLKSRQLHPWVDAIHKNLKSVAISHV

LRSMGIEFLTPYVLPKELRGKRQENYSYAVEKLNKRMKMEGDQGDFWDKVLVKSADDN

QRGDGMSAGEMLNNAAVMVVAGSETTASALSGAMYLLCLSGKIKKATAEIRKSFASPE

DIDLISVSHLPYLTAVIDETLRMYPAVPGQPPRVVPAGGATVCGRFVPEETRVGVSHL

GAYFADYNFTHADKFIPERHLQKTEEPYKYDNYGAYQPWSVGLRNCIGRNLAYAEVRL

TLAKLLWHFDFTLDVGKTGNFLDQKIWSIWAKRELYMFMKTRGTSSSSPQ

 

>CYP60B3v3  Aspergillus flavus strain SRRC 1007

            GenEMBL AF106959

            formerly CYP60B4v2

MYFLSLPALAIVIPVGYVLFQLGYNLFFHPLRGYPGPLLWRASS

LPWKIALLRGTMHHDLMRYHQKYGDTVRIKPDEISYANAQAWRDIHAHVPGRPEFLKD

PVRLPLAPNGVMSILVSDTKNHARFRSLFGHAFSDKGLRTQESTIVQYADLLVEVLRE

VANTGCSAEMVYYFNMAIFDSIGALSFGESFDSLKSRQLHPWVDAIHKNLKSVAISHV

LRSMGIEFLTPYVLPKELRGKRQENYSYAVEKLNKRMKMEGDQGDFWDKVLVKSADDN

QRGDGMSAGEMLNNAAVMVVAGSETTASALSGAMYLLCLSGKVEKATGEIRKSFASPE

DIDLISVSHLPYLTAVIDETLRMYPAVPGQPPRVVPAGGATVCGRFVPEETRVGVSHL

GAYFADYNFTHADKFIPERHLQKTEEPYKYDNYGAYQPWSVGLRNCIGRNLAYAEVRL

TLAKLLWHFDFTLDVGKTGNFLDQKIWSIWAKRELYMFIKTRGTSSSSPQ

 

>CYP61A1 Aspergillus flavus

100% to CYP61A1 Aspergillus oryzae

AFL2G_02074

MANVTGSFVSPSADATVVPQLFQPSGLLGSLLGDFNVWKGLLTLFIAAVIYDQFRYFYQKGSIVGPRWKLPFMGPFLQSV

NPKFHEYKAKWDSGELSCVSVFHKFVVIASTRDMSRKIFNSPAYVKPCVVDSAHKLLGEDNWVFLDGKDHVEFRKGLNGL

FTRSALSCYLPRQEETFNQYFKHFLEKSKANGYKPTPWMPEFRELMTAISCRTFVGHYMTDEVIQKINDDYYLITAALEL

VNFPIILPFTKTWYGKKAADMVMEEFAKCAAKSKARMAAGGEVSCIMDAWVKAQQVSAKYREDVAKGIPAEKPPQLLRDF

TDEEIAKTVFTFLFASQDATSAASTWLFQLMADRPEVLEKVREENVRLRNGDINAPITMELLDQMEYTRAVVKETLRYRP

PVIMVPYLVKKDFPITEKITVLKGSMIIPSVWPATHDEEAYPNPDTFDPDRWITGTAEQNPKNWLVFGTGPHYCLGQTYA

QLNLMAMIGKASMEMTWEHTTTPKSEDIKVFATIFPQDDCLLTFRPRA

 

>CYP61A6 Aspergillus flavus NRRL3357

AAIH01000781.1

Only 1 aa diff to 61A6 of Asp. Oryzae, 73% to CYP61A6 Nectria haematococca

AFL2G_02724 100% to CYP61A6 Aspergillus oryzae

      MDAKMATEIFNTTSAQPESPQSWAYKTSQLQGALPDFLAEWSAWQYVVTFLVGLVLYDQ

      VLYLKRKGALPGPTFKIPLMGPFIQAIHPTFDGYLRQWASGPLSCVSIFHR (2)

6085  FVVLASDRDLAHKVFKSPAYAEPCLVPVARDIIGHKAWVFLQGRDHAEYRRGLV  5924

5923  PLFTSRAIATYLPVQERVLDDYYNQFVAATKANQGKPMAFMTLFREINCALSCRTFFGDY  5744

5743  ISDDQVKKIADDFYLATDALDLVNIPLAMYVPFTKTWLGKRTADAVHRVFAECAARCKAN  5564

5563  MAKGATPTCIVDHWVLHMMESNRYRERVAAGETNLEKPKNMIREFTNEEISDTLFTFLFA  5384

5383  SQDASSSATTWLFQILAQRPDVLDKLREENLAARGGDRNKPFDLPMLESLTYTNAVIKEL  5204

5203  LRYKPPVILVPYLATKDFPVTPDYTVPKGSMIIPSCYPALHDPEAYPNPDVFDPERWISG  5024

5023  DAESKTKNWLVFGAGPHDCLARKYVPLSLAGMIGKASLELDWEHHPTPRSEEIRVFATLF  4844

4843  PM (0) 4838

      DGCNLVFKRRP*

 

>CYP62A1  Aspergillus flavus

99% to CYP62A1  Aspergillus oryzae

AFL2G_07212

MTNTASRELIRAIEHVPLTWWFLAVGGAWIVSKIVKILQTAYFSPLRKVPGPWYARLTSARLAWASFANNRIYYVQSLHE

KYGPIVLIGPEEVDIADPVAAKQIHRMGSGFVKAPFYKLLSPGPVDNIFNFRDAKLHSTRRKLYAKGFTLNSLRQQWEPT

IRNIVALTVERIRHDAQQGEAEILGWWTLMANETVCKLTFNGGHDTVRNGTKDPFVLMLERRMGDLAHLLQHFAPPLYYL

GRLLGRAEPRLHDVFFSQETMFEAGKHVVAIARSARDAEGDRNLFVKALAAGDLESKIGCLNDTEIITDAGALLLAGSDP

TALSLTYLIWCVLNRPKLQAELESEVAGLQGDITDAACADLPILNAVICESLRLYGPAPGSMPRSPPPDGATLCGYYIPP

SAVVVTQNWSLHGNPKVWKDPHTFDHTRWLPGSSLSEEAKMSFNPFGQGARQCLGIHLGWMQLRLATALFFRRCPGAKLA

PSTTPESMVMIDSFIAGMPKARRCAIQL*

 

>CYP62C2  Aspergillus flavus NRRL3357

          GenEMBL AAIH01000225.1

          63% TO 62C1

          1 AA diff to Aspergillus oryzae CYP62C2

          AFL2G_00193

     MEWQIYLGIAFALWIVQ (0)

955  VLYTAFTSPLRRVPGPLYTVLTRLPLKLASLTGNRIYFVHELHRKYGPIVRIAPDDVDISS 1137

1138 LAEFREIHRAGSPFLKSKWYEKFVPSKRSGVFTMRDPKEHAARRKLFARPFSKSELRRT 1314

1315 WEPAVREKVQLAVSQIQRELKAVGKSDLLKWWTFLATDVSGQLMFGESFNMLQLGK (0)1482

1535 KNQYINVLESTMMGSGIGAELPLVAWLGRHIPLSSFQNMFRATDYLFQYGQRAVTNSRTT 1714

1715 SNASRNIFAGMVYESEKGDGIITDEEVVLEAGNLIVAGSDTTAITLTYLIWAVLSQP 1885

1886 KLQRELEEEVNSLSADFDDSALEELPLLNAVIMEALRLYGAAPGALPRETPEGGAKFCGY 2065

2066 FIPQGMTVTTQAYSIHRDGDIYPDPERFDVSRWLKTETSASELAKKAFSPFGAGGRICLG 2245

2246 IHLAWMELRLATAQFFRECAGVRLAPSATWENMRPVNYFLISPRGHQCEVECNY* 2410

 

>CYP64A1 Aspergillus flavus U81806

99% to CYP64A1 Aspergillus oryzae

AFL2G_07214 revised

MIYSIIICAGALLGLWILEKLLAPKDTRPPLPPGPWRKPIIGNL

TDFPPKGTPEWLFWAKHQERYGPMSSLEVMGQTIIMINDAQLGIEIMHKKSALSQMIP

DAPFAHMAGWGMSLATERNRQAWKTIRANMKQEIGTRRAISTFHPKMEIGIRRFLLRT

LDNPDDLRFHIRKEANAFMMDVAYGYTIAPHGKDELYDLTQQSVRQFSHIFSPGEWSV

NFFPILRYVPSWFPGASFQIKAAEYKRTIERMTMVPYLWIKDQVARGCSRPSILLRLL

QKGHYESGSHQEQVLVWTNAEFVMGGSDTTVSAVSSFFVAMALYPEVQRKAREELDRV

VGPTTLATFEHRSQLPFIDALVKEVFRWHPASPLGAPHITQEDQIWDGYLLPKGALLL

PNIWTFTHDPSVYHDPMVFKPERFLEGKDSPPETDPMKFVFGFGRRICPGRFVTDEKL

FLIACHAVSCFFISPKDPGAPEPDWLPGVISQPGAFDLNVVPRSPAHEELIRSIETDH

PWKNADATDISRFMARNQMI

 

>CYP65T4  Aspergillus flavus

99% to CYP65T4  Aspergillus oryzae

AFL2G_07016 revised

MPFNILLWLVIAFFLYSLLAAIWYIYFHPLRRIPGPKSWIIFPI

MRHASAIRGRFDIDMRQHHAVYGPVVRFGRDEVSFITAEAWKDIYGHGHQQLPKVLSSASNTLDIISSNDTDHSRYRKAL

SHAFSAKGLQAQEPLLNSYVDKLIERLKGIAESNLPADMVKWYNLTTFDIIGDLAFGEPFGGLDNSEYHHWVSTIFASIK

AIPFLKLKDAYPLAFKAILGLIPKGIMEARKRQLEHSRITVQKRLQTSSSYNRGDFMDSMLRNRGEKDSLNDSELEANSN

ILIIAGSETTATLLSGATYWILRNPEALAKLTDEVRSVMKSEPEITAQKASAELPYMLACFDEAFRLYPPVPTGLQRRTL

VPTRISGCDIPAGTKVSVHQSAAYWSSTNFHAPDRFIPERWLPEAKSDPSSPFYSDNRGVVQPFSTGPRNCIGRNLAYAE

MRVILARVLWNFDLELCEESTQWSDQKAYTLWEKPPLMCRLKLRESFRG*

 

>CYP65V2  Aspergillus flavus

99% to CYP65V2  Aspergillus oryzae

AFL2G_09433

MLNSINIPQNAISWAVACAAAATFCLASSVVYNIFFHPLARYPGPLSHAASRVPYFIRVFKGTLPFDMLDFHTRYGDVVR

IAPDELAFSHPDAWKDIMGHSKGGLYLEKASWFYRPLEYDPPHIFNEGRQAHSLLRRQLAHSFSDKGMRDQEPMIRG

YVDLLLQRLREMGGR

EDTVDISAWYNYTTFDIIGDLSFGESFGCLKGSNYDEWIESIFRAFPFITALQALSFTPLVKEVLLALVPPSMRDRRERLRDF

TRQKMLRRMAIAEERPDLIEGLLKKKEEL (0)

GLTIDKLTANAETLVVAGSETTATLLSGVTYLLLKNPEAYQRLREEVRSTF

SSEDDINLSSAAKLPYMLACVEEALRMYPPGAIGPPRVTPKGGAEILGARIPGR (0)

TYVSIHHWALYRREEYFTDPHTFHPERFLGDPRFSNDRHNVLQ

PFHIGPRSCLGRNLAYSEMRLILALLFFNFDMELSDDSQDWIQQKIVIMWQRGPLKVHLTYIHRNSA

 

>CYP65V3P Aspergillus flavus

98% to CYP65V3P

AFL2G_00556 gene model revised, one frameshift in last exon

MSTAALVNAKSVLIATISA (0)

PIIYMLGMAIYNVYFHPLNRFPGPVSHAISRIPYFYRAVRGTLPFDMLKLHERYGDIVRIAPDELAFSHPDAWKD

IFGHKNGEPEMAKAAWFYRPLNEPLHIVNEDTDEHRRLRRQMAHGFSEKSMRAQEPIIRKYVDLSLEKLYQSCKNGSLVI

LDWYKFTTFDIIGDLAFGEPFGCLEGCNYDQWIKGIFKGAYLGSFMQALSFVPRLKSTLLLLVPKSMQEAHQRHKELTKA

KMLRRAAITEKRPDLIDGLLRNKDEL (0)

KLGLDKLIANAEILIIGGSETTASLLSGVTYLLLQNPNAYETLKNEVRSKFNHQ

EEINLISVNKLSYILACLDEALRMYPPIANGLPRVCPKEGSWVLGEYIPGK (0)

TVLSIHQWALYRREKHFKDPNTYHPERFLSSPEFLDDRRDAFQPFHTGPRNCLGRN (2)

LAYSEMHLILALVIFNFDMKIAAESK &

DWIRQRNYLMWDKGPLKVYLRPRTSI*

 

>CYP65X1 Aspergillus flavus

99% to CYP65X1 Aspergillus oryzae, 48% to CYP65AU1

AFL2G_04023

MALAAEYFSHALSQPYGSSFWVAVAASLVFICYITCDTVYNLCLSPLSSFPGPRLWAVSNIPRQLSILGGRSHLKMLALH

HRYGPVVRVGPSELSFNSPQGFRDIYGFRRGQPQFQKDPKMYGSPLTGISNSIGGHVDSDTHSRHRRLLSHSFSERSLRE

QEGIVVYYVDLFIQRLRERTSVNKIHRAEEDLKSWFNFTTFDIIGDLMFAETFDCLKDSQLHPWIALMFNNVKGIAFLGV

LNEYSLFRKMQGALLPKALKQKMLENHKLCAQKADRRLQKGASRPDFVS

AILKHGLSDDKEEFIENQPLMSRAEIHANSIF

ITIAGSETTASLLSGCLFYLCKHKYIMDQLNKEIRTTFSKDEEITSSKCFNLSYLNAVLKESLRLYPPVAASLLRLVPK

GGCTIDGHFVPED

VTVSTHHYASYRDAANFTFPEQFIPERWLGTDNRFDSDRKDVVQPFSLGPRDCLGKN

LAHMEMRLILSKLLFNFDIHLTPESENWVQQKMFIVWDKPALMVRLTDRFA*

 

>CYP65AB1 A. flavus

Supercontig 8: 73235-75051 (+) strand

AFL2G_07276 revised

MLFSLGPLTIVYG (0)

LVIFVVAKTIYNLYLHPLRSYPGPLLAR ATRWYYSYYVKIGLLPQKTKELHDQYGPCVRIAPDELSYNTAEAWEDIC (1?)

GHRTGQRTESFEKDLTFFPPAPNGVDSI (0)

IVAKDDVHRRFRRLLSHPMSDKALGSQQEIITGYVDQLIHELRQRSERSEVVDMVRWFNF TSFDILGDLAFGESFGCLGSGLMHPWIELIFTSIKSVMDMQIIRRVPGLFSLILAIAGLQ QKQDLQEQFMFCQKKARERYTKETTRPDF ()

MTYILRATEEKGMTPEEIEANAQILIMAGSETTASALS ()

GTLFYLLKTPTAMQKLRQEIHATFQTEAEITMRSTQSMEYLHAVLQEAMRVYPPVPCTFP RTTPPDGAMVCGRFVPGGYIVGVNQLAAMTSKKNFKDPLKFIPERWCGDERYQEDSRKAY

QPFSYGPRNCLGK ()

NLAYAEMRLVLTRLLWNFEFDLLEESKDWH AKQKVWMMWDKGDLKVRLKPLRH

 

>CYP65AC2  Aspergillus flavus

98% to CYP65AC2  Aspergillus oryzae

AFL2G_10525

MTLSAESSQLPWALGNIVQQVHGIPIWGTVLTILVLVVLHYAIYAVYNITFHPLAKYPGPKVAAMTRIVYTSHLLSGRLV

EFLHQTHLKYGAVVRVAPNEVIFTSSQAWNDIYNVRQGAPEMGKDTPLYQSLGTPPTIAEAGHDLHRRYRRLLAKGFSEA

GLREQEPVIQQKISVLIKQLHAATAKGTTPEMTSWFNFFTFDLISELTFGESFKCLENGRFHPWILMVTQSIKFRAIIQA

LGYYPLLFKLFMGLIPKSYQEAFRDHQKLTSENVQRRIDKKVDYTDLASNLIDPKHNLERYEIDGNCAVLIVAGSETTTT

ALSATMYYLTQNPEAKAKVIKEVRSSFSSAEEITAISVNQLKYLPACFNEAMRKLPPAPAVFTRRVPREGAYIAGNWIPG

GTHVGMCHFATNNSSLNFKDPEKYTPERWLGDPEYEDDARAAMQVFSVGPRNCIGQNLARLELRLLLSRVIWEFDWELDP

VSVDWDKDMPVYLSWGMKPLKFHFTPVVR*

 

>CYP65AD1  Aspergillus flavus

AFL2G_00138

MLPANNLAFILSPVVTFELIGEVIAL  (0)

VSIAAIASWSYNVFFHPLSNYPGPRLAAATRLWYAWHCAKGSLPFAIHKLHLRYGDVVRVAPDELSYIHP

DGWNEIYGHRPGQSEIPKDPSFYSS ALSSPE

GIFRAPRDRHGYIRRQMSHGFSEKSMREQEDTIRHYAD LMISYLSTQANGPKENVVDFT RWYNYFTFDVMGQLVFGESFN

CLQSSGFHPWVSIIFDSIRYNVFVRCTQFWPWLSPVIRRFIPKSFQRRKIEQQALSREKANYRKTIHDGRNDLVANLLKP

DSGVTDLEYQSTVQTLIVAGSETTASLLCGVTFHLLNNPEKLEKAVKEVRSEFDSADKISFVSVNKLHYLLACLNEALRV

YPPVADGFPRRTGSNVEVINGQPVPPN TAIRMTHWATYRSPRNFVRPNEYLPER

WLGNAPGFEKDHKNALQPFHVGPRNCIGRN (2)

LAYMEMRLLLALVLWNFDLELYPASKLWDKQRVYNLWEKPELKVKVLPRKI

 

>CYP65AF1 Aspergillus flavus

98% to CYP65AF1 Aspergillus oryzae

AFL2G_05426

 

MLSFLPLSGPFSSPVGTVGFYLGLGVLL (0)

SILYLFAVIIYNIYFHPLAKFPSPKSYAATRIPYFQALLGGQIGQA

IKDLHQKYGEVVRIAPNELSFIDG

EAWKAIYGTRPGHKQKPKDVRYYPPTAGGVPSIVISNDEDHSRFRRTLSHAFSETSLRVQEPLVNSYIDLLIQRLHEHCE

AGNKPLDMVAWYNFTTFDIIGDLAFGEPFNCLHNSAYHKWVSMIFSNIRYGTYGNLARRFPGSKFLLRLITPTRIANGRN

WHIELTKEKAKGRLAKSNDRMDFYGHILKQKDTERAMTFDEMVTNGSTLIVAGSETTATLLSAVTFYLLKNERVLSKLQQ

EIRASFESEKDITVTGCNQLEYLNAVLTEGLRIFPPTPTGLPRIVDADGDMIAGKWVPGGTIVSIPHLAAFHSASNFTEP

ESFIPERFLGDPRFANDSKTVLQPFSFGPRNCIGRNLANAEMRLILARVLYNFDLELDERSENWSRQETYILWNKPGLY

VRLRPRVGI*

 

>CYP65AY1 Aspergillus flavus

40% to CYP65S4 Fusarium verticillioides

AFL2G_11804

Note: there is no ortholog of this gene in A. oryzae

MAARLLSSVSLTDVVLLLSSVWIAVHLVLAAYNVYLHPLRRYPGPKLAAASQLLNVYHVLKGDNCKWTAQLHEKYGTVVR

IGPNELSYISPSANQTIFGGRPKEDKVFEKNPVAYLQGNGDISNIFFARFHDHNRLRKLMAPAFSETAVREQEATIQGYT

NQLIAALRNRSGQAAYPDAKGVVNIIPWLHFILFDVLTRLSFGDPIGCLDRADYHPWVSVIFKAIIHSTYTQAAHRLAPY

QWILKHFIPNDMTANYEAHLEFTRKQLDQRQQVKEEPVARADFSSFMLKGMSPDELFDNVNIVITAGGETTASTISSSLY

YLVHNPSSYERLTKEIRDTFSAEGEITLAAVAALPYLKAVIQEAMRIHPPVPIGLFRVAPAAGAFIDGQWVPGNTWVSVA

NLAASRSPTYWRDPERFTPERWLGDAKYESDVREASAPFSIGTRNCIGLNLANANMRIILARLLWNFDFEAQPDNIDPHE

LDEYGIWETKPLNLKIKERVQTT*

 

>CYP65-un2 Aspergillus flavus

45% to CYP65L1

AFL2G_11416

SSITTSSGLFRAIRSNCENIGSAGRIMVTELRNRVSFNSVTVNQCKYLVAVLQET

MRLWPAIAISLPRVTPPEGCEIDGSWVPGGTKVGVSQWSAYRSERNFARADQFLPERWLPEGEEESFINDTRAAFQPFST

GPRNCLGMNFARAETRIIFARLLLDFDLELLTGRDEWEAQKVYIIWDRCPLYVRVRQAKRR

 

>CYP68L2 Aspergillus flavus

97% to CYP68L2 Aspergillus oryzae

AFL2G_11735

MLGDLFESVLTNNSVTLLITVAVAAIALHLSSPKSNLPLVNDKKPWEFRYTKARKRFLANAHNLIKAGLAKAPAFRIVTG

NGKRVVLDAKYANELRSHDDLSFGLHTANYFHAHISGFQPFKQGSNDDEIYQNAVRMKLTQSLGNLTQPLVDETLVALQT

YWTDDTNWHAIPLKSNIQKVVAQLSSRIFLGDQICRNPNWLRITVDYTVDAFKAAEELRLWPKAFRAIVALFLPSCRKIR

AELQEAQDIIRPVLDARRKDKQAALSAGKEPERYNDAMQWLEECAKGRSYEPAFGQLTFSVAAIHTTSDMLTQVLYDLCG

RDALIQALREEVITVVQEEGWTKPTLYKLKLMDSVLKEIQRLKPISVVSMQRVATADLRLSDGTFIPKGTFLAVSSDRMW

DSEIYPNPLEFDGYRFLKLRELPGHETSAQVVSPSPEHMGFGFGRHACSGRFFAINEVKIALCHSLLKYEFKLADGSVPR

ATKFGFSFKSDPTTKLMIRRRQEETVL*

 

>CYP504A8  Aspergillus flavus

99% to CYP504A8  Aspergillus oryzae

AFL2G_01710

MSLQTIAIAAIAVAYFIIRYLNRTDVPKIKGIPEIPGVPLFGNLLQLGDQHATVAGKWAKKFGPVFQVRMGNKRVVFANS

FDSVRQLWIKDQSALISRPTFHTFHSVVSSSQGFTIGTSPWDESCKRRRKAAATALNRPAVQSYMPIIDLEATASIKELL

KDSQNGTVDVNPTAYFQRFALNTSLTLNYGFRIEGNVDDELLKEIVDVERGVSNFRSTSNNWQDYIPLLRIIPKMNREAE

EFRVRRDKYLTYLLDILKDRIAKGTDTPCITGNILKDPEAKLNEAEVKSICLTMVSAGLDTVPGNLIMGIAYLASEDGQR

IQQKAYDEIMKVYPDGDAWEKCLVEEKVPYVSALVKETLRFWTVIPICLPRVNIKEIEFNGAKIPAGTTFFMNAWAADYD

EDHFKMPEKFLPERYLEVSEGSGTPHYGYGAGSRMCAGSHLANRELYTAYIRLITAFTMHPAQNPADRPILDAIECNAIP

TALTTEPKPFKVGFKPRDAPKLQQWIMESDERTKDL

 

>CYP504B6  Aspergillus flavus

100% to CYP504B6  Aspergillus oryzae

AFL2G_01532

MAITATLFSIQKSLIHTPLQSIAIAALFTSCLYFIVNEFIRAFSRVPGFKGPRGLPLIGNIAQIRKNAAEQYRIWSKTYG

PVYQIQLGNIPVIVVNSAVSAKAIFGQNAQALSSRPEFYTFHK (0)

