Aspergillus nidulans P450s

 

sequences submitted by Ralph Dean, collected from the automatically annotated genome.

Some sequences have been modified, but most are as they were collected.  There are

several fusions that are possibly artifacts of the annotation process.  More work will

be needed to check each gene model and make corrections.

Trees of the fungal P450s are available under the Lower Eukaryotes button on the

main page.  For an overview tree see the Magnaporthe grisea tree, then look

at the subtrees for the fungal P450 clans.

 

List of P450s in name order

/Aspergillus.CYP.list.htm

 

List of P450s by contig order (shows gene clusters)

/Aspergillus.contig.order.htm

 

Aspergillus has 111 P450 sequences (some are long).

There are 42 NEW CYP FAMILIES even after naming all

P450s from Neurospora crassa, Magnaporthe grisea and Fusarium graminearum.

Fungi have reached CYP687 and will go to 4 digit names after CYP699.

The next number after CYP699 will be CYP7001A1

 

modified March 18, 2004

Last modified 7/20/2007 revised many of the sequences.

D. Nelson

 

PREVIOUSLY named seqs in Aspergillus nidulans 53A3, 59A1, 60A2, 60B1, 62A1, 504A1, 504B1

 

>CYP669A1P Aspergillus nidulans revised 7/18/07

AACD01000002.1 Aspergillus nidulans FGSC A4 AN0008.2 poor match 53 clan

may be a pseudogene of the CYP670 family

34% to 670A1, 29% to 628A1, 37% to AL115607.1 Botrytis cinerea partial seq

since this is a probable pseudogene and it matches 62% to CYP669A2P

after MDGPSN, the N-terminal may not be real but it matches

pretty well to an mRNA called an oxidoreductase. 

It may be best to delete the first four lines up to DSPG

       WKGHPFTPVVNIVPAFISSLLAFSLSTSQFAKTYRPFKNAPSSLVNHT

       VKFAGSSAVHGSHRVSILSSA

       SSGSVSGSAPNLLVNAV*TMPGLSA

       AAKTDGFSAAIHAMNLVSANLDVMYPDSPG (2)

       MDGPSNRNIRSDWYDLLHPQVSSIFTRDRILHQKRRQLWTKALSST(1)

       SIQLYTRRILSKIYALES

14773  LIATAADEGKPVLINEVMYWFAFDSVGDFAFSEDFGMLRNEGWHDVIWMFRSALALLGPF  14594

14593  SPAIWMPRLAFSYIPGLWRVKWWFNMLEFCDRCMEQRMK (0)

14416  KTPKESNIASWFLKDHKVHRQNAWLSGDTATLVVAGR

       DTNAPTLVHLFYFLARYPEHTEKIW*

       ELVSVNAEDPVALAKLPHLNGVINESMRLLPAVL  14054

14053  TFGSRTTQPEGLTVEGTFIPGGVKISAPRYTIGR  (1)13952

13871  LKSAFAETHEFIPEWWYSRPDLVKDRRAFAPFGV (1)

       GSTSCVGK  13692

13691  SLALAQIRLVTAALVSKYKFQFTPGMGSGEAVEGEMREQLTAQPGHCYLNFIRHVGQE*  13515

>CYP684A1 AN0222.2 AACD01000005

AACD01000005.1 revised

MQPGLSFLVGNWPSVVVLLGFAYFLTLAYGVRKNP

LSSLPGPQLTKWTDLLLKFYTVTGQRPRYVHALHQKYGPVVRISPSIVDI

SDVSASRDIHRIASPFLKAPFYKMLVRKDGESLFSTTDPEYHRRHRRLLS

SPLSDTNLRTVEPLVKARIRLAISRIREEALSPRGVADIYKWFFFMATDI

IGELSFGDSFRMLEIGKKNQYISDLETVAKIGGIRANFPWIISIGQILPL

SIFREVVVSTDRILEYANQSVERYKRHLAMNPNQPKPTLFTKLYDASLHK

EGDGECLSDREIRNDAQSFIVAGSDTTANTLTYLVWSVLKDRSIQEKLVE

ELDVL (0)

EELSDVHLRELQYMNQVINEALRLYPAVPSGLP

RVVPDKGSTLAGHWLPGGATVTTQLYSLHRDEEVFEEPER (2)

FDPSRWENPTKAMKDAYMPFGAGSRN (1)

CIGLHLAKMELRLATAYFFRSFPRARISAREDMNDGDMEMMLYFLLSPKGKRCLVEVN*

>CYP680A1 AN0338.2 AACD01000006

53 clan

AACD01000006.1 Aspergillus nidulans FGSC A4 revised

MDLKESSLRFLASDIRSVIWRLATLISVVALLRTAWVVIYRIYFHPLAKV

PGPLLARITWLYSFWYNIVTKRFYLRVQELHEQYGPVIRITPDEIHLSDP

ENLEKIYFVGSRYPKDAAFYGAFGADRSVFTAPSPDVHRVKRAALNPFFS

RKKVLELEDIVQDKAEKLVGRMKKAFNSTGAIDLHHGFRAISVDVITDYA

FGDSYNFLDRDDFGIDFFNGFRDTGPALWTFQQFPVIQRVAKKMPFWLAE

RLSAPLALRRSQHMSSRAQVLKVKAAVERDEKVSRTTIFHELLRPDAAEG

YAVPNVDELSSEAQNILGAASDTTGNTLTIAAYNVVRNPDIYARLSAELK

EAFPNPEGRLEFVALEKLPYL (0)

TAVIKEGLR (2)

LSFGVPGRLPRVVPPPGAEFNGYHVPPG (0)

