Aspergillus terreus P450s

 

D. Nelson

 

August 7, 2009

 

126 sequences

 

>CYP51F1  Aspergillus terreus NIH2624

         XM_001212028.1

         ATEG_02850.1

MGVFADIIGTLCEHCSTLSIWALGGAVLLAVFVLSVVINVLRQL

LFKNPHEPPVVFHWVPWIGSTIRYGIDPYKFFFECR AKYGDIFTFVLLGKKTTVYLGT

KGNDFILNGKLRDVCAEEVYSPLTTPVFGRHVVYDCPNAKLMEQ KKFVKFGLTSDALR

SYARLITAEVDDFVKNSPTFQQPKGTFDVCKTIAEITIYTASRSLQGKEVRNRFDSTF

AEMYHDLDMGFAPINFVLPWAPLPHNRKRDAAQKKMAETYMEIIKER RQAGGKKDSED

MVWNLMSCVYKDGTP LPDEEIAHMMIALLMAGQHSSSSTASWIVLRLAENPEITEELY

QEQLRVLGSDLPPLTWDSLQKLDLHAKVIKETLRIHAPIHSIMRAVKNPMPVEGTPYV

IPTSHNVLSSPGVTARSEEYFSEPLKWDPHRWDETAAPSTEEEEETIDYGYGLVTKGT

NSPYLPFGAGRHRCIGEQFAYVQLGAITAALVRLFKFSNPPGANKLPDTDYSSLFSKP

LGKSYVQFEKRETNTKA

 

>CYP51F1P  Aspergillus terreus

71% to CYP51F1 Aspergillus terreus

ATEG_10302.1 revised

MGLFAAALDKICKQCSTQAIYMLSGVGVITTLVLSVVINVLIQLSFKNPNEPPVVFHWFPLIGSTISYGTDPYKFFFECRRK (0)

YGDIFTFILLGKKTTVFLGTKGNDFVLNAKLHDLCAE*VYSSLTTPVFGNHVVYDCPNFKPMKQKK (0)

FVKFGLASDALRSYVELITKEVDEYITNANAFKQPRGTIDVGKVIADITIYTASRLLQGKEVREKFDSTFAELYHDLD

MGFAPINFILPWAPLPHNCKRDAAQKKMAQTYMEIIQKRR

*SGGEKNSEDMVWNLMSCVY

KDGTPVPDIEVAHIMIALLMAGQHSSSSTISWIILRLASQPEITEQ

LYQEQIRVLGADLPPLTYENLQKLELQTNVIKETLRLHAPIHSMLRTVKYPLQVEGTSYVIPNSHNVLSSPGFTA*SPE

YFSKPLDWEPHRWNGVNATG

DDEQVDYGYGLVSKGAGSPYLPSGAGRHRCIGEQFAYVQLCAICVALVRELKFKKLPNVEDVPATNYSSLFSRP

WANSVVQYERRDAAAKD

 

>CYP51F2  Aspergillus terreus NIH2624

         XM_001215095.1

         78% to CYP51F2 Aspergillus fumigatus

         ATEG_05917.1

MSLLTITSYAAVGILALIAWNVIRQLLFQNKSEPPVVFHWIPFL

GSTISYGIDPYAFFASCRQKYGDIFTFILLGQKTTVYLGVQGNEFILNGKLKDVNAEE

VYSPLTTPVFGSDVVYDCPNAKLMEQKKFIKYGLTQAALESHVQLIEREVLDYLRTSP

NFHGASGVVDISAAMAELTIFTAGRALQGEEVRRKLTAEFADLYHDLDKGFTPINFML

PWAPLPHNRKRDAAHARMRAIYMDIIRERRAHKNPDQVEAGSDSDMIWNLMRCTYKDG

QPVPDKEIAHMMITLLMAGQHSSSSISAWIFLRLASEPRVLEELYQEQVASLGKPDAD

GVFPPLQFRDLDRLPLHQNVVKETLRLHSSIHSIMRKVKNPLPVPGTPYVVPTSHVLL

ASPGVTATSDEYFPNASRWDPHRWENQAEPDDDGEMVDYGYGRVSKGTASPYLPFGGG

RHRCIGEKFAYINLGVIVATVVRHLKLANVDGRKGVPQTDYSSLFSGPVKPAIIGWER

RFPTA

 

>CYP52G9 Aspergillus terreus NIH2624

CH476602

62% to CYP52G2

complement(join(1144551..1145711,1145779..1146177))

ATEG_06678

GenPept EAU33222.1

MATLLSISVLAVVVLRLFWTLAAKFNHARKARRWGCAPYPTYPS

DLLGIGLLKETLAADKADVLCPMFERRIAHISAREGRHVATLSWMSLGRETCFTIDPE

NVRAVWATQFKDFVAGDLRWNVSHQLTGKNIASTDGAEWARYRALLRPQFSRSQISDL

DLEERHVQKVMLAIPVINGKWTEPVDIQEIFHRFTIDSSTEFLFGKSVESQISAITGQ

KTAEADFAHHLDKSMEYIGKRARLDKLYWLANNQESRFSESEVHKYVDRYVQDAIKAG

QEGKLQADPERSPQYILLHALTTATQDPIELRNQVLTLLLAGRDTTASLLSWTVLLLA

RHADEFQKLRQAVLEDFGSYDNPHNLTFGALKSCSHLRHCLNESLRLYPVAPFNRRIA

VRDTTLPRGGGSDGRQPIFVRKGQAIMFSAYSMHRRRDIWGPDADDFRPGRWEARKTL

WEYLPFSGGPRICLGQQFALTEAGYVLVRLVQRFDAMEDVNAETEIKQKVTLTSAPAQ

SVTVRLHAPRA*

 

>CYP52G10 Aspergillus terreus

68% to CYP52G4

ATEG_07540.1

MHTLLFVPALVLAGIAVRLVISFALSWRKARNARRLGCEEAPLYPSKDPFGFSNLLETLRADRAKVLPELAERRIDLLSQ

RHGRYISTFRVRQPGKESLFTADPKNIQAMLATQFKDFGLGDGRRNVGGPLVGRGIFTTDGEAWSHSRSLLRPQFTRAQV

SNLDMEERHVQNAMRALPVLSNGWTRAVDIQTIFFRLTLDSATEFLFGKSCDSQLAAVRTDVGRGSDSFLYGFDRSVWYL

SERLRFDRFYWLVDNREFRESIRMVHAFVDKYVNAVLERQAGDTKLPDSSQSTSQYVFLEALAASSKDPLQLRYESLNVL

LAGRDTTASLLSWAVLILARRPDIFSRLRKDIVEQFGTYKTPRGITFASLKSCQYLQHFINETLRLYPVVPFNRRCALRD

TTLPSGGGKDGSSPIYIPKGQQVLYGSYVLQRRKDIWGDDAEAFNPDRWIGRKVTWEYIPFNGGPRTCIGQQFALIKTSY

VLVRLLQRFDSIVDVHADQEIRYGVALTCAPADLVTVKLHEADD

 

>CYP52H6 Aspergillus terreus

75% to CYP52H5

ATEG_02198.1

MLAPIGLVFGALYLTYFVLQYIQRLYQQRKFAKARQCLPPREGAAGLFGITPFIRLAKAVREKRWVEYIADQYSINGTTF

SQAMLGQRMISTIDPENLKAILATQFNDFSLGTRHREFYPLLGDGIFTLDGAGWSHARGLLRPQFTRDQVADLDLMNGHV

SRLIELVPKDRSTFDIQHLFFLLTIDSATHFLFGESVNSMGSGVLEKSAVGGAQGFAEAFNTAQDYLASRSRAMKFYWMV

NPKEFKDATARVHEVVDHYVRLAIESKNHPERKEAGRYIFAEALAADNDDPKVLRDNMLNILLAGRDTTASLLSSTFFFL

ARSPKVWNRLRETIINEFGDSQNPKSEITHTKLKDIPYLRYVLNEVLRLMPPVPLNFRTATKDTSLPVGGGPDGRSPVFV

PKGTTVTYSVYAMHRRPDFYGPDPNEFRPERWEENGRRGWDYLPFNGGPRICLGQQYALTEASYTLVKLLQHFDTLENAD

PTLLRPVIQSNLTMSHETGVNVRLYRAGTA

 

>CYP52T1 Aspergillus terreus

48% to CYP52G2

ATEG_03903.1

MNHPTVLAAILALIYVVYKCVDSISDRRKAKALGCQPVPVLKNRLPLGLDHAYRAFQAIKAGQMPDHQVQVYKEVGRRTF

AGSSLGASYIHTVEPKNIQAILATQFHDFELGDLRRKVFFPLLGNGIFTSDGKAWEHSRAMLRPQFTRGQVADLELEERH

VQELFRLMPTDQSGWTQQINLTPMFFRLTIDSATEFLFGVTVHSQRHTSSQQPATDTDAFPWKDLARHFDESTKHLGVRS

LFQELYFLYNPSSFRNNIKEIHRFADFCIQQGLQRLDQQKSSAAQRYIFLDELLKVTRDPVEVKSQLLNILIAGRDTTAG

LLSWTFWLLAQHPAVYSKLRARVLEDFGPDAGRPDRITFAALKACTYLQHVMSEVLRLFPAVPLNARRAARDTTLPLGGG

PDGKAPVFVKKGHEVGYSVYVTHRLEEYWGPDAARFNPDRWVDRKHGWDYLPFNGGPRICLGQQFALTEAGYVIVRLLQR

FDQVELAEPATAPSHNYGITDAPHDYMIYLHEAGSKGG*

 

>CYP53A22 Aspergillus terreus

85% to CYP53A12

ATEG_07877.1

MIADLAAINPAYLLLAAVAAYYIVPYLKRWHLRSIPTPSVAGFTNLWLLIQARRGNRFEVVDNLHKKHGKLVRLAPRHVS

IADDAAINAIYGHGNGFLKALSDFYDAFVSIRRGLFNTRDRAEHTRKRKTVSHTFSMKSIGQFEQYIHHNIELFVKQWTR

LSETQGNPRSGYATIDALNWFNFLAFDIIGDLAFGAPFGMLEKGQDIAEMRKSADAAPTYVQAVEVLNRRGEVSATLGTL

PALIPYAKYIPDRFFKDGIQAVENLAGIAIARVNERLRPEVMANNTRVDLLARLMEGKDANGNKLGREELTAEALTQLIA

GSDTTSNTACAILYWCMSTPGVIDKLHKVLDEAIPADVDVPTHSMVKDIPYLQWVIWETMRIHSTSAMGLPREIPAGSPP

INISGHVFYPGDVVSVPSYTIHRSREIWGPDAEKFVPERWDPARLTPRQKAAFIPFSTGPRACVGRNVAEMELLVMAGTV

FRLFDFEMQQKGPMETREGFLRKPLGLIVGMKRRTPA

 

>CYP55A17 Aspergillus terreus

73% to CYP55A13 Uncinocarpus reesii

ATEG_06140.1

MTTTRAVSRPSLWAKYRPVPRPRFSYVSFNSLAGFTSRSGPLREAAAGTQ

TDAPEFPFARPRAAEPPAEFAKLRSSCPVS

RVKLWDGSLPWLVVKHEDVCNVLTDTRLSKERSRAGFPEMNPGGKAAAKNRPTFVDMDPPNHMRQR (2)

RSMVSAFFTPEYIDSMKPFIQSTVDNVLNDMIAKGCDEPVDLVERFSLPIPSI (0)

IIYHIIGVPTEDMDYLTQKNAVRSSGSSTAAAAQNANEELLAYLGSLVDKRIADPKKDLISTLITEQ

LNPGHLDRLDVVQLAFLLLVAGNATMVNMINLGVVTLLEHPSQLEELRRDPLLARKFVEELCRFHVASSFATRRVAKVDI

TLRDKHIKAGEGIIASNQSANRDEDVFPDPDTFNMHRETDSEQNLAYGYGDHRCIAEGLARAELEAVF (1)

SCLFRLPNLKLGVPHDQVRYSEAHKDVGIDELPVTW*

 

>CYP58E3 Aspergillus terreus NIH2624

AAJN01000124.1

93% to CYP58E3 = ortholog

ATEG_04417.1

36715  MLFQDLSFPAAIGAVFGAVAISVAARCIYDLFFHPLRNFPGPKRAAIWSFYEFYYDVIRD  36894

36895  GTYLWEIEKMHQKY (1)

36993  GPIVRINSRSLHIHDPEYFNTIYAGSGRKVNKELSAVSGYTFPHSTISTLDHDLHRKRRA  37172

37173  IVSPYFSKRAIAEIEPVIHERLNVLISRLAEAKGSIVDLTSAFSAYTADVVTYHFYGTHA  37352

37353  NYIGSKDFKYGLKDALTVLLNLYNLTRFLPVPANTLKNLPLPILGLINPNFPLVVSAREA  37532

37533  NKKMVLGYLNKPDEDKKAMKDARSKSVIVSALTDPNVPDAEKTLDRLLDEGETIIFAGID  37712

37713  TTARTLGVALFHLLNNKDVLMKLRKELQAVAKPDGQQWTTTELEAVPYM  37859 ()

37910  RGVVQEAIRLAYGLVVRIPRISPHEALRYNGFVIPPG (0) 38020

38074  TPVSQSTYLVNNDPSVFPNPQVFDPERWVKAAQDGVSLDKYMVSFSKGSRGCLGI (2?) 38238

38301  NLAYAKLYLGIARVATSLDMELFETTAKAISVYHTRGFAFPKEGDGAVKARVMGLCK*  38474

 

>CYP58F3 Aspergillus terreus

68% to CYP58F1

ATEG_04068.1

MASLILWGLASIIVWFALRSIYRLYFHPLSKFPGPKLAAITSGYEFYYNVVRRGMFIWEIERMHQQYGPIIRVSPREIHI

KDPDYYDEIYASSARKREKDPVVVAQFGLDGSAFSSVSPEDHRQRRAPLDKFFSKQAVTNMEHIIHECLDKLSRHLQDAC

ESHRAVSLDAGFAGLASDVIHQYAWGFNSGNLDAEDFNEHVRDGISGLFRMAHVMFFFPILQTITNAMPLWLLEKVNPFA

FAMASQKHDLYQRAVAALHNSGTKSGRGSIIDAIAGPSMPANMRTPERLMNEGFSLIIGGTETTARSLSLCFYNLITNEP

VRTKLREELRQVMPAPDSQPTWNQLEKLPYLSGVVLETLRLSTGIASRSPRIAPTEALEYKGYVIPPGTLVSETNYFILM

DPNIFPEPHVFDPERWMRAAAKGERLDRYLVNFSKGSRICLGMNLAYAELFLVIATMIRRFDFELYQTSKKDIDFVRDFG

TPYPDEGNFGIKAIVTRVLND*

 

>CYP58M3 Aspergillus terreus

55% to CYP58M1

ATEG_02828.1

MSLHSSMASFSLLGLAYLVLRSIYRLYFHPLRHIPGPRLAAISSLYEFYYDVVCQGRYLWEIERLHAIY (1)

GPIVRINPREVHIIDPSFYDEIYAPSSRRRDKDAKWVPTFGLSQS

MLSTVGHQQHRFRRSLLSSFFSKKSVLQIGPLIDQQREKLFQHLVNFHRTQEVVRLDSAFVALTSDIISAYCYGESGNFL

DDPSFRSDIRASVVDAASICHLARFLPFLQPLIQSVPEGILRALMPGKTALLDFEHSLASKASKALHEGKPSAAAEETIY

DRLTDKSVPPEERSLCRIQDESSLVLAAGTETTARILTIAIYYLSRDQSMLDKLRAELKQALPTPTSLTTWVQLEKLPYL

TAVVRESLRLGFGITCRLPRVAPEEVLRYKGYEIPPGTAMSTCTMFVHRNPEIFPDPDRFDPERWIEGGQLNNKLTKYIV

SFTRGSRICLGINLAYSELYLLIAHLARRFTFEIYDTSEDDVRVTRDLMVGYTRRGDLQVYAKVAEVVQE*

 

>CYP58M4 Aspergillus terreus

57% to CYP58M1

ATEG_03531.1

METQTLWGILLAFSVYQFFKTIYRLYFHPLSKIPGPRLTAATHLYEFYYDVILGGKFLFQIEKMHQTYGPIVRINPREVH

ISDPTFYDEIYASSTVKRDKDPHLVRIFGAPFSMVGTVGHEHHRFRRSLLNNFFSKRSVLELSPLVTERVQKLMERFEGL

HRSNAVVSLDDAFSALTADVITAYCYGKCWMFLEDESFRNDIRKTVSDMTSYMHINRFFPLVLSAMRAIPLWLLAVLQPG

KSSLLKFQEDIFKETVDSVRDRGKSLSGEKSNPARSTIYDKLSDPSVPPEERTLQRIQDEGVILLSAGTETTGRALCMAA

FHLAYDKSITNRLRDELRQVMPRPTDTVSWTELEKLPYLNGVVYEALRLSYGLIIRLPRISPTDALQYKDHIIPPGTPMS

SSSYIVHRDESIFPNADKFDPERWIRAKNEGKNLSRYLVSFTRGSRTCIGMNLAYMELYLTLASFVRRFDIELHDTTPED

LRFTHDLGIGFTRRGDMQVYAKVTGVVEN*

 

>CYP58Q1 Aspergillus terreus

49% to CYP58M1, 48% to CYP58P1

ATEG_02820.1

MAVTLPLIVALAFLWFGSKAIYRLYWHPLSHIPGPKRAAISHLYEFYYDVIRGGTYLF

EVEKMHQKY (1)

GPIVRINPREVHISDPDFYDEIYAPAARVRWKDPKQVPMIGAPFSMGA

MGATWHHGHHRFRRSLIKNHFSRQSIEKITTTIRKKAEILCGRLEEASAIARPLNVSDAFAALTSDIIAGYAFDIDLGFL

EDPLFRNDVYRSALELDMLCHVLKFFPFLLKPVRWLPSSVTEVLGLQNKSLGSLQEVIDQRIISSLRTTGQSGHAQEKER

DSIFTSLCHQEVPPEERTLERLRDESLVLLIAGAEATARALAVFVYYMATGSINVQKLRQELRQVMPTCTSQASWAELEHLPYL (0)

SGVVNESLRLSFGAIGRLSRIAPTEDLRYKAHPIPRMTPMSSSAYLIHRNADVFPE

PDCFRPERWIGAAASGVNLHRYLVAFSRGTRQCIGINL

AQCQLYFTIAAVARRFDFELFETTEEDIRVARDYITAFPKDGLFDVKVTVRSRLGD*

 

>CYP61A1 Aspergillus terreus

87% TO CYP61A1 Aspergillus niger

70% to CYP61A1 Aspergillus terreus

55% to CYP61A6 Aspergillus terreus

ATEG_03815.1

MATVNGSFVSPSADATIVPQLFAPSGLIGSVLEGFTVWKALLTLFLAAVIYDQLRYFWLKGSIVGPAMKLPFMGPFLQSV

NPKFHEYKAKWDSGELSCVSVFHKFVVIASTRDMSRKIFNSPAYVKPCVVDAAHKLLGADNWVFLDGRDHVDFRKGLNGL

FTRQALSCYLPRMEEVYNDYYARFLKKSKDVNYKPVPWMPEFRELMCAVSCRTFVGHYITDEAVQKIADDYYLITAALEL

VNFPIILPYTKTWYGKKAADMVLEEFSKCAAKSKARMAAGGDISCIMDAWVKQQLDSARYRENVAKGVPVDENEKPAQVL

RDFTDYEIAQTIFTFLFASQDATSAACTWLFQLMADRPEVLDKVREENLRVRNGDVNAPLTMDVLESLTYTRAVVKETLR

YRPPVIMVPYLVKKDFPVTDKITVSKGSMIIPSVWPATHDEEAYPNADSFDPDRWITGTAEQQSKNWLVFGTGPHYCLGQ

NYATLNLMAMIGKASMEMNWEHTPTPQSEDIKVFATIFPQDDCLLTFRPRA

 

>CYP61A6 Aspergillus terreus NIH2624

AAJN01000026.1

76% to CYP61A6 Nectria haematococca

ATEG_01083.1

       MNVKMQADMANSTQPDRQIWHVTTHWQGKVSDSFSGWSACQYIVTILLGVIFYDQ  (1)

44968  VMYIKRKGSIAGPTFKMPLMGPFLQAINPKFEEYLAQWASGPLSCVSVFHK  (2)45120

45171  FVVLASDRDLAHKVFKSPSYAEPCLVPIAKDILGPKAWVFLQGKAHAEYRRGLTPLFT  45344

45345  NNALATYLPVQDKVFATYFDKFVAASAANNGRPMEFMTMFREINCALSCRTFFGDYISQD  45524

45525  AVKKIADDFYLVTAALELVNIPLSMYVPYTKPWLGKRTADAVHAEFARCAAACKANMASG  45704

45705  AAPTCIVDHWVLHMMESNRYRERVAAGEANVEKPTNLIREFTNEEIGETLFTFLFASQDA  45884

45885  SSSATTWLFQVLAQRPDVLDRVRDENLAARGGDKSKPFDLPMLEGLTYTNAVVKELLRHR  46064

46065  PPVIFVPYLATKNFPVTPSYTVPKGSMIIPSCYPALHDPAVYPDPDVFEPERWISGDAES  46244

46245  KGKNWLVFGAGAHECLAKRYVPLSMAAMIGKAALELDWTHHATERSEEIRVFATLFPM  (0) 46418

       DGCQLVFRKRS*  46499

 

>CYP61A10 Aspergillus terreus NIH2624

NW_001471411.1 AAJN01000002.1

72% TO 61A1 A. ORYZAE, 55% TO A. TERREUS 61A6

70% to CYP61A1 A. niger

formerly CYP61A1, but a better match was found in A. terreus to CYP61A1

ATEG_00175.1

247642  MDFISKNTSPIIQKFQSPGIVAIFGSDISIWMVLLTVLITAVVYDQ (1) 247780

247843  FKYIRLKGTIAGPSWKIPFMGPFLESMDPKLEGYMAKWRSGELSCVSIFHK (2) 247997

248055  FVVIASTREMSCKIFNSPMFVKPCVVDSAHKLLGKDNWVFLDGKEHVDFRKGLNLLFTR  248228

248229  SALACYLPRQEEVFDMYFERFVARSAANNYKPLPWMPEFRKLMCTISCRTFVGHYISESA  248408

248409  LDKIAHDYYLITAALELVNFPIVLPFTKSWYGKRAADMVLREFSQCAAKSKLHIASGGEI  248588

248589  TCIMDAWVKAQLDSAAYRKNVAAGIPCEKPSHLLRDFTDYEIAQTVFTLLFASQDAN  248759

248760  SSAITWLFQIMADRPDVLDKLREENLRARNGDCNARLSMELFDKLPYTRAVVRETLRYRP  248939

248940  PVILVPYIAKKDFPITEKYTIAKGSMVLPSIWPATHDAEAYPNPDSFDPDRWITGTAEQH  249119

249120  PKNFLVFGTGPHYCLGQTYVQMNLMAIIGKASLALDWKHHITPDSEQIKVFATIFPQ (0)  249290

        DDCLLTFRRQPGS*

 