IVSNTAGTTIGTSPYSDS

LKRRRKGAASALNRPSVESYVSHLDAESKAFVAELLKYGEGGNVPVDPMAMIQRLSLSLALTLNWGVRVVSQEEDLFNEI

THVEEEISKFRSTTGNLQDYIPLLRLNPFNTNSKKAKEMRDRRDKYLNGLNRDLDDRMEKGIHKPCIQANVILDQEAKLN

SEELTSISLTMLSGGLDTVTTLVAWSIGLLAKRPDIQDKAAEAILNMYGPNQPMCDAADDQRCAYVAALVRECLRYFTVL

RLALPRTSIRDITYGGNIIPKGTVFFLNSWACNMDPDTWSDPEEFRPERWLEQPDAPLFTYGLGYRMCAGSLLANRELYL

IFMRTINSFRIEPYDEIDWHPVHGNADPTSLVAIPKKYKV

RFIPRDNKVLEDVLGSAFSLKRVI*

 

>CYP505A3 Aspergillus flavus

99% to CYP505A3   Aspergillus oryzae 4 aa diffs

AFL2G_09091 revised

MSTPKAEPVPIPGPRGVPLMGNILDIESEIPLRSLEMMADTYGPIYRLTTFGFSRCMISSHELAAEVFDEERFTKKIMAG

LSELRHGIHDGLFTAHMGEENWEIAHRVLMPAFGPLNIQNMFD (1)

EMHDIATQLVMKWARQGPKQKIMVTDDF

TRLTLDTIALCAMGTRFNSFYSEEMHPFVDAMVGMLKTAGDRSRRPGLVNNLPTTENNKYWEDIDYLRNLCKELVDTRKE

NPTDKKDLLNALINGRDPKTGKGMSYDSIIDNMITFLIAGHETTSGLLSFAFYNMLKNPQAYQKAQEEVDRVIGRRRITV

EDLQKLPYITAVMRETLRLTPTAPAIAVGPHPTKNHEDPVTLGNGKYVLGKDEPCALLLGKIQRDPKVYGPDAEEFKPER

MLDEHFNKLPKHAWKPFGNGMRACIGRPFAWQEALLVIAMLLQNFNFQMDDPSYNIQLKQTLTIKPNHFYMRAALREGLD

AVHLGSALSASSSEHADHAAGHGKAGAAKKGADLKPMHVYYGSNTGTCEAFARRLADDATSYGYSAEVDSLDSAKDSIPK

NGPVVFITASYEGQPPDNAAHFFEWLSALKGDKPLDGVNYAVFGCGHHDWQSTFYRIPKEVNRLVGENGANRLCEIGLAD

TANADIVTDFDTWGETSFWPAVAAKFGSNTQGSQKSSTFRVEVSSGHRATTLGLQLQEGLVVENTLLTQAGVPAKRTIRF

KLPTDTQYKCGDYLAILPVNPSTVVRKVMSRFDLPWDAVLRIEKASPSSSKHISIPMDTQVSAYDLFATYVELSQPASKR

DLAVLADAAAVDPETQAELQAIASDPARFAEISQKRISVLDLLLQYPSINLAIGDFVAMLPPMRVRQYSISSSPLVDPTE

CSITFSVLKAPSLAALTKEDEYLGVASTYLSELRSGERVQLSVRPSHTGFKPPTELSTPMIMACAGSGLAPFRGFVMDRA

EKIRGRRSSGSMPEQPAKAILYAGCRTQGKDDIHADELAEWEKIGAVEVRRAYSRPSDGSKGTHVQDLMMEDKKELIDLF

ESGARIYVCGTPGVGNAVRDSIKSMFLERREEIRRIAKEKGEPVSDDDEETAFEKFLDDMKTKERYTTDVFA*

 

>CYP505A14  Aspergillus flavus

99% to CYP505A14  Aspergillus oryzae

AFL2G_01234

MEETNLIPIPEPRGLPLLGNILDVDSEAPEKSFQRLAETYGPIFRLNLAGASRVFISTYELVDEICDEERFTKVVTAGLR

EIRNGVQDGLFTADYPGEDNWAIAHRVLVPAFGPLMIRAMYEDMYDIASQLALKWARQGSSATIMANDDFTRLTLDTIAL

CSMGTRFNSFYSEDLHPFIKAVATLLQGSSDRTFRSTLLNNLPTRENKKYWSDISLLRTLSQELVDARRNNPIDKKDLLN

ALILGQDLQTGQHLSDDSIINNMITFLVAGHETTSATLTFLFYYLLKNPHAYQRAQEEVDTVVGQRKIIVEDLSKLPYIA

ASLRETLRLQAPVPLIAFHPHPTKNHEDPVTLGKGKYALNNDEPVVLIMGKVHRDPKVFGDDAEEFKPERMLDKNFEDLP

KNAWKPFGNGMRGCIGRPFAWQEMLLVVAMLLQNLNFEMENPSYDLRIKQSLSIKPDGFQMKATLRRGLDAAKLASVLNS

GGDLLSRAPQILNGEYKPNTDLRFHLRPMHIFFGSNTGTCEALARRLAKDSMGYGFATRVESLNSAMENIPRDNPVIFIT

ATYEGQPPDNAAHFFEWLNGLKKAELDGVNYSVFGCGHHDWSATFLRIPKATNDLIEKHGGTRLCDMGMADAANSDMFSD

FDTWSELILWPAINLKFGRASSEGDVQSKSALHVDVSSSMRASTLGLQLQEGYVLENKLLTTPDVPAKRMLRFKLPPDTT

YQCGDYLIVLPVNPAHVVCRAIRRFNISWDSMLTVRKPSHASDGITNMPLETPISAFELFSTYVELSQPASKRDLITIAD

AATTDTDAQAELQSLASSPNRFTEEVINNRLSPLDILIRHPSINLPLSTFLEMLPPLRVRQYSISSSPLASQSDCTITFS

VLNSPHLSTENKRFVGVASTYLSELQAGDRVQISIRASNNKGFKPPLKEETPMIMACAGSGLAPFRGFIMDRAERNRGRR

TELLSDDDHPEIGKPARAILYIGCRTKGKDDIHASELDEWTRQGAVDVRWAYSRPTDRSQRRHVQDLLFEDRNELLELID

QGARIYVCGGMSVGQGIRQVFKDMFIERCREVLENGSDGDEDVAAEEYLDSLKTEERYATDVFT*

 

>CYP505C3 Aspergillus flavus

99% to CYP505C3 Aspergillus oryzae

AFL2G_10943

MRQNDNEKQICPIPGPQ (1)

GLPFLGNILDIDLDNGTMSTLKIAKTY ()

YPIFKFTFAGETSIVINSVALLSELCDETRFHKHVSFGLELLRSGTHDGLFTAYDHEKNWELAHRLLVPAFGPLRIREMFPQMHDIAQQLCLKW (2)

QRYGPRRPLNLVDDFTRTTLDTIALCAMGYRFNSFYSEGDFHPFIKSMVRFLKEAE

TQATLPSFISNLRVRAKRRTQLDIDLMRTVCREIVTERRQTNLDHKNDLLDTMLTSRDSLSGDALSDESIIDNILTFLVA

GHETTSGLLSFAVYYLLTTPDAMAKAAHEVDDVVGDQELTIEHLSMLKYLNAILRETLRLMPTAPGFSVTPYKPEIIGGK

YEVKPGDSLDVFLAAVHRDPAVYGSDADEFRPERMFDEHFQKLPANSWKPFGNGKRSCIGRAFAWQEALMILALILQSFS

LDLVDRGYTLKLKESLTIKPDNLWAYATPRPGRNVLHARLALQTNSTHPEGLMSLKHETVESQPATILYGSNSGTCEALA

HRLAIEMSSKGRFVCKVQPMDAIEHRRLPRGQPVIIVTGSYDGRPPENARHFVKWLQSLEGNDLEGIQYAVFGCG

HHDWSTTFYKIPTLIDTTMAEHGGARLAPRGSADTAEDDPFAELESWSERSVWPGLEAAFNLARHNSSDGTGKSTRITIRSPYTL

RAAHETAVVHQVRVLTSAETTKKVHVELALPDTMNYRPGDHLAILPLNSRQSVQRVLSLFQIGSDTILYITSSSATSLPT

DTPISAHDLLSGYVELNQVATPTSLRSLAAKATDEKTAEYLEALATDRYTTEVRGNHLSLLDILESYSVPSIEIQHYIQM

LPLLRPRQYTISSSPRLNRGQASLTVSVMERADVGGPRNCAGVASNYLASCTPGSILRVSLRQANPDFRLPDESCSHPII

MVAAGSGIAPFRAFVQERSVRQKEGIILPPAFLFFGCRRADLDDLYREELDAFEEQGVVTLFRAFSRAQSESHGCKYVQD

LLWMERVRVKTLWGQDAKVFVCGSVRMNEGVKAIISKIVSPTPTEELARRYIAETFI*

 

>CYP505C4 Aspergillus flavus

46% to CYP505C3

AFL2G_00477

Note: this seq has no ortholog in A. oryzae

MSGREDHEIPGPKPWPILGNGLDFPSEGYTDTLIELGLKYYPIYKLTFAGSVEVMVNSVALTNELCDESRFSKVVGPTLE

ELRSAAGSGLFTAYNGEPEWETGHRLLAPVFGPTKIRKMFDHMYEMVEQLSLKWERYGSTYPIEVADDFSRVTLDTIALC

GMSFRFNSFYRDGTFHPFVDSMNRWLKNSDTMGSTPRILKSFLFRAQRQYKYDIHLMRQTCLDLIERRKKDQSEHEDLLD

SLLKGVDPTTGARLSEETCVDNLITFLIAGHETTAGLLGFVFYYLAKYPHVQRKAQEEVDRVYGDGSITVNDLQKLRYIT

AILREALRLNPTAPSWGVSPHRDEIIGGKWHVKKGQPLNIMLHSVHRDREVYGPTADEFDPERMLDEAFERLPPNAWKPF

GNGKRGCIGRAFAWQEALLITSYLLHKFYFTLHDPNYTLVLQEALTVKPKGCRILAQPRGKKPTASSATTNDSLRGASGR

VSSPSVPRSSGPPLLVLYGSNAGTCEALGRQLARDIESRSSYTCTLAELDSYVGKLPRDQPVLILTGSYDGAPPSNAVKF

VKWLERPIVESLKGVSYAVFGCGHKDWRATLYKVPAAIDELLAQKGAHSLAPLFKVDTGSDDAFVQLDMWIERDLTGALD

MANTASGGTDSLRVFLQDPPNHRAGYVETVVCDVKLLTTPTTAKKIQVDLMVPTGLAYSVGDSISILPLNPKHTIQRALS

RFHLAWDTYLKLENDNLTHLPTEYPISVADLLGSFVELGQTATLGNMKTLIDATDDWTTKQALLSLRDAHEDHIADKHVS

VLDLLEQFPTIPISIEGYLSMLPLLRPRIYSIASDPQWQPGLLSIIASVIDEPHWRSDEDDLYRSELDGFEREGIVEVKR

AYSREVHSSDTRGGRYVQDRLELEKEDVIELWKLGARVYVCGGDGMARGVRAVLTRILEETGEGGDELLVAPRYVTEIFS*

 

>CYP531C3 Aspergillus flavus NRRL3357

AAIH02000016.1

98% to CYP531C3 = ortholog

AFL2G_11285

40898  MDSFLFLALDYSLRGFAVSLFGTLWIALVFWYLATYLISPLRKIPGPFLA ()

40659  GWTNLWRMYHVTQGQSQVVLHELHQKYGPVVRIAPNVVDLDLPEMIKTIYNTKGDYRK  40486

40485  TEFYHGSSAKSYGRIIYNLFSECDPDIHAQQKRPIAKYYSLTGVLPLEPHIDEVINYLCR  40306

40305  RLEEEFIDGSNAGITCKLDQWLLF (1)

       YTWDVVGQATFSEPIGYL  40126

40125  KNGFDFDGTIAISDTAMDYFSLVGQLPVLDHLLDKNPIYRIGPPAFGNITNISITHLLDR  39946

39945  LQGKDTSYHDANKPDFLDRFIDAKDKYPDIVDDSQIISYLMINMIAGADTTAITLNAAIY  39766

39765  FALKDPLVWARLQKEIRACQSSLDAAPSAVPYNIASALPYLNAVVREAMRMHPGVAMTLE  39586

39585  RYVPPGGLTLPNGQYIPQGSIVGMNPYVIARNRSVWGEDSDVFRPERWLRDDSQESEEEF  39406

39405  QARLRLMNNSDLAFGAGSRICIGRNLGLLEVYKVMATLISRYDIELAHPHRDWKTHNSFF  39226

39225  VRQEGINVKLSRRS*  39181

 

>CYP531E1  Aspergillus flavus

99% to CYP531E1  Aspergillus oryzae

AFL2G_10670

MLSITELIMDLGLAIVILGVSHLLWNYLSSPLKAFPGPLWASFTNLWRLQDVFKGRCDITHNQLHRKYGT

AVRMGPKVLSLSDPSVIPHVFNSKNPWMK SDMYNVNDVIVSGVRLKNLFSHQDEKWHSTYIRPVKGLYSM

TKVQDMEPGVDVTIKLFMDKLRERFVEKGQLCDMADYLNFF AWDVMSQITFSQNLGILEAGSDYQGFLGR

SNKSLDYFASISQMPILDLLLDKNPIVRLGPPTFVWANIFSLEQLQKRLSGGTPPSGHTDFLDKFLETKK

KYPDLVNDNTVVTYLLSNTLAGSDTTGSAMCSAVYHILKHPRVHRKLREELYAAKVPLPAKWKDLQGLTY

LDAVMRESMRVNPGVGLMIERIVPEGGFTLPDGRFIPAGTIVGMNPWVINKNEAIFGANTEEFIPERWLP

SPGESDQAYQARFTKMKSTDFTFGAGPRMCMGRYLSQLESYKLIATLFSTFEMELPSLDHTWHVTNSWFV

RHESIPVKMRERTDLAVSV

 

>CYP531E2  Aspergillus flavus

99% to CYP531E2  Aspergillus oryzae

AFL2G_04353

MDIAFKLVLLGATLILSHLIWNYFRSPLKSFPGPFSANLSNLWRLQDVFKGLCDITHNELHRRYRSAVCIGPNVLSLSDP

ALINQVYSTRDPWVKVSSERTQDPQH (0)

SDVYNVNDSVVSGVRIKNLFSHQDEQWHAN (2)

QELEPGVDITINLFLE

SEYINY (1)

FTWDTMSQLSYSQSIGMLEAKNDRFGILEVSNRSLDYFAS ()

VCQIPMLDLLLDKNPICRLGPPSFGWSVKFSAEQYQERFTEGKQSHNGIKDFLDRYIETKSKMPNIVDDN VAQMYLVLNIIAGSDTTARAISAAVYY

EELRGANLSTPPQWKE

IRSLPYLDAVMRETMLVHPGVGLLLERIVPKGGFTLPDGRFVPEGTIVGMNPWVINRNRTVFGPEPDSFKPERWLPAEGE

HDEAYQTRFSKMKGTDLTFGAGPRACLGRYISQLESYKFVATLFTMFD (0)

LEHPDHEWEVTNSWFVRQKNIPV (0)

PSSSSSSLVVSL*

 

>CYP532A6  Aspergillus flavus

100% to CYP532A6  Aspergillus oryzae

AFL2G_11872

MTLLAEVFSRASPEYALYILPFISLIYIGHLYFHNGLNRYPGPFLAKFTDLWRFLDVWGRQPHETHIALHRKHGDVVRIG

PNTLSFSSPAATKVIYGLNKGFTKSEFYPVQMTVSKGEPLPSLFSTLDDKFHAELRRSVNHAFSMSSLVQYEPMVDETTL

LFLDQTDRLFATGGKVCDFARWLQFFAFDVIGSITYSKRHGFIEKNEDIDGIVKSLARIFNYAGPVGQMPWLDKVFWKNP

IFDAMQKWGLLDNSHPVAIFARQRMMERMSSKAAIDPSSRSDLLTKFMKAGELRPNFMTEKRVLTMAVSMAFAGSETTAI

SLAAVFYYLLKTPDYMRRVREELDEAIQNGTIENRPSGLVSWTESQKLPFLDACIKEAFRIFPAAGLPLERVTPPSGADI

AGQFIPGGTIVGCSPWVIHRREDIFGSDVDTYNPDRWLNASEDKLKIMNGMMLQFGAGSRTCIGKNISLMEIYKLIPSFL

RRFDVRLAYPEQEWRLWNAWFVRQYNFNTVFTPRKIEVQ*

 

>CYP535E1  Aspergillus flavus

99% to CYP535E1  Aspergillus oryzae

AFL2G_09395

MGLVELVLETRWLVVGSLFILYFLKKFQAYYRLRKFKGPLSCGFSHFLHTKAVLSLRCERWYKEMTDQYGSIVRIGPNAL

ITSSPELWAHINAVRSPYKRSDWYYHAARFKPGEDHVFSETNNERHDRRRKQMLMGYSGKENLSLESDIDLRVLDFLDLI

RNRYLSTEDCLKPMDLAKKVQYLTLDVISTVGLGNSFGMLKADKDVNDYIKSGEEGLWVSNFLMGTGLHWIMQIEWVGRL

LGPSTDDLKGFGKMMATTGQMVAKRLQSPTNARSDMLASFIRHGLIGNELWMEAFEQVLAGSDTTASGIRGILLCLLSNP

RVYKKLQAEIDGAVQDGRAPSTGIISDAQLRRLEYLQAVIREGLRIFVPVVNIFARDVPPEGDEVIVDGESVQIPGGTWI

GYSALGMHLNKATYGEDAEVFRPERWLNDDKDHLANMTRVNDLIFGYGRWKCLGQTVALIEIGKTIFE

ALRNFDWALANPEQPWRRKNVNGLFAVSDMWVTVTAREQLGSCL*

 

>CYP537B2  Aspergillus flavus

98% to CYP537B2  Aspergillus oryzae

AFL2G_11813

MWSLWLSSILLVGLYLFKRLSSPLAKVPGPWYTNLTSFCLKYHEFTATRRLFVHRLHKKYGPVARLAPNEVSFASLDAIR

EIYASGGSGYDKTEYYDLFRQYGIK (2)

TMFSTLEKQE (0)

HSHRKRELADRYAMSNIVRDKHVSAIKERAQAFVSRCAAIEGSVNVY (0)

SLLHCYALDGVTNFMFSPGGLKSLDNTKDYQMMEELTYHQSL

QKNLLYYYLPRLAPYFPSCLHPRPAPRANAYVLQMAGQQHPEEHSLVARLTRKGSPLSHMQVAAECKDHMAAGIDTTGDA

LCFLMWELSQPQNLQFQDRLHKELLSTSDDTPLDKMPYLDAVIKEALRCAPPIPMSFPRYVPSGGRTIDGYFIPENTIVS

CQPYTVHRFNEEVFPEPDRFNPERWLEEKGFNDRNRLFFAFGTGGRGCTGKNLAMVEMKILLRELYSRFRSSVAPDMTAS

MDLDDQIISARPKDQICKLNFAVRGEDVDTA

 

>CYP539D9 Aspergillus flavus

75% to CYP539D7 Aspergillus clavatus

AFL2G_09153

MIEELLHQMTPGKASVLFLGVFIVLCLVRKVQVSMHIKRLGGRAPQIQFRFPY AMDFIYNSLNANRAHRDLEFFGNAIKT

AKGASQIDSPKTAEVSAGISSRFIFTRDPENIKAILAGQFADYGKGEPFHNDWKEFLGDSIFVTDGELWSRSRHLIRPMF

VRERIVDTEVFEKHVQHLIPFLSGGNSPAGSKIVDVGPLFFRYTLDAATDYLLGQGTDSLQNPTTSFSEAFGYVQHRQAD

LTRLG IFKFLLSLREFRRNLKIMDNFIQPYINRVLSLSTAELDQKLSKQDTFLDSLARFTRDPRVLRDQLVAILLAGRDT

TAGTLSFCLFELARNPQVVAKLRQEIESRLGVGAKGRKPSYIDLKEMKYLNAVLNETMRLYPVVPFNVRLALRDTTLPRG

GGPDGLSPIGVRADTRVLYSTMLMQRNPENYDAPGSPGYVDPEKFHPERWLSGWQPKPWRFIPFNGGPRICLGQQFATIE

MGYTVVRILQAFREIKAFPVSGKSVVEDPVLRFEVTLSPGSELNCLFVPEEASPTK

 

>CYP540A3  Aspergillus flavus

99% to CYP540A3  Aspergillus oryzae

AFL2G_09274

MKCQFYLVGDDIATAQSILVDSRWKFEDLQRAVGGIFHVALPTGISFHTSENETLSSVADIISASSSPIGLRIDGNAVQT

PQGPQGLPLVGSFYEIFPDHLGNHYRLFRKYGPVIKTTNMGKTTYLTDDPQVASVCLAESAYMTKKINENHPLWGVKDNT

AIFIGDTETENWRLAHKYLPPAMGPKAVRHYTGLMQNCARKSLPVFDELDGRDESWNVYQYMVKLASQTIGSFSLGKDFG

HFDSVDSPLHPIVTNIANLLSLNKKITARGEWYRYLPFGDPARLRHVQHTIYTLLQEAIDEVAGSGIADAPMNEAALSAS

CVVDYLLHAVDDKGEHFPQGLILANMLIVTGAGFTTTSALLSWLLYCMVTYVGTQDRLYAELVEHGIVGPSGERNQTTWT

PDLAHSLPYLDKFVKETQRLHNASFQPGRTTKTDVVLPGGYRLPPDSVIVPALYAIHTNPKTWRDPFRFDPDRWDTEEVK

GRHRCAYIPFATGPRGCIGFNFALLEVKILLAELVSRYEFVRDGLEAIDYDPEFQLIRPLNFYVRAKRRV

 

>CYP540B9  Aspergillus flavus

99% to CYP540B9  Aspergillus oryzae

AFL2G_07990

MPIRLFYLSGEPSSTAREIELESTLDYDGLRHLIAAHFAIVEPNGIGFQSQDAILSDVAEVLANE

DSISITIDGKSVREI

PGPKGLPIVGNFFEIYPDHLGNHQRLFEQYGPIIKTTNMGRTVYQTNDPQLSSIIFSETDFFTKKINEAHPLHAIKNQQA

GVFLGDTDTPEWRAAHKFLPPALGPKAVRHYAPTMQQTVEDAFKVFDHFDENGEAWNVYQYMLKLGSQAVGKLVLGIDFN

HFSSPDAPPHELIQIIAESLSLNKKVTARGDWYAKLPFGDPQRLRNMRYRIFDIVDQSIQNASRNGVEDLPLQDAALKAS

NMIDYAVRATDNKGEKLPKTSLIQSLVVATGAGFTTTSSLLSWLIYSLVTYPGVQDRLLQELIDNDITEDTQITADLTDR

LTFMDKLIKETQRRHNPSYQPARTAKVDMILPGGYKLPEESVVVGALHHLHNNPEVWSNPTRFDPDRWDTEEVKNRHKAA

YIPFATGPRMCIGFNFALQEVKVFLPKLVYRYKFTKENDGPIEYDPMFQLIRPNNLLSGSTGPWAYKA*

 

>CYP540B10  Aspergillus flavus

100% to CYP540B10  Aspergillus oryzae

80% to CYP540B7

AFL2G_06859

MPIRQFYLLGEPVSSAREIEIESSLDIAGLQHLIAAHFAIVEPSGIGFQANDNTLNDIPEITSSNGPVAITIDGKE

VREPPGPKGLPIVGNFFEVYPDHLGNHQRLFEQYGPIIKTTSLGRTTYQTNDPVLSSIVFAESDFFTKKINEAHPLYALKQPSA

GVFLGDTETPEWKVAHKFLPPALGPKAVRHYAPTMQETVEDAFKVFDEFDKQGEAWNVYQYMLKLGSQAVGKLTLGLDFQ

HFTSPDANLHEMVNLIAELLSLNKKVTSKGDWYAKLPFGDPQKLKQIKVRIIEMVEESIRSAERGGVVDLPLQDAALQAS

NMVDYAVRATDNKGEKLPKTSLVWALTVATGAGFTTTSSLLSWLIYGLVTYPDMQERLLQELIDHDIDENTQLTADITDR

LTFLDKYIKETQRRHNPSFQPGRTAKVDLILPGGYKIPQDSVIIPALHHIHNNPELWDNPQKFNPDRWDTEEVKNRHKAA

YIPFAMGPRMCIGFNFALQEIKVFLPKLIYRYKFTREGDGHIEYDPMFQLIRPNNLYVRAERR

VKWPPKTEN*

 