TVVSMSSWIIHHNENIYANADRFNPDRWLDPSRAKVLERYLFSFGKGTRGCIGMP (2)  140353

LAYCELYVTLGRMFREFDNLKTPAKSSEELIVDDGFSAYHPEKNNKFVFSLS*  140166

>CYP578C1 AN0459.2 AACD01000007

41% to 578A1 AACD01000007.1 revised 7/18/07

MEVPVFAWIVPIMLGLTLLYEFVIYPAFLSPLSKLPNAHWTAPISPAWILWKRFRGQNNRT

IHAAHERLGSIVRLAPSEISINCVDGGIKSVYTGGFDKHEWYPRVFGSFG (2)

TVSMFT

MTGSKAHSTRKRMLSNIYSKSYLQSSRHLQLISKTIIFDRLLPILQAAAS

SKTDTDVHDLNQGLTMDFVSAYLFGLANGTNFLQNAEYRREMLRLYQCRK

PYEFYHQEVPNILALLKKIGIRLIPKWCDDANRILDSWGLELCDKAEASV

ASSDLSVEPVVYKHLKQAISKQAPLKIDDQKLYADYLEQQRLDIACEMYD

HLTAGHETSAVVLTYLMWELSQHIEVQKDLHKELLTLQPRIAPRCLSGHA

ELPSPKSIDSLPFLEAILTETLRLHASIPGIQPRVTP

TPTCTLVGYDNIPPNTRVNAQAYSLHRNPEVFPDPETWEPKRWL

KDCNKPSELEERKRWFWAFGSGGRMCVGSNLALQ (1)

KMKLVIAAIYTNFRTTIVNDDGIEAIDAYTVKPKGEKLILRFEYI*

>CYP5076A1 = old CYP670B1 AN0606.2 AACD01000007

poor match 32% to 574A1 53 clan

MALSLNAAVVLAGVISHIAYFKQGEHHLYGFFYLKLLLTAMSTATVMLSY

VQGAPWRVALSTVLKLLSAYLFGIYTSLLVYRLLLHPLNRFPGPFPARIS

TVWTSTQLKSNNMHLTLLHYHRKYGPFVRIGSSDLSIAHPDALGPIYGTH

SRCIKGANYELSAPATALQLMRDPEEHHARRRVWSGAFSDRLLRGYEVRI

RKYREKLLDRLSEMSSRKEPVDVTKWFNLYSFDVMGDLSFGRGFEALERG

EEHWAMRLLMATQNFVGLNLPAWAFVLMIRIPGASMDFWRFLEFCGERLL

DRFKNDPEIPDISSSLFVPLKDRNVEDLTIEEKNLLYGDSRLIVIAGSTS

DTTAGTLSAIFYELVQHPEHITKLRDELEPHHLGNDNPKKTEFLHSKIAQ

LDHLNGVINEALRLYPAVPSSLQRKTPPEGVVVDGTYIPGDMHVVCPLYT

IGRSEIAYDHPEDFIPERWYSKPELVRHKGAFAPFSLGHFNCIGRPLALM

NLRVTLAQLIMEFDVKFAPGEDGKQFLADAKDNFVMYFGKLELAFTRRER

QKE*

>CYP578B1 AN1087.2 AACD01000016

42% to 578A1 53 clan

AACD01000016.1 revised

MFTHTAIFTLSFLLTVSFLLFIYLIHPLFLSRLSKLNIPNAHFTSPLSSY

WINSIRHAGLETVTIQALHAKHGPVVRLSPNELSVNSLHGLRVIYTGAFE

KHALYRDLFLNFHTENLVGMLGNKEHARQKRMLSRVYSKSYLQESEDMRV

ISAVILSTRLLPILQRIAENGETVNVLPLFQAVGMDFTSAYLLGVQNGTS

FLFDLPGWQRWLEEYEKFKHLSLNERADGFIERWCLDLCRQTQTESSSSD

AISTKPVVYNALRHGLEKSPDSRPSDLAIASELLDHLIAGHETSGITFTY

MMWELSHCPNLQDELRAELLLLQPSLKYPFPSGGGNGSFPHPSSVDNLPL

LDAIVRETLRLHAPASSPLPRVTPDTPGGTSIDGFDGIPGGITVSSSAYT

LHRIEEVYPQPTEWLPQRWLDPGSGKKHDMRRLWWPFGSGGRMCLGSNFALQ (1)