>CYP65T5   Aspergillus terreus NIH2624

          NW_001471196

          68% to 65T4, 62% to CYP65T1

          ATEG_08832.1

MALQEFLPVVPAISVLYIFLLAIWNLYFH

PLRHIPGPRSWIAFPIMRHISASRGRLDSDMRRFHAQYGGAVRLAPAEVSFITPDAWKTI

YGHGHTQLPKVQTSESKGLDIISSEGPNHTRHRKALAHAFSARGLQAQEPLVRGYVDKLI

ERLKEFAESQLQVDMVKWYNLTTFDLIGDLAFGESFGGLDNSRVHSWVSTIFRSVKVLPF

VRITDTYPILIPLLMALLPKSLRTARRDQTNYSKETVHKRLANTAAHGRGDFMDSMLRHR

GEKDGLSDRELEENASILIIAGSETTATLLSGVTYWLLRSPEALAKVTDEVRSTFQTEGE

ITLQDVGARLPYMLACLDEAFRMYPPVPCALERRVLTPIVIAGYNIPPG (0)

TVVSVHQSAAYCSPANFHRPQDYIPERWLPDAKSNPSSPYFSDQRDVLQPFSVGPRNCIG

KNLAYAEMRLILARVLWNFDLELCEESLHWKDQKSYLLWDKPPLMCKLKQRI*

 

>CYP65V6 Aspergillus terreus

57% to CYP65V5

ATEG_02650.1

MAVLTGDPSSLLAVAVGL (0)

VIVHITAKALYNIFFHPLRSFPGPPSHAAFRFPYCYK

LLRGTFPFDMLSLHRQYGDVVRVAPNELAFSHPDAWRDIMGHRIDGSDEMGKWDQFYRAVPQTPTSIVSADRTEHGALRR

QLSHGFSERAMRAQDPLITGYVDLLIQRLHENCRGGAQTVDMTAWYNFTTFDIIGDLAFGQPFGCLEKSEYHPFVPLLFK

SSRMGSVVFSLSFYPMLKKLVFAMIPKSLIQLFEDHRQVSIEKLRERMKLEVERHDLIEGLLRKKDDLVCLG &

MDHLEANANVLLIAGSETTATLLSGVTYLLLMNPEALSRLTEEVRDAFNSEAEIDMQS

VSRLPYMLACLDEALRMYPPVPNGLPRVVPKNGAQIAGKFV ()

QTPVAIHHWASYHNEKYFADPFNFHPERFL

GDERFANDRFDILQPFHVGPRNCLGRN (2)

LAYTEMRLILARVIYNFDMKLADDSTDWLKRQKVWFFWNRPALNVYLTPVKR*

 

>CYP65AD2 Aspergillus terreus

AAJN01000140.1

60% to CYP65AD1 Aspergillus flavus

ATEG_04967.1

MAISHLLTPDMTDFSLVTALGTVIAL (0)

29486 (0) GVLWTIGSAVYNVYLHPLSRYPGPRLAAASRLWFCWHLIRGELPFVIHELHLKYGDIVRVAPDE  29295

29294  LSYTHPDAWNQIYGLRPGKREIMKDPTFYSS  29202

LPSGKGSIVNAVRERHGHLRKLMSYGFSERALREQESVVRFYADFFHQRDHGDIG &

GKGVRWIWVRWYN (0)

FFTFDVMGHLVFGESFDCLQSTG

YNPWVALIFDSVRIGGLLRSIKFWPWLTPIVQHLVPAKLQERRKEQKRIARQKAAYRKSI

EDGRRDLISSLLQPDSGVTDAEYQSTVESLIIAGSETTATLLAGVTFHLLKNPDKSKRAT

MEVRNAFSSPEEITFVNVNKLPYLIACLTEALRIYPPVGDGFPRNTGENTEVILDERVPPN ()

TLVRVTHWATFHSPSNFARPDEFIPERWLEGEHGFENDRKSAL

QPFHVGPRNCIGRN (2)

LAYMEMRLLMALVLFRFDMELCDVSEDWDK

QKSFLLWAKPELMVRLSPRTV*

 

>CYP65AG3 Aspergillus terreus

64% to CYP65AG1

ATEG_08791.1

MAGWNILLTTAIAGLVCRIVYRVLLHPLSKYPGPKLAAISNLPYTKWSVTGQLHSRIRELHERHGDVVRIRPNSLTFSDP

QAWTDIYGHRKAGAPPFRKDPEFYIPSSNGSTNLINSSEADHARQKRLLTHAFSERSLRDQESLVMAYIDLFITRLGELA

NNSQDVDLLHWLNYLTFDIVGDLAFGEPFGCLKDSAYHPWVAILFQSIKTGALLRALTIYPTLAKIIRYFMPKSLLRKRA

DHYRLSKEMVTRRLDMDTTRPDFISYILKYNDERGMSRSEIEVNAALLIAAGSETTATTLSACVYYLQKNPECYKALTEE

VRQAFSKDEEITFLAAGKLPYLNAIIEESLRMYPPAPAIGPRLVPEGGAVVNGEHIPGG (0)

VSVSVAHYPTFRSSSNFAEPDSFLPERWLRDNEDSRFRNDKREALQPFSYGPRACIGRN (2)

LAYAEMRTILSKLIWHFDITLDPRTTDWDNARSYIVWENKPLWVRLTPTSAHLSSK*

 

>CYP65AK2 Aspergillus terreus

68% to CYP65AK1 Aspergillus niger

ATEG_04213.1

MFVEALSQVSFEHLPHIVLGTVCVPIPPVHGLQLTSVHSLQLVFAAIAKITYELLINPLRKYPGPKLASVTRAPYIYHTI

KGDLVQWIHNLHTVYGDVVRTAPDELSYATGDAWKGIYGHASAGKKATEKDMRFYGPSFNDTPDIIRASGPDHARFRRNF

SNAFSDRALREQQSLICRYVDMLIEKIKVEIEIDPLAKVEMVRLYNLTTFDIMGDLTFGDPLDLLKGTGNTGWVSSVFSS

VKRGAFRRASRYYPWAALLVKLSVPRSVIEKAANHFRACVERVDWRVNQKLDKPDIWGLVLDQKENLRLTRAEMHANSQV

FMLAGTETTATALSGLTYQLLLNPDKLERITKEVRDTFKQDSDIDITTLAQMKYLNACIEEGLRMYPPVPAGLPRLTPPE

GMVICGEYVPGKTAVSVAQWATYRNPKNFKRADEFLPERWTDPSFSTDDKSAFQPFSFGPRNCLGKNLAYHEMRLILAKV

LYNFDLVVAPELVGWDKQKSFTIWEKNDLMVQLKPRD

 

>CYP65AP4P Aspergillus terreus

some parts are 76% to CYP65AP1 Aspergillus niger

ATEG_04921.1

LYFHPPSRYNGPLLWALTRVFYMLAFRSGQLAHKIKQFYEQYGD

TVRVPNEVSFINSDCVSDIYS

LVTGHVGKTIVQLKTRAAAATPVDLQRWISYCTFDVICSLS

FGEDFGCLEHNRYHEWVGVQVYSLNAKVQLAACRFYRWLFRLLVRSMLASAQVAMAKHQA &

PVFNAAI

KEGIRLTSLVLLGLTRRAPSGGAIFCGAYFPEGTVVSYMQWAANVSAKNFTDPTEFTLERWLPPVGPRYQHDRTDATQPF

LQGPRDCLGQNLAKMEMALTVGRLLYEFDLSVPAG &

WEEQETYTVWVKSPLGVQMKGVVM*

 

>CYP65BA1 Aspergillus terreus

43% to CYP65AF1

ATEG_07093.1 fusion gene revised

MTILADF (0)

VYLLASVGYDILFHPLANYPGPKLRAASLTPYLWALISGRHHTSVSDLHRQYGPVVRIAPNKLSYITPQAWKDIY

GHKKANEPEMAKDAKWQVADPNSPSTREQHGHYRRLFSNGFSNRSLREQEPLLQGYIDMLMDGLERAARDKHPVDIVQWF

NWTIFDIIGDLTFGESFECLEKATLHPWVGNMFQAIKGNMLIRVMQETPGLGPYTAGILRYVLPGKALKKREAHFQYTRE

KVNRRLGNLSPRSDFMDHVLHQPEGRGLTSPELLSNSSLLIMAGSETTATLLSGAVYLLLTNPGKMQKLVDELSTVFPGG

SMVNIKSTSRLTYLPAVIEETPALPAACCWDSSRCTGWRLGYRWTTSVAVHHLAAYHSPLNFEQPEDFIPERFIDTSAFQ

DQRDVLQPFSVGPRNCIGKNLAYAETRLILARLFSQFELELMSESDGWIDQRTYVIWEKPPMVGLTRRQGA*

 

>CYP65-un3 Aspergillus terreus

36% to CYP65AQ1

one frameshift, possible CYP65 pseudogene

30/31 top hits are CYP65

ATEG_04028.1

MATAIISSLAFCLIILSISHKVVYNLYFHPLARFPGPSLWCASRIPYLWKLCRGKLPGKIRAYHDKYGPVVRIAPDELSF

DDPAAWREIYLDQTLEQPSRRRTKPTGLFMENLI

VAHPETQPRMRDALDLAFSEAS &

VDKYEPIVTRAIDRLIAKLKSSITKKNDGASALNIARCLELA

SFDIAAEVIWGSSFECLEGGQGNVVVDYALS

RKERLIAMALTFYPFLAFLSPLLSLSSTRTTTLQLFRRKTTERISKHQATSSGQQSQPDVLGSILQSRASETLPVTALEQ

TPVELVMDGGGPIAAVLIGTLNNLLRNPSKYDYLVQEVRGSFKRETDINGSATRPLPYLHAVVTEGLRIAPPFPDGVRRV

VPAGGITVAGCPVPPKTVVSTGCWVQFMNPRNFACPEEFVPERWLHAKGAGAIGGRTIVDTANKDAFYPFGLGARQCLGE

PLAWLELKLTLARLLWNFDISIPPEKTLPVWGEQDVFWTWNVQPMEVSLRLCRRF*

 

>CYP68L6 Aspergillus terreus

63% to CYP68L3

ATEG_03869.1

MLDTVTELPRWDLISLIGLSVISTLFFLLSPFQRSPFPLINGKGTLELSSSNAKKRFLADAGNLIKIGLSKASVIRLVSD

NDVKTVLHPKYVNDIRSHPALSFGTAIQKEFHADAGIHGFEPFKQGSTAGEIFQYAVRTKLTQSL (1)

GNVTEPLSSETALTLDTSWTSNT (1)

EWHEVDLRASILGIV

AQLSSRVFLGDQICRNPDWLRITVNYTVDSFIAAQDLRLWPKPLRPLVANFLPSCRKIRSELREATEIITPVLEERRKSK

ETQVREGRTPERYVDAMQWMEESAEGRPYDPAVAQLSFSLAAIHTTSDMLTQALLDLCGKDDLIKELREEIVTVIQGEGW

KKTTLYKLKLMDSVLKESQRLKPVSIASMRRLASEDVKLSDGTIIPKGSSLFVSSDNMWDPSVYPDPEKFDPYRFLRLRE

IPGHETSAQLVSPSPEHMGFGFGKHACPGRFFAVNEIKIALCHILLKYDIRLPEGYTPAKRRMGISLDVDPLARLLVKRR

QEEILL

 

>CYP68L7 Aspergillus terreus

54% to CYP68L6

ATEG_10083.1

MLEPVSTAQSLWSFGLWILVILSPVLFFASRELGILNAKKRFAKNGFEEVLAGLRKSDVFGLMTINGPKIVLAPKFAQEI

RSNPALSVSAFSSSELHAHIRGFDVFRQGEADDILQDTVRSKITQSIGDLIQPLSEECSLTLKPKWTDSPEWHEVCPHTT

ILDIIARLSSRAFIGDELCRNPKWLRLTVDFTVDSFRAAEALNWWPYALRPLVARFLPSCLKLHKYIQDADNMMKPVLES

RRQAQAKDPQKSYPDTIQWFEETAQGRPYDPVRLQLTLAFASIHTTADLVIQTILDLCSAKNWDELCRSLREEIISSFRE

EGWRKPLLAKLKIMDSALKESQRLKPVSIVGMGRIAKEAVKLSNNTIIPKGTRLLVSNTAMWDPEIYPDPRTYDPYRFLR

LREASENESAGQLVSLSPTHLSFGLGKHACPGRFFAAAEVKIILCHILLKYDIKLADGCKPKPLRAGTNLVADPTAKLLV

RRRQEEVAL*

 

>CYP68R1  Aspergillus terreus

         AF141924.1, XM_001209275.1

         lovastatin biosynthesis gene cluster

         gene="lovA"

         function="involved in lovastatin production"

         39% to 68D1 N. crassa

         73% to CYP68R2 gene mlcC Penicillium citrinum ML-236B

         (compactin) biosynthetic gene cluster

         ATEG_09960.1 4 aa diffs

MTVDALTQPHHLLSLAWNDTQQHGSWFAPLVTTSAGLLCLLLYL

CSSGRRSDLPVFNPKTWWELTTMRAKRDFDANAPSWIESWFSQNDKPIRFIVDSGYCT

ILPSSMADEFRKMKELCMYKFLGTDFHSHLPGFDGFKEVTRDAHLITKVVMNQFQTQA

PKYVKPLANEASGIITDIFGDSNEWHTVPVYNQCLDLVTRTVTFIMVGSKLAHNEEWL

DIAKHHAVTMAIQARQLRLWPVILRPLVHWLEPQGAKLRAQVRRARQLLDPIIQERRA

ERDACRAKGIEPPRYVDSIQWFEDTAKGKWYDAAGAQLAMDFAGIYGTSDLLIGGLVD

IVRHPHLLEPLRDEIRTVIGQGGWTPASLYKLKLLDSCLKESQRVKPVECATMRSYAL

QDVTFSNGTFIPKGELVAVAADRMSNPEVWPEPAKYDPYRYMRLREDPAKAFSAQLEN

TNGDHIGFGWHPRACPGRFFASKEIKMMLAYLLIRYDWKVVPDEPLQYYRHSFSVRIH

PTTKLMMRRRDEDIRLPGSL

 

>CYP504A3v2 Aspergillus terreus

           AAD34565.1

           6 aa diffs to 504A3v1

           ATEG_09973.1 6 aa diffs

  1 MTLQIIVIAA TAVIYFLTRY FNRTDIPKIK GIPEIPGVPI FGNLIQLGVK HATVARKWSK

 61 EFGPVFQARL GNRRVIFANT FESTRQLWIK EQSSMISRPT FHTFHGVVSS SQGFTIGTSP

121 WDESCKRRRK AAATALNRVA VQSYMPIIDL ESMASIKELL KDSQGGKIDI NPTPYFQRFA

181 LNTSLTLNYG YRIEGNVNDQ LLREICEVQR GVANLRSTSN NWQDYVPLLR LFSNRSNQAK

241 HLRARRDKYM AFLFDILKDR MAKGTDKPCI TGNILKNPET KLTDAEIKSI CLTMVSAGLD

301 TVPGNLIMGI AYLSSEDGQR IQQKAYEEIM SVYPNGDAWE RCLVEEKVPY ITALVKETLR

361 FWTVMPICIP RVNIKEVIYN GARIPAGTTF FMNAWAANYD EDHFDMPNRF LPERYLEPSE

421 GFGTPHYSFG AGTRMCAASH LASRELYTVF LRFIVAFTIE PAQNPADMPV LDAIECNATP

481 TSMTTEPKPF KVGFKPRDET SLRRWIAESE ERTKEL

 

 

>CYP504A9  Aspergillus terreus 

          XM_001218406.1 XP_001218407.1

          79% to 504A3

          ATEG_09785.1

MALQTLAIAAAAVVYFIIRYFNRTDVPKIKGLPEIPGVPIFGNL

LQLGDKHATVAGAWAKKYGPVFQVRMGNKRVVFANSFDSVRQLWIKDQSALISRPTFH

TFHSVVSSSQGFTIGTSPWDESCKRRRKAAATALNRPAVQSYMPIIDLECTASIRELL

KNSQGGTVDLNPAPYFQRFALNTSLTLNYGFRIEGNVDDQLLREIVDVERGVSNFRST

SNNWQDYIPLLRIFPKMNTEAEEYRVRRDKYLTYLLDILKDRIAKGTDKPCITGNILK

DPEAKLNEAEVKSICLTMVSAGLDTVPGNLIMGIAYLASEDGQRIQEKAYDEIMKVYP

NGDAWEKCLVEEKVPYITALVKETLRFWTVIPICLPRESTKEIVYNGAKIPAGTTFFM

NAWAADYDEDHFKMADRFIPERYLEQSEGAGTPHYGYGAGSRMCAGSHLANRELYTAF

IRLITAFTMHPAQNKEDLPVLDAIECNAIPTALTTEPKPFKVGFKPRDAALLEKWIAE

SDERTKEL

 

>CYP504B13 Aspergillus terreus

85% to CYP504B5

ATEG_08499.1

MAIAAALASLQRSAVDHPLQSLAVAALLVPIIYVIINEFIRASARVPGFKGPRGLPLIGNLAQIRTNAAEQYRLWSKTYG

PVYQIQLGNIPVIVVNSAAAAKVLFGQNAQALSSRPEFYTFHKIVSNTAGTTIGTSPYSDSLKRRRKGAASALNRPSVES

YVSHLDVESKAFVAELLKYGDAGKTPVDPMAMIQRLSLSLALTLNWGVRVASQEEELFDEITHVEEEISKFRSTTGNLQD

YVPLLRLNPFSSNSQKAKEMRNRRDRYLNGLNRDLDDRMEKGIHKPCIQANVILDKEAKLNAEELTSISLTMLSGGLDTV

TTLVAWSIGMLAKRPDIQEKAFKAIGEFYGEDEPMCDAHDDQKCAYVAALVRECLRFFTVLRLALPRTSIRDITYNGAVI

PKGTVFFLNAWACNMDPEVWHDPEEFRPERWLEQPDAPMFTYGMGYRMCAGSLLANRELYLVFMRTLNSFRIESDEDINW

HPVKGNSDPTSLVAIPQKYKVRFVPRSEKVLAQVVA*

 

 

>CYP504E2 Aspergillus terreus NIH2624

AAJN01000191.1

N-term not clear, does not match other related genes

ATEG_07913.1

        MTTTHDTAFIPSLAYRIQDGQGSTILGIAGVIALLSYL (0)

189214  TTIATDIPFIKGLPEIPGAVPIFGHLLKLGDDHATVCEKWWRQYGHSVFQIRLGNTRAV  189390

189391  VVNSFEDCRKMLLGHQNAIIDRPTLYTFHGVISSTQGFTIGSSPWDASCRKKRKAAGTAL  189570

189571  GRPALRSYYPMFDLESYSIVRDLHRDSCDGEVELNVRPYIQRYALNTTLTLCYGIRMD  189744

189745  AVYDELLREILYVGSAISLLRSASENLQDYIPLLRYLPNNEKNARSKSLRERRDKYLDLL  189924

189925  LDKVRDMIKKGTDKPCISSAILKDEETKLNGVEVSSICLSLVSGGFETIPGTLTSAIGSL  190104

190105  STKEGQVWQDRAYEDIKRHYPDIRDAWTSCFVEEKVPYVNAIIKEAGRYYTVSAMSLPRK  190284

190285  TVTEVNWNGAIIPQKTMVLINAQAGNH (1)  190365

190412  DVDHFGPDGGKFDPERW

190463  LKTLDPPTERETSGLNHLSFGAGSRACSGQYIASRLLYAALVRILSSYKIVASETEPPNT  190642

190643  DYVDYNQFKTALVAIPRDFKVKLVPRDPGMTAECLETAELRTREHYKE*  190789

 

>CYP505A19 Aspergillus terreus

65% to CYP505A18

ATEG_01555.1

MSARIPIPTPKGIPILGNITELAQDVPEYSLYRLADQHGPIFRLTFLNQSIVFVNSYELANEEIRNCVHDGLFTANYPGE

ENREIAHRVLVPAFGPLMIRGMFDDMYDIASQLALKWARQGPNTAITVNEDFTRVSMDTIALCALGTRFNSFYRDEMPHF

IATMRNLLQASSARALRPADLVDARLQDPVDKKDLLNALILGRDPQTGQKLTTDSIVNNMITFLIAGHETTSGMLSFLFY

DLLKHPHAYRKAQDEVDRVIGRRKITVEDLTKLPYITAVMRETLRLHCPVTMLVVHAHPIRNNEDPVTLGNGRYELYKDE

PVAIHIGKIHRDPAVYGDDADEFKPERMLDGKFEKLPKNAWKPFGNGMRACIGRPFAWQEVLVVVAMLLQKINFQMVNPS

YDLRLKQAMTLKPDGFTFRAAIRHGLDATRLSAFLNRGSDLTEYAGALGRECNMEMVLGNHLKPMRIFFGSNMGTCEAFA

WRLAHDALQYGFRAEVKALDAARENLSRGDPVAFMTASYEGQPPDNATHFFEWLKGLEGDKLEGVNYAVSGCGHHDWQAT

FHSIPKAIDRLVHQRAGTRLCEIGTADAANSDMFTDFDSWGESVFWPAVMSKFGVQVNGTAKEASNLEIQIRPGRRVSAL

GLQLQEGQVLENRLLTAPSVPEKRMLRFKLPPDMTYQCGDYLAILPVNPPNVVRWAIRRFNLSWDSMLTVWKPTDASGLI

AVPLETPISALELFSTYVELSQPASKRDLKYLADAANGDTAVQNELRSLASDATRFVDEIVQKRVSPLDILLRHPVIDLP

LNTFLTMLLLMRPGEKAHMTVRRSTFGFKPPLDLQTPMIMACAGSGLAPFRGFIMDRAEKIRGRQLTGAPHPDIRGLAKA

ILYVGCRTKGVDDIHAEELAEWERLGAVDVRWVYSRPAGDSLSGSSPHEGSDGADRSRWRRHVQDQIVHDREELVALLER

GARIFVCGGTGVGQGVRQALKRIYLRQRWDGCRLRIDTDEGDPSRTADDEDAAAERFLEMLKTKERYATDVFT

 