>CYP541B3 # AAIH01000171.1 Aspergillus flavus NRRL3357

the ortholog of Aspergillus oryzae CYP541B3 only 2 aa diffs

AFL2G_09797

MPSPIPKPKGVPILGNVFDLDGNNTWGSFNKLAKDYRPIFKINILGKDIVFITGAHLLEEVCDETRFRKCVAGPILAIRD

AVNDSLFTAKHTPEEIISWGIAHRIMAPLVSWEAVEQVFSGIQETTDDLIKKWTTGSRQRINVTNDLDRCNHAANMLCFF

DQRVHIMEGPEPAVIKAMDCATNEAMHRPFRLRIVNWLFHSRKWNAWIKTMRDYGKDIVETRRANPTDKKDMLYALLEGK

DPETGKGLTDSQVLDEIINIFIGSATAPNLIAFAMYYLANNPDAAAKAREELDAVVGGPSVRIEHEHLARLPYTEGVLRE

SFRLSGVAPGFNIEPIPENEGPVLLAGGEYEVPKGQALIAILAAVNRDPAVFEDPEAFKPERMVGENFDRLPKGVKKGFG

NGKRECIGKRYAWQWSFMVLASILKDVEFELADPNYKVGNDGVNCNGAFSVRPQEMFVVTGPRARAA*

 

>CYP547C3  Aspergillus flavus

100% to CYP547C3  Aspergillus oryzae

AFL2G_11890 revised

MDLMLALITLSLVEGFLLQRTVFVDLTFRTVTLSSVGVNLVLLTIWNTLIYPYFVTPLRHLPTISGNLNNARIVFDDPRG

RLPLEWMKTVPNEGLIHFRDIVNRSYLLATNHQALLDIMSTNTYDFEKPWRARDFLARIIGFGLILSEGSAHKKQRRALT

PSFNVKNIRALYSLMWEKTGLLMDELEKQIKQNPMDGTNAQSGEGKIEMSVWASRLTLDIIGPAAMGRDFRSLHNPENKV

ADSFLAILEPTKEKMAFLAVNFALPQWFARRIPWRLNKVINDETGFLRDLCRDIVHEKRASITATKATAKELEADILGTM

MLGGDFTDDELIDQMLTFLAAG HETTASAFTWACYLLTLYPDVQERLRTEIRERIPSGNHPITWSDLETLPLLNGVCQEV

LRLYPTVPMTIREAVRDSVVAGKHIPKGTRILLCPYAINRSPEFWGNDGEEFRPERWIDTDKN

GQLVTNNTGGASTNFAQITFLHGQRSC

IGKDFARAELRCAVAGVVGRFRFEMQNPKQKIHIAGAVTTKPVEGMHLRMSRVDDW

 

>CYP548D3  Aspergillus flavus

99% to CYP548D3  Aspergillus oryzae

AFL2G_08138

MLVQEVWKTLSIEGVVVGVSALLGLLSFAYVIYNRFLHPLRKFNGPFLASITPWVQLYHGLKGDRHLWLHNLHQQYGSHV

RVAPNFVSINSAQGLHDIYGHGKKLKKANFYNGFTAIKGVYNTHNVIDKTVHGRKRRVLSQAFSDQALKSMEDVMLLHVR

QLCTALAEQQTEGNKAEAQKTTVQNMGDWFSYLTYDVMGELCFGKSFDMLVSSGRRKMIQLVDRAANRHYVCGLWMPLDT

WHLDQIVIHRLTNDRWNFIMNSRVEANKRAQERTQAGHDSKKDFFYYLLNAKDPETGKGLTTPELWGEANVLMIAGSDTT

STTLAATIFYLVRNPRVMKLLKKEVREAFTSVEEIVTGGKLNELVYLKACIDEALRLAPAVPGAIPREVMEGGAVVDGAF

LPAGTDCGTPTYSIHRQPQYYREPEAYLPERWIEGATCVTADDKWESTKDAVETARRAFCPFSIGPRGCIGKGMAFMEMR

LTIARLMFLFDMELADRQGEDEKGHLALVDHFTSAKQGPNVIVRRRDI*

 

>CYP548F1 Aspergillus flavus

100% to CYP548F1 Aspergillus oryzae

AFL2G_04070 revised

MQVGGLRSRVSVLVAIQ (0)

LVSLIVYRIYFHPLSKIPGPLLPKITDWYPAWCVWRGSSHTALWEGHRRY (1)

GSIGRCGPNSVSVCSQTGLMEIYSTKANVCKDESY

VVMSVGSHAPNTFSFIDKKTHAFRRKILFQAFTDNALNGVQDQILSHISEFCAMLNPP

PSNGAGQSSVWGPSVDIAPLCDYLAFDVISDLSYGRSFGMLKSDRYRYVPKLTRRLAR

RNATCMTQSKLWRYKLDRLFFAGFLKALRDFGLWIRHQGKERIRLGNNGPRKDCFHYL

LSGSDPKTGQGLTERELRVELLLLIVAGSDTVATSLSAVLFNLAHNQQALQKATAEIR

SCFEREEDIRLGTRLKSCSYLHACISESLRISPAVSNMPPRRVLPGGITVDGYYIPEG

TIIGTPIYALHHNEEYFPRPFKYEPERWLENEANGENPSTDDGLKRARAAFCPFSIGP

RSCVAKNLAWAELTLTLARVLFSYDVRLPPDHCEVEPDCCSSVPRDQSPEYKLRTWIV

SAREGPSLQFRPRNVKVP

 

>CYP551A2  Aspergillus flavus

99% to CYP551A2  Aspergillus oryzae

AFL2G_08105

MEDTFNLTVLGGVIVLYSLGLVIYRLYFSPLAKFPGSKLAAATGWYEFYFDYWIGGKYVFEIERMHQVY (1)

GPIIRINPHELSIRDPDFYNEIYVTESKRRSNHYDLFARGIGMD ()

DARVESHIVTVDHNLHRKRRKPLEPFFSRAGIARLEPALVEMSLKLESRLRQYEGKHTVITLDHAFSAFSGDIIRRVCFNKDDFGDLFMDHPDFSPDW (2)

YNLIHNILRHFPVFTGFPLIAR (2)

IVTYIPESILLKAFPQGQSLNRLKD (0)

VALQRITHVMNSKATELKDTHREVSL

FHHIVESDMPESERSPERLVQEAQVLLSAGTVTTARTIAFASFYILARSEIKAKLQAELR

DAMDGWPEKVPTFMDLERLQYLQAIIKESLR ()

LSYGIMHRLPRVSPDLPIQYKDFTIPIG (0)

TPVGMSSYFMHTDPTVYPDPTTFRPERWLGAIDPAMHRNYVPFTRGSRNCLGMN (2)

LAMAEISLILAVLYRPNGLKLELYETDETDVMIAHDFMVPMPKVTSKGVRVLIR

 

>CYP567D2 Aspergillus flavus

AFL2G_04896, this model has a C-term extension that is probably wrong.

Model revised

MDRVVWLGLAVA(0)

LTALYWIHLAIYNVFFHPLASFPGPFWARASF (0)

IWRMWHTSTGRVHRAIEFQHKLH (1)

GDIVRISPNELSFASVESWKAIYQPKSAPLVKSEFYEIYGSGFNSLCIGSERNPETHSRMRKSLAAAFS

TKALLEQEDIIQGCVNDFIEGIRSQTTVNVTKWFEMLAFDILGEMAFGESFHCIEN (1)

SKSHFWCDMIEEHLYFITILDNLRRYPLIAA

IGKTILPHLTVSVRNKHTNYSRR

KVAHRLQSSSPRADFMSRLIAKVEDEEMEMEELTAHASTLV

IAGGETVATFLAAVTYHLLSTPNAYQKLRDEIRARYNHLSEITSTTALQL

PYLQAVISEGLRIYPPGSQGFPRNTPPQGIVVKGTYVPGN

VEVYTSAWTVTHDARYFHDPYTFKPERWLDPNCTDNKDASQPFSLGPRGCLGRN

FAIVEMSLILCKLHFQFDAELVNPFQEWESASQLHVMWWKPDLPVRFIPCTRDH*

 

>CYP573A5 Aspergillus flavus

99% to CYP573A5 Aspergillus oryzae, only 1 aa diff

AFL2G_03949

Note> end is n a sequence gap

MVLAGEDLVAMFTVTHVILALGAYVALRFAYQIVYYRFFHPLSVFPG

PFWGSVTRLWIAWHNLRETEVPTVYALTKKY (1)

GPVVRITPTLLLVSDPTKLPDIYHRNA ()

DKTGHYITGSFGETESLFNIRSHKTHAAFRKHIAGP (0)

YSFSNVTRMEPLVDARIDDWLNKLDETFASTGAKFDFAWWAV ()

YVAYDVISEIGFGAPFGFIEQGKDVGGLIQGFHDGLPAFGLLARLHPFTSWMKTTFMKKY

LVAKPEDNTGIGVLMRFRDRLIEQRLREIAEGKDVGRVDLLQTFIDARTEDGKPLDMDYL

KAEVLLVLLAGADTTGTVFQSLVNHLLVNQEVYERMMEEIDTASRKGLIPETIPQYDAIQ

EHLPYYVACVRETLRLNPPAPNIFPRFVSEP

 

>CYP577A4 Aspergillus flavus

99% to CYP577A4 Aspergillus oryzae

AFL2G_04292

MTITLVAIATGIVAFILYYICWSLFSSPLARIPGPKSFALTKWRLAYEDYKGTRTRKIHALHERYGPVVRIGPNEVAFNS

LPALRAIYGAGSGFERTNFYSMFAIYGRKNMFSFNTVKQHAERKKLFAHAYAKSAMLKGINASMIETKVRKYMELLEREG

RSQDIFTTLHYFSLDNITEFLYGDFGKTACLDGIEEDRALLHDILATGSRTLSWFTVHHPKLTAWLYSRTGFLGCVARQF

YPMQRPTPYTSIKLHATKAFQGFADASVAEKAKQSSLISKLWKHHRSMKDGGLDDLDIASECADQLDGGIDTTSDTLMFT

IWSLSRPEHWGFQQKLIDEVRSISEHDLNPEGIPRVEAADKLPYVEAVIKETLRLFAPLPASEPRSSPEATTIDGYLIPA

RTVVSISPYTLHRNAEVFKNPLEFNPDRWLDPSQDLTEMNRFFWAFSSGGRMCIGMHLAMAEMTTFVAALYRKYTTEPRG

GFGMISPGITSRFEVFYDEGCSDMRERLQG*

 

>CYP578B3  Aspergillus flavus

100% to CYP578B3  Aspergillus oryzae

AFL2G_11839

MTSATAIAIGILLAAFVYKYLVHPYCLSPISSVPNAHFTSPISNRWIEKQRNAGKEVLTIYNLHQKLGPV

VRLGPDELSVNSLSGLKTIYTGAFEKHSFYSDVFINFQTPNLVGMIHNNPHARQKRMLSRIYSKSYLQES

RDLRDISKIILSQRLFPILRRVAKSGEAINVLPLFQAVGMDFTSSYLFGTKNSTTYIFHLPEWQQWLEEY

EKFKYMSVQDRYMGFIESWCLSLCRKVENNDQPNDVPIATNAVVYNQLRQSLEKDPDSRPLELAIASEVL

DHLVAGHETSGITFTYMMWELSQHPELQAELRRELLTLTPNLRSLPISDNAVDLPSLPSPSAIDALPLLD

AVLRETLRLHSPAPAPLPRVTPASPTGVSIEGYHNLPAGVRVSSSSYSLHRIEEVYPQSSDWLPERWLKP

EPGKIHDMRRLFWPFGSGGRMCLGSNFALQEIKLVMAAVYTNFTTSIVDDEGIEQDHAFISLPTGRKLML

RFTPIKEA

 

>CYP578C2 Aspergillus flavus NRRL3357

AAIH01000684.1 100% TO A. oryzae

AFL2G_02113

1413 MAGSPIVAISAIVLTITLLYKCIVYPVFLSPLSKIPNAHWTAPISPAWMLWKRFRSQNNR 1592

1593 TIQAAHERLGPIVRLSPSEISINCVEGGIKTVYTGGFEKHEWYPRVFGSLG (2) 1745

1816 TVSMFTMISSKPHSVRKRMLSNIYSKSYLQSSPHMRLISESILFDRLLPIIQEAVSSDAP 1995

1996 IEVHDLNQGLTIDFVSAYLFGLANGTNWLQDAPFRRRMLHYYQGRKPYEFYHQEVPNLVS 2175

2176 WTKSLGIRLIPRWCDEANEMLDAWCLDLCDKAEQCLQSTEVSVEPVVYKQLQQAMIKQSS 2355

2356 QKENTDESLKQQRLDIACELYDQLTAGFETSAVALTYLFWELSRHPDVQEELRAELLTLE 2535

2536 PKILFPRSSASRGLPQAKAVDSLPLLEAIVTETLRLHAPIPGIQPRVTPYPSCTLAGYSD 2715

2716 IPANIRVNAQAYSLHRNPDVYPDPETWQPKRWLKGVNSDSDLEERRRWFWAFGSGGRMCV 2895

2896 GSNLALQ (1) 2916

2975 EIKLVTAAIYSNYRTSIVDDDNIEPIDAYTVKPRGDKLVLKFEAA* 3112

 

>CYP578-un1  Aspergillus flavus

99% to CYP578-un1  Aspergillus oryzae

MTQWIALLLVAICG

YLALRLRSSSLSKIPAAHWSARFSPIWILWKRYTGKELHTLVDAHQKHGSIVLVGPQD

LSVSCYQDGIRRVYDSGYPKPAPFYSMFNYYR ()

QQNAFTSLDRSEHGLRRRRTAALYSKSAL

1613568 MQSQHLRDITRSITYDRLLPKLNSVAQGNGRIDGLDLSYCICVDYLSSFIFGYSNGTNYLSQPKSAIDVW

RFHYENLTCQESFFVQETPSLYKLLRYISIDLLPRKYTESADFLGRWMSDMASKADRATDRKRSTGLPLA

LEDEPVVYDMAKEAVRKDSPHLSEGDQRKQVASEMFDHIC (?)

LVLGYAFWYLAQHPDAQQRIQTELNSQGID

MRSRETVTNSSKRPRAVELDSLPYLRAVIDECLRMRPTSTPLPRITPPNRKVSVAGIDGIPPGTRINTFQ 1614560

WFVHRDPQKWDNAHDWNPDRWLTRGNTDNKNEREDVLWAFAS

GLRMCLGNNWTYY (1?)

LTTLNSTAMQHILATICSSFNFTALPREENQCWPGSPEDELPIRVCLRN*

 

>CYP584E4  Aspergillus flavus

99% to CYP584E4  Aspergillus oryzae

73% to CYP584E2  Neosartorya fischeri

AFL2G_08031

MIMNSSHYPVALLAGA

VVFLVYTVTALQRKYIQYRIARANNCQPVHCQVNKDPFLGLDSIHNNLDAAKKHVLLERSRSRF

REFGNTFRARRLRTPIIVTCEPQNIKTILSLKFKDYGLGNRIDAFGPLLGHG

IFTTDGDHWAQSRAMIRPNFVKDQVAHL

DIFEELMADLLALIPTDGTTVDLQDLFFCYTIDSATEFLFGHSVQSLKKRLSGVKLDDNDFASSFNYAQDAIAKNTRLGP

LRHFFRDTKAEHCNQVCHKLVEQFVEKALKYRANYDEEKAATDDDKKQRYLFLQGLAQQTGDPKRIRDELMNVLLAGRDT

TASLLSNMFFMLAKNPRIWNKLREEVASLEGRAPTYEQLRNLTYLKYCMNESLRLHPVVPSNARFAINDTVLPVGGGPAG

NAPVFVPKGSIVAYSVYSMHRREDFYGPDANEYRPERWADLRPSWEYLPFNGGPRICVGQQYALTEAGYVTVRLAQQFSV

LESRDPGPWEENLTLTLCSRNGTKVALRH*

 

>CYP584E5  Aspergillus flavus

99% to CYP584E5  Aspergillus oryzae

AFL2G_11341

MELLPKLVILLLAALGIASVSIRRFLNRRQFARRCGCQPVARSFSKDPFLGLDTIPGTIRAIRQHRVLGRSCEIFRAYGN

TFTVKELHQSAIVTIEHENIQAVLSLNFKDYTLRHRLELFMPLLGRGIFNTDGQHWASSRALIRPSFAREQVANLSLLER

LMQDLFVLLPRDSTTVDLQELFFRYTIDSATDLLFGQSVGALKKSQSGLAFADALQYALKAIPVRDMLGPLNAVYRDRKA

DECNRICRDFVQQYVEEAVYAAGPKKEEKESRTTETKRRYILSHKLASRTSDKQRMVDELINVLLAGRDTTGSLLGNLFF

MLAKNPVIWAKLRAEVAVLQNRPPTYEELRGLRYVQCCVNE (1)

SLRLHPVVPTNKRKAMRDTVLP

RGGGNDGLSPVFVPAGTLVGYNIYAMHRRTDFYGPDAKEFRPERWEDGKLQPRWGYLPFNGGPRICLGQRYALTEASYVL

VRMAQEFRGLESRDPGSWEEGLVLTLCPRNGTKVGLIP

 

>CYP584G1  Aspergillus flavus

99% to CYP584G1  Aspergillus oryzae

AFL2G_07147 revised gene fusion

MAVSLSFLTYLSLIVAGVYLARKISRAVQ (1)

IRQFKKRHGCLPPPRDHHKDPVLGLDEVRSMLRVFREDYLMEYTLEKYRRHGNTFATSVLGDDDIFTAEPENIKTIL

AVKFKQFDLGETRRRTFHPLLGDGIFAADGPQWEHSRTLLRPSFTRTQIAATDLHERHIQRLISRIPRDGSTVDLQELFF

NLTLDTATEFLFGESVESLRLGSSAGSSSFAHHFNVAQDEIAFSMVIAPFDQLIFRPRFRESVRVARGYVGNFVKKAIEY

RHSLDAEKHAGDTTDSQSRYVFLEELAKETDNPSDITDQILNILLAGRDTTASLLSMVFYNLARRPDIWDLLRSEVATLG

GKCPSFEELKQLKYLSWVINETLRLYPVVPSNSRTANEDTFLPVGGGPDGKSPVFVAKGQRVAYDVYVMHRRHDIFGPDA

EEFRPERWETIRPGWGYLPFNGGPRICLGQQFALTEASYTTVRIVQSFKEITSRDPEPYRERLALTLASRHGTKVAMVPV*

 

>CYP595B1  Aspergillus flavus

99% to CYP595B1  Aspergillus oryzae

AFL2G_01662 revised

MLGQIFSSVFAWTLIAILAGLYRFTTKQRPIFPVVNDYRGDFFRRKAYREYNQNAKKLIVDGLAK

HGSPITLRVPDGLKIVLPSALSEWVKTNRDLDHQELIREEYFAGFPGFEAQDTLHAPDGMLIKLLRTNLSQNEEIVPTVN

RHIGPALQHYWGDSGIWHTIDWEDDTTGIISRAAASIFVGPEKAADDEWQTVVQAYVREYFAAVSELHTWRASLRPIVQW

FLPHASACRRLLHQSRAIMQEVVRKREREAQAAEDQGLVAPRYNDVLAWTMQVPDNKHPAGDIQLALAMAALFTTTELFK

QILINIARHPELVEPLRKEIKTSLLGHGLGLTALAKMELLDSVMKESQRQIPVTVGLERKVIRDTSLPDGTKLPKGSHIM

VDATDMWNPEVHVNPEVFDGYRFLKRRHAGDKASQFVQSSREHIVFGGGRHICPGRFFAGTELKLCLAHILLKYDIRLKE

GYYPQPMVLGVYAIVDPMTQLEVRRREHTEDLVF

 

>CYP613C1  Aspergillus flavus

99% to CYP613C1 Aspergillus oryzae

AFL2G_07286

MDCFSLDGQMLWILVAVVVIVGISSPFTRRITIEILSTILDRYLRSRFPIFSVDGSRTLPTCPYKWPNGQGDVAKFLQGI

ENRDLWEKEHGQIYRIWSGMKSEVVLTQPSHLQAVFRDSNKHSKAENNNSGYLMSELLGQCVGLVSRERWRTLRAVTEIP

FQHDKMPSYLELIQRHTRHHFDRLLASGDLRQERIHPAQDLKMLPFWVVAEIFYGECDAEMKTELQQLCVLREDLFKRMI

QGGIVRWQWSKYLPTATNRALAEFQRRWRAFNQRAYDRACQQQRILPIVLMIEAVREGSTSVEQIYQTIDEALFANLDVT

TGGISWNLVFFAAHSDIQERVRQEVLSATDHDAYLLSSSTLLAACISESARLKPLAAFTVPQSAPTDRIIGGYNIPAGTN

LVVDTYALNIRNGFWDADSQCYRPDRFLEHRATELRYQYWRF

GFGPRQCMGRYVADLVIRTLLAHLVAHYELGWVEPDPGKNSTWQRDLESWITIPDLQLRCVQRRND

 

>CYP613D1  Aspergillus flavus

99% to CYP613D1  Aspergillus oryzae

AFL2G_01551

MGFFIQHGLTKPEILYPFLFGIFAVASLCIATLLFPASFSAASRVISWVLSIYLEVKNPIRHTETGRNIPGPSYVWPNGQ

GDIEKYVQGRSRSEQWQRKYGNVYRIWAGMTPEV

VLTRPEQLHAIFKDSDKHTKATNSDSGYFMSRILGQCLGLMAGPRWKLLKGIAAPPFMHPTAVRSIGRIQEHVRA

HFHDLETNGNLREGRIHPVQDLKMLPFFIVAEANYGSLTPAMKSELDSLAPARENLMKFVLFGGLARFNISRFFPTEANR

QLRRFRSQWRAFNRAAYERAREKHPSAMVVQMYDAVHKGVLTEEQVAQTMDETLYANLDVTTGGLSWNLVFLAANPACQA

RLHEEISALTPAEEEGYISRNGTYLAACVLESSRLRPALPFTIPQSAPTERVVDGYRIPAGTNYVVDTWGLNVRDEFWAP

DNSTYRPERFLNSSNTDLRYHFWRFGFGPRQCIGRYTADVVIRAILLHLVKHYELQMLEEGDFTQDPECWITHPDLQVKCVRRT*

 

>CYP617D4  Aspergillus flavus

100% to CYP617D4  Aspergillus oryzae

AFL2G_02761 revised

MMGLPWATVYIVIAGYAIAKSTFGNFILLSILVSLLKVFYNWVLYPDFFTPIKKIPSPPGRSWITGNSDTVFLEAPYEHM

RKWLENVPNDGLIRYYVSINLERILPVGPRALKEILVTKSYDFPKPEFIRASLKRLAGEHGLLLVEGDDHKKSKKNLLPA

FAYRHVKEMYPIFWSKSIEMVRVMDEDLRKKADPTDNVLRMGAYASRAALDIVGVAGMDHDFQSLRDPNNKLVRTYQNLM

SEPPLYMKIIFLLTLLLGDPAVVHDLPLERNRSIERSSETIRDVARQMIRQKRAKWESGSSTAEDIDIVSVALRSGNFTE

EELVDQMMTFLGAGHETTSTA

LQWCVYVLC

KHPDVQTRLREEIRANLPPISTENPQPPAATDIDNLPYLNAVCNEVLRYHPSVPATIRCASRDTTIIGEP

IPKGTLFLIAPEIIGKSKELWGPDADKFNPERWLGPGRANNGGADSNYANLTFLHGPRSCIGQGFAKAEL

ACMVAVVVGKYHMELKNPNAPLEIRQQATVCPKDGVLAKFTNIEGW

 

>CYP620E5 Aspergillus flavus

99% to CYP620E5 Aspergillus oryzae

AFL2G_00089

MPLPTLGSVLLGLAFLYFVKIMLLRKKTLAPLPPGPKPKPIIGNLRDLPRPGQQEWTHWLKFKELYGPISSVSMFGQTIV

ILNDHQAAFDLMEKRSVIYSSRPRLVFAAEIVGWEDVVTLQGYTNRFRSYRKAMHRVLGTKELMSRFNPLQDVEVRRFLL

RILQKPDELIQHIKTEVGAVILKIAYGYNIEPHGRDPLIDLVNESMENFSAVVKPGTWLVDVIPLLKYLPTWFPGAGFKR

TGYEWRKTLLATIEKPYQLVKQHMRQGSYPPSYLARLLEQIDGEPTAEEELVSKWTAGALYAGGADTTASSLSSFFLAMA

LYPEVQRKAQKEIDRVVGPNKLPTFEDRDTLPYIDAMVKETLRWHPVGPMGVAHLVTEDDIYEGYLIPKGALILPNIWGF

THDPKIYRDPETFRPERFLGDNPELDPHTLAFGFGRRICPGRLLADATIFLTIVQSLTVFNFSKPEGEGDLKAEFLPGVI

SHPAPYRLEITPRSAAHEALIRSVEVEHPWEESHAKELEKWSVNG*

 