EIKLVTAAVYTNYTTAVVDDEGIEQDLADFISLPKGRKLVLRFDPINRA*

>CYP668A1 AN1300.2 AACD01000017

poor match 53 clan similar to 548A3

MSNTVYLITGANRGLGLGLTKSLLIRPSTTIIASVRNNEAKDALISELAT

IIPGQNSLLRIIHLSFPSDNWSSAPTSPSEILTALTNTVPEIRHIDVLLA

NAGFATPMTPALSTSVSDLRASFEVNTIAPLLVFQAFWPLLRNAQNGTPK

AIFMSSSVGSIGAQEPFPGGAYGPSRAAGNWLTRALHLQHEADGLVAVAL

HPGWVKTRAGDFVAKEWGFDAGPPETVENSVKGILKTSLLGTGIWTINHN

ERYYPQPFSFRPERWIPEEFGEEAVQLATAAFTTFSIRPWNCVGKALAMI

EMTLAMAAVISHFDFRRADGAAGGLGEGKGSFDGQFQTFWAFTGFKDGPM

IQFRPRKY*

>AN1387.1

probably not a P450 no motifs match

MNSKQYLSYGSADNTHPTDIFALAVTEKQILSASGSNALQVHSTTNPDFP

LVQTLEAHKAGCHHVVTDAKGSRAVSVGFGGEVVIWESHEGTWSKTKDVV

LADIWAVALSADGQYLAGTTQDGHVKVWDMNANEEEIRDHETKGSFGTCI

DLSPDGRFIASGHENGSVYIFSTETGRMPFSLSGLVKPVRSVAFSPGGKF

LAAAGDSRVIVLYDTTSGEQVASLTGHAAWILSLSWSNTGEYLLSGSFDG

KVKVWSIDTRNCVATHSETERAIWSVIWLPKIGKSEGFATAGANRSISFY

REATGG*

>CYP504B1 AN1397.2 AACD01000019

63% to 504B2 100% to 504B1

MAIAEALLFVNNRAVEHPLQFLTAVAFAVPLLYVVINEFIRASARIPGFK

GPRGLPLIGNLAQIRKDAAEQYRIWSKIYGPVYQIQLGNIPVLVVNSAAA

AKVLFGQNAQALSSRPEFYTFHKIVSNTAGTTIGTSPYSESLKRRRKGAA

SALNRPSVESYVHHLDVESKAFVAELFKYGNGGKTPVDPMAMIQRLSLSL

ALTLNWGVRVASQEEELFDEITEVEDKISKFRSTTGNLQDYIPILRLNPF

SSNSHKAKEMRDRRDKYLSSLNRDLDDRMEKGTHKPCIQANVILDKEAKL

NSEELTSISLTMLSGGLDTVTTLVAWSISLLAQRPDIQDKAAKAIQEMYS

EGQPLCDPADDQKCAYVAALVRECLRYYTVLRLALPRTSIRDITYDGKVI

PKGTVFFLNAWACNMDPEVWSDPDEFRPERWFEQPDAPMFTYGMGYRMCA

GSLLANRELYLVFIRTLNSFRIEPTEEKIEWHPLKGNSDPTSLVAIPKKY

KVRFDLISELIREYDTR*

>CYP503B1 Aspergillus nidulans AN1598.1 45% to 503A1 in 54 clan

revised 7/18/07

MDNYTWHSGTLIPSDSPSSIDRSQLYLEILGVLSVVYLLQT

LVAYSKSFKAPFVGFRFWYEPKWLVGLRFSQGALAQVNEGYAKYKNAMFK

VARNDSDILVIPNKYVEELRSLPDEKISAIRAHIKNLLGKYSTTLILLES

DLHTRMLQTKLTPNLGSFIEVIESELLFAMDQEIPANLDDWQSVNVFHIV

LRIVARISARVFLGVPACRNEEWLQTSIHYTENVFATVMLLRRFPKWMHP

IVGHLLPSYWAIHRNLRTAKRIISPMVRQRRAEEAKRNPDYVKPNDLLQW

MMDGANENDGQPDKLAHRQLLLSLASIHTTTMAAAHCFYDLCQHPEYFEP

LREEINDVIAQDGGWKKTTLNKMRKLDSFLKESQRINPPSLLAFNRIVSE

DLTLSDGTLLPKGTHFSMPSAAILQDNGVEPGADQFDGFRYYKKRLNPEE

ANKHQFAMTDNNNLHFGHGKYSCPGRFFASNEIKIIMAHLLTDYEFKYPR

GATRPRNLTADENLYPDPSARLLMRRRVVAPPQASITPQLVSA*

>CYP620E1 Aspergillus nidulans AN1601.1 43% to CYP64A1 64 clan

65% TO 620H3 name needs revision 620H3 = 620E4

revised 7/18/07

MAPTAILITVPLGLLLYLLFIRPSIAKKQKAPLPPGPPPKPLIGNLRDLP

SPDQKNWVHFLQHRDLYGPISSLTVFGQTIVILNDARVAFDLLEKRSNIY

SSRPRMVFAGEMVGWEHILAMQPYSDMFRAYRKAMHRVLGTKNVIAQFNE

LQDVEARRFLLRVLEKPGDLVQHIR (2)