>CYP505E3 Aspergillus terreus NIH2624

AAJN01000001.1

79% to CYP505E2

ATEG_00065.1

        MIKETEQIPGPR (1)

        PLPVVGNLFDMDLEHGLECLIRLADDF (1)

204332  GPLFQITINGEKQIFATSQALVDELCDESRFHKAVMGGLEKLRMLASDGLFTAYHGER  204505

204506  GWGIAHRILVPAFGPLRIRNMFEEMNDVAQQLCLKW ()

        ARQGSSTSINITDDFTRLTLDTIALCTMNFRLNSFYNNETMHPFVKSMLYVLRESDI  204865

204866  QSMLPGIANCIRVKARSRMSKHIQLMRNMARGIIQERRDQAEPVDDLLNTLLNGRDPVTG  205045

205046  EGMSDDLIINNVITFLIAGHETTSGLLSFTFYYLLQNPHILERAQNEVDEVTGGERITVQHLGR

        LTYIDAILKESLRLMPTAPAFTVTPKKPEVLGGAWAIDAGQAVNVLLPVCLRDRSV  205405

205406  FGPDADEFRPERMLEENFSKLPPNSWKPFGNGERSCIGRAFAWQEAQLVVAMVLQTFDLV  205585

205586  PDDPSYKLRIKETLTIKPDGFRVRATLRRGQSATGLSQGSMSASGATSSVASPGPPAATG  205765

205766  AQSNPAGGQRISFFYGSNSGTCKALAHRLASSLMGRGFTEQKLAALDTVVGNLPTDQPVI  205945

205946  IVTTSYDGRPTDDAEEFVRWLESKRPVLQGVSYAVFGCGHHDWAKTFYRIPILIDDLMH  206122

206123  KAGATRLTALGTANAAVSDLFSDLELWEETNLLPALREAFPPSNSSDVESSEPHQLQICV  206302

206303  SKPRRVDMHRGLVEAKVTAVRTLTSPDSPEKRHVEFHVQGDTTWRPGDHVNILPVNPLST  206482

206483  VSRVLAYFQLAPDHSITVNSFNTQGLPSATPVSATELFSSFVELSQPATR () 206632

206695  QNLKALAMAAESKTDEQELIRLHDSYDALVRDKRVSVLDILERFPSISLPIGIFISMLPP  206874

206875  LRLRTYSLSMAPSFKPSHGSLTFSVINEPAWSGNGQYLGVGSNYLASLTPGSLLYLSPRP  207054

207055  AKDAFHLPADQFNTPIIMICAGSGLAPFMGFIQERMTWLKQGRPLAKGLLFFGCRGPHLD  207234

        DLYYEELSEFEDAGVVEVHRAYSRAPDDVRAKGCRHVQHRLVTEAEAVRDHWGRNAIVYV

207415  CGSSNMARGVQTVLEEILGTLPPERYVAEIF*  207510

 

>CYP526H1 Aspergillus terreus

38% to CYP526A1, 13 of 17 top hits are CYP526 members. Three others are CYP5134 members.

ATEG_03457.1

MVITLPVRASQSPSQREIVWYILSCLFAWLLYKFSLLCLPTPFHDIPHNEGTTRTIFGDLASMLSEVSKSNDIFTWLLRQ

TQKANSPLYQVFIRPFGRPSILLSDYWEATDIVLHRSREFDRTPYTADVFSGVLPNHHIHMPTGPEWKAHRRLLQDLMTP

NFLNNTAAPAIYDRALELVDLWDAKARLAAGRPFFAAEDIHNTALDAVLSFSFGGAFPHSATRPQLELLSTLYMEAVHRN

DTPLDRPAEFPQASPPDCIKAILDITGAFEYTKSSIFPRLMWFLASKTPRVRHAVRTKDNFVLRELQGATHRLVWKDSDA

DHTWAQSAVDLIVDRERKYAEREGRSPNFFGSAIRDEVFGFVLAGHDTTSTTIAWGIKLLADNPDAQTNLRLALKNALLE

AAASNRLPLCSEVIRTSIPYLDATIEEILRCAPTVPAVDRVALNDTVLLGHSIPKGTSIFLMNKGASFFSPPHEIEDEKR

SPSARAAKNKGHHAWDPETLDIFLPERWLVASEEQASAVGTANVVFDPAAGPAMPFGGGPRGCWGRRLAYLEMRLIFALM

VWRFELLGCPKELSGYDAFDGLVHKPKDCFVRLKRIES*

 

>CYP530-un1 Aspergillus terreus

64% to CYP530-un1

ATEG_03951.1

MANVASTLILFSLFCCWVGWKIIYIARGGHRSPSLPPGPPTLPFI

GNLHQIPAQKAFLK (2)

FQEWSR*YGPIISLKTGPANLVILNKAKDVR (2)

LFDKRGAIYSSRLPNHIGNELITRDNVHLLL

MPYGQAWRNQRKIYQAILSITAVRSLTPLQEAEATLTLYQLSQTPELYYDHIRRYSTAVILSSVFGIRGPEFDHRNITRL

YHAQDQFTGILETGATPPVDIFPFLKRLPDFMSPWRRWARQIRAEQRQLYFELLQEVKSQRARGIYRNCFMSQLLDEKFA

EKYELDEEHIAYIGGVLMEGGSDTTASTLLSFLLAMTKYPKVFQKAQEEVDRVCGMSSSPTFDLIAKLPYVKHCVSE (0)

VLRWRPVAAGGLPHVLIQ (1)

NDEYKGFNFPTGTTFLANTWAIHHDPELYDRPDDFIPERYEHHPLGFKTDIKKTTDGIRKTYGFGAGRRICPGSHLAENSL

DINIAKIIWAFNIRAGTDPTTGRHLQDEEVNVDVATQWTDGFLIAPKPFPIVMELRSEKHREVF

RRELEDARKVFQSYED

 

>CYP531C5 Aspergillus terreus

65% to CYP531C4 Neosartorya fischeri

ATEG_06454.1

MTQQIYMDSIMNWCFHMGSLIAWACVFAVPIWYLTAYLISPLRQFPGPVLAGWTNLWRMYHVRKGNIHVVVHNLHKKYGP

VVRIAPGVLDLDLPDLVRTIYNAKGDFRKTEFYHVSSTKTNGKIIYNLFSERSPEQHLRQKRPIAKYYAMTEVLTLEPHV

NEMIQCLCQRLEEEFVAKPKSGSVCDLSEWMRYYTWDVVGKATFSNPFGYLQKGCDFDNTISIADQAMDYFALVAQLPVL

DYVLDKNPVYRIGPPSFGNITAISIQQLMSRLQRREAGTSQGASQDFLDRFIDAAAHDSDTIDHGQIISWLMINMIAGAD

TTASTLNAVLYYSLKHPAVWARLQQEIAMQEVEQDATACVLPFKSAHDVSYLEAVIREAMRMLPSVAMTLERYVPEGGLV

LPDGRRIPGGCAVGMNPYILARNSSVWGECPDEFRPERWLRDTAHESEAEYQERLQRMNNTDLVFGGGSRVCLGKNFALV

QIYKVLATLVSRYDIELASPDREWSTYNSFFIRQSGLYVRMSRRSK*

 

>CYP532J3 Aspergillus terreus

72% to CYP532J2 Aspergillus niger

ATEG_04107.1

MAVLSSIYGFVSQHLLALTVLSIVYYLTRNYLTPGVSSVPGPFLAKLSNLWRFVDVARGRPEITQYKLHQKYGDYVRLGP

NVVSVRNPDVVKTIYGINKGYRKTDFYRVQQQLAKGKPTPTLFTTLDEDFHAAIKRPVSSAYSMSTLTEFEPFVDSTIRS

LFVKLDEFVASRKVCDIAIWLQYYAFDVIGHLTFSKPLGFLEHGKDVDGIIGSLEKTLDYAGKIGQMPWLDYVFVKNPLK

QLIQGGSTTAVARFARDRMSERLSQPSEKASAASSQQKDFLTRFLEAKKTYPETVTDAQVFSYTVSNMNAGSDTTAISLR

AILYYTLKTPQVKAKLMAELLDALHTGKLTLPVSWKQSQELPYLDAVVKEALRLHPAVGLLLERIVPAGGLQLPNGPFLP

PGTIVGINPWIIHRHAVFGSDVDSFVPERWLRGEDETEAAFQARRQDMLRATLTFGAGPRTCIGKNISLLEIYKLIPSLL

LTYEIELDDPTTEWEIINAWFVRQKKIDIRLGRRYLGEGRVGAQTGRQCDV

 

>CYP537B4 Aspergillus terreus

73% to CYP537B2 Aspergillus flavus

ATEG_07898.1

MLSLWCLGIVGLGVFLFRSLSSPVAKVPGPWYTLFTGLVIKYYEFTATRRVFIHDLHKRYGPVVRIAPNEVSFASLEAIR

EIYASGGSGYDKTEYYDLFRQFNIK (2)

TMFSTLDKHT (0)

HSRRKRELADRYAMTNILREIHVSAIRERAEAFVAKCAAIAKSIDVYVYLHCYALDG

VTNFMFSPGGLRSLDRAEDFAIMEELTYHQSLQKNLVHYYLPSIVPYLPSFLIPRRSPLTNDYVMTMTNQAQPEPHSLIS

RLARPDSPLSSLEAAAECKDHMAAGIDTTGDGLCFLIWELSQPQNMRIQDRLYEELQSVPSDTPLDKLPYLDAVIKEGLR

CFPPIPMSFPRYVPAGGRTIDGYFLPQDTIVSCQPYTVHRLHEDIFPDPDRFYPERWLEEKGAAERNRLFFAFGTGGRGC

TGRNLAMVEMRVLLQAVYSRFRTTVASDMTGCMDIDDQIISSRPKDQTCRLDFARRE

 

>CYP539A8P Aspergillus terreus

note: best matches are CYP539A seqs but

no I-helix motif LAGRDTT is found suggesting a probable pseudogene

C-term half is 48% to CYP539A2

CYP539J1 is 3 kb upstream

ATEG_08168.1

MRCVYELATHGFHEYVRDILATKPGRTIEFHILDKRMIVTDNPENIKEMMSVQFDTFGKGDLTHHIFRNCFRGSIFGSEG

AEWAAHRAQLKPHVGTMRPSDPEKLEKHFLQMLKKNIPDD

GSPVEVYDMLDM

MLLETVIDIFVDPSKDPEYKHIDPRPFV

NGVNALLKINTFRVLLGNVSRLVSDTLVARASTQALHEYLGSHVRWIRKLQSSNYGEKP

KKEWTLMETFASEPLPDSDPVGMI

WVIYELGRRPEIVDKLREEIIATIGDDINTLPTDAQLRSMKYLQNIIKEAMRMYHPF (0)

LTFAVGFNIRCPNKDTVLPTGGGPNGDQPLPILRETFI (1)

VVNIMGLHRRADIVGA

DTDVFRPERWDTFKPGPWEYMPFHRGPRNCLGMAFGQYAMAYLIVRLYQLYD

ILPADNIVQRIKVEMNTKVSHP VNMRFYPRQSVSSPRLQKDEVLL*

 

>CYP539D10 Aspergillus terreus

76% to CYP539D9

ATEG_05807.1

MIEEFITQMSPGRAALCFLGALVVLFTLRKMQVSMKIARLGGRAPQVRFYLPYAMDFIYRSSKANREHRDLEFFTEAMRT

AKGAAALDNPKTAEVNAGMAARVIFTKDPENIKALLTGQFADYGKGESFHQDWREFLGDSIFATDGELWSRSRHLIRPMF

VRDRIVDTEIFEKHVQHLIPLLEGSSSPTGSKIVDVGELFFRFTLDASTDYLLGQGTDSLQNPETEFAEAFRYVQHRQAL

FFRMGVFGPLLSRKKFREQLKVMDDFIQPYIDRVLSLSTAELDQKLSKKETFLDALARFTRDPRVLRDQLVAVLLAGRDT

TAGTLSFCLFELSRNPEIVAKLREEIRSRVGLGANGQKPTYNDLKEMKYLNAVLNETMRLYPIVPFNVRFSLRDTTLPRG

GGPDGRAPIGVLEGTRVIYSTMIMQRSPEFYPPPGSPNYFDPQKWHPERWISGWQPKPWQFIPFNGGPRICIGQQFATIE

MGYTVVRILQAFEQVQGIPAAGKNRIEDPVLQFEVTLSPGSELNCIFVRDGEGIKESETG*

 

>CYP539J1 Aspergillus terreus

48% to CYP539A6 Mycosphaerella graminicola

ATEG_08167.1

MMLGEAGQFPHMG

ALLLTALFIVYLCRQWTTRQKILRLGGYAPRIPSYVPL (1)

GLDILFTAIRNGRRNKSLETWRGWHSCAPNNGTVEAKVLFERYLLTGDPENIKAILATQF

DDFAKGQLFHDTWSQLLGDGIFSTDGAPWRGSRQLMRPLFAKDRVSDLDVLERHVQKLLR

NVAAKSGQRLDLCDLLFRYTLDAATDFLLGEPVGSLDNDTQEFATAFDHAQYIQMMIARSG (2)

RAHVLIPRASLNKSISTINAFIRP

YIDSALRLQDSTKLVERSEPDYTFLHALAHYTRDPKLIRDQLVNILIAGRDTAASSLS

WVFFELAKQPRVTTKLREEILAQVGFERPTYSQLKDMKYLQ (0)

NVIRETLRLYPIIAF

NVRVAQRDTTLPRGGGPDGLSPVGVLKGTRVFFSSLYMQRRASLYPGDPNPDEFHPERWE

KWQPASWQYIPFSGGPRICIGQQFALTEIAYTIVRLLQSFDRIEPCIEHMEPVLETNISM

KPGTGVPVKLWSAAPVSNEQRVEGSAC*

 

>CYP540A5 Aspergillus terreus

87% to CYP540A4 A. niger

ATEG_06722.1

MQCHFYLVGDDVSTAQSLDVDARWKFEDLQRAVGGVFHVAQPTGISFHSDSNEPLTTVAD

VLTAASAPTAPVGLRIDGNAVQSPQGPPGLPLVGSFYEIFPDHLGNHYRLFRKYGPVIKTTN

MGKTIYLTDDPAVAAVCLAESAYMTKKINSDHPLWGVKDNTAIFLGDTETENWRLAHKYLPPSMGPKAVRHYTGLMQACA

RKSLPVFDELDARDEAWNVYQYMLKLASQTVGSFSLSKDFGHFDSIDSPLHPIVTNIASLLSLNKKITARGEWYRHLPFG

DPARLRHVQHTIYSLLQEQIDAVAAESRSADAPMADAALSATCAVDYLLHAVDDKGERFPPGLILANVLVVTGAGFTTTS

ALLSWLIYCLVTYEGTQDRLYQELVEYGIVGPNGERNQTTWTPDLAHSLPYMDKFVKETQRLHNASFQPGRTSKTDVVLP

GGYRLPPDSVIVPALYAIHTNPKIWRDPFRFDPDRWDTDEVKNRHRCAYVPFATGPRGCIGFNFALLEVKILLGELLSRY

EFVREGQEAIDYDPEFQLIRPLNFYVRAKRRV*

 

>CYP540B19 Aspergillus terreus

83% to CYP540B12

ATEG_10264.1

MPSQTFYLLGQSLSSAKEVGIETSQTFESLQFLIAAHFAIVDPSGITFQGPDAVLTEVAEVLAATAPVPITIDGHPVRDP

PCPKELPFVGTFFEVYPDHLGNHQRLFERYGPVIKTSNLGRVTYQTNDPKIAAIAFAESDFFTKKINESHPLHALKTPAA

GVFLGDTDTPEWRVAHKFLPPALGPKAVRHYAPTMQQTVEDAFKVFDKLDEQSEAWNVYQYMLKLGSQAVGKLTLGMDFQ

HFDAPDTPVHEMVHNIAEVLSLNKKVTSKGDWYSALPFGDPRRLKNLRVRIEEMVGESMKKATRAGIEDLPLQDAALTAS

NMVDYAVRATDNKGEKLPKSSVVWALIVATGAGFTTTSSLLSWLIYGLCEYKGMQERLLQELIDHGFDENTKMTADFTEK

LEFLDKYIKETQRRHNPSFQPGRTAKVDLILPGGYKLPKDAVIIPALHHIHNNPDLWDNPARFNPDRWDTEEVKSRHKAA

YIPFAMGPRMCIGFNFALQEIKVFLPKLIYRYKFSREGDGPIEYDPMFQLIRPNNLYVRAERRTKWPVKSRSASP*

 

>CYP541B5 AAJN01000228.1 Aspergillus terreus NIH2624

63% to 541B1

ATEG_09231.1

134658  MPSPIPQPKGYPLVGNLFDIDSQNPWGSFNKLALKNKY (1)

134844  RPIFKINILGKDLVFVTGAALLEEVCDEKRFRKCVSGPIVQIRDAVHCSLFTAYEKEM  135017

135018  EDWGIAHRIMAPMVSTEAVAELYSGMKETMPDLIKKWTAGPRQRVNVTNDLDRLNHAANM  135197

135198  LCFFNQRVDCVNGPEPPAIHAHEESTVEATRRSSRMKLVNWLFHQKKYDNYIKIMRDYGA  135377

135378  DIIAHRKAYPTDKNDMLNALMNGKDPQTGKGLTESQVQDEIINCFIGSATAPNLISFALY  135557

135558  YLMKNPDTIRQAREEIDAVVGVSESVEQEHLARLPYCKAIIDETFRLSAVAPGFNLEPH  135734

135735  PDDEGPVLLAGGEYEIPRKQALIVLLSAVGRDPAVFEDPDAFKPERMLGEKFDRLPAGVK  135914

135915  KRFGNGKRECIGKRYAYEWSFMTLVSILKDVEFELADANYVMNNDGVNYNGAFSVKPQGF  136094

136095  FAVTGPRQRSGH*  136133

 

>CYP547C5 Aspergillus terreus

82% to CYP547C3

ATEG_10355.1

MDSLLAAILLSLLEGFFLQRTYLGEYTFRTVTLGAFGVNLLLLAIWNLLIYPYFITPLRHLPTVPGNLNNARIIFDDPRG

RTPLHWMKTIPNDGLIHFRNLLNTSFLLATNHKALLDIMSTNTYDFEKPPRAREFLARIIGYGLILSEGAAHKRQRKALL

PSFNFKNIRAMYALMWEKTGLLMDELEREIALHPMDGTRPEDREGKVEMSVWASRLTLDVIGPVAMGRDFRSLQNTENKV

ADSFLAILEPTKEKMAFLAVNFVLPQWLAQRLPWRLNRVIENETTFLRNLCKDIVQEKRATIASTKATAEQLEADILGTM

MLGGDFSDDELVDQMLTFLAAG (0)

HETTASAFTWACYLLTQHPDIQDRLRAEIRARIPSGNHPITWSDLETLPLLNGVCQEVLR

LYPTVPVTLREAIRDTTVAGTHIPKGTRIILCPYAINRSPEFWGADGEAFRPERWIDTDK

NGQPVVNHTGGASTNFAQITFLHGQRSCIGKDFARAELRCALAGVVGRFRFEMQDPKQEI

HIAGAVTTKPVEGMHLRMARVDEW*

 

>CYP547C7 Aspergillus terreus

54% to CYP547C5 Aspergillus terreus

ATEG_03033.1

MSSAAEQLAFLIPVTVVETFAVTATRMVPEQKPTSVFLYALGLNLVLLAIWNIFVWPFLVNPLRHLPTVRGPFIGASIFL

RHPRGSVTIPWLRTIPNEGLIHFREGLNRSFLLVTNQRALMDVLHTNSYDFTKPRGGREFLARGLGYGLILSEGDAHRAQ

RKAVTPAFAIKNIRAMYDLMWSKTQIFLHQLDREIQLHPVPGMKSGASGYVELGSWASRLTLDIIGPAAVGRDFQSLENE

DDPVSQAYSAILKPSSDTLLLFALSVLFPQWLVKLVPVRANIELPRRISYLRRVFHDILREKRTQLTEKPSDVDGDILGT

MMRGGEFSDSELVDQMLTFLAAGHETTANALTWASYHLALNPHIQETLRAEIRATVPSADAAVTWQQLESMPYLNGVMHE

VLRLYPTVPMTGREAIRDTTIAGQKIPRGTIISICPQSVNRSPEFWGDTADDFRPERWIDTDPVTGRQTPNKHGGAGTNF

AQITFLHGPRACIGKDFAKAEFRCAAAGLFGRFKAELQEGCVVKFGGTLTAQPVRGMPLRLTRLEGW*

 

>CYP548D7 Aspergillus terreus

84% to 548D3

ATEG_07228.1

MIVQEIWGCISLPRLLLGVSVLLGILTSGYVIYNRFFHPLRRIKGPVLASVTPWVQLYHGLKGDRHLWLHRLHQEYGTHV

RVAPNFVSVNTAQGLHDIYGHGKRLKKANFYNAFPAIKGVYNTHNVIDKTVHGRKRRVLSQAFSDQALKSMEDVILLHVR

QLCAALAGPQADGHHAEEQKGTVQNIGDWFSYLTYDVMGELCFGKSFDMLVSSGRRKMIELVDRAANRHYVCGLWMPLDS

WHLDQIFIHRLTNDRWNFIMKSRVEANERAKERAQAGHDSKKDFFYYLLNAKDPETGKGLTTPELWGEANVLMIAGSDTT

STTLAATIFYLVRNPAALAKLKKEVREAFSTVEDIVSGAKLNELLYLKACLDEALRLAPAVPGAPPREVMEGGAVVDGVF

LPAGTDCGTPTLSIHRQPQYYREPGAYLPERWIEGATCRAPTGDEWQTTKEDVETARRAFCPFSIGPRGCIGKSMAFMEM

RLTIARLMFLYDLEKADGTGEDEEGHLALVDHFTSAKQGPNVIVRRRAE*

 