>CYP620G1  Aspergillus flavus

98% to CYP620G1  Aspergillus oryzae

AFL2G_07111 revised

MYTLSTLVLLGGILGLYVLLNSKAPRAPLPPGPKGLPIIGSVGSDLPRGGKDWEHWLKHKVLY (1)

GPISSITTAGHTHIILNDANVATELLEKRSARYSSRPRLVMANEL ()

SGSDIFVTTQNEHAIVRALRKRILSQLRSEEALLSFYPQVDTLI

RRFLLRTLQKPEELIGNIKT ()

GIGGVILKVVYGYTVEFH

DRDPLVDLVGETAVAFGRINQPTGYLVDSIPA (1)

LKYLPSWFPGAGFKKEAREYRRGFDTLLNWPFTFARRQMEEGNYEPSF

VSRLIEQRGSLLSLEEEVKIKHAAAAVYQAGYDTTASTITSFFLAMALFPAAQHKAQEEIDRVVGARLPTPEDRGKLPYV

NALINEVLRWNPVAQIGIMHAATEDDIYEGYLIPKGAPIVPNIWAIAHDPDVYSDPMSFKPERFLASDGHTPERDPHTLV

FGFGRRICPGRPLADFNNFLTIARSLAVFQVQKATKDGKEIDPIVDY

QGGIIGHLSPFEVSIRPRSAEHEALIRSIEVEDSISRGDTATESVRV*

 

>CYP620H1  Aspergillus flavus

99% to CYP620H1  Aspergillus oryzae

AFL2G_02999

MMLVVSLLLGLTGLYIIRWTLGERKTLKRLPPGPTSKPVIGNLLDLPSPGTPDWLHWLKHKELY (1)

GPISSVTIFGQTIVILNDRQTVIDLMEKRSGLHSSRPQLPIAEI (2)

TDWDDTLGLIPYNSRFRAYRKALHQEMGTPASILKYHDIIDMETHRLLFRILENPEDLVQHIRK ()

EAGSIILRVGYGYV

TEPHARDPLVDLVDKAMEDFSQLVLPGAWLVNFIPMLKYLPSWFPGNGWQETAKAYKKRVTAMRDVPYTFVQRQIKKQNH

VPSYVSSLLEQGNVEPGSEEEIVAKWSAQSLYGGGAETSVSSLACFFQAMVLNSNVQKRAQEEIDRVVGTSRLPDMSDRE

NLPYINAVVKEVLRWHPVTPLGVTHAASEDDTYNGYFIPKGSILVSNIWAIAHDPELYHDAIEFKPERFLGVNGRTPEYD

PHLLSFGFGRRICPGQHLAAANLYLAIARSLAVFDITHLVKNGKEVPVTPEFTTGIISHPAPFELSIRVRSPEHEKLIRA

VEKSYPWEKSHAEELQLKI*

 

>CYP620H2  Aspergillus flavus

99% to CYP620H2 Aspergillus oryzae

AFL2G_09608 revised

MLVLVSLVLCLTGFCLLQWALKERKIVKGLPPGPRPKPIIGNLLDLPPPGALDWLHWLKHKELY (1)

GPISSVTIFGQTIIIINGHRVANELMEKRSGVHSSRPHVPIAEL (2)

AGWQYTLGFIPYDSRLRAYRRALHQEMGNATSISKYHNILDMETHRLLFRILKTPDCLMQHLRK (2)

EAGSIILRITYGYITEPEAYDPLIDLVDKAMEDFAQVILPGGWLVNFIPM (1)

LKYLPSWFPGCDWQRRAKAFKQRAKAMTDIP

YAFVKQQHEQQKHIPSYVSRLLEQNNIKLGSEEELVVKWSAQSIYGGGAETSVSVFACFFQVMALHLNVQKKAQEEIDRV

VGASRLPDLSDCKNLPYINAVVKEVLRWHPVAPMGVAHASSKEDIYHGYVIPKGAILVPNIWAMAHDPDFYHNAMDFEPE

RFLKSGRNEQNPEYDPHQFIFGFGRRTCPGQHLVSANLSLGVARVLAVFNITNAVRDGKKVPISPEFSPGVISRPAPFEL

SIQVRNAECKRLIEAVGMKFPWEESHAEALAQLRI*

 

>CYP620H4 Aspergillus  flavus

99% to CYP620H4 Aspergillus oryzae

AFL2G_06042

MASLHLASIAIGVLTAYLVTKLLTFKKPPAPLPPGPPPKPIIGNLKDLPQNGERDWEHWLKHKELYGPISSITVLGQTFI

ILNDQKLAVELLEQRSKWHSDRPKMFFAAEM

SGCGGILGLIPYSDRSRAIRKAMNKEIGSKVAVSRFNALQEAETRRFLLRVLEAPEELRNHIRT

EAGAVVLKLAYGYTVEPHKQDPLVDLADVSMYYFSLVCRYGAWVVDVIPS (1)

LRFLPSWFPGTEFKRIGQRSKEAFDNFGGKPYNFVKHQMSQGTHHPSYLSSILESEEIEPGSEKEYVTKWSAASIYAGGADTTV

STMASFFLAMALYPEAQRKAQEEIDRVVGNSRLPTFADRDNLPYINATVKEVLRWHPVVPNNLPHLSTHDDMCQGYFIPK

GSIVISNIWGFAHDPDVFHDPMTFKPERYLGDNPEPDSHRISFGFGRRICPGRVMADAAIYLNIAQSLAAFNIGKKVVDG

KEVEPRVEFQAALISHPEPYDVSIKPRSSVHEELIRAVEEEYPWEKSHADELVNIKV

 

>CYP620H9  Aspergillus flavus

57% to CYP620H7, 98% to CYP620J1 Aspergillus oryzae

AFL2G_03370

MSYMVLGLAIGVIFLYFIRSFLARTKSFAPFPPGPRPKPIIGNLWDLPPQGTRDWLHWLKHKDLY

GPVSSVTVFGQTIIILNEARLAYELLEKRSAIHSSRPSCTFAHM

AGYGDIMTILEYSERLRTTRKVAHQQIGSNKAISRFSHIQDAEVCRYLLRMLR

DPGNWLEHIKKETGAVILKITYGYTVEPHGRDPLVDLAEDAVGKFSLAMVPGAWLVDSIPI (1)

LRHLPSWAPGGGCTRAAE

GFQTAARNLGNVPYAFTKQQMAQGSNVP

SIISYYLESENIQPGSEEEHLVKWATATLYGGGADTTVSTMMCFFLTMALYPHVQRKAQEEIDRVVGATRLPGFEDRENL

PYIDALLKEALRWHPIVPMGVAHMAMEDDMLEGYRIPKGAAILSNIWAFTHDPNEYHDPMTFKPERFLSDNGHTPERDPH

LLAFGFGRRVCPGRNLADSNLWLTIARTLAAFNIAKPIRDGKEVDIQPEFQAGLISHPEPFDVDIKPRSAGHHELILAGE

KQYPWEESHAEELRRAIAVL

 

>CYP620H10  Aspergillus flavus

99% to CYP620K1  Aspergillus oryzae

56% to CYP620H5, 57% to CYP620H9

AFL2G_05207

MESILLFLTISLVGLYLVGSHLSKKHSLGHLPPGPPRKPIIGNLTDLPSHDVCDWEYWLKHKDLY (1)

GPISSLSIFGDNIVILNDARFARDILEKRSSIWSSRPSWNFAKM

AGWNKILGTLAYSDPSFKDMRKAIGHQIGSKTAASRFNAVQDLEVRRFLLR

VLEDPDNLLQHIRKEAGAIVLKIAYGYTIEPHGHDPLVDLADEAMATFGLAILPGTWVVDFIPILKHVPTWFPGAQFARM

AKQFRKSAAAFSDVPYAFVKRRLAQRDFEPSFLAGLIRKNEEQPGPGSYEETVIKWAAASFYGGGSDTTVSTMSSFFLVM

AQYPDVQRKAQAEIDCVVGPDRLPSFQDRENLPYINAMVKEILRWHPVLPMGTAHASVMDDTYEGYTFPKGTLMVPNVW (2)

AFTHDPSTYPDPHTFKPERFLSYEGHEPEANPYYLVFGFGRRVCPGRTLADANLYISIAQSVAAFTITKPIRDGKEVDLRA

EYQSGAISHPVPYNVTITPRSPRYEELIRAVETEHPWEKSHSEELRLV

 

>CYP628C1  Aspergillus flavus

98% to CYP628C1  Aspergillus oryzae

AFL2G_09748 revised

MDTLWILAFSSGVATHLLLYRSGEWDIKAPRIVKIYTLLGATLVYLERADLLDGFPVSTRPKWGIAVILYHIFGVYASML

FYRAFWHRLCGFPGPFLARLSNFYVTSLSAKRLHLYEEVQKLHQQYGDYVRL

GPTELSIADPQAVKALYSGQAKVTKGPWYTVLEPRVSLQMSRDKKEHARRRKVWDQGFSSK

ALRDYEPRVSHYAKQLLEAVRKNVGKPM

DMAKWFNYYSFDVMGDLSFGKSFNMLAGGQDTYFSTQLHADMKSIGLFSHLTWLFPFFKRIPILNKDYLKFWDWVGGRVE

ERIKNDPDRPDVFSWILDAFQNGPKTKQDHLDLHGDAYLIIVAGSDTTAATLTNLFFHLVVDHTWQAKLQEELDALPELT

QEKVTGVKLLDALINETLRLHPAVPSGTQRLTPPEGLQIGDKYIPGDVMVCIPTHTLFRDERAFVRPDEFLPQRWMTQPE

LVKDASVFIPFNAGPYSCVGKQLALMELRRVTAEILTRYDVEFAQGQTTEDFLDG

KRDTFTLVTAPLKLVFRER*

 

>CYP630A3 Aspergillus flavus

98% to CYP630A3 Aspergillus oryzae

AFL2G_05913

MTGIYVLAAASALALGVGYVVILPIIYYFYDPKGFRKYPNFAPLAGITDLPYCYLSSCGYRSKDLYEAHKNAPILRIGPN

NLSFGRIGAVKDIYGHNTPCIKDIKYAMTWGSHTHLFDVIDKADHAAKRKRMSSAFAIKNLERWEHKVANVTGRLVKALD

AHCTLPLLPGQTEPQAADVTLDYNKWINLFTIEAINLIALSSTLGLLEKGSDEVTAQRKDGTTYPARYRKSQDSTAHAQS

LFVWDYKYFHWLSRLSKLVPKYRQMWKDGEPWGDVIYHQAVTRLQRYQSGEKLDDFFSSLMEDKAGHPNNLEWGEIVAEV

GAIINAGADTTAIALTQVLDMLIRHPKYLQRLREEVDSTLDADEVVAPYDKVKNLPFLRACLDEALRLIPPTSAGLPRRT

PPEGAQILNEWIPGDTSVSMTSYSAHRDPEIFPDPEEYNPDRWMDLDNRKRMEPYFVPFSTGARGCLGRNITYLEQTVVL

ATLVHRYDFAVPANWKLGRFEAFNLIMGEMPMKIWRREKA*

 

>CYP630B11  Aspergillus flavus

100% to CYP630B11  Aspergillus oryzae

AFL2G_11866

MYSLLLIVTLHFLLIYYIIIPIINYFRDPKGLRKYPNLTFVSGISDLPLIYYSHKGIRSRVLFEAHKKHP

VLRIGPNKLSYADPVAIKDIYGHGTKCTKDVFYSALSGSHYHLADVVDKEDHARKRKVLSNAYAIKNLEG

WEYKVADMTQRIIKAFDERCTSPLPKGRNPDPQDLTIDYRMWTNLYTIAAIANIGLSEDIRFLDQGNDII

SSEAKDGTVKKVHFRDCLYANASATSTLVWAYDWYEALVRVSKLVSSTYRQKWKLAEDWDGIVNNRATTR

WKRYEKGEKLDDFFSALMEDKAGAPNNLEWGEIVAEVSIMMNAGSDTTGISLNNVMLLLLKNPHCLEKLR

EEIDGVLEDDEVIAPYDKVKHLPYLRACLDENMRMYPPVSFHVPRRTPQEGTMIRGEFVAGNTSVGISAY

VVHRNEDIFPDPDTYKPERWLGDKGRDLQPYFVAFSAGARGCIGRNISYLEQTVLLASLVHRFEFALPSP

SWEPVRHETTNFNSGPMPLKVWRRASRVYEDN

 

>CYP630B12  Aspergillus flavus

100% to CYP630B12  Aspergillus oryzae

AFL2G_05615

MWSALSIAPYALVLGLFSLLYFVVFPWVEYIRDPKGLRKYPNMNPFSGMSAVPFMLLASRGFRSKELQELHRTKPVIRTG

PNMLSYGDVRAIKDIYGHNTKCIKDPSYIVTAGTHYHLADVVDKPDHARKRKVLSSAYALKNLETWEHKVSDKVEKVVAH

FDKVCTAPPSAAVAAGKMAPDPKDLTVDFRAWTNFFTLDAIADIGLSEKLGFLDSGSDVCIAERKDGSTYEVNLREALYP

TARKQSLILWNYEWYPVLNKMVNIIPFFNRMQNSSDNWDNIVWRRSMNRLRRYEAGEKLEDFFQAMMEDKNGRANNLEWG

EIVAEMNIMMNAGSVTTAIAIANVMYQLLRNPQSLKKLQEEIDAVLDADEIVAPYDKVKHLPYLRACLDESLRIFPPTSH

GLPRETPPEGMEILGEWVPGNTSVSMSAYVAHRDESVFPKADQYIPERWLGEEGKALQPYLIAFSAGARSCIGRNISYLE

QTKILATLVHRYDFALPYPGWELKRLETMNLILGDMPVKVWRRNVQEA

 

>CYP630B13  Aspergillus flavus

99% to CYP630B13  Aspergillus oryzae

AFL2G_08530

MLSLVLAAPYAAVGGLCTLLYFFVFPFIEYIRDPKGLRKYPNLHPISGMSVLPFMFMASRGARSQELSELHKKSPVIRTG

PNTLSYGDVRAIKDIYGHNTKASKDPSYIVSAGTHYHLADVVDRADHARKRKVLSSAYALKNLETWEYKVSDKIERLVKH

LDKCCTAAPVSGGRAFVPSAEDLTVDIRAWINFFTLDAMADIGLSEKLGFLDKGNDICVAERKDGSTFECGLRDALYPLA

IKQCMVLWNYEWFPIINKLVDVFPYFRNLQKKGDAWEHIIWRRSSERLRRYEAGEKLNDFFQALMEDKNGRPNNLEFGEI

AAEVNIMMNAGTVTTAIAITNVLYQLIRHPEAMAKLREEIDGVLGPDEIVASYDTVKHLPYLRACLDESLRILPPTPHGL

PRQTPPEGMEILGEWVPGNTSVSISAYVAHHDESVFPQPHKFIPERFLGEAGKELGPYFITFSAGARSCIGRNISYLEQT

KALATLVHRYDFALPYPDWEPKRFESMNHILGEMPIKIWRRSFDG*

 

>CYP630D1  Aspergillus flavus

98% to CYP630D1  Aspergillus oryzae

AFL2G_03294

MALEKLFIVVFLCFALRPLLLYFYDSKKLRKYPNQNFLSGVTNLASIRERQRKFRTRELYLQHQKHPIIRVAPNMLSFRD

VKAIKDIYGFGSPCQKHEMYKLQNGEGHMNILNVIDREDHNRKRRMLSHAFSTKNLESWEFKITDKVEKLVAQFDRRAHP

PAWKNEPSQPNNITVDVRYWFNLFTVDAIADIALSERLGMLESGSDVVKVGGPGEEDSAHRFIEDVHEAARVKSKIIGTL

DWYYVLKQVSSFLSSRCRSQWDCGGNVGQIVEHLAGKRLRRHEDGENIDDFLSCLINDKAGKPRNLAIGELKAETSILLD

AGSETTAIALTHLLYYLIKNPDCFVKLRKEVSGAIAGDKVARYAKVKSLPYLKACIEESLRLSPPLPRGLERVTPAAGAY

IMGEFIPGNVGVSVPAYVAHRDPDLFPEPEAFLPERWFNNENIGKMRDAFIPFSAGGRACIGRNITMIEQQILVATLVHR

YDFSLASPDWTLQNEEAFNLWPVELPVKIWERDLEA*

 

>CYP630D2P  Aspergillus flavus NRRL3357

           GenEMBL AAIH01000541.1 pseudogene

           same gene as Aspergillus oryzae BAE62696.1,

           97% identical

           runs off the end

           AFL2G_08101

418 VQTTEYSRSLQEHGKDGCFDSTIFDSVLRSFAEIQEGSNLKVQTENLVDEAFAI

MFAGSDTTALSLTITLVYLCKYPEKMVKLRREVQCLRDFKVQDIQLATISQMPYL (0)

DAVIREANRLSSPLSTVLPREVPSTGCVISGHFLPKG (0)

TVVGFHLDDINRNPKFFPEPNDFIPERWSGEEGKKLQRWFVPFSKGSRRCIGMDFAF

VEMKLAVAAIISRFEIWLDNPNVTLNSREMFVKIPEDDLRIRLRAITV* 1301

 

>CYP631B2  Aspergillus flavus

100% to CYP631B2  Aspergillus oryzae

AFL2G_12402

MLILLGLLCLYTGLYVARTYWRLRHFPGPL

VARFTDLGRLWWVKTSRSHHHHMGLHSRYGQYVRLGPNMISISDPDAIPLVYPIRPGVPK ()

SDFYRSMMPYTRKGRSLPLVFNTRDEDLHKRLKTPIAHLYSLSNILTFEAFVDQVLEILFRQFEERFVPDQAPFNLGNWLQYFAFDV

MGTMSFSRRYGFLEKGRDDTGLLSAIWAFMKAAAPVTQMPWVDLVWNKNPFIALFRATPAQPILNVVLSRINDRRNELYS

TTSTPEKVNERDFLSRFMHIQSNSDTIPPWAVTAWSFSNVIAGSDTTAVAMKTLWYNLLLHPATMHRLRKELVQAQQQSK

LSHPFPAWNEISGLPYLNACVNEALRIHPPFCLPFERIVPAEGMTIGDHFFPGGTVIGMNPWVINRHRPTFGEDADAWRP

ERWLEDPARTRQMENTLLSFGAGRRVCLGKNIALLELKKLTSALVLHYELEIVNPEKFQSQNFFFFKQEGLYAAVKRRSA

GSPELYPDDAVPH

 

>CYP631B3P  Aspergillus flavus

100% to CYP631B3P  Aspergillus oryzae

LFYNLLTHPATLQ

ALSSELITANLTLPYPKWNEVCDLPYLDACIQEAVRLHPPFALVLGRVVPAGGVTVLNHYLPEGTLVGGNPYVVNRHAET

FGPDVEEWRPERWLEGEGRKRLEQSVPTFDAGRRVCLGKYIGILELKRLVPFLVLKYDMKIIDPERFSVENGFFFKQRGF

YCNITRRKEGSDRDKADPK

 

>CYP643C2 Aspergillus flavus

60% to CYP643C1 Aspergillus niger

99% to CYP6343C2 Aspergillus oryzae

AFL2G_02642

MSNIANMADGLGVPVLKTQGASILITLVIGIGTLHIVRSIYRRHFHPLSQFSGPPEAALSTKWLYKTNQAGFPEHEFERLHEKY

QTKALRIAPNELHLSDVHQYKVIYSQSKPFLKDPPFYSSFNIDHSLFAETDPALHKERRKMLNPLFSRAGIFKLEG

VIHTKAGIMMKKIDRLREKHLINVYDAFR (2)

CLTTEVIMEFAFARSANMLEEEESTFDSWFLRAFDSVASDIWTAHEWPVLR

RIGSCLPKSIVKIMNKKVASFFEVIN (0)

FAESCMNYYEKHGNTTSHPVVFDHLTSLSYPQKITEAMDILIAGADTTASTLTA

ALLHILADKKIQTKLVQALQSVQPNEQGILPLMELEKIGYL (0)

TACVKESLRVGMPVPGRLPRIVPDNLAQPFTVDGKIIPP

GAVISMSAYTMHYSEELWGSDARSFNPERWLQPDSKNLDQYLCTFSKGARMCIGQN

VAFAEITIVMAYIFQNYKLSLPSDFQRPKQKDLFTMEYGKPGLPVKFEAVN*

 

>CYP653B1  Aspergillus flavus

99% to CYP653B1  Aspergillus oryzae

AFL2G_09894 revised

MDYMDYLKEMGLARHWVPIFVGLLAFYFIMERSTANASRTSLPIVKHFKLLPPFFNRILYVVKAPFLIYYGYEKYKSKPF

RILKLDGDLVVLPQKYLEEVGGLHSRQASLVGAKYK (0)

NILGGCTNILINSELPARTVSEKLNPVL (1)

DRQIPRLL

FELHHAFSAVVPYCEGRYVPINLYHMILKLVTHSTSRIIIGQRLCRSEQWINTITKCTYDVRIAVKQLQLVPRFLRRLAA

PFLPSVQRLETQLRWIAEQLILPMIQHRRRRELNDPSYKKQEDFLQWMMDLADNDLDRDPMNLAYGLMITMALAVVQTST

MLITHAMYDLMVHPEYLEPLREEIHETLTNGWIRASLSDFGAQRRLDSFLHESQRLNPPSEVSAQRVLGRPLTLSDGVTL

PKGTHVCFPSGPMSRDPTVVPDPLTFDGFRWCKDLNAPDGSLTDVSPANLHFGFGGQACHGRFFGAVIAKAVMSRLLAEY

DLKFEEGQSGRPENIVNGEQIMPSISTKVLIKKKNVDI*

 

>CYP653C1  Aspergillus flavus

98% to CYP653C1  Aspergillus oryzae

AFL2G_05469 revised

MDKLTATLAKINYPSEVENGSMLLVVTLVILFLWFIIPSPVKRSNVSVPTVTLFNPYLPEFLSRVWFNST

AATVIYKGYRQHKDRAFRLLKPDGDIIVLSNKYVEELRQLPLTTLNALEAVFE

DHVGKYTTILNDSHLHTEVIQKRLTPAISRLIPRI

IDELDHGFAVEMPECEDKWALIRPYEVFLRLVARAGARVFVGPEICRTEKWLTASIDFTKNIFMTITLLRPIPSFLHPII

GPMLPSSRSLDTQLRYVQDELLGPEVVKRRQRQASADPDYEKPDDFLQWMIDLAQNDKEGDPGNIAHRLLGLTSMAVVHT

SAMSITHGLYDLITMPQWLEPLRQEIQEVMPDWKSSSYSSLVSLRRLDSFLKESQRFNPPGELSFHRVVKKDLVLSDGLR

LPKGTHICMASGPIGMDTKYVSDPTTFDAFRYVDGDKAQSQFVHTSATSMHFGLGRYACPGRFFATFVLKAILSRFLVEY

EFRFGPDQVGRPKNMLLGDKIVPNTSVDVYVRKRTGSRSTA*

 

>CYP654B1  Aspergillus flavus NRRL3357

          GenEMBL AAIH01000140.1

          99% to CYP654B1 Aspergillus oryzae

          AFL2G_04897

      MDLFPRDYLFAGLAVFIFWWIIDHSRHKQRYIRNVPIVGGKANLK

      RNRQEFVTNSLQILRTGYEE (0)

      NNGELFYVPTPIGERLIIPGRYLEELKSADMAVVDFQATFLE (0)

4806  MFEGAYTTLGTHSRLLPQVVRAQLNQYL (2)

      PDVLPEIQ (1)

      FKVALQIHREIPFNAITECFAKSDWTVINVTELMAVLVARVSSRMFGGPAL  5162

5163  SQNREWIEASLRFAHDGFNAAQKLKMWPDTLKFIGQHFIPEVRSIKNTYKLAERAIIPLL  5342

5343  DEREVDKSKKAHDLLTWMYDQAQGAEKDKKFIAGTLLKVSFAAYHTSAAAPTQLLFDIAA  5522

5523  MPEHIAPLLEEYLSAPRDNNQNISVKGFAQMVKLDSIMKESQRFNPLLL (1) 5669

5722  LTFERIIKRDFTLSDGVVIPANTWIGCAAQAIGMDRKLYPDPDTFDAFRFVAKEEATAT  5898

5899  STSVPATKAHYTSANPGSMAFGYGQHACPGRFFAMMEIKAIIGEILSRFEMRLADGEMRP  6078

6079  PSVTFETQHLPHPAGKVLFKRRRRT  6153

 