TETGAVILKIA

YGYDIEPHGKDPLVALANESLANFAVAGTPGAWIVDTIPF

MKYLPSWFPG

TGFKRTAASWKQTLLTTIEKPYRLVLKQLESGKYPDSYLSNLLEETKGRP

LSADEEQVIKWTAGSLYTGGADTT

TVSTLSCFFLAMALYPDVQRKAQEE

LDTVLGSAKLPTFGDRARLPYIEAIVKEALRWHPVAPMGIPHMSTEDDIY

EGYLIPKNSLIMPNIWAFTHDASHYKDPATFNPSRFLGDTPEPDPSTLTF

GFGRRICPGRLLADSSIFLTIAQSLAVFEISSAGEDAAKAEFLPGVISHP

VPYRLDIRPRSKGHEDLVKRIAAESPFGEGGAKELEEIVV*

>CYP567C1 AN1737.2 AACD01000027

47% to 567B1 53 clan

MALESILSLPAATLAAGVAALVAMYWLASYAYLYWFHPLSKYPGPPLAAV

SELWYASAWTGGLWNRKIEEAHRRYGDIVRIAPNELSFATAQAFRDIYGA

PSKTRKLFPKSDRFYDNGHPNIAFVLDPEEHARQHKIFAPQFRPSAVRTQ

EPIVHAHVDFWVAQIAARGRSGAVPVDVSKWFEWLTFDIIGELTFGQSFN

ATRDNKSHPWVSILLDATYSGSIFNLRKRLAFVGPLLRWMPYISSTARAA

VESVSQHGAMTLAFTRKRIESGPARNDVDDFLAHAIRAGGMTDTELADQA

MVLLTAGAETSATALTATLWYLSQPAHAHCLERLRTEVRGAFASPADVTG

DATARLPYLNAVLEETMRLFPPSPVGPPRISPAGGETVDGTFVPGGVYVS

ADVWTIHHDARTVGARPDAFEPERWCDGQKPYTVPFSIGPRMCIGVTLAW

VEMRIALAKAVLAFDWELAEDAVGGSGDWVEEARLKQLWQKPPLMMRFRP

LEAKA*

>CYP666A1 AN1748.2 AACD01000027

poor match 32% to 588B1 534clan

Genomic seq AACD01000027.1 revised to add C-term

Intron boundary at VTPLC is AT not GT, but this

boundary is GT in CYP666A2 and CYP666B1

MLVFTIPLATALIYITHSAFSFLSNLYLVCKTCPSLPRVLFPVSEVNLLY

LALFESRWFNHIRRYWLPTSIADYIADAAFRGRWDVKDRLARKYGGFYLF

VAPGLISCHVGDAEVVSQVVKERKGFVKPVKHLEAFEMYGRNVLTSEGSE

WAYHHRYSASAFSDKNNGLVWQESAIQAQEMLAYWEKKFNASNGSDRFTV

PDVREDILKLSLNIICSAGFGVRLPYRPATSATAERDKDSAEDLFRDAAT

PASGYHFTFRGVMEYMNRSMMSVFIANGILPKWIPRMLVPFFKTDFAAHE

DLKKYLHALIEVTENSEHERHNLLGRLVAARREEQSVRCSGSGPGLSNAE

ILGNTYIFSLAGHETTATTMRFALPLLAIHQDVQDRLYKELEEALRDQPA

NPAEWEYSTVFPRLVTPLC (0?)