>CYP548T1 Aspergillus terreus NIH2624

AAJN01000173.1

92% to CYP548T1 Neosartorya fischeri = ortholog

ATEG_06914.1

21150  MYIAAVLTMMRPHWAAVIIGLAVCY (0)

       FIGSAIYNLYFSPLAKYPG  21329

21330  PFLSKISALPDFYWSLTGDRHMWIARNHEIYGDVVRFRPDGLLFRTPQAHRDIFNAKANV  21509

21510  KRAKFYDMMTRNKHDTSTITGTDPALHAQKRRILNTVFSEKSLRSMEPFLVKHVARWCEL  21689

21690  LIDGDGTDWSTPRKMSEACDYLVLDVLCDLCFGQSVHTKEPGENEYRNIPHAIGSFLQVLYP (0) 21875

       LGHSPWLDLIVWLKPRGLDWVFGALTPPHIQFLYDFVKQ  22049

22050  SLAQRLTAEQETPSSGHEGRGDMLHYLIHAKDPATGRVGYTPEALEAEALMLTIAGSDTT  22229

22230  SVIMAGFFFYIVRTPRAYRKLVHEIRSTFASVDEIRGGPKLTSCQYLRACVDEAMRIMPP  22409

22410  GPSEMPRIVLPGGIIVDGDHIPEGTTVGVASWSFYRNEEYFPDPNVYRPERWIVDEHAGV  22589

22590  TAEDVARARSSCLPFAAGTTGCAGKNFALLELYMTIASTLWQYDARLLPGDPTGAGSKAQ  22769

22770  GWGKRNRNIYHVKDKYISVRDGPMVQFKKRVA*  22868

 

>CYP548U1 Aspergillus terreus

41% to CYP548A6 Botryotinia fuckeliana

ATEG_03468.1 N-term exon not identified

FVTVVVYRLFFHPLSKYPGPFFWRISILPSLYYAWTGDRHLVVDKLHKKY (1)

GKVLRMEPNLISICTPNAIK (1)

TMYGPGTKFEKAMFYTRGPKEKQLLV (0)

NLASTTDKAVHARKRRIISHALSEASIRSYEVTILDKIQLFCKQLSDASTFGGPY

KNMSRWFSYLTYDIMGQLTFSQSYDMLTKDDHHFIQPLIDSYQHSQ (0)

LGTEPKLDQWGLAPLLLLRIMAENKKFRRYVDDQ

VNHRIALEKAGQGPPDIFKLLLEHKDKETGESMGFKELSDEAVVLIIAG

SDTTGTALSGLYFYLARYPECYAKLSHEIRSTFTQVDEIVGGPKLQACSYMRACVEEALR

MSPGVPGFLTREAPSGASIDGYYFAPNVQVAIPTWTMHRTPEVYPDPQVFKPERWM

VESEAELQRLRSSYYPFSMGTRGCIGKNMAYHTIYLTVARLVFL

FEIESRDELPLEFHVKDHFAAGSKDGPYLKFTRREL*

 

>CYP552C6 Aspergillus terreus

80% to CYP552C4 Fusarium oxysporum

ATEG_03758.1

MNFMIDMNVGLKAALTVFYLIALWAGYRVL

IALYNISPLHPLSRFPGPKIAAASYLYEAYFDWWCVGRYGHEIRRMHERY

GPIVRINPDELHCSDPSFTDEIYAGPGRIRDKWQHQLNTGGAGPVSVTGFSTVSHEVHRMRKGA

MARFFSRQQTLKLEGEVHEFAQLTVNKMLGFAGKAPFDVKEAFNCFTADVISQYAFGEPMGFIAQDAWEPNFATWVKSFF

RSAYMMRHNALARKMAQLLPMLADYMGEDVRAVMRQMNVIIPGYIEQALREPGNGRVFAEVVQSDLLPESEKSLYRLSGE

GFNFLLAGTETTAATLTVITYHLLAQPSIYARLMDDLQGLDPASLKWTELEKRSYLWAVIHESLRMMPGVSHRSARIARE

EDLVYKSRDGRVQWIIPRGTPIGMTSMINHWDEEFFPSPDRFLPERWLVDGQPNYKLQKTLIAFGKGSRSCIGENLAYCE

LYIMAALMALRVVPRARLHETTVEDISSYDHDLIVVQTKKGSISVRIAIS*

 

 

>CYP573A10 Aspergillus terreus

78% to CYP573A5

ATEG_01019.1

MGVVEEGLLSKLTVTNAVLALVAYVGLKFLYQIVYYRFFYPLSVFPGPFWGSVTRLWIAWHNMNETELPTVYELTKKY (1)

GPVVRITPTLLLVSDPKKLPEIYHRNADKTGHYITGSFGETESLFNMRSHKTHASFRKHIAGPYSFSNVR

KMEPLIDARIGDWLAKLEEKFVSSGEEFDFAWWAVYMAYDVISEVGFGAPFGFIEQGKDVGGLIQGFHDGLPAFGLLARL

HPFTSWIKTTFLKKYLVAKPEDDSGIGVLMRFRDRLIDQRLRDMEKSGGDIGRIDLLQTFLDARTEDGKPLDMEYIKAEV

LLVLLAGADTTGTVFQALMYNLFVNSEIYERMMEEIDNAVRKGLISEDMPQYDEILEHLPYFVACVRETLRLNPPAPNIF

PRYVSEPGMDLYGRFAPAGTEISGNPWIMQRDRGLFGEDAEEFKPERWLDPEQAKLFNKYLFTFGYGARVCLGRDVAMME

LFKGPLQFFRHFKPTVVPGKPPARFVIKGGVGFWRDLWVTIEKRPQVTRE*

 

>CYP576A3 Aspergillus terreus NIH2624

AAJN01000022.1 cont1.22, whole genome shotgun sequence

AC boundary before RHDPH (intron 1)

60% to 576A2, 59% to 576A1

ATEG_00955.1

65914  MGRLVEQGIVHPYYSFILLIIFLLCVSYIIGVVKAIVSPLSRIPGPWYAPLTTLHLNYAFATGKIWKIVEKG

       HQEYGSIMRLGPRQVWVSDMEAMRTILITADLPKVTMYAEISRDRSSPGLFGEI (2) 65537

65481  RHDPHKRLKRFLSPAFTVSYVDKLEPLFTECLKDLIVKYSDAFSSRRFETFTQPA

       TMDLMDDLHSLALDI (2) 65272

65224  MGECSFGRGFGYTNPQKETTFGIDEKIWSGIPSAIFKGMAQRYQ  (0) 65093

65040  MVYFKRLLRKIGVDIKFDWPDSMIA (0)  64960

64856  KNLGPDLLQHLIDEGEKPDSGMKMVPRDVIDQMSEVLLAGSETTSGTIGCFFLEVLRNPQVKARL  64677

64676  LEALPVLLPNDSIITSKAVRTDSQYEYLEACIKETLRLHPIASEMGRRTLNQSIELIGFS  64497

64496  IPPHTFVCASYRDLHRNPAYWPDPLRFWPERWLQNRPPDVP  64374

       LTAYYPFSAGKHSCIGKN (2) 64250

64153  FAWAEIRMVTANLLSRFEFIEVPAQDIDYRQYITMQFANGSWKA FLKPRYESRAEFFTI* 63974

 

>CYP577A9 Aspergillus terreus

54% to CYP577A8

ATEG_04675.1

MIPILCLGALLFGLVLFHVHKNLISSPLRHLPGPKSFAFTKWRLGYEEYRGMRTQCVNNLHKKYGEVVRVSPYEVSFSSL

SALRKIYGSG SRFERDDFYQMFDAYDRKVLFSYSSGIDH RERKKILNSAYTKTAIMSPSNVDMIEEKVKDFLALVQRDSS

ATGAVEIFSALHYFAMDSVSHFVYGATSPGRTTAMKGTRQHRGIIDDMLDPARRKLFWYAVFWPRLTEMLYAQGAIVQKS

LASFGLLPMKTPTYTGLRKHNFPVIQHLETQQLLGSDDSLASRLLAGTIPSAKASAPMDTLDVAAECSDHFLAGIDTTSN

TLMWVIYQLSRPENEGFQSKLRAEIQALDGPAGSGTFIYPEKAGTLPYLDAVIRETLRLHAPSPGSEPRWSTNDEVIDGY

TIPRGTVVSISPYTLHRQPQVFANPLRFDPERWLGPEDQVAERKRWFWAFSSGARMCIGVHLAMAEMTTLLANIYQNYWT

HIPSEYLQVSPGMSARGDLFYDEHLSQVEEHKCWIQFVPIRALSTCLQGCV*

 

>CYP577A10 Aspergillus terreus

70% to CYP577A8, 56% to CYP577A9

ATEG_07313.1 this model is a fusion of two genes

MATFSLLTQYIWKWMQKSLFL SIFVAAIALVVLYGLAKVHRNLIVSPLRPVPGPKFFALTRWRLAYEDYRGTRTRCINNLHKQYGDVVRVGP

NELSFNSLSALKSIYGAGSGFQRDKFYRMFDAYGRQVMFSFAFSVDHR (1)

ERKKLLNHAYSKTAVLSSRNAAMVEEKTRQFLSLLDREAKSGIMEIFNALHYFSMDSITQFL

YGESQGATTALTASANRSLLDDIIDPARRKLSWFAVHFPHLTHWLYSRTGAMEWLLTTFGLLPMSKPSTYTGIRRHALVA

AEHIRDQTIEDPTESIAARLFHAMRTREKGPAMDYLDVASECADHFLAGIDTTSDTLMFAIFALSQPANLSFQEKLHQEI

QSLPDEVVVDDVVNALAADKLPYLDAVIKETLRLYAPLPGSEPRWSEKDEVIDGYRVPARTIVSMSPYCLHRNEHVYKEP

LEFNPDRWLGPSEQVAEMKKWFWAFSSGGRMCIGMQ (2)

LAMAEMTTLLASVYRKCRTEIAPGFERVSPGVTARYEVFYDEKFPRMEEHICWIRFRSR*

 

>CYP578B7 Aspergillus terreus

70% to 578B3

ATEG_07890.1

MAFPSLFTGAALTLLALLYKYVVYPYFVSPLAKIPNAHWTSPISARWIERRRAAGTEVLTIYNLHQQHGPVVRLGPNELA

VNSIQGLKTIYTGAFEKHPWYGDFFINFHTDNLVGMTHNQPHARQKRMLSKIYSKSFLQESTDFNAISRLILVERLLPIL

HRTARSGTAINVLPLFQAVGMDFTSAYLFGTKHGTTYVLQPEEWAHWLEEYEKFKYLSRQDRYGGFIETWCLHLCDKTER

NDTPNCVSAETTAVVYNQLYSSLVKSPDERPLRMAVASELLDHLVAGHETTGITVTYIMWELSQRPDLQKQLYQELSGLG

RCLEYSEDGEEIFRLPSATSIDPLPILDAIVRETLRLHAPAPAPLPRVTPMSATGTTIERYKSIPGGVRISSSAYSLHRI

PEVYPHPFEWLPERWLKPGPGKIHDMRRLFWPFGSGGRMCLGSNFALQEIKLVIAVVYTNYTTSILDDEGIEQDHAFISL

PKGRKLMLKLSPVKAE*

 

>CYP578C4  Aspergillus terreus NIH2624 revised 7/18/07

          GenEMBL AAJN01000108.1

          58% to 578C1, 34% to CYP578-un1

          ATEG_03775.1

       MAVSAFTVVALVSLGLFVLYRVIIHPAFI

17000  SPLSKIPNAHWTAPVSPVWILWKRYTSQNNRTIQAAHEKHGPIVRLSPNEISINCVENGI  16821

16820  KSVYTGGFEKHDWYPLGFGSLG (2)

       TVSMFTMTGSKPHSTRKRM  16641

16640  MSNIYSKSFLQSSPHMRLISENIVFSRLLPIFQDAASSGKHLEMHDINQGVTMDFVSAYL  16461

16460  FGLANGTRFLQDEAYRKKMLHLYHSRKPFEFFNQEVPNLLSWTKALGIRLIPRWCDDA  16287

16286  NDILDRWNLELCDKAEASVGSTELDAEPVVYKQLKQAMLKHTSKEDNQNS  16137

16136  VPDTPEKQRIEIACELYDQLTAGFETSAVALTYLFWELSQHPELQTKLREELLTLDPSIR  15957

15956  YPATSKILPSAKSVDSLPLLDAIVTETLRLHAPIPGIQPRVTPYPSCNLAGYTGIP  15789

15788  ANTRVNAQAYSLHRNPEVFPEPETWQPERWLKDGNSSAELEERKRWFWAFGSGGRMCVGS  15609

15608  NLALQ (1)

       EIKLVIASVFTNYRTSIVDDDGIEAIDAYTVKPRSEKLVLKIEVA*

 

>CYP584E12 Aspergillus terreus

77% to CYP584E6

ATEG_02893.1

MQTDQGHFSVAALGVAVVVVFYVLNVLQRKWKQARFIKENRCESVALSTESRLFGINQLRENVDAAKSHRFLTLTEQRFQ

RYGYTFRAKRFATSFVNTCEPLNIKTVLSLKFKDYSLGGRIDTFGPLLGHGIFTADGEHWAQSRAMVRPNFVKEQVADLE

KFEELMQGLLELIPTDGSTVDLQDLFFCYTIDSATEFLFGHSVQSLQKRLSGVSLDENDFASAFNYAQDAIAHKARLGFL

RRFVRDPKADHANRVCHELVEQFVDKALKYREHYDEEKAEGDEAKRARYLFLQGLAKQTGDRDRIRDELMNILLAGRDTT

ASLLSNMFFMLARNPEIWNKLREEVATLEGRAPTYEQLRNLTYLKYCLNESLRLHPVVPINSRRAIRDTVLPLGGGPDGK

SPVFVPQGTIVTYSVWAMHRREDLYGPDASEFRPERWADLRPGWEYLPFNGGPRICVGQQYALTEAGYVTVRLAQQFTTL

ESRDPGPWEEGLTLTLCSRNGTKVSLRR*

 

>CYP584E13 Aspergillus terreus

63% to CYP584E12

ATEG_01150.1

MVISALVSVGPTTFLKALFGFVALYFAILAIKQKLALRASAGHAVRTRGR

PFYVGLDMLWETLTHAKKHQFLDLQRTRFR

RYGNTFSTKRLATTVITTCEPSNIKTILSLRFKDYELKRLSSFGPLLGKGIFTTDGAEWMKSRAILRPNFDKPQLVNLEM

FESLMQEMFKLIPDNGDTVDLQKLFFCYTVDSATHFLFGHGVHSLRKLRLGSAGDDTEIQFATAFNYAQGSARIRHRLGP

LKALYHDRKAMECNKICHQLAEECIDKALQAQADGASGKKKRYIFLEELLAQTNDRRRIRDELLNILLAGRDTTASLLSN

LFFMLARHPHIWQKLRTEVANLDGQTPTYDQLRSFKYLKYCLNESLRVHPVIPVNARFATKDTVLPVGGGPDGQAPAFVP

RGSMIVYDVYNMHHRQDLYGPDADEFRPERWEHLRPRWEYLPFNGGPRICLGQQYALTEAGYVTVRLAQRYRTLESRDPY

PWVEDLTLALSSKNGTHVSLMT*

 

>CYP586C5 Aspergillus terreus

62% to CYP586C3 Aspergillus niger

ATEG_07654.1

MFLRMVLLAVLPLLGFYLYEKARHSRFQQFAAWPQLKPSLVWGHLKAFNKFIATADPSRHIDIVLQEIRRHLGNPPLFLL

DLRPIQRPLVIVCSHEVAEQVSKSTKELPYSVPKSPTIKALEPLLGPNSILSAHGEQWRSLRKRFNPGFAPQHLMSLMPC

ILDKAWRFLENLDRHALDRNEFSLDEPCVNLTFDIIGAVTMDEDFCAQLGQDKQTELVRRFRELTLNFRTVTSNQWFTLN

PRTIIHRWWLSRRIDTILSDHIRAKFAELKAQSAAGAKSRSVLSLSLQNLDRLDNRIVAQTRDQLKSFLFAGHDTTSILL

QWAFYELSRTPRALAATRAELDDIFGADSSPAVVRDMLLSSQREGLVRRMSYTSAVIKETLRLYPPSGSARHLPYGSGFT

VALPGGGSLCLDGTVIYNCSTVIQRDEGVYGPTAAEFRPERWLGDTDTSMQTNVDAKEDAGRIPASAWRPFERGPRNCIG

QELANLEARVILACTVRRYDFEKVGLGAITHDSTGLPVVASNGQYEVENEVFNTMQVTAKPVDGMKVKVRLVPGAAPLLA

 

>CYP587B4 Aspergillus terreus

AAJN01000219.1

ATEG_08901.1

5121  MGLLSNFQNHDSSYLLLQSVTALLVTASAYGLYRGYQVRSMFQSLKKQGI  (0) 5002

4919  PLMPHSMIFGHLEVIGKLMSRIPSDAHGDYMMVLIQENWKELFPGCSKCPPVLYIDLWPF  4740

4739  APPMLISINPDTSAQCTQDYSLPKAYQQKRTLYPLTRNRDVSSMEGAEWKVWRKRLNPGF  4560

4559  SIQNITSRISDILEEVEVFVGVLEARAGNDGAWGEVFPLENATTNLAMDVILRFFL  (2)4392

4329  NKRFHQQTGPRSPITVALLDTISRMYFYVNIFNFLSYISPWRHFKLWLNYRTLFNSLSPF  4150

4149  LTERINEIQKNSQVTNKTLIDLLVKAMDEEKGTNGAAGDLSTNTDFLETAIGQI  3988

3987  TTFLFAGHDTTASTICWLFRLLEQHPDILSKLRAEHDAILGPDPSQAAAALRANPQLLNA  3808

3807  LTYTNAVLKESTRVHTNVGTMRRGEPGFFLTGPPGSGPECEGKQMPTDGFVVWDGNFAIH  3628

3627  RSPDVWPRPNKFIPERFLVTDENDPLHPPKNAWRFFELGPRGCIGQHLAMVEIKLVMALV  3448

3447  VRRFDIECAWDEWDSKR (2) 3397

3356  NFKGPQNMVWGDRCYQVGGDSPPHVKDGMPVHVRVRG*  3230

 

>CYP595B3 Aspergillus terreus

72% to CYP595B1  Aspergillus flavus

ATEG_02452.1

MLVELLSNGFTWSLIAGVAGLLLLFTKQRPVFPVVNDYPGDFLRRKAYREYNKNARKLIADGLAKHHGPITLLVPGGMKI

VLPSALSDWVKTNRNLDHQELVREEYFARFPGFEAQYAAHSPDRMLIDMIRTKLSTNETILPTVNQHLATALQEHWGSSG

VWHVINWDKDTTGIISRAAASVFVGPEKAADPEWQTLVQTYVREFFTAVGELHAWPAVLRPVVHWFLPRMSTCRALVRQA

RATMRDVVYKREQEAKAGRERGLEAPQYNDVVAWTQNVPSNNLPAGDIQLALAMAALFTTTEALKQVLIDIAQHPELVDP

LRQEIKQSLSDQGLGLAALGKMELLDSVMKESQRQIPVSVGLERKVIRDTFLPDGTRIPQGSHIMVDSGDMWSAEVHDNP

ESYDGYRFLKRRQAGNKKSQFVQSSREHNTFGGGRHICPGRFFASNELKLCLAHILLKYDVRLKHGYCSRPVQFGVYASV

DPVAELEVRRREVPDDNVL*

 

 

>CYP606A3P Aspergillus terreus

53% to CYP606A2P, 50% to CYP606B1

possible first exon followed by a frameshift (&) and deletion

of most of the P450 sequence

ATEG_00556.1

MIDSLVLDRPAVLFAGLAFVGIIFLRILFSSLLPNIPIVG &

RESQRLNSFVVTATNRMVVNPNG

VTTPSGVRIPKGTMVYAPSYPVMHDPDIYPDPESFKPFRLADKRTALGEEGQSYVQRARQAWTTTSPKYPAFGHGCHACL

GRFFASTLLKLMLAYILMNYDFQFLERRPENMWIGSNRTPPMKATIMIKRRVESEK*

 

>CYP608A3 Aspergillus terreus NIH2624 XM_001218190

75% to CYP608A2 Uncinocarpus reesii

ATEG_09569.1

MELQARHTYAALLHFPSLARRVQNPSAKDLDIDLQHYPQVIHFP

NTTGAFCIDRSVIDEDAEATTSPGPLNLTHPEAILSDRTASCVFLYIASRTFASPTPT

PAYPAMFTPLPQLTSETSPGASSPPVVHINREIRRSIKVNEAYSKALDKHGPVVIVPR

HGRNEYVIDHRYAHEVLTDTKNFTFEKAVFEMLHLGFLALCDNGAFVHDVDSLVEKNV

QPRMNAIIEQIFPIFTHYFDRMADGLPNPAVDKTAVEFPDMFHRIQLAVAHAMVVMIL

GQPHASSTVAGHFAAVAVAMANMTGMHENTHEWTRLPWLWVLVNGYSAVFLTIIPRFF

FRIVPTLWKARNEHLKNGLAAKHGEFVPLFDILLTKHYHGTTGLFALAGFFRCVIVSI

GVIFASIHQTVVAGLWILIKLTQKQDEYLPALREEWERVNPAGECLNVKKLTQLTLLD

SFIREVLRTKGDTWGPVRQTTQPVRVGPYVLPKDALCMVLISRVHQHPDNYGTEGTAF

NGLQWAEKGRPAVQGAPDFLTFGLGRWACPGRQLAIHEIKVILYMIFSKFDIKLKGDR

YRVTNTINTTSVAPEATFMLKRRDV

 

>CYP613G1 Aspergillus terreus

50% to CYP613C2

ATEG_03474.1 gene mosdel too long at N-term revised

MYPLESVRHLVVEQSQLCYILFGAVLAYAGWRWVLRLDILNEAITD

LMSNLLNYYLTRRYPIHHSETGQQIPGRSYRWPNGQGDQGKFLDGIENRAQWAKEHGRIYRIWAGTTPEVVLQTPEHIKL

VFRDSDRHSKAVNNDSGYLMGQVLGQCLGLISGGDWRRVREVCEAAFTHSKAINYLDLIHSRVGDYLQKCTALQRGTLNP

ADDFKFLPFLVVGDILYGHMTQEMEDELRQMAPLRERLFQFVIRGGLARYTWSQYLPTEANHALREFRSRWVAFNQAAYC

RARERGATATPVYQLFTAVSDGMITAANAYQTLDEMLFANLDVTLGGLSWNPVFLAANPAVQEELYENITAAQEAEGPAM

PMYLQDSSTYLAACILESSRLKPLAAFSVPQAAPTARVLDGYVIAGGTNYIVDAYALNVEHEFWGPDRHEYRPGRFLGVK

GADLRYHMWRFGFGPRQCLGKYVADLILRVFLVHLVRNWRLGFEDGQIADSREWKRDLDAWITHPTIELTCTPRGARA

 

>CYP617D9 Aspergillus terreus

64% to CYP617D4

ATEG_05929.1

MAVPFGVIYIALAAYTLTRSTINNFLLVSVITALAKLVYNLVLYPDFFTPIKHIPTPATRSWLKGNTRSIFIESPFAQMR

KWQKEVPNDGLIRYYITGNLERILLTKPKALSELLVYKVYDFPKPEFIRSNLAPITGEHGVLLVEGDEHRKQRKNLMPAF

AYRHIKDLYPIFWAKSTEMVRTIEKDLKNRTDPTDNVVRVGTWASRATLDIIGVAGMDHDFNSLQDPDNNLVQQYHKIMT

EHPKYVKVAFVLAMVIGVPNLVSKLPFKVNIQTKESSEVIRAVARDMIRQKKEKLENKTAKNSVDIISVALESGTFTEDD

LIDQMMTFLGAGHETTSTALQWAAYALCKHPDVQTRLREEVRSNLPSISTDNPEPLSAATLDTLPYLNAFCNEVLRFHPS

VPATIRIAARDTTLVGAHIPKGTLILLAPEVVNHSHELWGPDADQFNPDRWLGPGKANTGGATNNYAFLTFIHGPRSCIG

QGFAKAELACLVAAMVGKFQMELKYPDAPLDVRRGATVCPRDGVLAKFTPLEGW*

 

>CYP619C1  Aspergillus terreus

          CH476602

          This P450 is two genes away from MSAS polyketide synthase

          6-methyl-salicylic acid synthase used in patulin synthesis

          patulin is a mycotoxin sometimes found in apple juice.