>CYP655A2P  Aspergillus flavus

Supercontig 5: 1921861-1922169 -

95% to CYP655A2P  Aspergillus oryzae

QSDVVQVNKNVMHRDKDVWGEDADEFKSERWFGLRPYWDFVPHSGGPRHYPAQLLVTTEA

NYVVARFCQRSKAVENRDVNGYVPIMRAGPVDSNGVKIAVTPV

 

>CYP655B1  Aspergillus flavus

100% to CYP655B1  Aspergillus oryzae

AFL2G_07514

MFTLTEYFIAACVWLVLYKVGNLLWNRHHYFKQQKARGCGEIKHYRHRDPILGLDFVYTLSKAFKEHRWLPWQQELFAAQ

GVKTFQANFLGSRAIYTSESENMKAMSTTYWREFGLEPLRRGSGAADPVAGPGVSTVDGPMWDFSRNIIKPYFTRDGYSN

LARLEVFVNRLLDLVPTDGSTFDMQPLLQRWFLDTSSEFLFGKTVDSLTHPENVKVAKAMVDTMRGIRVRLTMSKLMFLH

RDPVWMENVKIVRDFVDERIDASLTQLQDVKSGKGTSCTENQPDGRTDLLWDMVQQLQDKEALRGQIMAVFIPSNDTTSI

LISNAIYALARHPHVYQTLREEVLALGDQEITFEKLRGLRYLRYVINETHRLYPNGIQMVRIALEDTTLPVGGGPDQSQP

IFIQKGDIVHANRYLMHRDPDNWGPDAEVFRPERWGDVRPLWKFVPFGGGPRICPAHVLVDTEASYVLLRFVQRFRTLEP

RDERPYKAIMRIGPSNLHGVNVAVKTA*

 

>CYP657B2  Aspergillus flavus

99% to CYP657B2  Aspergillus oryzae

AFL2G_03848

MGKDGLSTDGLIQNAWSGSSELVWPLLATVLVLCCIATRIISGFQSRVD

SKTEQPQSVKTLPYWFPWLGHSLSFVWDHVSFTEKSR (2)

DYMNASVFGSYMGGTK

HNTIVSPSMIKSIMQSKATTSAPLVNRALKAFGDDLGSLRDLNTTDYQVFHHKLPNLLMREPFITEASETTIQLLKREVPNF

VTFCRSVVDQTLWERGSDVEVVDDNGDKPACEANLFDLVRGFIGNITTTTLMGQAILEAFPSLLDDLWVLDNRFPLLAIG

VPRWAPLPGVPAAYAARDRILNSLAAYQQAFLQWDDGIDPGVKFRDLEDVSEPLKQRIRTSKNLGLSPRSSAPGHLSLLW

AMNVNSSNIAFWYLVRLYNDPTLLEEIRKEISPYVKAHRPSREETGFPFEEPPRISLNLKGLLDSCPLLKASFYETLRLD

SADMSFRKLTSDLTITESNEDVTNSDRTKPHSYKVYKGESLILHHGVLQNDSRYFSNPSQFDPLRFIITDPETGEKKANM

HTIHPFGGGMSGCKGRTFAERQLLAFTAAMIVMWDIEPMDGSHFTVPRHRQSSGAYLPKNDIRGKTLWNVNNHGVVQNIHI*

 

>CYP660C1  Aspergillus flavus

99% to CYP660C1  Aspergillus oryzae

AFL2G_08647

MSDIPSIIGLTLLVAFLTSVVFFVQRRKLDPREPPLVSSAIPLVGHLASFLYYGLEYFAIA SRKNRLPAFTMDMLYTKVY

IIASPE LVSAVRRSRNAMSFGPLFANVAENGGGINGRGMQLLRDKEYGGQGVGQQTADSMHPALLGSGLDQMNGKMIAVL

KTFIDELASQPDNVVDLYEWCSHAVTVASTDAVYGPLNPYRSESNRRAFWAIESNLSLLMMNVVPWITARKPWKGREQLT

QAFIQYYQADGHLDSSQLAYTRWKVQHEAGAAIEDIARLEALTALGILSNTVPTCFYFLFDIFSRPDLLGKIRDEILDGA

FSVDSAGVHTLDLADIRERCPIFVSTFQETLRTRSNSGQLRVVQKDTLLDDHLLVKAGSIILMPAAVINKHPSVWGADAG

TYDPERFSKIDPAQKRSKASGFMSFGSSPHICPGRHFASGEILALVAMILVRFDVRPVRGTWVEPKGNTKAVAASLPPAV

EKVEVKFSETSKFAGVKWEFRLTPGKGTFGLITG*

 

>CYP660C2  Aspergillus flavus

97% to CYP660C2  Aspergillus oryzae

AFL2G_07402

MSDFTTIVGLSVVAILASLLFTQRPKLDPREPPLVSSTIPLVGHLISFLIYGIGYFATES (2)

GKHSLPIFTMSILKQRVYIIASPDLL

HSVRQNRSTMSFNPLFTAMAQRAGGIQKPGLQLLREEELGGQGLAKKTVEVMRPALLGDKLDHLNEQMIHVLKHIVDQVA

SSPTLSFDLYEWCSDTLTVASTDAIYGPLNPYKSEAIRKAFW

DFESNLSLLLVDTLPWLTCRKAWKG

RERLVQAFIQFYQADGHISASSLAYSRWKAQQEAGASLEDIARLEILTGIGILSNTVPS

CFWLLFDILSRPELLSAIQDEIHQNALSIDSTGTHTLDLADIRGKCPTLLSSFQETLRTRSNSGQVRVIYQDTLLNDRWL

LKAGSTLLIPAPSINKNNSTWGSDAGDFDSQRFTKIAHQTHKKSKASGFLSFGLSPHICAGRHFATGEILALVALLLVRY

DIRPIQGSWTEPKTNAKAVAASLPPAAEKFMVTAVERPEYKGLEWRTTVTPGKGTYGLIIG*

 

>CYP663B3P Aspergillus flavus

95% to CYP663B3P Aspergillus oryzae

AFL2G_01674

MAYHYLLLHWWKRNQSINEPPPLPLSRIAGCVSLAHVLTQKKLIQDTKMEFGILNSFFALLILRVIYEYYRDRRLPPGPR

RLPLIGNIHQVPQVLPWRTFHQWSKKY

(large deletion of about 274 aa)

IRAVVEEGLRWRSIVPGGVPHAARKDDTYMSYHIPKGATIVPLHWSMSLDEQH

FDNPLEFRPERWLAEPDDDQFTNFFGYGRRICPGRHIARNSLFILVARILWGFEVRPPTGPDYQPKTVEDMDFGSAFVSV

PAPFEAIFQPRSENARRVIESEWESTEKDINTLMDSIKEK

 

>CYP666A2 Aspergillus flavus

99% to CYP666A2 Aspergillus oryzae

51% to CYP666A1 Aspergillus nidulans

AFL2G_01122

MLGIILFSLFISYTAYLGLCFLRHWSLARKIGLPYVSFPISSHNILFLSLFETRFVPYVINTWLSPKLADFIYGSAFKTR

WAARDRLHRRYGGVYMLITPSVSTCMVCDASVASQICMSRHGFPKPIKQY

GALEMYGPNIVTSEGSQWAHLRRHTATPFNERNSALVWEETIRQTKEMVQYWEDEYSRSSSASEFIL

TDTREDILKFTLNIICSVGYGVKLPFRPGLENSTESAEGLFKDAITPLPGYHFTFRSAMEYLNKHITSMFIANGLLPK

GIPRSVLPFFKKDFDAFDDIGRYLRALVSTAETKETLSQNLIDGLVRSKQKI

DKDQGLDPELTEDEILGNLFVFTIAGHETTAVSLRFALVLLALNQDAQEYLYEGIREATYDEPRNPVEWDYRRVYPKL

VSPLCVM (0)

LETLRMYPPVSGIPRWTGDSAVNITYHNQPYLLPPHVYVNVNASGLHYSEEYWGPDAAVFDPKRWDKQNTRSF

LAKNKEGGLSGPGLEYDTIHKPVRGSYIPFSDGFRSCIGKKFAQVEFVVAMAIIFREYRVMLAKSNERETEDDLRRRAEK

VLGESTAFITLSMRDEVPLLFQKRCVSKA*

 

>CYP671B2P Aspergillus flavus

98% to CYP671B2 Aspergillus oryzae

stop codon is conserved in both

AFL2G_04121

MDFISFLHQENFKEVLETDLLQLGVSAALLGVLLHITIFRTSFCVENHIYNLLGLYATVVLFLFYAYFTITVLSLMQVLG

RVALLTTLFNTSLNTSISIYRLFVHRLHPFPGPFACKPTRFYSAFLAAKNIQYNVELKRLHKQYGNFVRT

GPR*ISILRNTALPLIYGPQTGCRRSTWYGHVDVDDTKICMALSRDFNDHRRRRRAWDRAFSIK (1)

SLSVYEPRVIAQAKKLMAQVEANQGKPLDATTWSMLFTFDIMGDIGFG

KNFGNLTTGKAHPAISAIRDHMRVIAVVSHLPWLLNMLGKIPG

AAAGYQGFFKWCTDQVETKRK

SWDHDKYPQDIISWILKAFIDNDVSAPPSEPALHDDS

RVVVIAGSDTTALALASIIYFLAKHPQILQKLQAELDNAMPNGPRSWTYDKAKTICYIDDIIHESLRLRPSVSGGGYRVT

PAEGLQIDEVFIPGDVNMFVPQQLIQTDERYYKFSKEFIPERWGEKKVEWGTDKAPYFLFSL

GIYGCVGKNLAMLSLRV

AVSTLAQRYDIRFRTGDILER

CIGYIHHFSAAFASCVSPKEIVNTTPFLRLLQVFFILHISGVKVRT

 

>CYP672A4 Aspergillus flavus

79% to CYP672A2 Neosartorya fischeri

99% to CYP672A4 Aspergillus oryzae

AFL2G_10674

MVFVALYLPSGQMPEGYSPAMISYPTLVVVLFIFLVILFVQVQPKGPTIKGVQGPFLDIFCCGIATKLAFISGRSAHHFH

ALHESYGKIARFAPGQATTNTIKALRNIYGSGTGKGSAFLKTGFYKSISRRNIFTASDPIYHSSVRKLFGPSMTPGSMEA

HAGVVRECTLRLHDVINSRLESKTILSLNELLYCHSVDTVSEVLLGKPLGCLKRGKPYFWTAQLPRIFYWATIRDQFDGS

GVPTVMKWLLRRFLRKGIRLRSEEARMRLIHEQLKASHTRRDIMVEVMERAETSGLPESEIAENFSAIMLAGFHTTQNAL

CAVIFFVLTHPESHAKLVRELQGAFHSAEDISRDVVQQLPYLNAVITEALRLYPPVPLGGPRVSPGAYVDGVYIPAGTEI

CTSLFALHHNPEYFNEPYEFIPERWTEHGSRDKKEAVQPFLVGSRACIAKYFAKQMMQITLAGFFLDYEAEYVGTVKDWQ

RESRCYAFWELPDLKVKLHQRRQA*

 

>CYP673C1  Aspergillus flavus

99% to CYP673C1  Aspergillus oryzae

AFL2G_09403 revised

MTLLQNIVSETPLAAGSALLTAIVVAYVIYQRYLHPLAKYPGPFLASITDLWQVHQFLSLQQPYNLTALHERYGPIVRYG

PDKLSITHESAVPTIYQKSAKSMPKTEFYDAYGAAHPNVFGMRDEVMHSVRRRHMSHSFSLSYIKEMEEYLDLNIRILKD

KIRYHSEIGEVFDLKKALHYYMIDVLGELAFSRSFGVQEADDESRIPPVIEHSLLAAVTGAWPTMTMTLKRWLPYMPHAG

LRRLFAGRKACADLASSSVQRRLRDLNDGGSSVGVQNRKDILTNLIKAKHPETGERLTQTDLETEAFGFIIAGTHTTSAT

STLLFYHLLHNPDFMRKCTEEIDSNLPSLGPSETAYSITAAEASLPFLRNCIRENFRITPVFTMPLARRITDPAGVTIEG

EHLPQG (0)

TSVAVCNHAFHHNP

VVWGEDHNIFNPNRWNDPNVGAKARLLMHFGLGGRQCIGKAVATTNIYKLLSTLLKEFTFELADEQERVD

VDKGLYKGRIPKLFSVGISDLQGPLLVRARVR*

 

>CYP675A2  Aspergillus flavus

97% to CYP675A2  Aspergillus oryzae

revised 3/23/2009

MDLLGLRDRSLLGQGALVAFVTYWAVWIIYTRWFHPLAKFPGPFWASVTRAWTLLHVLHGDTEKRQMKLHAKH

GSVVRIAPNELVTSEPEAIQTLYGVRSFTAK (0)

ATLGYVRTQYYPQQRLIGVA

TDFYLAFRPPW (1)

ARFPDHFSSEGGKQHGERRRIVSHVYTMTSILQSEKY

IEKCIAVWLEKLGQMADRKESFDLWIWTRMYAYDVIGELYFSKMFGFLQAGHDHLGYIDATEDLVPVQFLAANMPTYVRG

LFMLTGILFPKVRRALRALGDLTDATNAMLKDRLAAIQSDSEDKPQRHDILGKLLVISQERGKELDFVLDDIKMESFGAF

FAGSETTALTLSGILYHILRNRSVYAKLTAEIDVAVQCNQLSTTHISYNEAIKLPYLTACIREGIRMHPITGVSFPRHAP

SSGCTIGGYYIPPNARIGVNPRVMHFNKTVFGEDADQFRPDRWIDGDVSKMDRYIMQFGMGARTCLGKNISMCEIYKAIP

ELLKSYTFELAGDEDMQTTSYWLYKPVAIDVNVRRR*

 

>CYP682B2  Aspergillus flavus

          AAIH02000253.1 99% to CYP682B2 Aspergillus oryzae

          AFL2G_04898

12469  MTLISLSLLALSLWIIIRVLVIIYRL

12547  AWHPLARFPGPKFAAATSAYEFYFDAIKGGQYTFEIGHMHKKY  12419

12363  GPIVRISPHELHINDPGFIEELYPGPGKPRDKYAYATGQFG

       IPD

       SVFGAVSHDLHRMRRGALSPFFSK  12019

12018  AAVTKLEPVIYSAVDKLISRIEEVVESTGFVDLTMAFSCMTTDIVTQYAFAESSRFLENP  11839

11838  DFTPNFHEAILAGTRMGSWARHFPILFPVLRSIPI  11734

11657  DILSRMSPETGVFLRWQE

11533  SMKKKVSEIWQDQSALPVKDKNVSPFGSTIFHELFHSDIPDSEKHPGRMWQEGQIVIGAGTETTAW (1) 11360

       TLTATTFFILDNPNILSKLRKELAATMPNRYEKPSCRELEALPYLI (1)  11136

       IIQEGLRLSFGVATRLQRINSKAPMIFRQKKTNDTIEEKVWEIPTGTPV  10925

10924  GMTAVLVHLNPELFPDPHEFRPERWFDQDGQLHRGLDKYILSFSRGSRQCIGI  10766

10707  NLAYSELYMGIGILIRRLGDRMQLFETDRTDVDMVEDCFVPVPRRESNGVRVRLSA*  10537

 

>CYP682D2  Aspergillus flavus

99% to CYP682D2  Aspergillus oryzae

AFL2G_00090

MFQFLFQPWIIALAGAGYLISLAVYRLWLSPLAKFPGPKLAALTLWYELYYDIYCEGQYTFQIIRMHEKYGPIVRISPWE

LHISDPDYYEVLYSRDSPRNKYEYYTRQFGLTKTAMATVDHYHHRLLRSNMNPYFAMTRIRKLEPLIQGLVDKLYDRLRE

FKGTGTPVALQYPFTCFATDVVTDYTMGAGFHYLDEPDFVPRWSRTLSGVAKSGVYIKPFPWLIKVFNALPESWLSWLNP

EMDLTFHFQRRCREVIASIMEEQNANGYDKVKSQFSHPTFFHDVLNSNLPPEEKSPERLWQEVQVVVGAGAETTGKALTW

TMFYLLHSPDKLQKLREELNQLDPDRTATLLDFEKMPYLTSVILEGLRLSYGLSTRLQRVAPDRALQFREWSIPAGTPVG

MSSTLMHHDERIFPDSHKFIPERWLDLEQRKHLEKYMVAFTKGSRQCIGMNLARSEILLALPKVLRELDFELYETTLEDV

TLAHDMFLPFPKMDSKGVRVLIK*

 

>CYP682D5P Aspergillus flavus

50% to CYP682D4 N-term part

AFL2G_01379

VAGAFYVLWLALQRLWLSPIAHFPGPKLAALTMWYEFYYGSFLEGQYTFRIAEMHRKYGPIVRISPY

ELHIDDAEYYETLYSRDAPRDKSLHLTGMFGAPASAFGTVDHRRHRIRRQPMNPFFSQQRIRQLEPM

LRDMVDKLCDGLRAWKDRHTPLHMYHPFNAFTTDVVVEYTMGHSSHYLDDSDFSPQRSKTMQAIVNA

GIQFRQFRWFISLFELLPR

 

>CYP682-un1 Aspergillus flavus

pseudogene 47% to CYP682H1

AFL2G_06952

DDDRSTLATLEQLPYLTAVVQEGLR

LCDPVTHRISRQFPDQPLQCRGIFIPANSTVGMTAMLTHLNEKIFPEPRVFRPERW

LGSDGKRLERYLVPFNRGTRSCLGMNLARAELVLILAAVFRQFDFDVSGVNRERDID

VSRDYILGAQARDTPGILVAVKGC*

 

>CYP684A2 Aspergillus flavus

100% to CYP684A2 Aspergillus oryzae

AFL2G_06246

MDSGFIRDNIPAIASIAVLVYVLSVVYRSQRSHLSYLPGPWYTKFTDLPLRYKVVTGQRPRYVHALHDKYGPVVRIGPDE

VDVSDISGAREIHRIGSGFLKSPWYSLLNRKDTQSIFTTTDPKFHNAHRRLLSSPMSELSLKSMEPLIDARVRLTIQKMQ

EEMKTRGVADVYKWWFFMATDIIGEITFGESFRMLEKGKKNQYVKDIEMISVIGGIRASFPILVKLATLLPLPIFKEVNA

SGNRVFGYATESINRYKRLLAENPENPKPTVFTKLYNAGEEGLPDNEIRDDAQSFIVAGSDTTANTLTYLVWAVCRDPQI

KKKLVDELAEIRDDFTDEDLRSLPYLNQVINEALRLYPAVPSALPRSVPPKGTTMGGHWIPGGSTVSTQLYSLHRDPVAY

PDPEKFEPSRWASPTKLMKDAFMPFGAGSRNCIGLHLAKIELRLATGYFFRYFPNAKLSSKYDFNDNDMEQMLFFLMSPK

GKRCLLEV

 

>CYP687A3P Aspergillus flavus

AFL2G_07246

Note first part is CYP687A like (65%),

Second part is CYP645A like (39%)

The CYP645A sequence has a C-term extension as in CYP645A1

this second part which occurs after the heme signature in CYP645A1 resmbles a

phthalate 4,5-dioxygenase reductase subunit

This gene seems to be part CYP687 (first 137 aa) and part

phthalate 4,5-dioxygenase reductase.  The P450 would not be functional.

This may the created by deletion of part of CYP687A and CYP645A genes

that were adjacent in the genome.

The second part is 46% to Saccharopolyspora erythraea AM420293.1.

This is a 7% better match than to CYP645A1

MFFTTTPSADEDFALIEDNNPDKIYEQFGQLRRKCPVAHTSQTGGFWR

LTRHDDVERAASDPDTFVSSVKAVIPSDPRGIRRPPLSTDPAAHSPYR

TALDRTLKPARLKRLAPILERHAQRELDALLKTNTVDHQDA

(deletion)

KIHYEKVRPARGVAGVVVAWDPPLAPSLRTLPHGSSTEMASSTTQNMSAKVLSLKSMT

SEVLGVTICSNTPDELPQWTPGYHVDILSQYGYRQYSLYSYPAETSFWKLAILKEENGC

GGSKWLHENLREGMDVTVRRPKNHFRLRKRPRYILLAGGIDITPLTPMLSELK

CNGADYHLIYLGRPRGTMAYVEELCRGHPTEVWTSQDGKGFDLESFVKAQEKNVQ

IYCCGPDRLINALEDACRENVVVELRVERF

NKSFHVTLGRSGRRLTVPPEKTLLEVLNQNGCGIMSTCSK

GTWGTGEISVLEGRPEHRDTVLSPEEKGKNKVMMPCVSRYLEEELVLDLW*

 

>CYP698A2 Aspergillus flavus

AM921700

97% to CYP698A2 Aspergillus oryzae = ortholog

complement(join(11445..11634,11697..11940,11996..12176,

12236..12352,12397..12508,12562..12929,13003..13119,

13172..13276,13329..13484))

/gene="atmQ"

/function="aflatrem biosynthesis"

MYRLLERTLDRFTGLVEYQPTYPFAAPTWVYLVGAILIQQLATRWYRYYKSWV

NVPVVGGHGIIGSWIAAFRWTARARSLVNEGYQKYGDFAFQVSTPTRWEVFICNDEM

VREYRNFTDERFSANAVTAE (0)

LFEAKYTVPGAAEGVHKVPVPIVAKALTWQRTRA

ATKTDPYFEEFVKELQHAFDAETKFENEDWNDLCCFATGTRIVAHLTAKSLVGYPLSR

DTELIDLFAEYGNAVPTSGFFIAMFPQILKP ()

FAAKFCSAPKISARLDRIVMDELRKREANPRSEPQ (0)

DITDWITFWSRTYPGTYTDQDIARSVVSAVFGAIHTTTQ

VLVHCLTDLAIRPEYIHPLREEVETILNRDDQQWTKEGLESMEKLDSFVKECQRFNPLDA

GSLARRATKDFTFSKGLHIPEGTFVFTPNSPVLFDEKHYPDAQQFDGYRFYRLGRVTGRPLEYKF

IAANLKYLQFGDGRHICPGRFMAADEIRLLLAHILVNYDIRPKDDGERPPNWTFKKIL

FPDMKGMVQLKRRSINISQPN

 

>CYP698A2 Aspergillus flavus

98% to CYP698A2 Aspergillus oryzae

59% to CYP698A1

AFL2G_05467 revised

MYRLLERTLDRFTGLVEYQPTYLFAAPTWVYLVGAILIQQLATRWYRYYKSWV

NVPVVGGHGIIGSWIAAFRWTARARSLVNEGYQKYGDFAFQVSTPTRWEVFICNDEM

VREYRNFTDERFSANA (0)

LFEAKYTVPGVAEGVHKVPVPIVAKA

LTWQRTRAATKTDPYFEEFVKELQHAFDAETKFENEDWNDLCCFATGTRIVAHLTAKSLVGYPLSRDTELIDLFAEYGNA

VPTSGFFIAMFPQILKP ()

FAAKFCSAPKISARLDRIVMDELRKREANPRSEPQVQ

DITDWITFWSRTYPGTYTDQDIARSVVSAVFGAIHTTTQ

VLVHCLMDLAIRPEYIHPLREEVETILNRDDQQWTKEGLESMEKLDSFVKECQRFNPLDA

GSLARRATKDFTFSNGLHITEGTFVFTPNSPVLFD

EKHYPDAQQFDGYRFYRLGRVTGRPLEYKFIAANPKYLQFGDGRHI

CPGRFMAADEIRLLLAHILVNYDIRPKDDGERPP

NWTFKKILFPDMKGMVQLKRRSINTSQPN

 