IMLETLRLYPPVVSIPKMTTTHMAEITYKGERHCLPPNVRVNLNANVLHYSEAYWGPDA

DSFDPRRWDKRNAGSFLARNASARGLSGPGLESPNVHKPVRGAFIPFSDGLRACMGRKFA

QVEFIATLAVIFHRYRVTLVRVGQETEDDARKRVEKALRQSSTLITLALGGVVPLAFVRR

TGVAAEDDA*

>CYP682D1 AN1794.2 AACD01000028

38% to 551A1 38% to 552 53 clan

revised

MLEKGGFLRLFEGAFPASSKSQKLQKPSKSRMLHLVPYIFLAWVAYVVSL

VIYRLWLSPLAKFPGPKLAAATLWYETYYDAFKWGKYTFEIAKMHEKY

GPIVRISPHELHINDPDYYEVLYSRDSPRNKYEYFTK

QFPVAGSSIATVDHYHHRVIRSNMNPYFSITRARKQEPLVQALVNKLIER

LQAYKGTQTPINLQHAFTCFATDVVSDYSMGVGFHYLDEPDFIPDWSDTL

AWSVKNGVYLKAFPWSGALLNSLPPWLLSRIYPGMGLVFQFQDRCNRIVQ

RIMEEQKERGYEEVKNQFDHPTFFHDVLTSNLPKELKTPDRLAREVQAVI

GAGSETTGKMLTWTMYYLLENPDKMNALKEELNRLDPDQTATLVDFEKMP

YLTSVMLEGLRLSYGSSSRLQRIAPDRDLKFKEWSIPAGTPVGMTSVLIH

HNEEIFPDSHEFIPERWLDPEKRKYLEKYMVSFTKGSRQCVGMNLAKSEI

LLCLPHVVRKVNMELYETTRDDVTLAHDLFLGFAEEGSKGVRVLIR*

>CYP617D1 old name = CYP617B2 AN1884.2 AACD01000029

38% to 547A1 46% to 617A1 547 clan

MAPIPWGMLYVSVVGYSVLTSNLFTFFVLATALTALKIVYASFLYPEYLT

PIKHIPTPPLTAQKRSWVRGNTDTYVVISPFEGMLNWTKSVPNNGLLRYY

IIGNIEQVLVTTPKALSELLVQNAYDYQKPESIRISLARIAGEHGILLVE

GQEHKRHRKNLMPAFSYRHIKDLYPTFWAKSVEMVKCIEKDLQDRRDTGD

ITVTVRPWASRATLDIIGLAGMDRDFGSLADPQNELAAQYHRILEDPPLW

LKLLFAAAFVLGNEELVMALPVKRNRDIAEGAKYVRQVAQQLISEKRERI

KHNPEKAEGGGGGKDILSVALNSGNFTDIELIDQMMTFLAAGHETTSSAL

QWSVYALCKHPDIQTRLRQEIRSNLPSVSSNDPKPITAEAVDSLPYLHAF

CNEVLRFHPSVPITFRTTTRDTTLAGTLLPKGTQLTISPEVINHDPDLWG

PDAHIFNPDRWLGPGRANTGGASSNYALMTFLHGPRSCIGQGFAKAELAC

LVAAMVGRFEMELADPGKKLAVRRTATISPVDGVVARLTPLDGW*

>CYP51F2 AN1901.2 AACD01000029

64% to 51F2, 60% to 51F1

MLSPTLFSAYVLVGAIVAVLVNVIRQIFFRNKNEPPMVFHWVPFVGSTIS

YGMNPYKFFFSCREKYGDIYTFVMLGKKMTVYMGVKGNDFILNGKLKDLN

AEEVYSPLTTPVFGSDVVYDCPNSKLMEQKKFIKFGLSQSALESHVPLIE

KEVLDYIKTSPRFKGDSGVLDAPAAMAELTIYTAGSALQGKEVRKKLTAE

FADLFHDLEMGFTPINFILPWAPLPQNRKRDIAHARMRETYMEIINQRRK

NPDAQDHDMIWNLMHSTYKNGNPVPDKEIAHIMITLLMAGQHSSSSISAW

ILLRLASEPQILEELYQEQLANLKRDPRTGAFEPLQYKDLDLLPLHQNVI

KETLRVHLSIHSILRKVKNPIPVPDTPYIIPTSHTLLASPGATALSDEYF

PNANMWDPHRWENQRPDKEDEEGELIDYGYGAVSKRMSSPYLPFGGGRHR

CIGEKFAYVNLGVIVATIVRNLKLYNVDGKTGVPATDYSSMFMGPMKPAV

VGWERRFPARS*

>AN1967.1

linoleate diol synthase not a P450

MGEDKETNILAGLGNTISQVENVVAASLRPLPTATGDGTYVAESTQTGLA

KDLSHVDLKDVRTLAEVVKSAATGEPVDDKQYIMERVIQLAAGLPSTSRN

AAELTKSFLNMLWNDLEHPPVSYLGADSMHRKADGSGNNRFWPQLGAAGS

AYARSVRPKTMQSPSLPDPETIFDCLLRRKEYREHPNKISSVLFYLASII

IHDLFQTDPKDNSVSKTSSYLDLSPLYGNNQDEQNLVRTFKDGKLKPDCF

ATKRVLGFPPGVGVLLIMFNRFHNYVVDQLAAINECGRFTKPDESNVDEY

AKYDNNLFQTGRLVTCGLYANIILKDYVRTILNINRTDSTWSLDPRMEMK

DGLLGEAAAMATGNQVSAEFNVVYRWHACISKRDEKWTEDFHREIMPGVD

PSTLSMQDFVAGLGRWQAGLPQEPLERPFSGLQRKPDGAFNDDDLVNLFE

KSVEDCAGAFGASHVPAIFKSVEALGIMQARRWNLGTLNEFRQYFNLAPH

KTFEDINSDPYIADQLKRLYDHPDLVEIYPGVVVEEAKDSMVPGSGLCTN

FTISRAILSDAVALVRGDRFYTVDYTPKHLTNWAYNEIQPNNAVDQGQVF

YKLVLRAFPNHFDGNSIYAHFPLVVPSENEKILKSLGVAEKYSWEKPSRI

SHPIFISSHAACMSILENQETFKVTWGRKIEFLMQRDKHQYGKDFMLSGD

RPPNAASRKMMGSALYRDEWEAEVKNFYEQTTLKLLHKNSYKLAGVNQVD

IVRDVANLAQVHFCSSVFSLPLKTDSNPRGIFAESELYKIMAAVFTAIFY

DADIGKSFELNQAARTVTQQLGQLTMANVEIIAKTGLIANLVNRLHRRDV

LSEYGIHMIQRLLDSGLPATEIVWTHILPTAGGMVANQAQLFSQCLDYYL

SEEGSGHLPEINRLAKENTPEADELLTRYFMEGARLRSSVALPRVAAQPT

VVEDNGEKLTIKAGQVVMCNLVSACMDPTAFPDPEKVKLDRDMNLYAHFG

FGPHKCLGLDLCKTGLSTMLKVLGRLDNLRRAPGAQGQLKKLSGPGGIAK

YMNEDQSGFTPFPSTMKIQWDGELPQLKEDF*

>CYP551A3P  Aspergillus nidulans

           AN5460.3

           About 47% to CYP551A1

VTFYCASLIIYRLYFHPLAGYPGPKLAAATRW

YEFYYDVIRQGKYVYEVNQMHDKY ()

PIVRINPHEIVIKDPEFYNQIYVAGNTRRTEKWXXXXXXXXXXX

GSIVMTVGHELHRLRRKPLDPFFSRMEIDRLEPLIVKEAKLLNHRLQSYSGSGRVLRLADVF

SAFAVDMITHICSEAGPVMMNKPEFGKDW 224

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

ETKNSLFRQLLSPSSA

GGLPESELDAERLASETMVLFGAGTVTVTSTLSLICYYILRDSHIRDRRAGELEGVMAQYPTSMPTWQQLER

LPYLHALVQEGLRLSYGTMRRLPRXX

PDAALHYKQWTIPP  (frameshift)

TPVGMAAYSLHTDPEVYPDPFEFL

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

(Missing PERW and heme signature)