          51% identical to CYP619B2, 39% to CYP619A1

          ATEG_06277.1

MSKWAKQYGGIFSLKRFRNTTIVLTDWKIMKELVDKKSTNFSHR

PPSKVADLITRGNHILMMQYGETWRTMRKLIHQYLMESQCEKEHWKVQEAEAAQMLHD

FLVDPENHMKHPKRYSNSITMSLVFGIRAKSVNDEYMTRLYSLMEKWSLVLETGATPP

VDSWPLLQWIPERFMGYWRRRATEVGDLMTGLYTEVLHVIENRRKAGIYKDSLMDRVL

DKKDKYRFDEHQLAFLGGTLMEGGSDTSSSLILAIVQAMTQYPEVQKKAHAEIDSVIG

TDRSPAWSDFRKLPYINMMIKEAHRWRPVLPLGVVHGLATDDSYNGMHLPKHSTVILN

VWGMHMDPDRFENPDAFIPERYANFPELAPHYAALADGAARDHFGYGAGRRICPGIHL

AERNLFIAVAKLLWAFEFKNNPAGKNDASAETGSSQGFMHCVKDYDAIVTVRGEERRQ

TILRELEQAQTVFAKYD

 

>CYP620E7 Aspergillus terreus

55% to CYP620E5

ATEG_02682.1

MSTTLLLKAILAIASLYIVKLFLSGKRGAQPLPPGPVPKFIIGNFHDLPPHGVKDWEHWLRHKDLY (1)

GPISSVTVLGQTIVVVNDAELAVELLEKQSAATASRPRLVFASELL

GYGLSLPMQTDLQRTRAYRKAMHHVIGSTKSMADFHPLLEREVRRFLLR

TLRTPKELIQHLKT (2)

LTGAIILEIGYGYTVEPHGPDPFVDLANKVMAEFSVATQPGTWAPDIIPALKYIPSWFPGAEFQRMAKTFNSRVNDFSGKPYAFVQKK

MARGSYKPSYLSRLLEKDNPQPGSEEELVARWSAASLYGGGSDTTLSSLGSFFLAMAMYPDIQRKAQAEIDRVAGNRLPT

FNDRAELPYTEAVVKELLRWLPVAPMALPHRATDDRSCGGYLVPRDALILPNVWGFLHDPEVYHDPMTFNPERFLGSTPE

PDPRKFAFGFGRRVCPGKALAEANAFLAVAMSLAVFRIRDAKQNGRKIDGYPDVTAGVISHPVDFEVEISARSAAHEALI

ESVEKDCPWQEGDGKECDF*

 

>CYP620E8 Aspergillus terreus

72% to CYP620E5

ATEG_07797.1

MALYTLVGTLVALAVVYLLKQLLLSKPPTAPLPPGPKPKPIVGNLGDLPPPGQQEWKHWLQFKKLYGPISSITIFGQTIV

IINDAQVAFDLMEKRSSIYSSRPRMVFAGEMVGWNDALAMQTYSDKFRAYRKVMHRVLGSKAVTARFNPLQHVEIRRFLL

RVLDKPNDLLQHIRTEAGAVILKIAYGYTIEPHGRDPLIDLANESMDKFSVAGTPGRWMVDTIPFLKYLPTWLPGTDFIR

TGNAWRKTLLTTIEKPYQLVLQQMKQGSCPPSYTASLLEEANGNATPEEDLVIKWTAGSLYTGGADTTVSALSCFFLAMT

LYPDVQRKAQEELDRVLGPNRLPTFEDRDNLPYIEALVKETLRWHPVAPTGIPHLCTEDDLYNGYLIPKGALILPNIWAF

THDPNVYRDPASFKPERFLDTDGTAPELDPHMLAFGFGRRICPGRFLADSTIFMSIAQSLTVFRFEKDPAVTAQPEFLPG

VVSHPTPYQLKITPRSAQHEALIRSVEVEHPWEESHAKEIEKIECVV*

 

>CYP620H11 Aspergillus terreus

58% to CYP620H5

ATEG_07254.1 revised

MSPILIATAIGLVAFYVLKWVSTKRLRVALPPGPPRKPLIGNLGDLPSHTDKAWEYWLKHKDLYGPISSLTVCGQDIIII

NDAHIAVDLLEKHSSAHSSRPHATLVEMAGWEDILTSVPYGDHFRAIRRALHQEIGSKVSVARFNHIQEVEARRFLFRVL

DDQKSLVHHIRKEVGAIVLKLGYGYTIEPHKRDPLVDLADRAMEEFSFSILPATWAVDFLPFLKYLPAWLPGAEFKRMTA

TFRKTATAFSDLPYAFTKHQMTQPSHVPSFLSHQLEKGIPRPRSSEEKVAKWSAASLYAGGTDTTVSTMTAWYIAMALFP

DVQRKAQEEMDRVTGGNRLPSYEDRENLPYINAMIKESVRWHSVVPMNVAHVSIQDDSVGEYAIPKGTQIVTNLW (2)

AFTHDPNIYPDPMAFKPERFIDTATHKAERDPYYYSFGFGRRVCPGRTLADANIYITMAL

SVAAFNISKPVRDGKEVEVKLDPQPGIICHPAPVELDIKPRNQVIERLIRAVETDYPWEKSHAELLTSLPY*

 

>CYP623E1 Aspergillus terreus NIH2624

AAJN01000124.1

93% to CYP623E1 = ortholog

ATEG_04418.1

39131  MGASTFSQSFAEGYAAWALMLPALVGCALLIYRAFFAIRYPANLPLAGEPDGKRTFSWR  39307

39308  TRWRYYIDCEALYKETYDN(0)

       YTKHGKTVLLPGLGFRHDIVLPQSA  39487

39488  MRDIMARPEKELSHADAVLELVQLKYSLGHEKYKADPWPCMLVKSDINSKLEAVCDGMNE  39667

39668  ELKYAFDKYVGCDTESWKEVDLLETIRMIIMAAASRFTVGFPLC

39845  RSEAYLRACWKVNDGIMMNGGLTGATPRLLRPIVGPLVTMKLRQSIEQVKKHVEPIYRQ  40027

40028  RVQALSQQNSAEKPASDETQDLFQQMLRYAQRERPGELHDLPSMCRRLCFANFAAVHQTT  40207

40208  LLVTNMVLNIVSSDPQHNTISVLRDEVKDVIGPDSNAKWTKYKVAQMIKSDSVARETMRL  40387

40388  YSNTNRGVFRKVLVEGIKTEDGIELPKGAYVSFLGRPLQCDPETFEDPFEYNPFRFSRIR  40567

40568  EQAPRDTKGRSSASHLSFVSTSPEHLPFGHGGHSCPGRFLVDFEVKMIVAYLLMNYDVEF  40747

40748  PAEYKGQRPANRWMAEALMPPSGARIRIKRRS*  40846

 

 

>CYP628H1 Aspergillus terreus

46% to CYP628A2

ATEG_08441.1

MLISLDGSCILAAAYILGIGLHQTIFRYGEWDLHSFKILVAFSVVPIFLGTFLQSFHLPSRGKTTWESLEYSSVLVFIAI

CGIFSSISVYRGWFHRLNEFPGPFLARFSTFYMTFVNIAEARGFKTTQALHSKYGDIVRVGPRELSVANPEAFRAIHLSS

SCGRGPWYNVTAPMISLQMERDVKRHGERRRAWDKAFDNR (1)

ALGDYMTRVNAHTENF

CAAIEDSVKNNTSLNVTKWIHLYSFDIMGDLAFGSSFDMLQSGTFHYFFNLTHKTLELIAIFSRLVWLFPVVKAVPFLSN

DYKSFRKWVGSHVQRRIAVPPPVRDIFSWILNDYQRKQNPSWQDTENLYGDASLIVIAGSDTVAGTLICLLYHLASSPDV

CKKLRDELHSCAKERADTELRPDELAKLPYLQACIDETLRLWPAVVDGLQRETPPEGLTIGTEKKSTWIPGNVIIKTPSY

TLCRDPRAFSRPDEFIPERWTTEPELILDASVYAPFSLGRFSCVGKRLAMVMMRRFISSIILRYELEVLFKSAQDAFERQ

VKEYFTLTPPDLQIRFIKGQKG

 

>CYP653D1 Aspergillus terreus

50% to CYP653A3 Aspergillus clavatus

ATEG_09291.1

MGAGSLYILLPVLLGYILVFYHALSISRKTKNNIPILKHSRFLPDWINRRIFFLNAPAQIQYGYDKYNNMPFLVLRPDHD

LLVLPARYLAEIRQIPSSRLNLIEAEYN (0)

NILGDYTNILKDSE

(small seq gap, 14 aa)

GRILPRTMQELQHAFDVEVPPCSDGWVSINLYTVILRLVARVASSVVFSDE

TCRNETWINTMISYSDNLGPTIVFLRPTPDFLRPLVSRLIPSVNRLKQQLRWVQEELIVPAVTARRAAQAANPDGPKPDD

FLQWMMDVAANDIDRDPRNIAQSLLIVTAVGMMHTSTMLITHALYDILSHPECFDPLRQEIKDTLPQGWINATVAAFAAQ

EKLDSVLRESLRLNPPAE (1)

VSTQRIAKEKFTFSDGFAIPDDVQICFPSGPVARDPAFLPDAHVYDAFRWCRDPEASNK

KLVSISTTNFHFGYGRLACPGRFFSANTMKAVLSRFIAEYDMRFESEHQARPANLRFGEQ

IMPSMWTKVLIRKREVKV*

 

>CYP657B4 Aspergillus terreus

61% to 657B2

ATEG_10169.1

MLSALLYVYLPPGAMGEYEITKDVLIQTARNNLTALGWTALCAAALICIITRVITGLQSRTDGSSKTSDVRPVRTVAYWI

PWLGHGISFVWDHISLIEKARDSLKEPALGIYMGGTKHNVVVSPSLVKAVMLSPSTSSVAWINYALKTVGGDRGPIRNFN

AADHHVFHHDLPNLFMREPFITEASTKLVELLKREIANFVTFSWSPVDQAPWERSSDAVLTDRSDKPVCEADFFALIRGF

VGHITTTTLMGRAILEAFPRLLDDVWELDNHFPLMAMGLPRWLPFSGLPAAYAARDRILEVLAAYQKAFLDMENGIDGDV

KLRDLDDASEPVKQRIRMSKNMGLSPHDSAPGHLLLLCAMNGDSPNVAFWHLLRLYTNPALLDDIRQEIAPYVKAWRPSR

EETGFPIPEAPKVSMDFEAMLKNCHLLKASFYETMRMDSAGLSFRELTSDLTITESKDDAAVAGVEEPRSFRVNKGESIA

VPHGVLHNDPRYFSNPGQFDPLRFLVTDPETGAKRAELHTIDPFGEGASGCKGRVLAEREILAFVAAIISMWNIEPADGK

EFKLPKHQPSRGAYLPKNDIRVRLSMRV*

 

 

>CYP660A3P Aspergillus terreus

51% to CYP660A2   Aspergillus niger

ATEG_00534.1

Pseudogene with defective EXXR = KTLR

Deletion near the PERF MOTIF

MPNIYALTVFGVVSALGYVLNRQQKPDLNEPPNSRQD (0)

(gap, most of N-term missing)

TFESALKPLAMKFLS*LIACK

AWQAHEKVVAALVKYYEIGGQEESSELAFVRWKTLRNGGLPIE

NIARSEVSMTVGLLSNTVPANFWVLFGLYSRPELLEEVRQEVAQKALYTSDNVRILHISTLHDDCPLLLSVFQKTLRTRT

WTSPSRFVPDDFLLTGQYSLWAGSVASMPDASVGRTP

(12 aa deletion)

RRFLTTNEDARRVCGFMMFGASPILCPGRHFASAEILAKAATT

VLLYDLTPMGGVWNVPKINTMAITSVIQPLKGGYEVTVSPRKEYEGTQWACTVREGNGMFNLMVR

 

>CYP660A4 Aspergillus terreus

66% to CYP660A2 Aspergillus niger with one frameshift

ATEG_00435.1

MLDLYRLVALGAVVALGYALSRRQHRDPREPPVVGSGIPIVGHLLGLLWYGVGYFSLMTEKYTYPIFSLDMVFGKAYLVT

SPALLQAIQRNKALTFDPFLTMSAQRIAGIRGLGLELMREKQSGGQGLNQKVVHAMHPTLTGRPLDRMNERMTQLLSPLV

DELATRKTVDLYSWCSHVITLASTEAS

YGPLNPYKSREIEDAFW (2)

AFESNLSPLTANFLPWLTARKAWKGRETAVKAVIKYYELGGHEEGSEMTYVRY

KTLREGGMSVEDTARSEVTMAIGLLSNTVPASFWVLFELYSRPELLEEVRQEVAHNALRVTADKKHVIDISA &

LRDHCPLLVSVFQEVLRTGSTTSPTRFV

LNDLVLADKYLLRSGSVISMPGASMGRNPDAWGSTAGDFEPRRFIKTDKTPRRTGGFMTFGVSPVLCPGRHFASSEILGM

AAMMVLQYDLTPVDGAWTPPPVNPMAITSITRPIKGGFDVRVSPRKEYEGVRWDCEAQEGNGMFNLMVG

 

 

>CYP662A2 Aspergillus terreus NIH2624

AAJN01000191.1

90% to CYP662A2 Neosartorya fischeri = ortholog

ATEG_07945.1

        MLALFLIPVALV

267630  SYFLVRLRQQRAMFKNLPGPPHHAIWGHFLIMRDIASTLPPDATPQLFAHLMRQRYGLGD  267451

267450  FFYLDLWPLAPPQLVIAHPELATQIVHRMNLPKESAVMQKWTGPILGEKSMVSANGHDWF  267271

267270  IARKSFTPGFQPRKLLQHVPNIVDEAVAFAGVLREHAQRNDIFRMEDLGARMIFNISARVIL () 267085

267032  GIECNAQRDDDEFLDLFRRQAALAPQDFWSRYLYDVNPRRYYQKWNNGRALDRYVGQLVD  266853

266852  QRVVSGPTSIPSDKAKYYAIDDAIATSRILNKTIPPSTSMDKDTRDMLIASVKTLIFAGH  266673

266672  DTSASTLC ()

266602  YTYAALSKHPQVLHTLREEHKALFGAEPSAAANTLRSDPSLVNNLPYTLAVIKEALRLWP  266423

266422  PTGVSLRRGQPDQSILADGKEWPTYPFAVLVNNCATMRREDLFKDAERFYPERHLVTDPA  266243

266242  DPYFVPRDAWRPFEKGPRMCLGQTLALIQLKIALVMTVRTFDFEIVYEEGTFMYQVLDVT  266063

266062  AKPSQGLPTRVRWIE*  266015

 

>CYP662A3 Aspergillus terreus

52% to CYP666A2

ATEG_09350.1 this model is a fusion protein, revised

MFQSFGIALWGFLALYPIHVTLEFFKNRRLAQQIGLPYMVFPFSEHSVFYLGFVETRWYRYLVDHCLPAWLADLVHNSSF

KYRWRVKDRITKLYGPVYTIVTPWSVTCHVSEANVVTQVCMARRSFPKPVKNYEGFAIYGPSVLTSEGNQWARYRRYTSA

TFNEKNNALVWQESIRQGIQMTNYWEEKHASDSPHTLFSLPDVRDDIVKFTLNIICSAGFGVTLPFKPAYKATTGDAEGL

FQDAVMPPQGYSFTFPSVMEYISTSMSTVFFANGIWPKWIPRRMAPFFKTDFMAYDDLGKYLRALLDNAEVRENPSSHNL

LEGLVRARRENSELGSTHRVDGLSDEEIFGNLYIFMIAGHETTATTLRFALVLLAMHQDVQDHLYDEIQEVTMGEPANPT

GWDYERTFPKLVAPLCIMLETLRLYPPVSSLPKWTDTSSASISYRDQAYQIPPATYLCLDANALHYDEMYWGPNASEFDP

SRWDKRNIDSFLAKNDGLDGLSGPGLEHDTIHRPVRGAFLPFSDGLRACVGKKFAQVEFVAALVIIFRNYRVTLQKHADE

SESEMRCRVQQALEQSSNAQTLTIGENVPLVFSRREA*

 

>CYP663B4 Aspergillus terreus

64% to CYP663B2

ATEG_07324.1

MAITILTSILGIFLLRLIYEYQRDRKLPPGPRRLPFIGNIHQAPQILPWRTFHEWSKKYGPIMSVQFGRQTIILIADATI

ARELLDKRGSIYSDRPRMVMANENLTKGMHLLLRRYDERYRLHQRMEAPVLSPRASSTYYPIQDLESKQLLYDFLSSNNF

FKHFERYSASLVYTLTYGFRLETGEEQEMKSAREVMHNFGLAARPGTWIVDAIPALNTLPMCISPWKQTAEKFFQIEANQ

HMRNMTVAKENKVWNWTKEFVVSKQAEDMSPLELAYDMGILADAGLETTSGVMQTFTLALLSYPGFIKTAQEELDRVVGP

DRLPTMSDRENLPYMTAVVEETLRWRSMAPGGVPHATLKEDTFMGYRIPKGTMVMALHWSMSFDERHFENPLEFHPERWI

GRNPDDGCFTNFFGYGRRVCTGRHIARNSLFLLMSRILWAYNVQPGTGPDGKPKKVDDMAYGSGFVSIPLPIRRDL*

 

>CYP666B4 Aspergillus terreus

59% to CYP666B1

ATEG_07596.1

MNNFRWRIKNRQVKRYGGVYLVVTSKTVTCCVADAAVVSQIVNARNEFPKPIWQY (1)

KVIELYGPNLVT (0)

CEDKEWAHHRRHTATTFN

ERNNELVWKESIRQATEMLHYWRQTASPRPDTLALNDISEDIVQFSLNVISGAGFGVQIP

FKPSLSRANSPNDADIFQDTACPPPGFDFTFRSVVAYTDVKIRTVVFANLMLPRWLRRPL

APFLRRAFAAHRDLENYMKRLIETGSASFAGAHGTKETASNLIHGMLASRADAADKAKGL

SDREIISNMHIFTLAGHGTTETSLKYAFVLLALSPRVQEWLRQGILDAVGNEPADPAQWD

YAAVFPKLVTPLCVM (0)

LETMRLYPPVVTVPKWTGASPSRIHYRGRDVVLDPGVSINLNMNGLHYSEEYWGVDADTF

DPARWDARNSGSFLAQYANTPGLVAPGLEYPTVHRPVRGAYIPFSDGFRACLGKKFAQVE

FVAALAVVFRVYRVRLADESDAGRRQAERALQESVSVVTLGMVEGVPLVFERV*

 

>CYP675A3 Aspergillus terreus

58% to CYP675A2  Aspergillus oryzae

ATEG_07776.1

MLDNIPDRQLILQAVVLGFATYWAAWICYSRWFHPLSRYPGPFWASVSRVWTVMHVLRGDAEKAQKSLHARY

GRVVRIAPNELAINDPQYIKKIYGINSRFTK (0)

SDFYLSFRAPF (1)

SRYPDHFTSTDEKVHAERRRIVSHVYTMTSILQSENYLDECTAVFLEQMG

KIADRKGTFDLHEWARMYAYDVIGELYFSKMFGFLKSGCDHLGFMASTDTLIPVMTLSAVMPTYIRSVFMFAGILFPRVR

NALTALGNLSKAAETAVQERLAQRDESKDGPERADVLNKVLDIYHGKKADFDLDDVRLEAFGAFFAGSDTTAIFISGTLY

HIIKSRDVYDTLTREIDQGTRNGLLSTPFITYNEAVKLPYLSACIKEGMRVHPSTALTFPRNAPKGGCDIEGHWIPETAR

VGVNAAVVQFDKSIFGDDADTFNPSRWLGPDADNMSRYILQFGAGSRTCMGKHISMAEIYKIIPALLRSYHFELDGNGDL

KTSSYWFYKPANITTRVQRRQV

 

 

>CYP677C1 Aspergillus terreus

48% to CYP677A2

ATEG_02825.1

MISASSTRGPFRAELEGGIPWRWSLLPFGAILTLIWVLLRRLHHAGLSRFPGPPLAAVSGLYKTYIEVLQQGCFVHKLEE

LHARYGDVVRTGPNELHFSSPAAYMDIYNMNNRWDKDPALYEAFGESDSSFGRLSYRDAKERKNVLQSLFSKKAAVQAHR

LVESKVVELCKAFEKSEGGPVDLLAAFRCLSIETIA (1)