>CYP5042A2 Aspergillus flavus

100% to CYP5042A2 Aspergillus oryzae

AFL2G_06076

MGASIHAHISAAANESPITAAFVSIAACLGLIFLIIQEIFKPVGKRRSPQGKKWKLPPGPQGVPIFGSLLYLQKVREDEE

HRIHKDLAKYGEMTTLHLGSKTWILLNSKRVVSEIIAKRGSLTNGRSPMPIASGIVSRDGRSLLLPPAQWMEKRRVMHSL

LSGTAMKQYGSWQELESTQMLAEYLFQPERWYRHHYRYANSVVHRIALGERLVKSGKELAELQDVVTHFVGSIGTSLVDW

FPELDKLPRMLQPWRKHWEKLGDWNEEVYKSWWIPAREKVENGTAPPSWVRDVLLHPDTKFTGNDQEAMYVALQLLEAGS

DTTREALNIFAMAALCFPDKFQKAREEVDSQCSTTKNFRLPGIDDLGNMPYICAMIKELLRWRPIFSFTPDHVLTSDMEF

EGYNFPAGVGFVINEIPVCNECEDPEDFKPERWLDGHETDAAHGLWQFGGGRRICVGYRLAFQGLFINVARLVFCYNYEA

AGPYDSKRLNHHKTVEPFPVKVTPRSEQHTSLILEEGARLGVLEDAKRLI*

 

>CYP5042B1P Aspergillus flavus

99% to CYP5042B1 Aspergillus oryzae

AFL2G_04298

Same stop codon as in oryzae

MTQLSIETFVVFTAFGLLWLSYEYFRPGSILRRFASIRSKLPPGPPGLPIFGNMFQFTRARDAGLWGPFVSPGFLPSA (1)

ASLRQYGPMTTLHMGFQTWVVLNGP*VATDIINKHGK

ITSERPDMPIAGDLVSHGLRTVIRPTAAWTEGRRVMHHLLSGSVLRIYGNWQEIESLQMLSAYLREPKHWYAHHYRYSIA

VLYRLVMGENLSKTQDELNDYQKVTMEITLSSLNSMVDFFPRLDRWIPIYLQWWRPYWAKMGDFHHSVFKSWWDPIRDAV

RQGTANPGFVRDTLLHPDMRYKGTEEEAMYLATSVIAAGSDNTRMTLNTFIMAMISHPETMARARQQLDAVCINEDGTLR

LPGMADFDRLPYLAAMVKEVLRWRPTTPVTPQHQLTEDLEYEGYRFPKGTCFVVNGIALGQVCDNPDQFDPSRWLDGNEG

NIVHNLWAFGGGRRICVGYRVAQQALYVAIARIIFCFDLCADGPIDTRKLNHFHIHNEPFPVRVTVRSAKHEFLIKEEAE

KASTAF*

 

>CYP5053C1  Aspergillus flavus

98% to CYP5053C1  Aspergillus oryzae

AFL2G_05205

One stop codon, possible pseudogene

Note: assembly error ASGPEAKQCYARKLFEEVPKHNLTKMEI

appears twice on either side of a seq gap

revised 3/24/2009 added N-term Probable gc boundary after HFQM

MIVERVEQLFALIQGQRILSHPGWSHVNLATLIPPVVVILGLALIVDYGYMIYLHFQM ()

PPGPFPLPMIGNTHLLPDQKPWIYFEQLAKEYNTP

MITFWTGRRPTIWICDAWAADELLNKRAAIYASRPRMVVFSELGAG*SNMVN

MYYGDRWRLHRKLTHMGVGLQQVRNYRGFQNDESKVVALDLLRELREY

VNHFERYATSVVSIIGFGRRVCAYTDPIITEVIAVMQRAAELNVPGKSFPMLMESFP (1)

FLAKFPNWMAPWKHGLGNGQGRGRPFFYALAEEA

ASGPEAKQCYARKLFEEVPKHNLTKMEI

SSLAGNLFGAGSDTSSSTLVTFVLACCAFPETLPKAWEELDRVVGPHRSPTFEDESDLPYV

RAFVKEVLRWRSVAIIGGQPHAPIKDDRYK (0)

GWLIPRNTWVQGNVWAIHHHEREFPEPDRFNPERYFEESPVHRPFPVDKGYMTFGWGRRV

CSGQGLAEQGTFITIARLLWGFDIRKALDRHGNEVPVDIFDFT ()

NGLNMRPNSFECRITPCNQEIRSTIEREGLQALQDLSQYDGETKYRMSTYYNPEKL*

 

>CYP5061B2 Aspergillus flavus

100% to CYP5061B2 Neosartorya fischeri

no oryzae ortholog is found

AFL2G_12481

N-term in a seq gap and C-term is in a seq gap

SHSPMIVLHPRYMDEIKSHPHLTFDEANRK (0)

AFFGAKLPGFEPFGLDKEGIALDVINKKLTHTLGSLTISLSRESAAVLKETLPPKSDEWQSLVFAQEIPYIVARLSSLVF

MGEKVCRDKEWLHVSVNYTIDAFGAARDLRLWPSITQSLVHWFLPSTRRVRKHISVAKKIVQKEIEKRELIRQGKLLEYS

PLKPDDALDWFREVAAGRPYDMTKSQISLSLAAIHTTSNLLTNVMYDLIAYQEYIQPLRDEIVAVVKEEGCLKKTSLTKL

KLMDSFMKETQRLNPVSIASLQRYALADITLSDGTFIPKGAMLVISAHTMNDESIYPHADTFDGYRFYNKRKVPGNEHRY

QFVTTSNEHFAFGHGLHACPGRFFAANEVKILLIHLLMKYDWKFAEDRGRPQSLMHGTEIICDPNVK

 

>CYP5061B5  Aspergillus flavus

99% to CYP5061B5 Aspergillus oryzae

AFL2G_02841

MPVLATFLESHYFFQGIAVALALIFVSNFYRELADGLPYRKIPLVGRSRWEISNTKAKKLFVTSAKDLMVQGFSQGRTVF

QAMFTAGPTIVLHPRYVDELKNHPHLDFGEAVRKSFFGATIPGFEPFNNQTKEDIVIEVINKKLTHTL (1)

GQLTIPLSKETAAVLTDKLPGSDEWKPFTFAQEIPHMVARLSSLVFLGEKICRNETWLDVSVNYTIDAFNA

ARELRDLPAVARPFIHWFMPSMQKLRHHRKVAAEIVQQEIIKRDMIREGKLPEENPPRTHADALDWFREVAAGRPCDETV

SQIGLSVAAIHTTSNMLTNVMYDLTAHPEYIQPLRDEIKAIVEQDGILKKTSLTKMKLMDSVMKESQRTNPVSIAFFNRI

ATEAVVLSDGTSIPRGANVVVSAHVMEDESIYPNAKVYDGFRFYNKRQVPGNEHRYQFVTTSPEHLGFGHGMHACPGRFF

ANNEIKILLAHLLLKYDWKFADRVDRPKSFLHGTEIICDPTVKLLYKSRQPEVDLSALGEGTTD*

 

>CYP5064A2 Aspergillus flavus

AAIH01000146.1 Aspergillus flavus = AP007159.1 Aspergillus oryzae

only 1 aa diff to CYP5064A2 of Aspergillus oryzae

AFL2G_06876 revised

20049  MDFGGILLHLEA

20013  RSMATVLIAGLLVYWVGSAIFLAVLHPLAKFPGPKLAAASDWWLVYHEWFLGKSLTDILF  19834

19833  DLHQNY (1)  19807

19730  GPVVRYGPYR (0) 19701

19642  LHFSSMQAYSDIYNVKSKWDKDPEVYKAIVDTSSAFGLRNYHEAKERRDLIWPFYSRQSV  19463

19462  QRMQKAINRQ (0)

       ISFLVDQLDKQNQEGKLSNMSMAFRCLAQD  19283

19282  IMADICLGKSFGTLEERDFGSPLIHALDEGLESYVLMKSFPTLRNILYSISAMVTLPGEA  19103

19102  EFATYGTIVADHVTRGIQQPDTIPPNTMLGFLVPTSSNTAKEAPQPKLSQGHMTEEL  18932

18931  QTFVIGAGETVASAMVQGLSGILQSPDLYKNVYEEIVQVWPETDGPVPPIE

       VLEKLPLLTAVIKEALRLTHGVVTPLARVISAGGACIDGHHVPGGTSVGTSHVFIHMSSD

       YYDAPDEFRPERWLGSSSDKHLVAFSKGPRGCMGINLAWCQLYLVLATLVRTVQMEYPAD

       LNDIKIKWKDCFQPLYYGRPLQVRCTRAEGHS* 18320

 

>CYP5068A2 Aspergillus flavus

100% to CYP5068A2 Aspergillus oryzae

AFL2G_02173 MELIIGLCLLAPLLFLYTPLRRFIGLNASELPLPPGPTLLSGPFPEKDIAKTFQKWNKKYGPIVSAKIGAQQFIILGSRR

AAQDLLERRASIYSSRPASKFLDKYLHKGLASAFMPYGAQWRLHRRLGSSLLSERASTAYRQLQDFESKRLLHEFLSTND

FSEAFLSYTSDIMFTLVYGKGRGKDDSDHKMLYQINEMATFVLQKASFGTILLDLFPMLDWLPHCFLTWRKKAEELHYKT

KEVYTECGNIALGGDCWNWSHEVSQRSEAKELPWEDVCYALGELYVAGIHTTKMVLEILIMVCVLHKEVKQKAQAELDSV

VGEDRLPSPDDLEKLPYIRAIVSELLRWRPISPIGVPHAVIQDDEYMGYRIPAGATVVANQFGMNMDEATFDNPAAFNPD

RYLNNPDLPVSAFGFGRRICPGHRLARGSLLIVTSRLLWAYDITSAQGDADLGDEYSPSSVKAVFQPRSVKHEQVIKKEW

EESDKDEKRILERIRDRI*

 

>CYP5069A2P  Aspergillus flavus

98% to CYP5069A2  Aspergillus oryzae

MDLYKAVVLDLHLSPGLISAIHKPTVLVGIACALFFSQLLFWTAKYSHKKTKGLADLPGPSGWPLIGMGLDLPVRPRELL

NRWAAQYGDVFKVRVGWYNWVFFNSPDAVKEVFDRQAAVTSGKPPLPIAQDYCLRGDGVLPMTYNAKWKRLHAFLKQLLS

AKASAAFIPSQEFEIKQLLADLSHEAGKNSTDFYMHIRRMTFSIVMTSAYGLRIPKWDCQEVRDVYGNMRMLSIILSPGM

FWID VFPPLNWLPRFLFPSWPKAKFMAN*MHSNK

MRHWDNLKDRITAGN ()

APDCFAKDLIESNHRD*GLEEETVSWLAS

AVPEAGPETTASALNGLIRYLAMFPDAQARAHDEVTRVLGDTRMATLADEPNMP

YIRAVIKETL

RLCPVATTGLRRMADGDVHYRDHLIPKGTILLANLNALHWDSERFPHPFHFKPERYLNHLHRSAVYAAGGDILAR

DNFTFGAGRRICPGIHLAENGPFLAVANIIWAYEFKLPLYDQGEEIPLDITDEGFMEGAI RVPKQYTVRILERNAAR

SRLIRSEWGQAQQAGYVLRGSHVDVNGGG*

 

>CYP5070A1 Aspergillus flavus

99% to CYP5070A1 Aspergillus oryzae

AFL2G_04072

MALFTFRLLPLVCTASIAIYVLSRFMHFETKSTGALTYSITFIIYLLYWLYIYPYHLSPLRHVPTVPGCPLWGHVFEIFN

AEIGAVQQKWHKTHGPIVRYFYPFGKEILSVVDNSALKHILVEASYNYEKTASNRKFLSRLFGEGILTAGGKVHAQQRKA

LNPAFSISAIKALAPAFWDYSCSMSSYWEQDIKESSDDSVSLDISDWASRATLDIIVAVGFGAKIDTLHNSTAPLIEAFR

TVFRFDAVAKLLAVLHILFPIVRYLPIKENREVDAAKRTLFEFASGLIQEKEANINSTGNNILSQLVRGDRKPQAAGEDI

FSRVICDQIATFLGVGQDTSATWLSWTLHLLSKHQHMQVKLREEIRSHFPFLFRSATHEKIDFTEVDVDRLSYLNNVCRE

SLRFIPPIPFVSREAASDERLGEYFIPKGTVIHIPINTIHRMPEYWGPNSNAFDPDRWNCLPASYTNNAFLPFTQGPRGC

IGRKFADTEVKTILCCLLSKFQFSPDPAVQDPEELKRYRIVQKSQYGIRLKVSKLDG*

 

>CYP5075A1 Aspergillus flavus

99% to CYP5075A1 Aspergillus oryzae

AFL2G_11923

MLLLLLETLALAYVAWSLVAMEINYRRACAMKIPLVRLCIDPQNLLWVILEPHLWPWLDRLPINWGNFGRYSRRGWYFAD

RGESHRRYGPIWALVTPKEIYINVADSEAIHDIFQRRTDFIRPVEQYTVLEVYGPCISTANTTDWPRHRKVLATPFNESV

MSFVWDESVEQTRQMIDIWASPDLDKISSVAKDTRTLSLNVLAAIGFRKSYPFRSGNGNSHREQSDSVSYRDALQTVLDN

AILLMIMPRRLLSLSFAPESWQQLAKAATDFKQHMVRMLDEEVQALNEGKAGSGGLMTSFVRVMNLKQEDAPSKGLTTDE

IFGNIFVINFAGHDTTANTLSFGLLLLAAYPEVQDWVAEELLLLTNTKGQYADLFPKLNRCRAVMLETLRLYPPIPSLPK

WTNDQAQPLKVGDRTIMIPPKVGINPSLLTMHIDPQHWEDPLEWKPSRWITPTKLVRATSIEDEQLITPVRCTYFPWSDG

PQNCPGNKFSQVEFVAVIASLFRHHRISPVANAGETFQQTRERVLATTRDVDLQLLLRMKDAERVHLKCRRV*

 

>CYP5075B1  Aspergillus flavus

99% to CYP5075B1  Aspergillus oryzae

AFL2G_01648

MLLIIAVALLGWTLYSVFCLVGNIRRIQKIGIPYHVIPCSPVNPLWILLEPLIFFILGLLPFEFGRIKHYGRRTWQFTDK

AQSHMRMGDAWAIATPNEIFVYICDADAITDIIARRADFVRPIELFTLLNVFGPNVATTEGADWQRHRKIVAAPFNESLN

SFVWREALTQAQSMLTTRATAGPSGGLGTDTRTLALNVLAATGFKRSTRFQSAQEAQSEDPRSYAQSLKTVMLNTFLIML

IPPSVLKFPIFPSWCRRAGEAVEDFKQHMLNMFNTEKTLLDQGKPGTGTLMSSFVRESTVDPKSNKTVLTLDEILGNIYV

INFAGHDTTAGSLTYVLFLLAAYPNIQEWIAEEIRTVFPNPDRDTWDYKEAFPRLKRCLAVVLETVRLYPPILALPKSVA

PQSTSLRLPESNRTIVLPKGTVVLPSLLAAQTHPKYWPDEPTTWNPRRWIETPNPTDATPSTPEDHLAGEEIMEPRAGSY

FPWSAGVQNCAGRKFAQVEIVAAMAAWFREYRVRPVREDGEDFEKAQARILESTNDSYQLLVMQMRDPDSAKFVWERVE*

 

>CYP5076C1 = old CYP5066A3 Aspergillus flavus NRRL3357

AAIH01000263, AFL2G_00411

99% to CYP5076C1  only 2 aa diffs

5507 MDIKEKPTLYAFALGILIHILYFRIGEHHLYPARYIYGYFGSFIGVAAFLYLVEELPVHS 5686

5687 ASYRSLYLIFTHLLGLYSSLVLYRLLYHPLRHFPGPFLSRVSVFWLSVQLRHKTLYRKLA 5866

5867 DLHNEYGDFVRVGPSDLSIIHPKAVNTIYGFKSACTKSAWYDSSAPLRSLHSHRNRAAHD 6046

6047 KHRRTWTPGFTDRALHGYEKRIQVYRQKLINQIKSMEDSKPVNINTLFTWYGYDVMGDLA 6226

6227 FGQSFDMLVKSESHWAILMIHSMLKPMEYLMPIWFFRLLLSIPGTTKAFWKFNEYWGQLFKMRMA (0) 6421

6473 TKQEIPDISACLLEPLKGRAPTPDEFNVLLGDASLIINAG  (2)6592

6651 DTTATTLTTIIYELARRPGEVQKLRTELISCTTDPNGEYTQESLAILKH 6797

6798 LNGVINETLRIHSPVPSYIPRKTPPEGINIDGTHVPGNMNVSCPQWVIGR   (1) 6946

7010 SESVYQNAQNFIPERWYLYPKMIKERSAFAPFTT (1) 7111

7165 GPYTCVGKPLALMNIRATIARLITTFDMELPPGDDGRALERSMREHFSIYMAKDIQVHFQKRAI* 7359

 

>CYP5078A5  Aspergillus flavus

99% to CYP5078A5  Aspergillus oryzae

AFL2G_12240

MIDAASVVILIIGLIVARLVTNRFRLSGIPGPSLAAYTRLWKLYNAWKGDHHHTEIALHRKYGSLVRIGPRHISVSDPKA

IPIIYGVNKGFTKTAFYPIQSISWDKKPQMNLFSTRDELFHRDRKRPIASAYSMTSILEMEPAVDSCTELFLSQIRKMVE

EKAPIDLGMWLQYYAFDVVGELSFAQKLGFLEKGEDVDNMIEAIRGMLTYAMICGQIPEAHKVLLGNPLFPILLPQMETW

NQVVVFTLKAINRRASLQRDGDLGKDEIDEAIGGKDMMSRWLAIHNADPTRLSTRDLMVHLSANVFAGSDTTAIALRSIL

YHLICHPDKMAKVRAEIDTADQEGKLSNPISYQESNTHLPYFGAVMKEAMRLHPSVGGNLERHVPPQGVTICGHYIPGGT

NVGINPWVVHRDPIVFPQPDSFIPERWLDSTPEQLKEMEKAFLNFGAGSRSCIGKAISLMEMRKILPQLLREFDIHLHQN

KSWKTRNVWFVQQEEFICDLTPRVRS*

 

>CYP5080B2 Aspergillus flavus

100% to CYP5080B2 Aspergillus oryzae

AFL2G_06254 revised

MYILLLLPVLIVSYHVLHLIYITLTTKSLLSVPGPFIARLTKLWYFDRVRRGHFEEDNVRLHERYGPVVRIAPDHYSISD

RAAVKLVYGTGTKFTKSAWYEGWKHPSPERWTLFPDRDVRRH (1)

AETRKRFSGLYSMSSLVHYEEFVDHCADIFSQ

RLTEYAQREGSLNLGHWFQCYAFDVIGEITFGKRFGFLDQGDDIEGTIAALQKTMVYSTLIGIYPEWHPRLFELLSHFSW

SGAGGRTYIMRYVQEKIRRHSEPAKRDPEQGTLQTQDFLEKMILARDKDPEKVTDYHLFMMGLSNVIAGSDTTAISLSSI

MYHLLHYPAVLEKLRREVDDFTAQGRCSARVTFKESQEMPYFQA (2)

VMKEALRMHSATGLPLWRVVPAGGAEISGYYFPEGTTVGINTWVAHYDEEIYPDAKKFRPERWIEAEADPERLKIMNEMYMP (0)

FGLGSRTCLGKHISILEMSKMIPRLIRDFDFTTTSQKWSTENYWFVKPTDFVVKVRRRTSSAKQA

 

>CYP5080E1  Aspergillus flavus

98% to CYP5080E1  Aspergillus oryzae

AFL2G_11025

Note: one frameshift exists, possible pseudogene

MNDGRIILTQDKGQSYTAQLLYLIVAG

YIAHTVYYAYWGPTARIPGPWLARFTRLWELLKVSKGHFEQVNIDLHKKYGPIVRISPNTFSISDPSAIKQIYLGRTTLM

KSKFYEPFGDPLDPNLFSETDIKKHAQSRKAVAHLYSMSFLVTYEGSADRCNVQLCAKLRDFARHRTAFDVPTWMQFYAH

DVIGEITFGEPFGMMAKGQDEHGIADSIDETMAYASRMAVIPELHRWVSWFGRVAHLKTPFHNIQKYILEQIDARSGSDS

VGIDFLKKLLTLREDDKIMQLDIEKTVGNNIMAGADTTAISLSAVIYNLLKNPGTETKLREEIDTLAAAGKLSNPVTFEQ

ARHMPYLQACIKESLRVHPAVGRPLLRVVSPEGLTIAGQYFPGR

FQGNSRYQCL &

VAHYNEDIFGRDATTFRPERWLESDKEKLSVMEQSLLA

FGAGVCTCIGKNLSMLEMSKVIPELYRQFEFELS

ESEGAWMTWNNWFVKPAFECYVRLREGV*

 

>CYP5087B1  Aspergillus flavus

99% to CYP5087B1  Aspergillus oryzae

AFL2G_08921 revised

MVQPIETPRQAFLAHPLTVILVGIILSLLVRRLLWNLKQRELERLHGCERLHNEGGCLRYDFLGIAKAIKLGFHFRRRTS

LPYTNALFKRYGETYASNVLGYRLIFTCSAENIKHLLSTAFADFDSSPLRKPLFQPITPDGIFTLDGPGWKKSRDQLRSR

LSNLRKIVDLNQCERHFQAFLQHVPPNGQAFDVQACAFALALDMQTLFSLGESVDALSFCQSREKKQFLEDLLFVKEKIV

QDGFRGPLRYLYPKRRFLHCCKRARRYVIAHVSRQLTGCSSMSEKAEGAQPTNAEEEVSLLADQALSILLANDSMSTTLS

GLFFCLSQDERVVKKLTASILDTVGLEPPTWGQLGSLHYVRWVLQEAMRLFPAVVFNARVANKNSTLPTGGGTNGNSPVLIRKGEIV

VFSTWARHRLGKDFGENPDEFYPERWEHLSGDMIGFIPFNKGPRACPGQHYAMIVLTYIVARIFQTFSTVSNYDTREWTE

RISMTLENENRVLIGLS*

 

>CYP5089A2  Aspergillus flavus

99% to CYP5089A2  Aspergillus oryzae

AFL2G_03453

MVSSTAFIVVQVALAALAAHVIYQCYFHPLARYPGPFLARFTNLWRLFTFFGGQHHLSEQHLHDKYGHVVRVAPNWLSFS

DLHDFDAIYGFNKSVEKDDFYLFGRPRDNRVPSVFALKTDADHRQRKRKVVGPALTTAKITRYESVVTKHVDLFFTRADA

ASASRQDGEMAAVNLAPLAHRFTMDVMLELIYGPDVVSHPYTDSATGADMCSAMRKLVKMAWSFSLCPSYGWIMNSRLIS

GVLRTLTTSKQGGPTGMMALMTSSHTMIFRRPEQVSLPAQPGIVKSWLDIPLDDSSRMTQDEVFSEAVNLVFAGPGSVAA

ALTAMVYQLGTQEGQLWQEKLRKEADVEAPPFSLELQAVVKETLRHCASFPTAFPRVIRRGAETIVSTLPAPLPIGTTVS

ANSYVLRRSRKIWGHDADQWLPQRWLGDESQRQEMEAKLVAFSK (1)

GSRGCVGKELAWLVLAKAVMAIIRRWKFVSVGELRGKSYLEMQYDDCWIEYEELA*

 

>CYP5093A2  Aspergillus flavus

98% to CYP5093A2  Aspergillus oryzae

AFL2G_08665

MDYIHSLPSNPALGLSCCIIFILLAIVLHDVYMWKCLPPGPPPIPLIGNKFQIPSKHPWIKFEEWSNVYG

PIYTIWLGRRPTVVISDPSIASELLEKRSTKYSTRPRFVT MGEIYWDMASILVQPYGKEWLIRRRLLHSALTPRALDNYKPLQEAESSRLCYQLLESAHEWEPLFDRLASSIVFAVSYGH

RVDSAQSPVIKQRLDFMQYASSLNVPGAYLVESFPVLKHLPDWIAPWKAEIKRRGRLEAEANMTLVRVVQQDVESAKESP

GAEPLFNSLTKQLLETRDSDPTAFPLSERDFSYIPASLFGAGSDTTSSTLCSAMLAIVTNPRTMEVAQLELDSVVGRDRL

PTFEDIPSLPYLRAFSKEVLRWRPVAVLGGTPHACSEDDYYRGYYIPQGTVMLGNSWAINMNPKYYPNPDQFNPLRFLDM

DPHLLPYLPKEYTASAEQEKGSGHPSKLGHSSFGWGRRICPGADLATNTLLITLSRLLWCFDIRPIPGQTYDTLDYTNGF

NIRPRNLHLSLQVRSDQHRRVLEREYEVATKFLERLSPFDERMLQGNS*

 