LAYAEVYWALAVMFKSNAPKLQLFETEKMDVEHVVDSMVALLRLGSQETRITV

>CYP552A2 Aspergillus nidulans AN2040.1 53% to 552A1 50% to 552B1

AACD01000032.1  revised 7/18/07

MTISAETVLRLLPLTAGGAWVFFHLAKCIYNLFFHPLSHIPGPWLAAATY

LPEFYHDVVRGGRYTTQIQQMHEKYGPIVRINPHELHCNDHRFINEIYAG

GTRKRDKPVHQVTGSEAAAHATFSTTDHDVHRMRRNALAKFFSRAQVLRL

EPTVRGLAERLCDKMLRTEKGRPFHVGAAYSQFTADVISGYCLGENLGLM

GQEGWEEQIVDEVATVLRLGCTLRFVPWWKHVLGVVLLIRKQLVGSPKES

SDALIVGMPNHIRKAQADIKIMDGKGNGNGPETIPTTVFTSLLQSDLPPQ

EKTFERMTSEGISLFAAGTATVSWALTVATYHLLTKPAILQRLTAEVSDL

VNSSSCTEKVEWSALERLPYLGAVIQEALRLSYGVASRTARVATGEDLVY

RGEWAHREVQYIIPRGSAIGMSAVLAHHDEAVFPDSHLFLPER

WLDEKNQRLKELDRALLAFSKGSRGCLGIK

LAYCELYLLLALLVVRVFPRMRLYGTTEADVAYDH

DFFNPFPVWESKGVRVVV*

>CYP532A4 Aspergillus nidulans AN2125.1 56% to 532A3 top part

revised 7/18/07

MALVTEILDHTEPLSNYGLYILPFFILLYLAQQYFHNGLHRYHGPILAKF

TNLWRFLDVRGRRPELTHIALHRKYGDVVRLGPNTLSFASPSAIKVIYGL

NKGFTKANKSQSEFYPVQMTVSKGEPLPSLFSTLDESFHANLRRSVNHAF

SMSSLVQYEPMVNQTVELFLDQTAALFANSGKTCDFARWLQFFAFDVIGS

ITYSKRHGFIEKNEDIDGILKSLARIFDYAGPVGQMPWLDKWLWKNPIYD

VLQRWGIADNSHPVAIFARQRMNERLMADNGTRTEAEQQQDLLTKFIQAG

KDRKDFMTEKRVLTMAVSMAFAGSETTAISLAAVFYYLLKNPEYMARLRG

ELDNAVAHGIVENRSSGLVTWSESQKLPFLDACIKEAFRIHPAAGLSLER

VVPASGIDIAGHFIPGGTIVGCSAWVLHRREEIFGPDVDSFIPDRWLNVS

AERLKTMNGTMLQFGAGARTCIGKNISLMEIYKLVPSFLRRFDIQLAHAD

QEWELWNAWFVRQYNFKTKFTARNFEV

>CYP630B3P AN2191.2 AACD01000034

55% to 630B1

pseudogene very similar to 630B1 AACD01000034.1 ANcontig1.34

note 630B1 is missing 16aa after the CYS 53 clan

MLEPILALLLVYSFYSYLVAPIITYIWDPKNLRRYPNFHPLPGISDIPFLLAAQKVF (fs)

RSRTLHALHQHHPIVCVGPNALSYGAPTAIKDIYGHGT

TCVKDRFYSEKSGSHAHLANVV

GKQDHARKRKVLASAYAIKNPEG*EYKLSGMTARLMRV

FEGKCTEPLPSSV*ATEERDLTIDFRSLTNHFT

VVAIANIGLTEDL

GFHEQGSDTNSLESMDGRVKDVSFKECREASGTVAYRLIWAYDWFPVLKR

LSKVLSPYYRKLGKLDADWNGIVYNRATRRLNV (fs)

GEKLDDFFTAMMEDKKGAAHNLETGEIVAEI

SIMMNAGSDTTAIALRNVLFLLLKNPRCMARLREEINVVLDEDELVAPYS

KVKHLPYLRACLDESLRMLPPVVFGLPRRTPPEGTTILGEHVA (fs)

GDTSVSMSAYVVHDESFFKDNSTYLPERWLGE (fs)

RSKSLQSYFIPFSARARGCI GRNISYL*QTVVLASL VHRYDFALP (fs)

XXXXXXXXXXATNLSPGPMPLKFGRGFMHDE*

 

>CYP646A1 AN2596.2 AACD01000043

54 clan, revised 2/21/06

revised 7/18/07

MLLELDVSLFSMAALVGTLVCIVVKLFETSPVPKDIPWV

LKKQNVLRRAAERFIGVNPISFIQEGYEK (0)

YSKNQQPFVMPSVNEGDEVVLPREHSNLVLFAKES

EYSFKAHISDFFQLKYTSWPLAFAEKYDFFVKLVSKDLTETLKSDAIAEA

LANEARACLSDIWGEDEDNWVEVPLYSAMEN

HDTSLLNAMTNCSNAIVFGANVIKAFPSFLHG (2)

IVGPIVGLVNRWQERVFHTRMKPLIEARIKTQREAVDKAALQENLKAQGSLLDMLINAGLRSKW

PVEVETMWLAYRIFMINFPGVHTSGISATSALLDILSFPSEEGLIDMLQAEIQNIAAS

SCGKWTAAELEQASLLDSAIKESLRFNGINALSPTRM (0)

VVAPEGTTLPNGLFLPYGTKI

GIPQYAVHRDSDLYPNPDQYNPYRFYTPGASPAQLRESSMTNTSESYVVFGHGRRQCP

GRWIFAHIFKLLIAEMLLKYEIKPFPTRPKIH (1)

RWGRFQLPPLTTKLTVRRRKDTA*

 

>CYP661A1 AN2607.2 AACD01000043

30% to CYP56A1 547 clan = 56 clan?

MHPTLLYTCTFFITVTALLWRYFRVPSTIPSNIPRIPIWVNFYAWYHDLS

VIELYDAFYRKIMEEHGAVVVWFTGAWCILVTKPEYLVEIFRNEDTYPKV

GVNVRGKGSLMGIFAGENIINSSKPTWATLTKVMKPGFLKSFDAQAIHAK

AKKVPERLLQAQSEVGKGKGVPATQWMEKYAQDVMGLCLFNFDLQALDEP

RVPYAPLLGQIIPTIFSRWAFYFPTLDIPGRYFLSRKATLDNIAKFDSLL

NEIVESTLNADAEKQPKVVSHMLKRALDNGQLTPELYRYNLRMSFMFGHD

TTAIFMGLTMYVLGNNTVLQDRLRTEVLQSTGKTIHQLPYLTSLLYEVLR

LYPPVTEVLNHTVSRPTALGGKVTIHPGTWLGWNAYGVHTNPAIWGPDAL

EVRPERWGDTVKDIQASFRLQSTKGNYIPFSLHARKCLGQSLVLTEVKLL

MFEMVRQLKWVVDPTYKLNLGGVTFTMLLGLRLIVEELELDSRDTVADEK

SQMHT*

>CYP566C1 Aspergillus nidulans AN2610.1 38% to 566A1 53 clan

revised 7/18/07 NW_101284.1, 79% to 566C3, 79% to 566C2

MTLIESSPAQFTLVACSL (0)

GVAFLVLIVVYSYFFHPLARVPGPWTGAVFP (0)