YIFCGQSLGAIESPTFDAPIIQS

MDEGVSYIMLMKHFPILQLLMNHCPPWMSKLLSPKANGMVDFRN (0)

FLEKQVRSLVADRRELQKLPHTSTIY

HLLLGPEVANPPSQLSILEETQTQVFAGESSGLTLMHGSFHIIQTPRVYRKLREELMAAWPDLEQPPSLATLEQLPYLT (0)

NATVKESLRMGGGATSPLLRVVPQTGAKIDGKFVPPG (0)

TVVGSSSHFVHRNGDVFDRPHECIPERWLDERRADMEQYLVAFGRGPRRCIGEN

FAWVILLTAMAHFYRKFDVELDPSS (2)

PAKLEWKDRFVPVYSSPHLTVRLQKVSQ*

 

>CYP680A6 Aspergillus terreus

67% to CYP680A5

ATEG_04863.1

MARADLLQLLGFTLVAATVVRGLWTVIYRLYFHPLAKVPGPFFARAFYFYSFWYNLNGGRLYLQIQKLHEQYGPVVRISP

NEIHLSDPENCDKIYYVGSRYGKDPAFYGAFGTEKATFTTPSPDMHRIKRSALNPFFSRKKVLDLEEIVQEKAAKLVGRM

RAAFESTGRIDLHHGFRAISVDVITDYAFNHCYGFLDEEEFGVEFFNMIRDFGPAFWFFQQFPAVQPLALGTPFWLAKLT

SGALTRMMLHHEGSRRQILRVKDEVDNGKKAARTTIFHQLLSPDAAEGYVVPTVEELKDEAYILVAAAADTTGNALTIAT

YNAVRNPKIYQRLTAELKEAFPDPAMKMDFVSLEKLPYLTGVIKEALRLSFGVVGRLPRVVPDPGAEFNGYHVPGGTVVS

MSSWIMHHNEDLFPQSEVFNPERWTDPEKARSLDRFLFSFGKGSRQCVGMPLAYCELYVTLGQVFRQFDDLTTPAKAREE

LLYNDYFSSYHPEQYNKFVFKRGSNGQ*

 

 

>CYP682C4 Aspergillus terreus

78% to CYP682C1 Aspergillus nidulans

ATEG_04990.1

MELLRLLLSHPYVTAAAVTVGYLLSAAVYRLWLCPIAHFPGPRLAALTVMYEFYWDTICCGQFTFHIGELHKKYGPIVRI

SPTELHVSDPDYYEVIYSRDSPRNKYNYYQRTFNAPLALITAEDHFRHRLIRSHMNPFFSTMRIRQQEPVLRALINKLCG

RLEEWKNTGKPLHIEHALTCYTTDVITDYTMGEGYHYLDEPDFIPQWYHTLTGTARTLVFIRPVAFLLPLLLAMPESVTA

WLNPGMELFFDFQRRCRKLIHKIATDHLEKGSHAVDQKGRLTLFDDVLSSDLPEQEKSEARLAQEMQILVSAGAETTAKA

MTYILFYLLDNPELLKKLKAELEPLGPDPALIQLEQLPYLTSVMLEGIRLSYGVTARLPRIAPYNALKYKDWTIPPGTPI

SMSCLLMHHDESVFPDSYRFDPERWTDLTERKRLEKYMVAFSKGSRQCIGMH (2)

LARAEILMVISTLLQRFEFELYETTVEDVRVKHDIFIPFTKLDSEGVRVLIKG

 

>CYP682D6 Aspergillus terreus

63% to 682D2

ATEG_08919.1 revised

MKEILLLYAQAAGLVGAAYFLVLAIYRLWLSPIAHFPGPKLAALTLWYEFYYDTILHGQFTFEIARMHRRY (1)

GPIVRISPYELHIDDPEYYEVLYSRDSPRNKYEYYVRQFGQPKAAFSAVEHSRHRLLRASMNPFFSLTRIRRHESRIKALADK

LTQRLNEFQNTGRPMVIQHAYTCFTTDIVSEYVAGQDFHYLDSPDFMPQWCETLSGIAKAGVFFKPFPWLHSVMKCLPQS

WVSRVDAGMGLFFSFQQRCASLIQSITDSENNQPGKSANNTRAHTAFFHEVLKSDLPPSEKSAERLAQEMLIVVAAGAET

TAKALTWITFHLLNKPELLQRLLDELQRLDPNQTASLLQLEQMPYL (0)

NGVILEGLR (2)

LSYGISSRLPRIAPDRALHYKEWTIPPG (0)

TPVGMTSVFMHHNESIFPDSHRFMPERWLDLQTRKHL

EKYMVAFSKGSRQCIGMNLAKSEMLLAVSKVFREVKFELFETTVEDVTMA

HELFLPFPKVGSKGVRVIVRS*

 

>CYP682-un2 Aspergillus terreus

41% to CYP682C2 Neosartorya fischeri C-term fragment

ATEG_06280.1

TPISMNIWNTHYNKDFFPGPTEFWPERWMGEGTRELEKYLVPFGSGSRMCTGQNLSIAEQV

LTIATLFRNYELELYQTTKKNVVMASYCMISLPGSESPGIQVKVRKTVQ

 

 

>CYP684A4 Aspergillus terreus

53% to CYP684A2 Aspergillus flavus

ATEG_03444.1

MAYIQASSTQAVVVLLLVLVLTKIYRVYTGPLAHLPGPAISKWTGLVLQKHLFAGNRPRYVQKLHQLYGPIVRISPDELD

VSDSAAAKSIHRVASRFYKGRFYEHIGHRSPKTLFSSTDPQFHAYRRRLLGGAMSETSIRQHEPTVAQKVKLCVDQMARE

AERRGCIDVFKWWCFLATDTIGELSFGESFRMLEKGEKSQYSRDLELVSTLMIIRTTFPFLSRVAEYVPLPYFKQAAQSG

KRMFGYASESIQRYKKHVEM

YGDGVRPTLFTKLITKGHQEGSLTEAEIRLEAGGYIVAGSDTSAISLTYLVWAVCKN

PLIRDSLVAEVATLPEDFTDDDVRALPYTRRVIDETLRLYPAVPGALPRAVPPEGATLVD

HFIPGGVTVSTQVYSLHRDPKIFPDPDR (2)

FDPDRWIDPTTEMRDSFMPFGGGSR (1)

TCIGMHLARMELRLATAHFFRRFTSPTVSTKEGFTDDDMYQHMYFLVSPKGHRCLIDV*

 

>CYP684A5P Aspergillus terreus

54% to CYP684A2

50% to CYP684A4 Aspergillus terreus

gc boundary at DPDR, bad boundary at HLHM

ATEG_08902.1

 (seq gap upstream)

LAGRRAKYVHFLHLHM (?)

XPIVRLSPGEVSVSDISASREIHRVGGQFLKSPWYLTLTAKGVENLFNTIDPQFH

GRHRRLLSMPMSDTSLRGVEPLVNSKIQFTIQRMKGDIERTGVVDIYKWWILMASDIIGELSFGESLGLLEIGMESPFIT

DLKAVGTMEALNTTFPCLVNLASIFPLPFIPNVVSGGRRMVQYADEALARYKNHLVTNAENPKVSLFTRIYKATEDGLTD

AEVRDDALSYIIAGSDTTATSLTYLVWAVCRSPRIKQALLEEVNSLPDGFNDQDTRRLSFLGQVINETLRYAAAPSGLLRVVPSGGRVLAGHFVPAGVTVSTQAYSLHRDPTIFPDPDS (2)

FNPSRWENATKLMKDAFMPFGGGSRICIGLHLALREIRLATCYFFRTFPHAEVFDEKTTDADMEQVIYFLMAPKGKRCFIKSPGSV

 

>CYP684A6 Aspergillus terreus

54% to CYP684A2

ATEG_05259.1

MGFLTLFQSISLVLFL (0)

RLLYRRFNGPLAHLPGPEISRWTGLLGTIYWFRGQKPNYVHYLHEKY (1)

GPIVRVTPEEVDICDITAAKEIHKTGGRFLKSNFYHALAPPGTESVFSTTDPAFHSAHRRLLAMPISDSSLTGFE

QVIAGKVHLAVRRMGEEMRSRGAMDVFKWWLFMATDVIGELSFGESFRMLESGQKNQYILDLEQISSLAPVRTTFPLLVQ

LGSLLPLPVFRRVAAAGQRLIDYAQQSIDRYARLVEGSGVSAPPPTLFMKLYNAGKDGLSTTEIRNEARTYIVAGSDTTA

ISLTYLVYAVCRDERVHARLVDEVAALPENFDDRMMRELPYLNWVINEALRLYTAVPFGLPRTVPAEGAEFLGYRLPGGV

IVSTQSYSLHRDGEIFPEPDR (2)

FYPERWETVTKEMKEASMPFGKGAR (1)

ACIGIHLARRELRLATVLFFRAFPQARISTREGMGEDD

MEMKSFFLMAPKGHRCLIEA*

 

>CYP5043B2 Aspergillus terreus

57% to CYP5043B1

ATEG_08967.1

MLQDIQLSWRALATCLVAVVILDYLRVYFRRGLRTLPGPRLAPFSSLYRLS

MVYNGAGPAQYRKIHEKYGPIVRVGPNEVSVADPTMIPRIYGIGSKFTKTPFYTSMAPIYQGEVMDSLFTTRDPAHHKFL

KSSVSQIFSMTNMKNFEIFADECTRIFMDAMLDLEGEPLDFSKWLQWYAFDVIGSLTFQRRFGFLEQRTDVDGMIGKIDI

GLQYVKVLGQFPSLIPFLQTISMSRPIQKLNIFPDTMDKFLKITEEEIKTYDNNNGTEKAQRTDFLAQLRAVESSRKLSH

RDMMNHLSNNLLAGSDTTAISLRAMFYYIVKNPRVYRKIQSEIDEADQKGLLSEFVTYEECLKLPYLQATMKEAMRLHPG

VGFPLERFVPPEGAEICGYALPGGTNVSISAPVIHVLKEIYGEDAESFRPERWLEATPEALKAMDRAFLAFGHGARTCIG

KNISIMEMGKFVPQMFRHFNITWASQRPEWETHAAWFWKQSGLILRLEKRK*

 

>CYP5053C1 Aspergillus terreus

82% to 5053C1 Aspergillus flavus

ATEG_01585.1

Check for missing region compared to CYP5053C2

MIIEKVEELIALIQPQPNFIHEQWSSMRLETAMLLVIATLGLLFITDYGYMIYLHFKMPPGPFPLPIIGNTHLLPESKPW

IYFEKLAKEYK AP MITFWTGRRPTVWICDAWVASELLDKRAAIYASRPRMVVFSELGAGQS

xxxxxxxxxx

NLVNMYYGDRWRLHRKLTH

MGVGLQQVRNYRGFQNDESKVVAFDLLREPKHYVKHFERYATSVVSIIGFGRRVATFSDPIITEVIAVMQRAAELNVPGK

SFPMLMESFPVLAKFPNWMAPWKHGLGKGQGRGRPFFYALAEEAANNPSSGQCYVKKIFQEAPKHNLSRMEISSLTGNLF

GAGSDTSSSTLVTFVLACCAFPETLPRAWEELDRVVGSHRSPAFQDEPDLPYVKAFVKEVLRWRSVAVIGGQPHAPIKDDHYK (0)

GWFIPQGTWVQGNVWAIHHHEREFPDSDRFNPNRYMKDSPDHRPFPGEKGYMTFGWGRRVCSGQGLAEQGTFITVAR

LLWGFRIEKALDREGNEIPVDIFDYTNGLNMRPNPFECRITPRSAEIQATIEREGMQALQDLAQYDGETEYRMSTYYAMENL

 

 

>CYP5061B1 Aspergillus terreus NIH2624

AAJN01000160.1 cont1.160, whole genome shotgun sequence

ATEG_05844.1

16164  MTVILDVLDTHHLVQ

       GIAVALLLVFVSSFYGDLADGIPYRNIPLVGRSRWEISNKKAKQRFVSSAKELMAQGFSQ (0)

       GRTVFQLMFAQSATIVLHPKYVNEIKNNPSLNFDEANKK (0?)

       SFFGSKIPGFEPFDGIDKEGILLEVINKKLTHTL (1)

       GQLTIPLSRETATVLSEKLPKSG (1)

16898  EWQSFTFAQEIPHIVARLSSLVFLGQKICRNQEWLNVSVNYTIDAFLAARDLRLWPSVTR  17077

17078  RIVHWFLPSAKRLRHHTVVATEIIQAEIQKRELIRTGKLPEEDPPRTHADALDWFAEVA  17254

17255  AGRPFNVIRSQIGLSLAAIHTTSNLLTNIMYDLTAYPEHIQPLRDEIKAIVDEDGMLKK  17431

17432  TSLTKMKRMDSVMKETQRLNGAGI (1)  17491

17569  AFLNRIAMDEVILSDGTRIPKGASITVSAHHMRDESIYPDAQTYRGFRFYDKRQEAGN  17742

17743  EHRFQFVTTSPEHLGFGHGIHACPGRFFAANEVKILLAHLLLKYDWKFAEDVGAGRPPNI  17922

17923  MHGVENICNPTIKLLYKARQPEVDLAALGEGAE* 18024

 

>CYP5063A6 Aspergillus terreus

79% to CYP5063A2

ATEG_07362.1

MVIAPYVVVLAVGLVTWLYMSTRKKNVNTVVDGNKPLLKLPLIGDLHSSPIDRPLVNWDAWTKQNGPIAVPKLFGIVPIV

VLNSFEAVTELFSRRSQWYSNRPASVSMEMITGAEPGRSRFTLMHDYDEHLKLHHRILSPSLGAVASPQYQPLMELESKQ

LLFDLANALQKCPDGATISTDAIYPLLERTQSSVILALHYGLRIPRFEEPILHEIIDTQTQVTHIAANPALPDLIPPLRH

LPAFLSPWKRAADKLYAVQVDLYMRLFHHGRNSPGWNATKQAICTAEKYAPVDSP

VSDLDLAFTLATSIQGGMETSPRQL

LWLFIAALHQPSIVTQAHAVLDAVVGRDRLPRFSDRAQLTFIDAIMHELLRWRPISPGSIPRRADHNDEFGGVKINKGVT

VMANAWAIGRDQAVFDPALGDPQEFIPERWLRHDANGDTKLRTDLPLPVFGQGRRICQGKRVATDGTFMQVASLLWAFDI

QLAEGQPVDPWEMVVVGFMTMPRERKFKLIPRGDWVLDVIRREWNDAEKSLDKVMGMAYDVEG*

 

>CYP5067A2 Aspergillus terreus

52% to CYP5067A1

ATEG_10307.1

MEQYIKLSFPSAVTECIFGLLIIGTFVMFGSRKNTPKLVPTLNDHEWDIFRRKAKKNWEESAESILRAGLQK (0)

GYPGFQVITSMGTKLVMRDQYAEELRNDDRFAVYEAFKD (0)

VALVELLG

FETWVPGGFHNHVSTPVVHALNRNITRLVQPMSEEAAHCLKVQWTDNPAWHSVSIHDTVLRLVAQITSRLFIGQEICRDP

EWQDIAKDFSTKRVIAIQAIHAWPSLIHPVIHWFLPVCHDVRKLIRRAKSILLPIFELERCNRKSGRESNNVFSTLSFID

EYANGRPYDPTMAQLRLTGVSIHSTSDLVKKVIARICEHSELIPALRAEIISAAENCGLQHSSLLKMPLMESIMKETQRL

EPPAL (1)

IVSMFRMAKETVTLQDGTQIPKGAQLAFANDLRLDRSTYPDPETFDAYRFLRMRDD

PAQSKQVPFTKTTYSHLAFGHGKHACPGRFLVCNEVKVILSHILMKYDIKAIDGEG

AGLCKSGMFVFLDPRARMFVRRRQEEIPI*

 

>CYP5076A3 Aspergillus terreus

57% to CYP5076A1

ATEG_00808.1

MPLSHPLYISAAAGIASHIAYFNKGEHHLYVTQYLKLFLAAIAAITATLHYTQSQPWPHALSTTSHLAAAYLSGLYTSLL

IYRLFLHPLHQFPGPLGSRLSSLYLPTQLNHNLYKHLHAYHTHYGPFVRTGSSDLSIAHPAAVHALYSAASPCTKAAYYD

FTHPGLALQNIRDPAAHAARRRVWARAFSDPLLRGYEARVREYQQRLVERLAGMEGRAVDARKWVNLYSFDVMGALTFGE

GFGCLERGEPHWAIELLDATMRQIGLCVPIWVMLAMNAVPGLSRDWWRFLEFCGQMLRYRVKNKPAIPDVSSALIAHLEG

RDPTPSEELLLDGDARLVVVAGSDTTACTLAAVLYELVRHPEEADKLRAELAPYADASDNGELLHSQIANLDHLNGVINE

ALRLYPPVPGGLQRKTPPEGIMIDDVFIPGDMTVSCPQYVVSRSPLCYEQPDEFIPERWYKRPELIKDKTVFAPFTIGPY

SCIGKPLAMLNLRTTVARLVMEFDVRFAPGDDGRKFLDEAQDNFVLYMGELNVVFERRR*

 

 

>CYP5076F1 Aspergillus terreus

49% to CYP5076C1

ATEG_06378.1

MWIQKNIEAIAFISGVVTHIFYFRKGEHHLYPFSYLYTYVGLSLTGAALLHYDAEASVIEATRQSI

SLICIHLLGLYTSLLVYRLFLHPLRRFPGPFGARISGFWMPMKIRYQPPYQILEDLHRKY

GDFVRIGPSDISVTNPKAITAIYGLKSRCIKGPLYDFNYPVLSMQT

MRSKEDHHQRRRIWNPGFTESAVRGYEKRVRPYRQQFMSHIASASDDGKPLDISEVCQWYSYDVISDLALGKSYGGLQKG

VRVPIAQSFIDANTGLRNMYPPWFYRLIVTSPMGSQEWKEFNDRIWQDLMARMKVTFFDLSEPDVPDIYSYFLAPLKGQQ

PTPDDIPRLLGDALLLIGAGGGMTLTVAIYELARRPEEVKKLRDELACCPRELGGEYAHENIASLRHLNGFINEVQRMHA

GVPSQLPRKTPPEGLDIDGTYVPGDMNILSPHREIGRSEAAFEKPQEFIPERWYLYPNMVKDKSAHAPFSTGSYGCIGKP

LALMNLRTTLAQLVMTYELELAPGDDGFALERNMDELFSIYVHNLYVVFREREL*

 

>CYP5077B1 Aspergillus terreus

49% to CYP5077A1

ATEG_03631.1

MALLEDIINFATLNPMVVVAIPVFLFVISLLRSYLRLAHIPGPFAAGWTNLPRFSWVLSFKAHDIHTALHRKYGPLVRFG

PNMVSVGDPKEVGHIYGFTDPWMKSDFYHALLMKPRGKPIPGIFAAQDENIHRALKKPISSAYSMSTLLSFEPYVDSTMR

VFCEQLESRFIENKKPLDFGKWLQMFAFDVIGELTFSRRLGFLESGEDINHVMANIWETFKKTSLVTQMPWLDKLWTNNP

IQRWRRGGGASPGAAFAMARVEERRELQRTTNKNDWHFNTRDFLSRFMEAEAKDPSIPPYALAAWASSNITAGSDTTGIF

LRTIFYQLLTHPETLRKLREELDQAAAAGNLDDLASWKQTRELPYLDAVIKEGGRIHPPFGLPYERVVPAQGATICGKFL

PGGTLVGMSAWVVHRNKELYGEDCDEWNPDRWLKCDTEKRRKMENALLT (0)

FGAGHRTCMGKHIAYLEMYKVVPTLLRKYD (0)

FDLVGQDEGGGWTVLNRWFVMQEGFLVRLKKRAK*

 

>CYP5078A9 Aspergillus terreus

73% to 5078A4

ATEG_01078.1 model is a fusion with two other genes, revised

MISKATLALLLLSVYLLRLITNRFKSGLRDIPGPTLAKYTRLWKLYSVWKGNHHTTEISLHRKYGPLVRI

GPNHISVGDPAAIPIIYGLNQGFTKTGFYPIQSISWDKKPQMNLFSTRDEAFHRSQKRPVANAYSMTSLLEMEDAIDSCT

HLFMDRLRAFAAHKRPVDLGTWLQYYAFDVIGEVTFAKKLGFLEEGRDVDAMMESIQGILRYASLCGQVPDAHPFLLGNP

LFPIFVPSMESWNQVLQFTLKVLHARGSLGKDEENMHEQSPDEGKDQLSRWLAIHRSDPAKLSKRDIIVHTSTNVFAGSD

TTAIALRAIFYFLLRHPSVLAKAQKEIDAANAQGQFSDPISYRESVTHLPYLAAVFKEAMRLHPSVGLILERHVPRQGAS

IAGKHIPGGTVVGINAWVLHHNPAVYPNPEAFVPERWLDSSPAALKAMEQSFFAFGAGARTCIGKNISLMEMHKIVPQIL

REFDVRLCAPELEWKTRNVWFVQQEGLVCELVPRRH*

 

>CYP5078C2 Aspergillus terreus

57% to CYP5078C1  Histoplasma capsulatum

ATEG_08443.1

MSSPPAKSILADTVVCVWQQIQLHPWWTALTILLTRLVLTRYRDGLRQVPGPFVASFSNLWKLRAVWKKNMHRENVRVHE

DYGPIVRIGPNHVSVADAPSMRAIYGVQNSAFYPLAEAIYKGRFLPTLFTTESNDYHMRLKRGAVKAFSMDTVVGLEPYV

DKCIAVLVSRLREVTDNGKRPVNPVAWLQYFAFDVLGEINFSKDLGFLEKGVDVDNIIAAIGGILTYVSLIGQIPLAHKF

LLGNPLLPKLFPAIEKTNQVLQFSLAQIEERLKNPVDRKDILSQLLETHRADPDSLTLDEIIAITTTNV (2)

IAGSDTTAISLSSVLYYLSKYPDTRRKLEK

DIQAAIAEGRASNPITYAEAIKLPYL (2)

TAVINEAMRIHPATGFILERRAPPGGITLHGVHLPEDTIVGVNS

WAIHRNKSIFGEDVHTFRPERWIEGDEEAIKEMKRNLFT (0)