>CYP5093B1  Aspergillus flavus

99% to CYP5093B1  Aspergillus oryzae

AFL2G_07281 revised

MASESSIPLYDCLIIGGGIAGLSSALSLVRTLHTAVVFDEGIHRNDQAPHLATVPTWDSQDPKRFRDAAKLNILSKYSTV

EFANVKLEKFNKALGKPFLTKVFGHDYVVLPSKYFDDIKRASPQSLSFFQALSDGLNMEASVGHLYASTTEIDVVVKHLNPRL

TQLTPLLCDEAEYAIEREVGALPDWKKFNVSNLIAAIVHRTTNRILVGKKLCRNEEYLAITTKFSRSLFISGIFWNFVRL

GPLRKLVAWLTIGLHLRDRNAAAKVLLPHVLARRQEKESGVDVATKYPDALQWTIDTAPSFPGDDEPLHQVYHMLHLTFA

ASSASGVGVTQCLLNVLAYPEYLEPLREEISTVVARHGGWTDKALSQMSLLDSFIRETMRLHPAGSLTVARTVMDDHFRF

HDGLTLPKGTNIIAPALAIHYDPDNYEDAHRFDGFRFARYRQKQGENHRWLASTIDQKFLQ FGYGNHACPGRFYAIRKIKLVLAKLIMDYDFK

WAQPRPVHDRPEDFAIEAQLVAAPDAEILIRSRNLSN

 

>CYP5095A1  Aspergillus flavus

99% to CYP5095A1  Aspergillus oryzae

AFL2G_11819

MGFTQDLVSVIRPSIESPLAFCATTVVAVVLYVLVLGVYRITLHPLAKFPGPKLAAFTQWYETYYEFFKSPGGQYLFHYR

KLHEKYGPIIRLSPFEIHIQDSSFFEEMYSQSLPWDKPKELEHRFGNANGLFPTHKHEVHRHRRAALNPYFSKRAINNAV

PMMQEQITKLCDRLRREYQGTGKVFRLDWMMGCIASDIIVRYCVDRGYDFFEAPDFKSPFIQALFDLLDGVHMITQFPWV

ATLFNSLPQGLVETLQPGMKSVHHFHKEMADQVAHILSNKEKRNGSEQTNVFNALLDSDLPPEELTLTRLQQEAFTVIGA

GFDTTRYALSVAGFHIINTPSIYQRLREELKTAIPDPNNMPSLTDLEQLPWLTACIQECVRMSYGVSQRAFRISDHITLT

YKNYVIPPGTVVSMDNYSVAHDEEIFPESFTFKPERWLGDPLAPDGKKLTRYLVSFGKGTRSCLGINLAYAEMYLTIANV

FRNFDFELFETDRSSVDCYRDMFLPHVKPGSQGVRVKIN

 

>CYP5096A1  Aspergillus flavus

99% to CYP5096A1  Aspergillus oryzae

AFL2G_09795 revised

MMPTFFQAVCSTCIALAIYTASLAIYRLFLSPLAKFPGPTLAALTGWYEVFFDVLLGGQFMWEIERLHGKYGPIVRINPH

ELHIKDPDYYNTLYAGPTRRRDKYLWFLSVGAPTSTFATPESDHHRLRRGMLSPFLSKQAVRDLEGVIKAKLDLLCEHMK

KAMRSGEAVELHAYFVSFAVDVVSTCAFGESGCFEELRRERLDDRWKNVVTGAFGKLLLTRHFPWLVVVFRFLPVWATAL

LTPVVRHIDYMEKGVENQMQHVYAMNKDGVKENGIFSQLMHNLKIPLKERALYRLADDAKFLMVAGIDAPSQVLAITMFH

VLRSPLVCRELREELQDKTAHSQDELCLNTLEKLPYL (0)

TAVIKEGLRVSAVVTSRLPRIAPEETLEFRGWKIPPG (0)

TPVSMSSHFILRDPAIFPDPLVFQPERWLKQSTTGSSLDRYLVPFSKGSQGCLGPN (2)

MAHAWLYLALATLLQRFEFSLFETTEENIRTVRDCFNGQTKPGQNNIRVKVLTEFI*

 

>CYP5097A1  Aspergillus flavus

99% to CYP5097A1  Aspergillus oryzae

AFL2G_03561

MDLTLHLILFLCFWACYLLFEKQLQQRSPLPPGPTPLPIIGNILQFKRKQAVWETISQWSDQYGPIMSFKVASRTIIVLS

TNQAIRDVLEKTPVNSSRPRFIGVNENLTRSMMPIFLPISDKWKAIHRVQLSLVNSRSAKGIAEIQLLTAKQHLFNMLEN

ANYDIADHINRFTSNVVSTVLFGTNIGSVSQTKSNGKFGLADQFIASICVEHALVDLFPILEHIPGVARLGASKGNAWFE

SIRQQYTEDIQRAINSPTWSMIKAAHQQKIGGMSEDAFRMWNVEMEFALGMTSSMMIANLVAMAVSHSHEFRQVQSEIDR

VVGPERLPTADDLAHLPRLHAFVKEGIRVAPIVPFSVPHAAVEENEYMGYRIPVDAIILPNQWHINREPKYFEDPAEFKP

QRWIDNPNLPGPALFGYGIR

ICPGRQTANNGLLIVLALMAWGFDLNHAGGVKEPPNVLETLIMKLPTSSIRYSCRSSVHRDLIQKEWLAS

DDDPSSILNTLGSSLGF

 

>CYP5099A1  Aspergillus flavus

99% TO CYP5099A1  Aspergillus oryzae

AFL2G_07491

MEHHTWALFVDKLDYKAVFGLLLTIIIAVVTTQILHVYTKCCPGIPSIPFHISVYDAYRRVSEIGFHNSR

LRPVLETHGAVNIWNSGQWAVLVTKPEYVVRILRNERVVAKGGFYGKVPHSTLAGLFGENIIDSHGELWK

QFTGVMKPGIQRPHSISSLKVASSKLIATFKREQQHAPSDRGVVINDIIERWAIDVFGESFFDVDFGALN

GGTVRAQDALLAILWNLGGHLIHHFPMFERIGWPLRPTRPHCFSMIRELEEALIDITEKLKYPETPPDRF

EKLIYRLKRARDDGLMTNFHYRSNLKMMFFAGHENVKFAFIATLWELSQNPQMQEKLYREIAAHIASSSD

GDDLKSLPYLTAVLAETLRLYPPVSQLINRKTLEPVYLGNGITIPQGMWVGWTAYGVHTDPNTWGPTAHE

YQPERWGDDVHAIQRAISQQQVRGSYIPFNAWTRSCIGSEFALLQLRVTLYEIVRHFEITSAPDYRYSIKV (0)

NASLEPYNCRLIFKDRL*

 

>CYP5100A1  Aspergillus flavus NRRL3357

           GenEMBL AAIH01000177.1

           98% to CYP5100A1 Aspergillus oryzae

           AFL2G_11920 this gene model has wrong C-term, revised

22528  MPAFSLSLIGIGVVAVGTVWALWALTRKLQVPNNYPNAPRSLPYSIPFLKSTIPFVLDGL  22707

22708  NLFRQAS (2) 22728

22785  LYCQDRWPLRVDLLNGEVYIVQGAKNIASIFSTPGLTVTQAYGIALKHCFGMEQKAVD  22958

22959  AYLADTSGSWHRPIPGSQTPWHGRVSYHTHENLVQGLLGAGLDPTTERIERLLLASLEGA  23138

23139  VSRTSEWTYGMDLTEFFETHLGSAILQALYGPLLVTKNSDFNRNLWRYDKQIMRLAKRLP  23318

23319  SWLIPEAYRLRDELLGAIMRWHQQATLLSETIPSCERTSGGEADPYWGSAMMRERNKMLL  23498

23499  SIEGQDAKSVASTDLGFIWA (2)

       SVTNVVPSTMALCTHMYRDH  23678

23679  SLVENIRLAALNCIRPGATLRFDLNKLGKQPLLLSMYAETLRFGVQIHIPRCSPHQPLSV  23858

23859  AGVTIPPDKMIFINTSLAHTDKSVWNTRNGEYPLDTFWAQRFLIDPKDEGSGPTRKECSQ  24038

24039  PLESTPRGEYKRMDGQGSSSGQFTLEGLDGSWIPYG (1)  24146

24215  GGQHACPGRILAKRIILLASSMMATMFDIELLAPNSSLQFGSPRFGFGVRKPSAQVPFRI  24394

24395  RRRKPVNQDPFTC*  24436

 

>CYP5101A1 Aspergillus flavus NRRL3357

          GenEMBL AAIH01000177.1

          99% to CYP5101A1 Aspergillus oryzae

          AFL2G_11924

12856  MGRSRSTDWR ()

       NSSALFARAKKEFRHKLCALRIAGQDMVMVTTAAQ  12677

12676  IAAIDKDSPTFAFEPFVDLVYDEIATVSRESKPLLWRTPAEGYKSLFPSAKQMTAAHTGI  12497

12496  HLLHKQLTQPDAMHEFMTNSLVHVNNTLQWDSFYNTSVLAATADVKVVSLECLCRDVIID  12317

12316  AQLTSFFGPRILEIEPNIRSFLKAWDSISWKVSYRLPSFLAKHATQLRDHLIEVLVKYYA  12137

12136  FPAEERPGSVSFVNDVYDDYKQAGIPDRDIAGIVFTILWG () 12017

11949  LNSNVNAISYWMIAHLMNNPTVVNEIREEIAPMMRALDSSPTIDGTILADVSKDPLLNSC  11770

11769  PIMNSTFNETLRFTATGSSFRETTRDTTLDGRRIPKGTKIIIPQRTQMMHSAAFGPDPET  11590

11589  FDCYRFYRNKSLLRKVEFRGFGGGTTLCSGRVVGRHQVLAYLALLFWRYDLEVIGPDQEV  11410

11409  LGVRGKGFPRLDEAKPSLGPGKPIDGDDQILRLTRRNV  11296

 

>CYP5102A1  Aspergillus flavus NRRL3357

           GenEMBL AAIH01000069.1

           98% to CYP5102A1 Aspergillus oryzae

           AFL2G_11964 model wrong at N and C-term, revised

27804  MVVCVITVLILGFLAFVRALCNYTRLSTVPGPLFTGLSDLWRTYARSTSDYGCSLAGLHM  27625

27624  KYGKVVRLGPRSISVSDPTAIFPVYNGRPSER (0) 27529

       PIFEHGDRIVFTQGSFTKSTDIESSLMSKVDRRRSLESAMR

       YEGIIDQAANNLITSLRQR  27296

27295  PLVRLTTLLQGFATEFINRLVLEESATQVMPFSAQGASCHWYNRTGKWLKLPMIEYALLR  27116

27115  SPAARLKRRRGISFVPRKVQGGINGSQSSRAMNDGGISYNISFPRSYSNADGAYACIAMA  26936

26935  FVSTFSSLLKHENVMTRLRSEIDTAFSKGLLSDPPRWQELGKLRYLDAVIKESMRQLPSL  26756

26755  GYNREVVTPPEGAIVAGYYIPPGTMMELHSEALRDDPGIYGEDVHTYRPARWLTADPRQR  26576

26575  WAMNQNLQQLSTSINDCPKVRVTWLELKKIVVLILLKFN (0)

       LQLVRPGEGPIPSERSDQGSPPSMAYCTPRNH* 

 

>CYP5103A1P  Aspergillus flavus

93% to CYP5103A1  Aspergillus oryzae

MKSTYFPSQPQAWFHHYRTMEVQYILEILHNLEAAIWAVLIFIAFVLISQAHYKAQLAKLPTFDIDEGNEKWRRTYLKSA

RRLYQEGYKK (0)

FKNQAWIMPTSDGRKTVVVPGQLLSELSKLPETVLSFPTAINKVLEVKYTKVAPDEPLAPYCIKADLNPA

LSRLNPIIYREVENALEEKIPQCEDWAPVFIYQKLVNTVAKVSGRIFVGAELSHNKDYLDTAINYTIELGNAVQAVKKMK

PWLRPFLAWKLPEVQQLNK

REEMAIRFLEPIIQARREASKDPD

YQ*PDDMLQWFLNRSEDYKVHST

RRIVKMQLLVIFAGIHNTTVTATNVLYNLAVSPEYMQPLREEICKAISDNDGTL

TSRALQQMEKLDSFMKETIRFYP &

QNSPPSRAKR

GQYIPPGTSIETPLQAIYQDDSNYPDSDTFDGFRFYKIR

QGGGATVHARNQFVTSNEQNLVFGYGKHACPGRFLAAAEIKMIVSKILLTYDFKNADDWTERYSNYEVGRL (0)

NMPETAIPLLFRKTTAQDSSL*

 

>CYP5105A1P  Aspergillus flavus NRRL3357

            GenEMBL AAIH01000184.1

            pseudogene with 4 stops, 96% to 5105A1

            AFL2G_04889

38647  MTLFQVVETSFILLAL*TSVEAIRRLFSHSLSHIPGHRLAAFTWWYEFYYDAVQSGQYVF  38826

38827  KIQELHKQY (1)  38853

38921  GPIIRVTPDEVHINDVGYLDTIYAPSMTRLDKYDYQLRTLRVPGGVGTTADYYLHRIRRE  39100

39101  ALPPFFSKRNVLWLESVITEKVNQLCGLIAKHAATKTPVNL*DAFYGFSND (2)  39250

39309  VVNNF*FAHQTDVLADEQEAARLRHNSHELLKGINMNKHFPWIPDILEALPQLLTRPTMP  39488

39489  PGLIDMLELFD (0)

       RVRAELTTIITRISSNTSGEKESINTGAKGS  39668

39669  VYESVLDSPNLPASEKALLRLEQEGALLTLAGTESPAQTLNIIFYHLLANPALLAKLREE  39848

39849  LATLPTLSTWTQLEQLPYLSAIIEEGNRLSFGVTARTARIQHTPITYTPSAYVTTPDPTH  40028

40029  KSYILPPGTPVSITTLSAHTAELVFLDPYAFLPERWLGDEGRERRKFQLAFSRGGRKCL  40205

40206  GVELARAELYLVTAALVRKFDLVLWETDERDVSFEHDYHVAMPRDGSTGVRVVARIR*GL  40385

40386  ALSRDRLTTK  40415

 

>CYP5106A1  Aspergillus flavus NRRL3357

           GenEMBL AAIH01000668.1

           only one amino acid difference

           AFL2G_08751

MSFASALILVVAIWCIYVGWPWYRNWKQAKALHVPIVISPISTS

GAALQSLRYILDRDILPTWITRLAFVRLIQRNSRFQEKFAVHAEYGKLFILVTPATCE

LYVADVDAAKQVLSRWRDFPKPSSLLGMIFPERNA (1)

GADWQRHRKLTARAFNEKLHEAVWAESTRNATKV

ITKWNNTKPVYSTRSDMMALSLAVLFKACLNIDGDDKDDTRILAGDVAACQWHLDVVLKGISNPMALGRG

FEGIKKLKRSHKALGELLTEFVEARTIRPKLSAHADLLSSILAPTDHRGLSSDEVTGNLFLFMFAGHETT

ANALIYIIHLMAIFPAWQDWALEEIDQLSHNRADGEEVPSYSQILPQTQRLRAIL (0)

YETLRLYGPVPTLVRQTDPQAQTLVLPEQEVIIPKDTPVNVNTIALHTDPKQWGPDPLAWR

PDRWILQPCDSSLQKVSNELLKYLFAWGDGPRLCPGQRFSQIEVFAVLICFFKS

HRVELVPSRDQTMDQARSHALSLIQNSKVGLTLQMPDAESVGLRWVGR

 

>CYP5107A1  Aspergillus flavus NRRL3357

           GenEMBL AAIH01000006.1

           only one amino acid difference

           complement (71337-73087)

           AFL2G_11056

MIGEQYTSIITGFKSALAVSCIAVSLFLLSPWIAYARLPSSIKSPIKAKGPLSALRACLNEISAGAKTSTRGYELYSKKG

QSFAMLNINFRPQVILPPEHVRWLVTQPEDILSHAKASDDADALGYIWPLFDASALHSFSKVLQIDLTRNVTQTEKDVLE

EVQHIMDELVGQTESWKEVNMVQAFERIMYQATQRVYVGLPLCRDSTYMGYVKGYARSLGTAMVFAAQLTPWPLRQVTAL

LAGLPVYYYVLRVRSYLSPLFKERMERLKEKGGTQDDNLEGEPRNLITWMSDGVLSGVGPKSISPSEMVTWLGILALLPT

DNLWTTCTNVLLDLLSSESEHAYLHTIREEARTVFASSKESGKPVSHGLHHIDSAIRESLRMNSLSPRSLHRQVVRRGGV

VLPDGQKVPTGTWLCVLSGNIQRDEDYYEDAQTYKPFRFVPKLTEAGGDKAPLLPLTNEKYLTFGYGRHACPGRWFSFQV

MKIVIAYILANYDIQPLEKRPDNIVFADLNIPHLSHIIRIKRMT*

 

>CYP5107B1 Aspergillus flavus

99% to CYP5107B1 Aspergillus oryzae

AFL2G_11057

MQIADMAASTTAQILVVSLGLLIFVLLCPWFGYLRLPSSMRWWPSIPSGPLSALRLSLKEYSGSRSSEDGYKAFSKKAEL

FAICNPSFYPQVLLPPEQIPWLLSQPENVLSHEKANEDVHALPFLAPAFDNYDHLELIRAIRTDLTRNIPNTEDAFLDEL

RHTTNEVLGAPGDNAWKEVNLTVALDSIIFGICLRLFFGVSLSRNRTFVYYVKIFTRVTGAMMLFVSQLVPWPLKPVVGI

VAGFPIYYYWVRLIIYLYPTFKERIQCLRTKKETPPADMVTWMVDLAISQNPTRKVHISSLIVRLTLI

VFLPVDVLIAMT

DNFFLDLLSSDPDRKYYNALRQEAEAAFTNRDKTQPISQSMPYMESTIRESLRLSPLSDRMLSRRVVHKGGITLPDGQFL

PRGTWLAVAAVGVHRDERTYEDPDEYRPFRFLSEDTETKEAKAMLVPVTSEKFLAFGHGRHSC (2)

PGRWFAAHAMKLIIGYILVNYDIEPLEKRPVNSVVGQTIIPQLDVKIRVRRRE*

 

>CYP5108A1  Aspergillus flavus NRRL3357

           GenEMBL AAIH01000996.1

           99% (4 aa diffs) to CYP5108A1 Aspergillus oryzae

           AFL2G_08676

6424  MLEALLFRPSLLSFIAAWLGTLGLALLLFSSRRASTKLPPRANGGIYFISDILVFLASPV  6603

6604  QFVKQATGKHGSVFRIDCLVKQIFYLRGQKWNRFFLEMKEDTWSFSGGI  6750

6806  GMFLNKAANPGYFTHGRNLLGSINRGVNRSAALQSYGRLAGEEAHKSLQHWSQMPDVEIF  6985

6986  ESISRFVHRVIVRCMMGEDFYDHHVDELYDLLQQMESLVGHPFNLLLPSWVPHLPGRQLA  7165

7166  QARNRFAEIFRERLAARQLESDVWRDSLDYINYTLNDPRTAQLADYYPSHHVVLMFAAHT  7345

7346  STVASIAWTIVE (0)

      LLRHPIYQEEIRESLATTSDIHQCAPLLACLREEG

7540  RRYSGVHMFRTTKRPVSLEGSDYTVPEKSVVLISPYLTHHDPAIYPEPHEYQPHRWLLPD  7719

7720  GRLNPWNGSKEAAFLQFGAGNHRCPGENFAAIIAREFLAALLMKYAIEWGRDGAPADLSR  7899

7900  LDFTKVGSPWLEGDAAVRIRPRVFGS  7977

 

>CYP5109A1  Aspergillus flavus

           GenEMBL AAIH01001109.1 NRRL3357

           4670-6495, only 3 aa diffs

           AFL2G_08515, gene model is revised

MSPFIFAVTLTFAILALGILRRRYFHPLSRFPGPFLGSVTSLYQTYWHVHPNKTLHDTELHRKY (1)

GPIVRYSPNGLIVNDPALLPVIYNRRANKTDFYAPVFDTHSTFTRKDYREHVASRKAISHAYSVTNTRLFEPQVDG

ILSELISLLSESATEKRLVDIMEYGS (2)

WFTYDVTSLFVCGKPFGFVEKRTDVKGLIQNKNKVLFIVFIMTIQENLSWIVRN

TRLGRRYLMPHPTDQSGLGVVMAERDRIVDAVIDSDGKVKRHLLVKGSLLSSLMEILGTEGCPLSLVDVKAEIFFAMLAG

SSVTPSQLARVIFHISRNFKVQEKLYEELVAAEQDGRIPPLSAIISDEQAHRLPFLSACIREAQRYAPTMSQLPRYAPEG

TGLELHEQYVPPGTSVSTSPWIIGRNKDLYGEDANSFRPERWLEASPEEERRWDHFSFHFGYGARKCLANNFGLMQLYKVAAE (0)

VFRRFEVKVEGSNEDTVSGGPPASARFRFDRRARSWS*

 

>CYP5110A1  Aspergillus flavus

97% to CYP5110A1  Aspergillus oryzae

AFL2G_04288

MAIQSTLEMCHLAESGVYLILVTFGVGLLFGLIVLTSDYLDGWLRRRALGDIPFVDEGSN MSACLRWWSRKFDCEKEYAEAYKQ

YSKTGKPYATRLKNNDHGIVLPLNSTKEWRTLPHDQLSFLHALSE (0)

FADLYMHINMTDRTPLQAVHYCNNTKTL (1)

SRFNRLMVDATDRALPLIVGKDTES

EWKRANAFHTILSLCSTVAMSVLLGPEFSMDTSLIQTIM

MYNTAIMPSCAK

RTSYPRILRPFVWRLSPLCRAMKSDLTKTK IKLTPEIKHRIDIARSKKGWLEEGPMSLLDGLIETAFEKGCLSRSSDRGDDDQQVA

LLAEEIIFYHFELSTPVAFFIIFAVYVIMNNKEYSTPLREEISEALKLSGGSFTLDTLNHAPKLASFVKETCRLYDISCCN

FRRVMKPIHLESINLSLKPG

TIIMAPGRDVHLDPDYYDNPTTFNGYRFYDASRGTCTPHISTTSPTFLTFSHGISACPARVLATQITRTIFIMFLLKFDV

ELAHEEMPAYGFANGPAYLPNPSVMMRVRPCQKDVLGV

 

>CYP5111A1  Aspergillus flavus

100% to CYP5111A1  Aspergillus oryzae

AFL2G_01649

MLQDLIATLASGAQMYWASSGVWMRVVLTVSAIWIFWRIWRFTILPLFRPNEPVELPYWIP (1)

YF (1)

GHAGAFFKDSHQLIRTAL (2)

KRFGTLEPFSMIIAGDRYYVITSPEDTRPFFADVKAMTTDGFLDRALLAFGCAPERLHTLWQRNTPTKVNPKGKNLIHL

TQDLFKHDLVPGPTLNVLLERYQGALDELLSWDRLVGAYPSLVSTQTEAISLYDICADFIANANQIVLFDRALLAIDPDM

AVEMRTFTDELWKLVHRSRLVDTTEVTRILRQYSSAFKSYLQLPPEARPNETPVIRTLLETYAELGIHEDDRAAMLVMIC

WAGDANAYKAAYWVLAYILYDPQLREIIRQETAPAVGPDGKLDWPYLAKRCPRLSSIYHEVLRLTKRDVIVRQVVRDTAL

AGKRLRKDSIAVIPTCQLHDNPDTYGADAASFNPDRFLKQPGLAQTTFFPYGGGRHYCPGRYFVEMEIYGLVALMLNRYE

MDLAWAAPFPRRDESLVTLGISRPVPGDDLHVTLNWKEGNKN*

 

>CYP5112A1P  Aspergillus flavus

97% to CYP5112A1  Aspergillus oryzae

NTSLDSSTALGFYITLTVVTISVAYVSILA

 

TPVSMTPH*MHMDPDVFPNPNSFEPSRWSSTLTEPEKLSLMGRYFVPFGKGSRSCI

GTRLAYLLLYQTLAHLFRPGAPRLLLHETDISDVTPVRGFLFSL

PKEDSKGLRVIL

 