309588 FWSISTLYRRRLNPDLAELHKIY (1) 309535

309472 GPVVRVGPNQLSFATIEAQKMIYNAKPTNNGSDEH

FGRDGTLQDVLLSMILGAPNIGSLSNRAEHKKMRK

RLLPGFTSNTIFEQEPLLRLHVDQLLHRLAQDAGLINLTSHFSRFLWDLI

GDFSFGEPLVPEKH (1)

ELRTDKLKSMVEIYQGCFPLLEAINHVVPEINAVIRLAFRLVPPATLRAVLPTATLRG (2)

CVDRQDGRSDFLTHIMGDKSRDPTELEL

SYDEVHSNATVLM (2)

IAGYKTTETSLSALFYRILSTPGVLKNLQSELFSNFQ

SIDGITGRKLLSLPYLNGCIYESLRLAPPVAGKFASRRSPGAVIQGFYVP

PGTEVFTETYTMQRSPLYWYAPDEYHPERWLKQSEGSPYAQDVHEAFKPF

SSGPRACLGREMALQTLRLTTALLAYRFDMEMVNEDQFVWEQDTESRMVY

SQYQIKAVVQEHLT*

>CYP56B1 Aspergillus nidulans AN2706.1 43% to CYP56A1 547 clan

revised 7/18/07

MLVTLTVLFLGLVGILASFLTYLFTPPQFFPKGLPTIPFYYTLIPLLNQT

LKRAPTDQVTLYHRYLSTPLRTHGAVKLFFGGRWNILITKPSYIAEVLKN

EDLYAKSGNQKKIPHSVLAQYTGDNIISSHGENWKLYSSIFKPGLQRDYD

PSGIWRNASLLVQMISQDIKRKSPVDINPLMQRYALANLSEVLLGTTFDT

LQKPAASLHAFQLLIKPKIFDPIFLNFPVLDYLPLQTREEARKLVTRFTD

ELIETVRKGHTTCDHEKEHTRNLGCRLLYACESGLFTEMQLRHNMISAFL

AGHENPQLLLVSSLFLLAEHPEMQESLRAEISALNDLEPAYNALSALPLL

TSTIYEVLRLYPPISQLINRRTTAPTLLGGEIPIPAGTYVGYNAYATNRD

IGFWGPDANEFKPSRWGNTMEEINALFRRANAKGAFISFHGGRRTCLGQR

FALLEGRVTLAKLLMCVRWEIDPSWQRGMTPAGPLYARNLQLRFSNISGAGKAGAS

>CYP665A1 AN2727.2 AACD01000048

35% to 530A2 66 clan

MGLSLGNDLWILLVSLLVAIVTSLVVALAPYTWASLRPKNFPPGPKPLPL

IGNLNLIPPSKAFLLFHQWTKKYGPIIGLKFGPTNVVVLNNWKDVQELLE

KRGHIYSSRPDNYIANELICKNHTHILFAPYGDGWKALRKAAQGLFTPRE

LAGVLPIQEAEATQTAFDLIRSPDRYYEHIQRYTTAVILASVFGQRGADF

NSPNVQALYDVQNRFTALLEPGAAPPVDGITFLRHIPEFLAPWKRRAKEI

RRDQRALYFRLYNATKERMAKGIRTGCFMEKLIDDQVKNGLDDEHTTYLG

GILMEAGSDTTSSTLLSFLLAVLENPGALKRVQEDVDRVVGTERSPTMND

LENLPYIEACMHEILRWRPVAAGGIPHMLTQTDTYKDYIFPAGTIFFANT

WAIHHDETEYSNPAIFNPDRWLDGNKYGTKDNNSTLDSTAQRKTSYGWGA

GRRICSGQKMAEASLKINIAKLVWAFDFERVKGEENVDISVDTGYEGGFL

VCPKKFPIKITPRSEGRAAVIEKEFEGLKGFYEKLAA*

>CYP631B1 Aspergillus nidulans AN3225.1 38% to 631A1 53 clan

revised 7/19/07

MDHPHPSTFSL

GLSQILVCLALLYAAIHILSV

YRRLCHISGPFWARIS

NLPRVWWVNTSRAHEIHQQLHEKYGDVVRFGPNMVSLRNPTWIPTVYPTR

MGVKKSDFYRTLAPYTPSGALPAVFSSRDEEVHRGLRGPIASLYSMSKVL

PLEVFVDRTIDVLVRQLDGRFAGAGETFDLASWLQFFAFDVMGTLTFSKR

YGFLEKGMDVHGMLDTIWRFLKGAAPFTQIPWVDEIWNKNVLATKLKGAT

GVSILGIVGKFVSQRQEESKAGKIDGTADRDMLSLFMEIQKNNQLPPWYV

TAWTFSNITAGSDSAAVVMRTVFYNLLSHPSTLQKLRSELLSAGPLTQPY

PSWKDVCNLPYLDACILEALRLHPPFCLPFERIVPQGGMVLGDTYFPEGT

VVGMSPWVVNRHKPTFGEDSDVWNPERWMVSKELKSKREAAVLTFGAGRR

VCLGRHIAILELKKIVPALVLRYDFELIDPERFTTENFWFFRQRGMDVRV

KKRMQAEAGI*

>CYP649A1 AN3253.2 AACD01000054

32% to 503A1 54 clan

MEDPSSLPSLYPGLFVLFLLYFAGDLIATRRAAQRQKDHPLVGSPSWWTP

RFGLNLVFAARAVEILQTGYHKFKNRTFQLIRGDGSVVILPLHLIDELSS

LPQSVASSHGALERDLLGRYTGLDIILTSRMHHTIVQRKLTPRLAALTPS

LQDEVSLAVQEGFPHSTEWTIVKPYQILAQVAAKIAARAMVGPSFCRDPR