FGYGPRSCIGKNISILEMWKVVFELYRHFDIDLAGDQEWTVN

GTWFTTQSNIEVRFKPKGSTG*

 

>CYP5080B4 Aspergillus terreus

80% to CYP5080B2

ATEG_08377.1

MYLLLLLPVGLIAYHILSLVYKTITTRSLISIPGPIYTRFTKLWYFNRVRQGHFEQDNID

LHQRYGPVVRIAPDHYTINDRAAIKTIYGTGSKFAKSAWYEGWKHPDPERWTLFPDRNMKRH (1)

AETRKRFSSLYSMSSLVHYEEFVDQCADIFAQRLSEHAQRAQRLNLGYWFQCYAFDVIGHITFGQRF (1)

GFLDEGRDIEGTIAALQKVMTYSTLVGIYPEWHPRLFGPLSKFSWSG

AGGRAYIMRFVQEKIRQHNGQPKSGADQGALQTQDFLEKMMLA

RDKDPEKVTDYHMFMMGQSNVIAGSDTTAISLSAIMYYLLHHPAVLEKLRREIDDFTAQGRCSPRVTFKESQEMPYFQAV

MKEALRMHSATGLPLWREVPAEGAELGGYFFPEGTVVGVNTWVAHYDEEVFPDAKSFRPERWIEAEQDPERLKMMNDMYM

PFGLGSRTCLGKHISILEMSKLIPRLIRDFDFHTDVQQWSTENFWFVKPTDFEVTVRSRASSVAGTV

 

>CYP5082A3  Aspergillus terreus NIH2624

           GenEMBL AAJN01000207.1

           ATEG_08430.1

MDHAQPTKLGFLAVPAAPYSIGILVFVLVVLAAIGPWAVVDSILN (0)

CYLSFVHRIPAADGKKYISGPAYTFPNGQMVDKFLDARTKSWEWEEKYGKTYRIWAASIPEV (2)

337559  VITDPKDVETLYQQSTDHNKAPQANAGWLLTQLLGSGLGLINGTRWTSLRKTLDPMFSHR  337380

337379  TSLQYFSDSLDAGAENYVAGIHQFAKADQVCADGKSIILNATQALQRYPFFEVASMFY  337206

337205  GKMSEEEQERLWVLGRRYSEVFAAIVSGGIHRSKLTRY  337092

LNTKAWNNARDYQTAWREFNREIYKRRKLTAS

EAPIVVLTEAAERGELTYNE (0)

VTDTIAESTFANLDIVTHVISSCIILLADAPEVQKDLLQEMNRNKADRKAYITRKDTLLHYCLLESLRLRPVL (1)

SFTFPENPPREKVLGNFVIPKDTTVIVDAFAINIR

NPFWGPDNRAYRPQRFAGIKQNQ (0)

LRYNLATFGYGPRKCLGQHIADKIIKAVVYHLFTHYKVSLQPMQAIEGDFKVDKTSWVGL

YDVDLKLDPRGPCVDKVDV*

 

>CYP5085B2 Aspergillus terreus

55% to CYP5085B1

ATEG_03471.1

MSLASLDLNALWLEHSAVIATLFAFGTALFLVSRSQKQSLNLPRFEVTNDVLKTIEEAHAQYPDDPFILSMVGMELAILP

RSGIDVIKTLPEDQVSIKRHHHDVFLGEYTYMGTKSPEFDEAMRYDLTRNTPTVLASFVAEVQYAVEDSFGRPDQWTAFQ

PRACMSKIASLMSGRAFVGLPLSRDNTWVDATVRYTQDVTRAWLVLRTIPWVLRPFVAPFLPQVRSLKNQRRMTEERLTP

LLDPSNAKNRDEIPGGDMLRWFRQRYPQGPTPKQLARDQLLATFASIYNLSNALSYLLFDLATYPEHIEPLRQELQEVLK

GEPVNKENIQKLKKLDSFIRESQRLSPPSLANMPRIVTNPRGLKLPSGHTIPCGMRIMVRAHTLNLDPNLWPNPTRFDGF

RFSKLREIPGNTFKYQHATTGTDNINFGHGLWACPGRHFASSQMKVVLAHLLLNYDIKLPNRMEKPQQQHFGLAIVPDTE

QMVLLKIRG*

 

>CYP5093A3  Aspergillus terreus NIH2624

           GenEMBL AAJN01000232.1

           75% to 5093A2 no introns, 36% to 546B1, 35% to 546A2

           ATEG_09500.1

49905  MEHLRTLLSSTLVWGAGCGILLIVLGILVHDVILWKRLPPGPPPFPLIGNKLHVPSKHPW  49726

49725  IRFRDWSKIYGPIYTIWFGRRPTVVISDPTVAAELLEKRSTKYSTRPRFVTMGEIYWDMA  49546

49545  SILVQPYGKEWLVRRKLLHSALTPRALDNYKPLQQAESARLCYQLLQHADRWEALFDRLT  49366

49365  ASIVFAIAYGHRVDDFRSPVVRQRLEFMQYSSSLNVPGAYLVESFPILKDLPDWMAPWKA  49186

49185  EIKRRGRIEAEANMNLVRVVQRDIESANEAPGTAHIFNSLTKQLLEIRGQDPASFPLTDR  49006

49005  DFSYIPASLFGAGSDTTASTLCSAMLAIVTTPMVLEMAQAELDSVVGYDRLPTFEDMRNL  48826

48825  PYLRAFCKEVLRWRPVAVLGGTPHACSEDDFYNGYYIPKGTVILGNSWAINLNPEYYPNP  48646

48645  DHFNPLRFLDVEPHSLSYLSEQYLSSTKQEKGTSHPSKLGHSSFGWGRRICPGADLATNT  48466

48465  LLITLSRLLWCFDIRPVPGRTYDTLDYSSGFNIRPRNLHVKIKVRSDHHGGVVEREYGDA  48286

48285  SEFLETLPPFEDSLPEHSPIKM* 48217

 

 

>CYP5104A2P  Aspergillus terreus NIH2624 revised

            GenEMBL AAJN01000022.1 

            probable pseudogene 54% to CYP5104A1P

            ATEG_00956.1

       MKLLALLLDSSAIATLLLA

68053  VTTGYVVYQVFFSPLAAFPGPFWAKVTYWYWAWRSMRGQAHRDLVNLHQRYGSVVRLGPDYL (2) 68238

68297  ERGKSKSFQEIYS (?)

       PEEAGGKFRKSAVHDTVTGTRPFDLLAQRDE  68476

68477  KIHSGQRRLVASAYTMDSIVYLEPMVDSLIVSTMEKLSTLPGDIDLGGWIQLFAF () 68641

68712  DVIGAISFSRPSGFIEAGDDGGIFRRMQNSLSSISWLMYVDWFYSLYQRLMPVIGNWLAA  68891

68892  NDRNGHFFNFARQEITARKDRAGNTKDMASQLFAVQHTKTELDDTNIAFMMASNVLAGSD  69071

69072  TTSTSARAVIYLLLKNPKSLQRLLDETEERKSDGRLSYPVKFQEAESWPYLQAVMYEAMR  69251

69252  LYPAVGRNLDRDVPAGGLRIGDHWVPEG (0)

       TMVGSTAWAIHRIPEIWGPDVEDFRPERWL 69479

DEE*VGDL (1)

KRYFFAFGGGSRTCIGR (1) 69613

NISWLEISK (0)

FVPTLFMRFDVDLVPGTALEEFCG (2)

ALVFLSGPDVQLKLRPDFFNTAVKASTAT*

 

 

>CYP5108B1  Aspergillus terreus NIH2624

           GenEMBL AAJN01000021.1

           43% to CYP5108A1

           ATEG_00916.1 revised

       MLTQELQAIYANNAGFLITSL

70767  LAFALLALAVRSFLRSEKIPLVSAGLPILGNLQKYSLDPVGFIASATRLHGECFAVPML  70943

70944  FGRTIWLRSPQLNKEYLETRE (0)

       DVWSFGDGMGLFLNKIVIPGYF  71123

71124  SHLRSMVGSLSRGISRKATLEYYAQVADEETAKAVDGWTCKSEAEKSVALFEEISFLVHK  71303

71304  IIVRCLMGQDFYDHHVRELYDLLRTMEANVGSIWHTVLPGWVAHGPARRLWRCRQRVQEI  71483

71484  FDFRLRERERSPEEWKKRLDYISYTLQDPATAHLSRFYGAHHTLLMFAAHTSTVASISWI  71663

71664  LLE (0) 71672

       LLRSPHRLQRLREELATHALEQSPFLDALVKETG

71834  RHYSGNSDVRWARKPKTLRTEVASVPESRITIPEGTIVSISPYLTHHDPATWDNADTYLP  72013

72014  ERWLADPDLAKKMNEGGQLRYIPFGAGSHRCPGEKMAILIAKIAVARIVQSCDLAWGEGS  72193

72194  SENTLGGLDFSKVGSPWLKGDVQVRFQ  72274

 

>CYP5120A1  Aspergillus terreus NIH2624

           GenEMBL AAJN01000022.1

           36% to CYP5102A1

           this p450 belongs to a group of sequences without

           Cys at heme region CYP5102, CYP5120, CYP5121 families

           Not included in the Cytochrome P450 database in Korea 3/24/2009

33059  MVTLAIVVLFVLIASIRLLYNHVRLNTIPGPVLAGLSSFWLHAQPSSQLPNSLLQLHE  33232

33233  KYGTIVRIGPDLVSVSNPATIVLIYTRRSRNR (0) 33328

33462  YEGLVDPALRNLVHTLRRYQTLDLASFLHFFAADFLSRLTTLHPAGANNA  33611

33612  RRHEPTERGLPGFFAECLLLRGPISRLKRQHGCPFICREVRSHFTGQPTSISSRTLFK  33785

33786  SEDHPSPMEEHLDCIAKTFVSTFRFLLKYPAVMRKLRREIVAAHNHNNLSPLPLW  33950

33951  SELGELKYLQAVMKESLRLSHVHRVHEVKSPAGGVTVSGYYVPQGTTIRCHPLVVHNNA  34127

34128  QIYGDRPQVFDPERWLNNDLQRQKCMTECLMLFQQHVFENPTIYAAWWELKKAIVVVLMW  34307

34308  FN (0)

       LELCTAYEAAQDSGTGSNPPVVVRFIPRS*

 

>CYP5128A2     Aspergillus terreus

              GenEMBL XP_001210824.1, EAU39384.1

              ATEG_00738.1

              66% to AN1703.3 CYP5128A1

              49% to AAGI01000270.1 Phaeosphaeria nodorum CYP5128B1

              47% to AAID01000197.1 Botryotinia fuckeliana CYP5128B2

              42% to AAGT01000426.1 Sclerotinia sclerotiorum CYP5128B3P

              40% to AAIL01000498.1 Trichoderma reesei CYP5128C1

              49% to AAIM02000125.1 Gibberella moniliformis partial seq CYP5128C3P

              VDKEIQ may be an intron

  1 MYKSLLERGP VVLGGFLLVL IAFCVCKSIY RVYF HPLSHV PGPKLAAATS LWLAYHTFIG

 61 DECTTVSELH KRYGPVLRVA PNDIDIADGE AIEPIYLAHG GFPKTRAYSK FDIDGHTTIF

121 SSLTLSERAT RAKAVAPLFS TASIRQSEQA LGVVFDDFVA RTRREAQTGR PVNVLNATRC

181 MAIDAVSMYL FQKRYGAIDE GSKTMSASPF VDAYVGVGAF FNLAHGKISD ALMRFIDRWN

241 TTQATETAFQ LMDAYTSQLV KTAVPKSGSY QSRLLEREIS EELSQIELKD VCFAGTDSTG

301 MNMATIMWNL AKHPDVYARL RQELQDSAAR DEDLTSCAYL RGVVREALRL SWANPTRLPR

361 AVPSGGWRFK DYFFPAGTSV GVAGFQLHQD EEVFPEAQRF RPERWLQPTD AMLNNFFAFG

421 KGTRACIAQN LGTAELVWAT IKVVQADLLR GARI

    VDKEIQ

    ILEWFNSRVK GEKILIQFDVQS

 

>CYP5130A1P Aspergillus terreus

            CH476602, NW_001471243.1

            This P450 is six genes away from MSAS polyketide synthase

            6-methyl-salicylic acid synthase used in patulin synthesis

            patulin is a mycotoxin sometimes found in apple juice.

            32% to CYP65S1, 38% to 65AF1

            This looks like a pseudogene with stop and missing I-helix

            ATEG_06281.1

117527  MGRARYETIKLLDTRDHREL 117586

117804 AITVYLGSVVYALYLHPLNKVPGP

KLYAIFRIPWIRDWLSRRLHVSVQRLHEKYGPIVRVAPDEVSFITAAAWNDVYGQKVA

KSLIRDGKWYANLTEGQEVIIVASEADHMRFRKIFGPAFGEKVLHESRSVIMSNIDLL

IAQLKHELKKTEGVADMVKWYNWTTFDIIGSL

VYGE*FGCLQGAEYHPGLK

VVLQNIRLSSYGALMERYSIFKRLVM

GLLPRHLLEMRNFHLTVIRDKIAWRSEKPRL

IPDESDLPLRATSPYRRGSWRP 118613

TSTSATALSAASYYL

118685 CRNQAAAQKLREEITTAFQSESDMCHD

TAVIREALRLYPPTPVGLPRRV 118831

118939 TVVYITQYSAYHSALNLRERNEFRPELWLGDPSYASDNLSVVQTFITGPYSCIGKSL

AYMEIGVVLAKMVWHFEWELSSSCCFEKEKVYALWQKSPMELRLRDLVSQ 119259

 

>CYP5179B1 Aspergillus terreus

41% to CYP5179A1 Aspergillus niger

ATEG_08637.1

MVLQRERGLIIPNDFRLPSTCTLSYHPHYAWFFGVLPPGSVHGSTDSTLDPPAFSVY GSWARGAHIFSSSYAGGPSVGHDL

GGNLISKHVYAIFDQPLGTQITNWVNSIPNNGLLHFYGLMGAEYLVVTDVESLSDVLSNRSYHFQKTSGLRRYAERFFG

RGIVIQEGDEHKKNRKSFVQVFNQRQVDKLKPVLSAKAGQVVEHLLGLCSRQPGQDEKNYGGASNAAIKVVEFAKLVSFD

VMGIIALGIDFNSMQHHNLELFEVFQTLFATDANKQRQFMWHNCAPPCLVSMFPSTIDRQMERAYRQLRATLGQLIPERL

AALNGKDLSDQDILTQIAGSGSFSQEEIMPQIVTTLAAGYESTASSLSWTLYCLAVNPEIQCALRQEIAQAKLTKTSLDE

ESYETLPLLNGVCNEASRLYPTFAMTLRKAICDTYIKGRLVPAGTYIAIVPRAINRSRHLWGPDAEKFIPERWIDRSDPE

KPKLNSTGGSSSPICMLSFLYGPRSCVGRSLALAEIRRVTARLVEAFHIQRAGTGVVEPTGFLSSGPPSDLNLLFSPV*

 

>CYP5235A4 Aspergillus terreus NIH2624

AAJN01000135.1

93% to CYP5235A4 Neosartorya fischeri

ATEG_04721.1 gene model is a fusion protein, revised

102330  MLAPHLYLIGTLGLLVYFLGGRIYQWNRLRHIAGPPGTGWTKLWLLRQAWSGRLCDSLYN  102509

102510  ACREY (1) 102524

102580  GPLVRIGPKWVLCGDPAEIRRIWGIKSGYYRSDWYKAVRLNSEVDNVLSVIDNKDHHRLR  102759

102760  SHLMPGYGGKGIANEEQLVDQQITKLIALIEKRYISSKEALRPCDLARTMQYLTQDVITA  102939

102940  VGFGKPAGYLEANSDMYGILETSEALHRPVHMVTLLPTLRKILESRPLKPLQPKPHDGSG  103119

103120  VGRFLGYIKDLVDERYDDLKANHTDILQSFIKSGLNRPQVESEALVTVFGGTDTTSTALR  103299

103300  NIIFYLSTTPRAYRALQSEIDGAVKTVTRPVIRDAEAKALPYLQACIKEGLRIFPPSMGL  103479

103480  MGKVCPRDDTICGIKVPANTQVAWSALAIMRNRAIFGEDADIYEPQRWIDAPVERRKEMD  103659

103660  ASYGLVFATGTRWECLGKRLAYIELGKTIFE(0)

        LFRRFDFAM  103839

103840  VNPVEPFRWANHGLTAHFGMNVRIT

 

>CYP5268A2 Aspergillus terreus

69% to CYP5268A1P

ATEG_01068.1

MPTHTQEDPSQVLQVGVQLLLLRSPMTDTFPGKPFVGNLLDIPKVHSWLRFKEWADEYGPIFQLNIAGRKHVVISQEKIA

NDLLRERGSLYSSREYLPFASGLLSDNLRPLLLPYNDRWRRGRKLMHQLTTTTVVTSYEPVQDYESKRLLASFLKAPRDY

EKWFERYACGVVYRLGFGRWIETGQETDFRRIVHVGKEVERVASPGQYL VDSFPFLMNLPLPLAPFKREGARLHAEELSL

FRKLQQDVRDALERGDSVKSFTRTFLENQKTFRLSDDEAAYVIGTLFEAGTGTTAAAMMSFCLAMCHHPEWQTKMQAELD

RQVGDRMPEFKDLPNLPTVRAVIKEVLRWRPVTAGNVPHQLTQDDTYQGHFFPKGTVFHANQWAIHRDPELYPDPENFRP

ERWLDPSFPTYREPLTQFPNMQNYSCFGFGRRICPGQSIAERSLNILTARIAWAATLSRKKDADGNLMLLPLYDYCPGFN

VQPNFFGFDVIARSPKRAEQIAAAYEEARLMRDQILT

 

>CYP5269A2 Aspergillus terreus NIH2624

XM_001213125.1

60% to CYP5269A1 Fusarium verticillioides

ATEG_03947.1 revised

MAIILPEGPMALFREGYGNRIVYVLISVPLI (0)

TLLYIIFCVFLSSLSQFPGPFWAKISPFWLMKQSRATQRTDAV

MRLHERYGNFVRIAPKHISVNVSGAIGEIYGHKAGFLKADFYDA

FVQVKPGVFNTRQADVHQRKRKYMNPAFSARALRDFEPYMDQELRAWKSQFLNMTRRA

NAMVDFSIWTNYLAFDVIGSFSFGQSFGFSQKGYDAYGLIQTIDERGEVLNALGSTPS

WVRPLMKYHPFDSFWKRGVNAKANLENFGRRAYLERKHSKFCDRQDLLSYLLAAKDPD

TGNPLPEEEIIAESISFIVGGSDTTSSTMTNFIDYVSRDKMLLGRIHAELDAAYPGPL

GPDWVADNDTAGTLSLLNATLREVMRLRPTSATGLERVTPKGGRTIGGSFIPEGTIVS

VPTQGLMQDPNIFPDPLSLRPERWLEGNTEALLNSFLPFSTGPRACIGRNFAWMEAVK

GLATLLRLFDLHRTTETETKVREGFFKKATECSVELCRR*

 

>CYP5290A1 Aspergillus terreus

33% to CYP5055A1 Nectria haematococca

ATEG_08242.1

Note: does not match any other Aspergillus P450 at the family level

MSAQSILSNIFPHQDLGPIPAVRIVILIAVSTALYGLLTTLYNLFLHPLRSVPGPFLARVSCIAICSPLWNTYIALTAQQ

PFRIKEAHERYGPIIRIGPNELHFASPTAMTKIYAQGKGAPLKAGFYSHAIPIKEQHSFSMVDKHQHLARKKLISRFFSP

SHQAKFLEGVKELSIDLNRLLARKASESVDNVVDVYHLLNMFTFESVYLLSFEEPLRMMKTGEEHRLMHLANRTAASLVI

AVILPFTRQFLYRIPGRMFDDFRAVHEWKQYYIDRMRALTKSSQSPFLSQLLNTTSEEHNRPLNESEAAEELIALMFAGS

ETVGVTMNWLLWELAHHPEVQEKLFKEICEVMPSPTSSVPYDELANLPFLRAVIKETLRVHTAILGPFPRVAVEDMVIEG

QAVPKGSVVNMCTYVTHRDPNYFPDPERWVPSRWIDGDAGAMKVAFAPFSTGPRVCMGQGLALAEMTSLV

PTVCRRFKFSLAGDKWPKGDMSPIGAFTTRPKGETNYLRVEDRI*

 

>CYP5291A1 Aspergillus terreus

37% to CYP512G2

ATEG_10278.1

MFVSTSLMYCYYILGLK (0)

AKVPGVGYPKFPIFASWIAAYRFLRDPVGLVREGVEKYKRSP

FRISTLQGEYVLIPSREMVSEYIRAPDSVLSFQDGAND (0)

QQQIPFTMGYGVAYRTYHVPVVRMNLTKSILHQISTIWEEIECAFDDHIGSPKEYQPFPLYQIMAMTIARASNRIFINEEFARNKEY

LQLAVDYAQAVVISAELLKPFPDWMKQYEKQKPELLSSSRILVKAVPVSSCRRRALKYLRQVVQECLDRKPGDERPDTMI

QWLADAAPPAERKLDLLVERIMALNVAAIHTTTM (0)

TLTGALHNLASEPDKYLPQLREEVEQQCANGPTKETLTNLHK

IDSFLKEAGRFNNAGL (1)

MAMQRNAKQK

FTFSDGTIIPAGAKIGTPSLILHRDPTAYEDGDAFDGFRFSKKGAAASSPREAAKFSMVSTAAEYQIFGHGKHACPGRFY

AVNEMKIMLAIFISRYEIKAVPGTAPKQTFLATMAIPDTQLETLVKRRET

 

>CYP5292A1 Aspergillus terreus

35% to CYP58M2

ATEG_02670.1

MILLTPDMLMLVVACFILAQAFKY

IYRLKFHQLARFPGPRLAAASSLYATYHNWIERGAFTERLPWLHDLY (1)

GPIVRTHPNELHIRDISAYNEIFRVGTPFKKEGRFYGFPFEGSHF

SMPDIESAKTRRSLLQPHLSDRSVKQIQPVLEQSINQFSRILQNASG

YKPGVDLSLGYRSVTIDMLLRYGFGKSLKSLDAGSFNCEMAEDMDDVLFGSLIAKHFPNM

GKAVFELLLQLPLAIAKMVKVSSILEMRKVCF (0)

PNIEDNSNPRIFDTAV

KELISDSRRLSIDELTAEAVVLLFAGGEATAISVIIGTFHLLSDP

ERLHTLKQELLSAMPDGQSLALSELERLPYL (0)

RGVVKEALRFTQGAPGRLPRVVPSEGATLGGEFIPGK (0)

TIVSSSHYVYHFDPQIFDDPFAFKPERWLDENNAQHLDKYMLSFSRGSRGCIGIN (2)

LAYAELYLIFAHVMRKFDLSLNGTTLDDMTLRDYYAPMARGHLKVRVDGYDRRMHIEG*

 

>CYP5293A1 Aspergillus terreus

42% to CYP5286A1 Aspergillus flavus

43% to CYP5237A1 Uncinocarpus reesii

41% to CYP685A2  Neosartorya fischeri

ATEG_01795.1

MHSLFGTTILVVLIAIYTRYYRN (0)

ISHDFKDSQGRRIKQLKKDTRYLRFSHG (2)

RELSQEGSELAGEEPYLMRNGWWTRELVITHPDHLREFYRKDAK ()

HQKPVNMNLGDYFGR (2?)