>CYP5113A1  Aspergillus flavus

99% to CYP5113A1  Aspergillus oryzae

AFL2G_06213

MTAETGFVPTVFSLPSESAYSWVWAVSAGLVAIFVLYLTQGIARRRFAYAHGCQAPPRYAHRDPILGLDSLRDSMQARKS

DRYFRREQQLHQAYGNTFMSLLLGSWMVNTIEPKNLEVLFSTKFADYEVGFRRRNAFAPLFGKSIFQSDGARWQTLRSQL

QLCFSRVQTSQLGLLESHCQRLLAALPPDNQKFDLALFLHRFAADVSTDFLFGESINSLENPQNLDSGALKAFADTHSTC

ELRWLLGSMSWIWPQRTFMKNVRLTHRFIQRYVDAALQREVTPPGKASDQQNEQRILFIDQLRQRTQDPIALRDELTTLY

FAGTDAPAALLINLFFVFSKRPDVWDRVRSEVQSLGGKAPDLQQLKGLRYVQDCIRECLRLYPPQPSNSRVAVRDTVLPT

GGGPDGGSPVLVPKGMMVHLSVYALHHRKDLWGEDADEFRPERWSYEKQTWKYIPFLGGPRNCVG (1)

MDFGLNEVAYAVVRMAQNFQTITSVDPDEWVEGSSIALESKNGVKVVMCRDA*

 

>CYP5114A1  Aspergillus flavus

100% to CYP5114A1 Aspergillus oryzae

AFL2G_11037

MELPIRYCLGISLAVA (0)

GVAFCLYQMFFHPLAKYPGPTLAKFTAARAAYCAWKDDVHLDIWLCRKKY (1)

GPIIRYVPNHLCFDTVTGLK (1)

DIYLSGKDLRKDKIMGKASFVPNLLTIMDRKEHARHRRLIGIGFSQSAMKSVNERLLHHVKSFYHVAYNAGLPDEANGWSHPLTMSDLCSYLTFNV

MADFIYGKSYDLIHCPDYRHLLEHIEESNLRTGVLLYCPQLYIGRLDRKLFPRASTGNKTIHSFINQIIQERKSENGVGQ

SIYEQLGTQRKSTDHPLTPEEIRSEAMLLTIAGNDTTSTALCAALFYLGKNLHAYEKLAAEIRTKFSVVDGIGQDETLRN

CHYLHACTYESLRMSPPVGSSMWREVGPGGTSIDGEFIPCGYGVGTGIYSIHHNPKYFPRPHDFIPERWLSEKDGFICKE

QADIPFAAYILFSAGTRACLGRHLAITELLTTIAALVLLYDFRISHTENGELGCGHALGRHGRTNPGEFQLYHRVTSGKE

GPILQLRPRKGN

 

>CYP5116A1  Aspergillus flavus

99% to CYP5116A1  Aspergillus oryzae

AFL2G_10567 revised

MSLFLVIVVVLLLFLSSPLHRLVHIGLKKPVSPNIDPETYRRIIEGKGLYQEVHNQLNARQSRAIPNKRL

RAVFGIENALTTDNEIHAKRFLRQVKGLINLSPTSWESLSGLVRSAARRSIDGA

MANSPDKPRVMLTNLVQVLVLRVVLSVLFRMETEALEIPDHDLLRLAEAINDAWTSSKDKTHLVSFQDNISLQNSLKTLF

PHLNCLDPQENPLNLVIPGFETMWRIVLRLFIEISYTSGLYHPEWRGIMTTFAIAPTKDEFERRNGKQNLSAEMLVNEAL

RLYPPTKRVYRAFLPVGSDTVEVLNADIEKAQTATHIWGSDAEVFAPGRWGALTPQQKLAFFPFGSKPFVCPAQAAFGPR

AIALVVGALLVELGGEWSLCVGAECTEALVPGVRLSNQRTEYRDLCLARAGPV*

 

>CYP5148B2P Aspergillus flavus

100% to CYP5148B2P Aspergillus oryzae

AFL2G_08556

RRGKKLHEDLVETYGGIIKDTEREMKEGKKVVLDCLAKT

MVEMRDKEDLDDPDMAILASTFMIGGAET (0)

TAAIMQWFSALIPVYPEIQN &

AQEELDLVVGRDHLPGIEDEQNLPYCHAIIKEVERVHNSFWLGTPHVASEDCV

YREKYIPKETVVVLNTWTMHYDPTRHSNPETFDPDRYINDPLTSAESANVANPMERDHWMFGAGRRICPGMLVAGREIWL

SISRMLWAFDMYEIPDEPIDLK*YDGLSGHSPMPFRIGLKPRHENVAKVLQGIEI*
 

>CYP5284A1 Aspergillus flavus

31% to CYP5157A1, similar to N-term of CYP608A2

AFL2G_09003

MSLGLEILNITFFKAIA (0)

RPLSGTPPIVSLTVCVLLRPLP (0)

TNNLPEALERQIQQHGPVMGLRRDGR (0)

VEYIVSDELTFQVLTDDATFSFELGTAK (0)

ILRIEFLPSMFGNSIFQDIDSVVDKLLTKRLDTMIHRGR (0)

PIFERNSAELLKYCPEGPVNLLPRLQRTVAEAAMSIVFGDA (1)

SELIGTFRSRSILARYFPALWQIVTWYVYETSLW (2)

LKVVICTVIIRFGIAFGPLIWTQISAILQKSNEKPSKNDVRVYFHHSFLLPRV

WNLTPQYQGIPASDP (1)

VVVFIFASVHQT (2)

VSITMWTMFQLALHPENQDITRREIHDLTRRDFVPIPMSELNMRTLRKA

SCTDSFIREVLRMKGDTVNLVRMARKDLQLGDYIVPK (1)

GSLVLPLVSLFHWSPRYNEGDPKKLDGMRWVEKQKAASTTDSGHLSFGLSIWTCPGRFMAVA (1)

EIKLAVFALLADTRLELVGGRHDVADNFNVTGNPPEGELVLKRISVC*

 

>CYP5285A1  Aspergillus flavus NRRL3357

         GenEMBL AAIH01000268.1, AFL2G_07275

         98% to CYP-un2 Aspergillus oryzae

         Supercontig 8: 71207-73019 (-) strand,

         216 bp from CYP65AB1 head to head arrangement

         formerly CYP-un2, suspected gc boundary at SSFQ

      MVNEVGTVYWPYVAALAVILMVAHRARRQHTIPAVGDANDSNLLEALKEGSQR (0)

      YPESCFQIATKDIPTVIVPLKCLSTIAYAPEEKLSLGREVYERLMGRYTKMVKS

      DHLAEFVRAGLMKNAGNSVALLQEEAERTVSSQIGHCP (1)

      DWKSVALFPTMVKLVSLHISRSFIQSPLSRNQEW (0)

      IDLTLDYAISTVTVAGKMSNTHWALRPFKGHFLPETAEMSRQFTRARELLRPTLEARLQQ

      RDEVPNDLMQWIINNYPDQEDDLTLHTRLQLEAVQAATYNLAFQ (0)

      LVHFFYDLLAHPEYLQPLRDEILSVSESCNGHWTPAALSNLRKCDSFLKESQRLNPIGI (1)

      VSVSRFALSPFRLPGGSTVPAGVSVSAPSMMVNL

3887  DDSLWTDPTSFDGYRFEKLRTIKGNEQKFQYASTS (2) 3988

4047  ASELNWGYGTHACPGRHYASNQIKLMIVSLLSRYEFQFDHEQTDKKAIVERPPNVVDGV  4223

4224  RIMPNPQTLVMVRSLGNVNEGCE*  4295, 71207

 

>CYP5286A1 Aspergillus flavus

40% to CYP685A2, 42% to CYP5237A1

EST CO136609 confirms the C-term

98% to CYP5286A1 Aspergillus oryzae

AFL2G_07510

MASPMKSDFLAGSHMKLPKIGIAAAVAVVASIVIYLALSSFFVGTD (0)

EFKNDENQSIKEYPDNTRFMRFTH ()

GKQLSKAGEDLAGSEPYLVRNGKSKELVIFAPEHLQEFHRKDANSHYKPENMNMGDYAGQ ()

LLGQCVGQLGGTKWKLARSHMDPEFSYRASRSMMKRFSQEIDSWVSHLSEN

PTRRSTQKDVFVQDVKKRCKDLSLRSIAISIYGETFSEE (0)

NYAFLSTMNELHEKIIFVAFLNKRVMSKWYNKLPTAEKRLMDSFQTQWKAFNLAQIKLARE (0)

KKLSCPAEKIYVGVEAGDMSLPE (0)

FLQSLDEMLFTNIDITGSILALIFQHLAKDQAMQKKLRAEISAHRAQPGYTVGDYISKQNTLLHFSLLESIRVTPAM (1) YFTLPECNASPKRIGGFHIPAHTPTIVDVNRLNKNESIWGTEADAFRPERFFGLDPARYRFGFVRWGIGRDKCLGKNMAEVILKLAILAVTDKYTLHVPPALPGQGEKSEAGFTINRDVEVEFRPAI*

 

>CYP5287A1 Aspergillus flavus

33% to 617D8

AFL2G_04005

Note: there is no ortholog of this gene in A. oryzae

MAFLAAYRLYLYPQFLTPFRSLSTP (0)

GRHWLWGNYLDRNENPIVYLRREAVLFYKEDIVRVYGPLNIEVLFAMSPR

AIRDLLCRRSKDFVKPRVAEKIFSTVGARGLVASNGNKHR (0)

LHRQQISAAYTPCNVREQCPIIVEQALRMAESMDAENKEQGRVYLWDILNRAGL

AIVCKTQLDTHFDPIRHETTVKKVLERFLFGISLGTCVKALMCCALPESIQTIVQPQVPGLADLKCFVRRIITEEKKQTQ

TRRRMSGKRATLLSCLLEGDIFGDGERVQQSVDFLLAGSATVTFTMQWALFVLSRDPDLQGKVRNEVRQCLPSPTTTRLD

EWSHIFLKRLDDGLPSLQAFCNEVFRCYPAISLTGREACCDTTLAGVYVPKGTLVLLSPPVANQNPEWWGPDAAEFNPAR

WLNGDGSFNSSAGGNQIHNRYTFLTFGQGPRSCIGQELGRLEVNIMVAIMLGKFEMQLADEQKEPVVMGILSPIPRDDVV

VHLRELHGW*

 

>CYP5288A1 Aspergillus flavus

38% to CYP52G6 Aspergillus niger

AFL2G_06019

Missing N-term (about 8 aa) in a seq gap

note: there is no ortholog of this gene in A. oryzae

ALLACIAFFYIFRRLTEGCKL

RKLRQSSSFRNPPRVQSRGPLGIYNVLERLRFRGDILDGYLARQFETYGFTHEIKELGLHAI

ITAQPENIRAILSTDFESFGPGKIRKRS

MAPLLGEGLFTVDGEKWKHARNMLRPLFVKSNITDMALVQRHLERILAHAIPDNDPAWSGWTEPVDLKSLFERFTMDTAT

ESIFGRSVDSQLWAQASFPMDEVDDSAASMTQNFARAFDVSLVGVVVRMITGRLSFLFKRRKFRSAFSFVQQYVSLQVHR

LLKDDLLQREGTKKPFLAVLMEAETLNETQLHEYSTNLLIASRNTTAALLSFTFALLSLHPDILEKLRSAILSTFPVDGH

PARTRDGFSSSTITAEKLLQCEYLQWVLREVLRLFPPIPITGVEAKKHTALPLGGGEDGEAPILIPKDQLVIFFPYFMHR

RRDIW (1)

GDDAESFRPERWAKSPPSWAYVPFSGGPRTCLG (1)

KQYALIHASYVVTRLLQSFSRIRPAHPTNNWLSAETESERSRLKVRSIRKSGFISLSVRNFQVQFWKDESS*

 

>CYP5289A1 Aspergillus flavus

34% to CYP5110A1  Aspergillus oryzae

93% to CYP5289A1 Aspergillus oryzae

AFL2G_09861

MDTMFSEALSRAVLHAPTVGVIATLSLIASFLIIFVSDLIHCGFKTWAV

RWAPCIAGKSLLSERFRLKKSMEDYYEEFADAYRK (0)

YSKNGKAFSISDNIGEGYIVMLPPQHYHDWYNVPRDHLNWGKAVNQ (0)

FSLDDLGIDLGWHIAPLTVQKCSQVDFI (1)

KRVEGPIGRELDRLLVENLTESK (1)

EWHLCSLFNTVVNIYSHIALLVVLGPEFSNHTALAEQLPLFNMQLSDRMGSEKSYPMF

FKPLVRKFSAKTRQVQSIMAEMKKTIVPEIRRRVEQRRRSTKQSTQNCFLDVMIELLL

KKGLLSHDAVKDDERHFDTMAIQTIFLLFEVLGGLTPATTSSLYQIMKTPEYLAPLREE

LAAALKQADNAWSFDIFKHTPKLESFTKECLRVFTPSGSY (2)

GGLVEKPLQLRSTGRTLSPGTKFSLPAQQAHLDPDNYPNPNIFDGYRF

CDPQSGACDIRGTITPSAKWLIFGIGTSACPARLLATRISQTLFFKVL

RKYDLRLKLDNGQPEVVYAATNMFVNFNTQMYVKSASI*

 

>CYP6001A1 Aspergillus flavus NRRL3357

fusion with diooxygenase, P450 (C-term) part may act like a hydroperoxide isomerase

EQ963473 fatty acid oxygenase PpoA, putative

Name revised from CYP6001A2

AFL2G_01904 Note: this gene model is fused to a ubiquitin-protein ligase.

Probably this is an error.

MAESESGGVINGLGKTVSQLEKVVSASLRPLPTETGDGSYVKES

NSTGIVRDLGRMDLSDVKTIVELTKNAATGEPLNDKHYIMERLIQLTSALPSNSRVGK

ELTNAFLNQLWKDLEHPPVSYLGREYSYREADGSGNNVLWPHIGAAGSHYARSVRPKT

LQSPALPDPETLFDSLLVRKDFKEHPNKISSILFYIASIIIHDLFQTDRNDATISLTS

SYLDLSPLYGNNQDEQNFVRTFKDGKLKPDCFSTKRVLGFPPGIGVILIMFNRFHNYV

VEQLASINEGGRFTKPDESDTKAYARYDNDLFQTGRLVTCGLYVNIILKDYVRTILNV

NRTDSLWSLDPRAEMKDGLLGEAAAQATGNQVSAEFNLVYRWHSCISQRDEKWTEDLY

KDMFPGRDPSSVSLQEFVRGLGKWEADLPEQPEDRPFAGLQRKPDGSFDDDSLVKIFE

DSVEDCAGAFGASNVPTIFKSIEALGIKQARSWNLATLNEFRNYFNLTPYKTFEEINP

DPVISDQLKRLYDHPDHVEIYPGVIVEDTKEAVVPGSGLCTNFTISRAILSDAVALVR

GDRFYTVDFTPRHLTNWAFSEIEPKDSVDQGQVFYKLVLRAFPNHFKGNSIYAHFPLV

IPSENKKILTKLGFAEKYSWDKPGLTPPPEFINSHSACMSILSDQETFKVTWGSKIEF

LMHRGKQPFGRDFMLSGDRPPNSASRKMMGAALYRKRWENEVRSFYEDITLKLLHRNS

YKIAGINQVDIVRDVANPAQVNFCANVFSLPLKTESNPRGIFTESELYQIMAVVFTSI

FYDADPANSFELNQAAREVTQQLGQLAMANVELVNNTGFIANLVSSLHRHDVLSEYGV

HMIQRLLGSGLPAEEIVWTHILPTAGGMVANQAQLFSQCLDYYLSEEGSVHLPDIKRL

AKVDTPETDELLLRYFMEGARLRSSVGLPRMVTKPTVIEDNGKKLNLKAGQHILCNLV

SASMDPTSFPEPEKVRLDRDMDLYAHFGFGPHQCLGIGLCKLALTTMLKVIGRLDNLR

RAPGPQGQLKKLSGPGGIAKYMNPNQSGFSPFPTSMKIQWDGELPQVER

 

>CYP6001C12 Aspergillus flavus

69% to CYP6001C1 Aspergillus nidulans

AFL2G_02242

MLRRISTNFKKSKNDRETKQNGTQNGAQNGTQVNGDKRQSKVSPARKSADQEPSRKAANGASVFGKYAQVLHASQSPLPN

QTGDGATFEQRHGSLVQDLKSLHLEDAATLKQLSMNKIKGVPVDDKTMLMEKIIQIASSLPDNSENRTKATNLFLNQLWD

SLPHPPLSYVGPEYSYRSADGSNNNPTLPWLGAANTPYARSIAPLTIQPGGLPDAGLVFDSLFAREKFNPHPNKVSSLFF

DWASLIIHDIFQTDHANPHINKTSGYLDLSILYGDVQEEQDLIRTHRDGKLKPDSFSEPRLQAFPAACCVMLVMLNRFHN

YVVEQLAEINENGRFTKPSPDLSEEKAKKAWAKYDEDLFQTGRLITCGLYINITLYDYLRTIVNLNRVNSTWCLDPRAQM

EGNDPTPSGLGNQCSVEFNLAYRWHSAISANDEKWTEQIYEELMGKPAKDVTVLDLKKGLGKYAMGLSKDPSERTFAHLK

RQEDGTFKDEELVSILANAIEDVAGSFGARNVPKCLRAVEIMGIEQARSWNVGSLNEFRKFFDLKPYERFEDINSDEEVV

EALRHLYGHPDYVELYPGIVAEDAKQPMVPGVGIAPTYTISRAVLSDAVALVRGDRFYTVDYNPRNLTNWGYNEVRYDLN

VNQGCVFYKLATRAFPNWFKSDSIYAHYPMTIPSENRNIMKDLGRESDFSYERPSFTPPHVNLVSYPNVKLALEREEDFR

VVWNGNTPLASAKGGDDFWSKSLDNDQWRNSIKEFYEDITAKLLQEKSGNLAGLKQVDITRDIGNLAPVHFASKLFSLPL

KTKENSRGVFTDNETFMSMAVIFTSIFFDVDKTKSFSLHHAARAVAEQLGHSVENHVKSINSPSFLSGIIGNRRNDHNAL

KEYGDQLIKKLLESGLGVSDVTYSQVLPAAVAMVHNQAQMFTQIIDYYLSEGKKHLPEINRLSKEDSKDSEDKLMRYCLE

GFRLNGTFGSYREAQTDLSMTEETGNVNIKRGDRVFVGAVKANRDPQVFPDPNEVHLDRPLESYIQYGLGPHTGLGKETT

LLALTSMLRVVGGLDNLRRAPGPQGELKKIHREGGYYVYLREDWGSYSPFPTTFKVHFDGAIPAPKKRLTYLGN*

 

>CYP6001C13 Aspergillus flavus

74% to CYP6001C4 Neosartorya fischeri

99% to CYP6001C13 Aspergillus oryzae

AFL2G_11739

MKGVPSSAEASNSSPGSSLPSQRAHEPLTHKQPTLDHPRKQSVQSISSEHGGMAENFSKITKVVQAARRPLPTETGDGTY

IEPENGGSLWRDLRALGIKDANTLKDLIENKAGGLVKGSGQVVDDKTMLMERIIQLVAKLPTESRNRVKLTNMFLGELWD

SLPHPPLSYVGDKYAYRSADGSYNNPTLPWLGAANTEYARTIEPLKVRPASLPDPGLVFDSLFARDTFNPHPNNVSSVFF

TWASLIIHDIFQTGHPDENFNKTSSYLDLSILYGDNQEEQNMMRTFKDGKIKPDSFSEPRLHALPAACGVILVMLNRFHN

HVVEQLAAINENGRFTKPPERILDPVEARAAWAKYDNDLFQTGRLITCGLYINITLYDYLRTIVNLNRDNTTWTLDPRAH

MEHDTVPTALGNQCSVEFNLAYRWHSTISRKDEAWTEQAYQAIVGKPGSEATVEDLMSGMRRLGANMPKDPSKREFAGLK

RQSSGKFKDEELVDILTMAIDEVAGSFGARNVPKVLRSVEILGMEQARRWNVGSLNEFRKFFDLKPYQSFEEINSDPEVA

DQLRHLYEHPDNVELYPGIVAEEAKKPMIPGVGIAPGYTVSRAVLSDAVALVRGDRFYTKEYNSRNLTNWGYEEANYDLE

INQGCVFYKLALRAFPQYFKQNSIFAHYPMTTPSANRDIMKMLGREEDFSWDRPSYTPPRTTLFDYANVRRILEDSSNFR

VIWDEATGYVFGKGGYDFMLSGDSPFHANQRRIMKESLYRSQWHEAVKEFYLEITEQLLSEKSCRVGNVNQIDISRDVGN

LAHVHFASNIFSLPLKTKEHPHGVLTEHEMFDVMSIIFTAIFFDVDPSKSFRLRHMARKAAETLGPLVEANVKAVSSASF

LSTLIDGIRTNKNALSGYGVHMIRRLLDHGLDASEVTWSQILPTAVAMVPNQAQVFTQIIDYYLSDEGKEHLLNIQQLAK

EDTPASDEMLLRYVMEAIRLNGIFGSYRKSHTNLTLDDKNKMVQIKPGDTVFVSFVDANRDPNVFPNPKKVDLNRPMESY

IHYGVGPHTCLGGEASKVALTAMLRVVGRLKNLRRAPGPQGELKKIPRDHGFYTYMRADETSLYAFPMTWKLHYDGTIPG

RERSVPEKLTCNVPGHWHD*

 

>CYP6003B1 Aspergillus flavus

99% to CYP6003B1 Aspergillus oryzae

AFL2G_03725

MGWLSTTTKSSWNPFSTGSSGSSLDSGGSLASLAFGSKDQKWFQSVLSKFGFNGVLATVLSFFLYALYLKFVNHDEKGLQ

TLIKEKASQYLGKIPGLNKLSFLKGHLPLGKFSKSLIPKATKGALGSIAGSSGGILSKLNPFNWKIFNKRKIAEEEDDMR

YQAGEPYGDPEVLAPTLRDDLKAVGLKAGVQDLKVLLDVVKNKGKPIDDRDLTMEKLIAIVSSLPRNSKAREKLTGVLID

TLWQSLPHPPMTYLGNKYQYRTPDGSYNNPLQPDLGKAGSPYARNVPKLKHMHGVPPDPGLLFDLLMARSDETFKENPAG

LSSVLFYHATIIIHDIFRSNRFDPNISDTSSYLDLAPLYGSSLEDQMKVRTKVRGLLKPDTFSEKRLIGMPPGVNAILVM

YNRFHNYVADNLLKINEGGRFSLPATKSEEDKKAALAKQDEDLFQTARLVTNGLYVNISLHDYIRGLANLHHSSSDWTLD

PRVKINKIFDSEGVPRGIGNQVSVEFNLLYRFHSIISRRDEKWMNEFFADIFGQDKKVDQLTPQEFIQGLYRFEQSIPED

PSEREFGGLKRGENGKFSDADLVQLMKDSMEDPAGCFGARMVPKALRVIEILGIIQARKWQLASLNETRDFFKLKRHETF

EDVNSNHEIADLLRKLYDDPDMVEMYPGLFLEDIKPRMDPGHGGCTPYTVGRAVFSDAVTLVRSDRFLTIDYTASNLTCW

GYNEVQQDYDILGGSMFHKLFQRALPNWFPYNSLHITQPMYTRKMNEQIAREIGTIDEYTLDDPSPPPKTVIVTKHSTIT

KLSKDQANFRVIWAKYLNEMIPGRDFSDYMLLGDKPANTAQKTLVKEILYSPAEFVQLLSETAVSVAKEQLATETLNLTS

ELHQVDIVRDVAIPMVTRILADLFCLDLKTPENPNGTYNVAELYKYIIDVRIFGFNNDDPGLALQRRKWAREGAESLTKT

TLKVVSNLPASEKSGKGIVKGAVSTAKSIASKIPLVGKLVGDGKGVEGQSTSGSLRWYGYNVAKELIASGKTPAEVADIS

WMNAVGGVGATIGVFTDVLNYFLQDENSHHWEEIQKLAASSDLESSNKSLRQYVLEAQRLTSTQRSIRLCAGKAVIDGQS

FEPGNLVICLLGAACKDPDAVPDPEAFKLDRPSSAYIHFNVGPHECLGREIALSCITSLVRVCAGLKNLRAAPGQMGVLK

SITTGTEKHFLNDSWSTLTVDPTTWKIHFEGQGQGIHHPPKIPVTAGRDLNALSNALKKQHQDKLQETVSKVANGVTAPL

TKLIPSNGPSNGASTPGHLPLPINPFQNGNGNSNGVANGNTHPSLLHQAVSSAAAIPQHALGTVHDVAHNTVGHLPGGQQ

VTDFTHGLVHPFAGAVSPGQTQTPPQGQTQPHQGNWFFLPHGMENAAKQVPGHPFGQTA*