LLGQCLGLQGGQKWTVMRAHFEPEFSHLASMN

MADTFAMEIEKWALTLSKGGDLHQQEATPGSFYRNPTE ()

ACRYLPFRLTGLTVYGDALDDE (0)

TYQDLVHLNDLHEQVMLDAF

FGRFTVSKIFNILPTQSRRRLETFKARWEKLNLDIIAKART (0)

KQLHCPAERIYKGVESGKMSKVE (0)

PQFLETMDELLFTNIDVTSTVLAFLLINIAANQSFQSSVRE

EIAAKQSQPSYNLRDYVLEKESLLHYAAMESVRMSPALWFSLPEKTAAEKVIGGYLIPAQTPVVIDWKR

LNTTPAIWGSDGEQFRPERFADISPTAYRYGLLRFGIGRGRCLGKNIADMMLKMVTVAIVQRYFMKPAG

REKGTRQDRFTVTSEEEIVFTPIRSLNACA

 

>CYP5293A2 Aspergillus terreus

62% to CYP5293A1 Aspergillus terreus

ATEG_04640.1 revised

MKSIVLNLTSPAATVYGAYYLLDSRLGSLLVTAVLSILLGVYTRHFQN (0)

TSKHFRDVSGRKIKKLKGDTRYLRFSHG (2)

LEMSQEGQDMAGEEPYLVHNGWTRELVVTQPEHVQEFYRKDGKDHMKGKNLNLGDAFGRLLGRSAGVQGGRKWVAIRAHFDP

EFSHSSSVYMSDIFATEISQWVTELSQGSADNPHPISRFVRNAAEACHFLPFRLIALTAYGDALDTKTYQELVHLNDLHE

PLMLDAIFGKWTPYKLFNFLPTEFRSRLKKFERSWERLNDEVLAKARE (0)

NNLRCPALRIFDGVESGDIYKVE (0)

EFLQTMYELLYTNIDVTSTVTSFLLLNISANQS

FQSKLREEIQARQNEPSYKLMDYVEKKDTLLHYAVMESLRMSPALWFSLPEKTATDKIIGGYHIPAGTPTIIDWKRLNTT

PEIWGADSEVFCPERFASISPTAYRYAFLRFGIGSRRCMGQNIAIVMLKMAVIEVLKRYSMKVGYDSGIRNDRFTVTSEG

EIEFMSIEGED

 

>CYP5294A1 Aspergillus terreus

34% to CYP5068B1

ATEG_06474.1

MAVNLPIPFILLLLLFLPLLLPLLRRKHDLPLPLLGNLHQQSWSEPWKTYREWHEMYGPLISFKIGPYQVISVGNHQVAK

DLLERRGAIYSSRPESVWSQYMTKGLQPVFQSYTNSWKLIHKLQMPLLSTVAINAYLPLLDLETRQLLIDLLLPQFISGP

LARFAFSTASCLLTGERVKSAVAVSFHEAKDVIDGFFKDIHWTYILLDLIPGVKYMPSWLIKFKQVSDAFYQNAVRTYNR

LFGRAIHLREWTWVRAVMSHRDAQKTTWEQICFALGELWTAMSVTTPVMLMVFTRLSLLNRDRFLQLQQEIDSVCGPNRL

PSQELVEHLPYLNAYILEILRLDTLIPLGFLRSVDKDDEYMGYRIPANTIIIPNTWCLDHDESLYPDPYGFHPERWLADP

DLPLGAFGFGRRKCPGRFLATRSLQLAIARIAWAFNLVWNAGPIPTSPRYAGMILRPRDFLGVFQPRSLERRAVIEQEWS

DGERLEDHYTDFQMT*

 

>CYP5295A1 Aspergillus terreus

41% to CYP5069A1   Neosartorya fischeri

42% to CYP5050A1   Nectria haematococca

ATEG_06204.1 no introns

MTDDIAPSGYQPHRISTLAVLIGFIALLTAWLRRDRRLASIPGPRTYPLVGLGYKLPPKAPALFRKWAMEYGDVFRIRVG

WYDWVVINSPEAIAEILEKQAVKTSSKAPSPLGHDVVTGGNRMPTMPYGKEWRNLRSVVRQITTVPMTASFVPSQEFEAKQLLFDLATDNENQRNFYQHMRRYAFSIIMTNTFGTRVKSWDHPDAQN

AVRSQAVLRRTSRPGAFLVDELPPLARLPKWLQPGRREAQRAAKVVHDIKMELWERLKTQ

VETGKAPHCYAREIYESRESWYAKGATEEQLAWVSGGLVEAGFETTAGTLNSLVLYLAAN

PQVQKTAQEELMRAVGPHRLPTFEDTRRLPYIRACVKEVLRMNPILSPGIRHYADEDVVY

KEHVIPKGTVLLANTAYLHYDPRRYKDPQKFMPERYLDHPLYSSDYAAMTDPSRRDHFTF

STGRRTCPGARLAENSLTIALAGMLWAFEIRPGLVDGVETEVDMSDDAYLDTGFTLPKPF

AARFLPWSEERLQIVKEQWELASKKGYELRGVPVDIEGMTK*

 

>CYP5296A1 Aspergillus terreus

35% to CYP5049A1 Nectria haematococca

ATEG_08476.1

MVLLHLLFLSAVGVAVFG (0)

PKPPHSAVWGHLKLFNNI

MNQFPPNTAIATYYTEISHKYQLKGIFYLDLWPFGPSQMVLVHPNAAEHVTTVENYPLHDEVSRYLTPLLGEHAIGASDG

ERWKMLHRILTPAFKPSKTKAMAPVIAEQVSLLLHPTLTQYAGSAEVFSMEECAARLVFSISSTVILGNSVSEDENAQLI

SDINAVVDYATMLTLTAATNPLSKVRKWWKKRAAIQRMDSFLRLLIKGRYAQLAHGKVDVNRADSTILDAIL

ANVQSMRCVPHGFAAPDSELQIVTDN (2)

VKGLLLGGYGTTADTLC (0)

YVFIVLHFHPPVVQNLRDEHDRIFSRDINA

IRKVLEQTPHKLNELHYTTAVVKETLRLFPVGFGARKAKQG (2)

STTLTYNGITYPTTNQMIIPC &

HTIHYDPEIIFPHPTKFNPARFLEPDLASMPRNAWRPFERGARMCPGRDLAMD

GLRIILLLTVREYKFQCADVDHLVKSMPGVQHTDMDAVMGDLAFQEMGFSAKARGGAMMRVSLMQSY*

 

>CYP5297A1 Aspergillus terreus

ATEG_03567.1

MSISNMTSTVWPGTPRTLLTAAFMDLM (1)

NLQVPAIEHNHLPILTVALLTGIASA (0)

RPRLLDAYRSGVWWRIFVPRLVPYIEEGYHKVGAL (0)

YNKNDQPFRIWLGGFQAYAYVLPERYLDKIKN

MPESEASFAAMANKYFHTGLPTGEVNNLVLQVASKLVNGNLATIKTLMQGEVQKALAREIGSPRQWTKINAWQVARKTTE

APGLRVVFGEELANDKTFVTGVSEFVSNITVYAFTLRYINLGPLRDFILYLVHWRHRRSLPAVLTPLNNVITERKKVRSN

RHISDDEESFDCIQWALDQPVSDDCKTAEAIARRLVVISLGTIDTVAGVLVKQLTHLASHPECHEEIRAEIRECLAEDDN

GWTLKSTGRMKKLESFIQESLRMSSGAISLSGMRIVTGSGFRLDDNTVLPRDSFIAIPTRNILYDPEVFPEPEKFDPFRF

YKIKEDEKNAGSRSNRRDIRASWLAFGYGRQACPGRFYAINAMKTILGEILLKYDIRLAEKQAPRIDIDLDPMLAPVRST

DLEFRVRA

 

>CYP6001A1 Aspergillus terreus

79% to CYP6001A1 Aspergillus oryzae

Supercontig 5: 1242713-1246265 (-) strand

ATEG_03992.1

MQGIGKAISQLEKVATASLRPLPTETGDGSYVAESTATGLVQDLPHVDLGDLKT

LLDVTKNAATGEPIDDKGYVMERLIQ  (0)

LASGLPSTSRNAKQLTSAFLNQLWNDLDHPPVS (2)

TVGGEYSHRSADGSGN (0)

NILWPGIGAAGSHYARSVQPKTMQSPSLPDPEALFDSLLARKDFKEHPNKISSVLFYIASIIIH (1)

DLFQTDHRDSSINRTSSYLDLSPLYGNNQDEQYLMRTFK

DGKLKPDCFSSKRILGFPPGVGVLLIMFNRFHNYVVEQLAAVNEGGRFTKPSESNDKEYA

KYDNNLFQTGRLVTCGLYINIILKDYVRTILNINRTNSTWSLDPRMDMKDGLLGDAAPLA

TGNQVSAEFNLIYRWHSCISQRDEKWTTDLYNDIFSDKGQEDIPLNEFMMGVGKWEAGLP

QQPAERPFAGLKRKPNGLFDDDDLVTIFKESVEDCAGAFGASHVPTIFKSIESLGIKQAR

AWNLATLNELRQYFGLTPHKTFEDINSDPYISEQLRRLYDHPDQVEIYPGVIVEETKESM

LPGSGLCTNFTISRAILSDAVALVRGDRFYTVDYTPKQLTNWAFTEIQPKDSVDQGHMFH

KLVYRAFPNYFKGNSVYAHFPMVVPSENQKILTALGSAEKYSWDKPGFIHPPQFINSHST

CVSILADQETFKVSWGDKIEFLMSNHDKIYGKDFMLSGDRLPNAESRKMMGAALYTDQWE

EEVKKFYEKITLKLLKKHSYKIAGVNQVDIVRDVANLAQVNFCANVFSLPLKTEASPRGI

FTESELYMIMAAVFAAIFYDADPANSFALNQAAREVTQQLGQVTMANVELIHKTGFISNL

VNGLQRHDVLSNYGIHMIQRLLASGLPASEIVWTHLLPTAGGMVANQGQLFSQCLDYYLS

EEGSVHLPEINRLAKENTPEADELLLRY (2)

FMEGARLRSSVGLPRVVAKPTVIDDNGTKLTLKEGQHILCNL (0)

VAASHDPVSFPEPEKVRLDRDMDLYVHFGSGPHKCLGFGLCKLGLTTMLKVVGGLDNLRR

APGPQGQLKRLAGPGGISKYMTADQSGFFPFPTTMKIQWDGDLPEPASD*

 

>CYP6001C14 Aspergillus terreus

64% to CYP6001C13 Aspergillus oryzae

ATEG_03171.1

MKFNQTTEAEGSNPQLVVRGRTPETEPAGKASINRVSSPLVNVVSAPPVNESPPMSNGENETKNTVHNIEELEQESQRPL

PKETGDGTYVEEETSKSTLWQDLRRLGIQDVNTLASMIKTEATGQYIDDKTMLMEHIMQLVSKFPDGSKTRETLTNLFLN

ELWTSLPHPPLSYVGDKYAYRSADGSYNNPTLPLLGAANTEYARSIAPRTVRPNSLPDPGLVFDSVFARDQFHPHPNRVS

SMFFVWASLVIHDIFQTGHPDLNMNKTSSYLDLSILYGDTQEDQDQIRTFKDGKLKPDSFSEPRLQALPPASCVILVMLN

RYHNHVVEQLAIINEGGRFTKPQTSKMDPEQARKAWLKYDNDLFQTGRLITCSLYINITLYDYLRTIVNLNRTNSTWCLD

PRAQSEGQKPIPSGLGNQCSVEFNLAYRWHSTISNKDEKWAEKVYKEIVGKDGEEASVSDLLLSMKKFAGNLGHDPAQRT

FAGLQRQADGMYRDEDLVQILTSATEEVAGSFGARNVPKVLRSIEMMGIEQARKWNVGSLNEFRKFFKLKPYQTFEEINS

DPDVADALRHLYDHPDNVELYPGIVAEEAKEPMVPGVGIAPTYTISRAVLSDAVALVRGDRFYTVDYNSKNLTNWGFAES

QFDLGINQGCVFYKLAMRALPNWYKPDSIYAHYPMTIPPENKVIMRTLGRENDYSWDRPAYMPPGINVCAYPNVWGILND

PTCFRVTWGDAMGSIFGKPGLDFMQSGDSRIHSNQRVTMASALYREHWQEQIKSFYLSITGQLLKERSYKLGKVHQVDLT

RDVGNIAHVHFAADIFSLPLKTEKNPRGIFTEHELYEMLSTIFTYIFFDDDAPRSFQLRRDARAAAQKLGTVVEATVKST

GGSGFISSLVDSFRSPGNAALKDYGVHMVRRLLDSGLDAAEATWSQILPTAVVMVANQAQAFTQIMDYYLSPAGAQHLPL

IQRLAQYDSPEADEKLLRYCMEGMRLNGTFNLARESLTNAVLEERGRRVHLTPGSKILLNIVEASRDPDVFPDPDEVRLD

RPMSAYLHYGEGPHMCLGREASKIALTAMMRVVGRLPNLRRAPGPQGELKMVPGPNGCYSYLDEDETRLMPLPTTFKVHF

DGPV*

 

>CYP6001C16 Aspergillus terreus

78% to CYP6001C12 Aspergillus oryzae

ATEG_04755.1

MLRRFSTQFKKSKGDRESKQNGTPGPANNSSKRQSKLAQPRKSSSSSSDGERSAKNEDGVPAFEKYAQVLHASRSPLPNQ

TGDGATSAHDHQTTLFQDLRSFGFKDFGTLKEVIATKAKGEHVDDKTMVMERIIQLVSGLPANSKSRTELTHLFLDQLWE

SLPHPPLSYMGSDYAYRSADGSNNNPTLPWLGAANTPYARSIAPLTIQPGGLPDAGLVFDSLFARDKFRPHPNKVSSVFF

DWASLIIHDIFQTDHQNPNINKTSGYLDLSILYGDVKEEQDLVRTHKDGKLKPDAFSEPRLQAFPATCCVLLVMLNRFHN

HVVEQLAEINENGRFTKPSPDLPEDKAKAAWEKYDEDLFQTGRLITCGLYINITLYDYLRTIVNLNRVNSTWCLDPRAQM

EGSSSTPSGLGNQCSVEFNLAYRWHSAISANDEKWTEQVYQDLMGKPAEEVSVEELLGGLMKYGRSLEKDPSKRTFAGLQ

RQADGTFKDEELVEILTNAVEDVAGSFGARHVPKALKAVEVLGINQARQWNVGSLNEFRKFFDLKPYESFEEINSDPDVA

DALRNLYEHPDYVELYPGIVAEEAKEPMIPGVGIAPTYTISRAVLSDAVALVRGDRHYTIDYNPRNLTNWGYNECRYDLS

INQGCVFYKLATRAFPNWFKPDSIYAHYPMTIPSENRNIMKNLGRESHYSWERPKFTPPQVNLVSYPNVKLALEQEKQFR

VIWSGNTPLRPAKGGDDFWSKALNNDEWRKNIKEFYEDMTIKLLNEKSCKLGGIRQIDITRDLGNLAPVHFASKVFSLPL

KTKQNSKGVFTEHEMFMIMAVVFTSVFFDVDPTKSFPMHFASRAVSQQLGSAIESHVKSIGHPGFLSAIIDSFRDDDNVL

KEYGDQLIKKLLDSGLGVSDVTYSQILPTAVSMVHNQARMFTHIVDYYVTEGKKHLPEINRLAKETTPEADEKLTRYCLE

AFRLFGTFGSYREAQTDFTVNDGSGPVDIKQGDKVFVGAVKANRDPSVFPDPDEVRLDRPLDSYIQFGLGPHAGLGKEAT

LLALTAMLRVVGRLDNLRPAPGPQGQLKKIPREGGYYVYLREDWGSYSPFPTTFKVHFDGELPAPKKRGIASA*

 

>CYP6002A5 Aspergillus terreus

65% to CYP6002A4 Neosartorya fischeri

ATEG_00985.1

MTYNDRREPNGPSGNLSKLTKLVTGLRQDISSQTGRILPDLEVLQGIGSTIIAGGIIDDRKYLIERIIQVAASLPDNSRL

RDDITNELVKTLWNSLQHPPVSSLGNEFKYRTADGMSQNIMYPHLGAAGSPYARTVTPQHPRPSVLPDPSVIFD (1)

TLLARKGPAKEHPTRVSSTLFYLATIIIH (1)

DLFHTDESDMNRLKNSSYLDLGPLYGHNQEQQNRVRTFKDGLLKDDTFSESRLLGQPPGVCALIIAFNRFHNYVVKEMAFINEAGR

FSLPTGLTPDSPEYLSALSKRDNDLFQTGRL (2)

VTCSLYVNIILGDYLRTILNLNANPVNSNWKLDPRGQIDFFDSEGVPRGLGNQ

VSAEFNMIYRWHAAISNQDEAWANAFMKDLFGQDVDPSTLSVTEFLRGLGKWSANLDKEPSRWTFGTLERLPTGSFKDSD

LVKILQDGTEHVAGAFGARNTPQVLKAIEMLGIQQGRDWGLATLNELRSYFKLKPYTTFEAVNSDPAIAEALEALYGHPD

NIELYVGVQAEESKVPFSPGSGLCPGFTISVAILSDAVALVRGDRFYTVDYGPVNLTTFGFKESNSDFDVANGGAMYKLL

MRAFPRYYAPNSVYALYPFTTPQQVRESFGKQAASGDLDYNVPSFQGPVTAIKSWEGVTHVLNQQKHFHVPWGSHTFQLT

HHDYMLSGDSTADANQRLFVDKCLYTPKDALDEVRRFYEDATSRLLQKYSRKLGPYYQVDVVRDIGNLVHAEFTSEFFDI

PLCADADRMDRDSYTTTELYDVLASLFGYVFLDVDVMQSFKHRVAASKYTEKLGKVMQKRIGHVTTHNSHLREYLIGSKS

KQKLLPDYGTELVRRLSAGGKSAEEVTWTIIPTAAAACATQAQG (0)

WAQLIDLYLSDKYYVHWP

DIQRLARSNDAESFEKLKKYALEGFRLSTPAFGVLREVTKDSTIEDGVEQVNLKRGDTLFVDFVTAGRDITKFPDPESIR

LDRPDDLYIHHGWGPHSCLGRPVVTVAAAAMLRVVARLDNFRRAPGPVGEMKNKVVAPGFKVYLPEDGSEWTPFPCNKKA

LFDSI

 

>CYP6003B2 Aspergillus terreus NIH2624

fusion with diooxygenase, P450 (C-term) part may act like a hydroperoxide isomerase

XM_001211214.1

ATEG_02036

MSSVIVALAVLVLSLLYLTLFRNDLTHLIIEKLQSFRTGSGWEL

SPRSRLLPRATKAALSSITGTGVGIWSRLYARIFHSDELAEEEDDEKYQAGEAYGDPK

VLATSLIKDLRALGVKGRRSDLRTLIEMVKNKGKPMDDRQMHMEKIIAIVAMLPRTSK

ARQRLTGVLIDQLWRSLQHPPLSYFGNKYQYRTPDGSYNNPLEPNLGKAGSPYARSIP

RIKTMHGVRPDPGLLFDLLMARDDSTFKENPAGISSMLFYHASIIIHDIFRTNRRDPN

ISDTSSYLDLAPLYGSSLEDQLKVRTMEKGMLKPDTFHEKRLLGQPAGVNVILVMYSR

FHNYVADMLLKINENGRFTLPPTSSEEARKKALAKQDEDLFQVARLVVNGLYVNISLH

DYLRGLTNTHHSASDWTLDPRIAVGRTFDPDGVPRGIGNQISAEFNLLYRFHSVISRR

DEKWTNEFLKSLFPDLNKPLDQLTPQEFMMGLMRYEQSIDKDPSKREFGGLKRSPDGK

FNDADLVQILKDSMEDPAGLFGPRNVPKALRMIEIAGIMSARKWDLGSLNEMRDFFKL

KRHATFEDINPDPEIADLLRKLYDHPDMVEMYPGMFLEDAKPRLDPGCGGCPPYTVGR

AVFSDAVTLVRSDRFLTLDYTASNLTNWGFREVQQDYDILGGSMFHKLIQRALPGWFP

YNSLHATQPMFTRKMNEQIAREIGTIDHYSLADPAPPPRKIVLTDYATNIKVLKDQAS

FRVPWARYLNDMFPGKTYNDYMLGGDDPANAAQKKLVHSILFSPDQFLDLLSETTTKL

GSELLKANTLWLTKDLHQVDIIRDVAIPLNARIMADLFCLDMKTPENPTGSMNAATVY

RHLMNVRIWGFNNNDPALMLQRRKWAIESAEALIETTRKLVNEQAQPAQSGVLKNLMT

RRQATGTLRWYGNNVAKEMMEMGMSAEEVADICWLTAIGGVGTPSGVVANVLQYYFRY

ENIGHWEEIQKLVTQPDTPAADRTLRQYVLEANRLTSMECTVRVCARPVTVDGHDFKP

GEVIVNHLGLACRDPHNIPDADKFRLDRPASAYIQWGYGAHECLGKEIAITFAVSMIR

ILAGLKYLRPAPGEMGVLKSVMADGRQAFLNDSWSWLTQDPTSKSNMHGKASAVD