WLDISVNYTESLFRTIVILRLFPGWTHPVLSRCLPSYWAGKRYLQRAKGI

LGPKIDELIRRNDTGEWSPERTESDFNVLCWLVEAAKGRDRNAETLAHIE

VLLALAAVHTILLRLVNVLYDLVAHPALFEELKEEIQDIGFNEDWNFGSY

NKLRKLDSVLRESQRLSPPTILGLKRLFLQPYKFTSGITVPAGTYVALPV

MAIENDPLHTDNPEEFDGLRSYRRIEQKTASMRPNPKDGPQFSTIEKTVL

GFGYGKSACPGRYFASLVLKMVFVKLLTEYDFQFLPGRSRPKNYLVHEFL

FPWPWDKILVRRRENGVCPF*

>CYP648A1 AN3256.2 AACD01000054

poor match 54 clan

MFQAASSVLSTLYQICANGAQAPLPAGSVWAILVLLLVALILLVCRYADS

YDGVPVVNRICALEPRVFSRIRFAFNAEQILQDAYRKYDGKPYIIARGDA

DYLVLPSESVTELNRLPASIINSRMCHAYSMTGHLNGMNVVLKSNLHVKT

LLNRITPALPAFLGPASARMQATMQETFPSVSSWTTIEPLDLVVGCVSRA

ITLAAVGEPWCDDTELVNLTFEHTKLVFTVMFAMRLVPAALQPVLVWMLP

HKWRLQKSLQRLESFIVPIVQECKAAKPRPATERPSTLLAWMVAEATNDV

EEDPYVLTELLAALAAGGTYSSANFIVSVILDLIANPQFLDEIREEIRQK

HEELQGRWDFAAFNNLPKLDSAFKETIRLTPGSLTTYSRVMLQDYTLSTG

ITLKKGQFICVSSYARAKDDEIYQNAGSYDALRAYNESQQYHAAQPFKGV

YQQEFRWGAGRWACAGRHLASLLAKFIVVKLLDEYEFQFVPGSHRPPNSV

FHEFVFVHPSTRLLTRRREENLGICCW*

>CYP667A1 AN3272.2 AACD01000054

29% to 589A1, 534 clan?

MLSLPSSVFTILVGLFLYKIIRLAHNVRLARKTSLPYIITPLLETEVVAL

LLNPLLRYLYRDYLDRGKGWPRWCRFFVKDWAWEDKRQAHDELGDVFLCV

SPEGIICYSADATMGWDVMNRRNTFTKPRDKYKVLEPYGMNVATAEGKTY

QFHVRITAPPFGDLSGVNNLVWRETVHQTKRLTEAWAESPPTEIQKDVNA

LTLAIISLAGFGKRLEWSKNGEKEGVPAGYQLSFLHALQDTLHYMVPILL

FPRWVLRVILHKAALAHAQLDRYLREIIRDQKAKLSADINHSDKQSRGNL

LTAVVRASMVFDSEQSSKESSRSSGERKQGFTEDETMGNLFIYLLAGYET

TANAIIYGLAVLALHQDIQDQVIEEIDRAHARAQSANRSELTYEDDFEFL

EYTYGFMYETFRLFPGVTLITKMIHQPERIITDGPDGSPKSYDLPAGTRV

YLNAPVVHYHPKYWPEPYKLDPNRWRSSQGEKHVVASDRTRQMKGTLLTF

SDGSRACLGRKFAQAEYVAFFATLLRQYRVRLAPGSDPAVVERDLFGKSA

GTITLAPLANVRLHIQPR*

>CYP654A1 Aspergillus nidulans AN3274.1 35% to 512A1 54 clan

revised 7/18/07

MILKLIPVTGGAALLLQASALLSFAWLLLAWASRRRRNRLIPGVYVAGLKSGKVPLSQARQAFIHGCA

DLMLEGYQKTQGGLFYVPSPAGERLMIPTKYLDELKN

AANEEVDFTASFSEMFEGRYTTIGQKWHLHPDVVKKSLNANLELIMPDVY

DEIVHAYRSLLTPSHDWQPVRMSEIFTQIISRASNRMLGGKALSRNRDWT

DTSINFTTDTWLASQQLKRYPAWLRPVIQHLLPEMGRVRRHFTVARQVIC

PIVQKRSESDNDTKKPLDLLQMLWEGAEPVDQTPEFMAYTALAISFAAIR

TSSSVPTHLLYDLCARPEYIAPLREEIESVLREEGSIFTKAALNKLLKLD

SFMKESQRFNPLSLLTFGRVIQSDRILHDGLVIPKGTIIGVPAHAISQDG

DFYPSPSTFSPFRFVPSAPGEKTAGFVTTNASSSLSWGYGKHACSGRFFA

ANEIKLIMAYFLLNYDFQFAGGRTERPANYTFELQNMPDETVEVLVRRRK

DGNL*

>CYP567E1 Aspergillus nidulans AN3275.1 Missing N-term 147aa 53 clan

revised 7/19/07

MVPYGTCETMDHFRGQPALVLIGASALVGIITWIARLLIRAFVSHPLAHFPGPRLSALSN (0)

LNYSWSYMGGRQPYDILNLHAEY (1)

GSVVRVAPNELSFNTAQSWKDIYAPRKGRATFIKSDFYDGGNFADQASSI

VSERDPARHSAMRKFLSAAFSDRSLREQEGLVTRVIDDFIDQVGQRGNSKDGVDMTMWTNL

LTFDIIGEL (1)

AVVLESMGQAGLSDFLKRFPIIGRVFLKLNPRWLNKLMDGAIKHQTYTIDLVKR (2)

RIQQKTNRKDFMSYLLLERNSSQISDIQLAAHASDFV (2)

ATLKEDHSIAGSETTATCLATVIYYVGRNPRILKTLQEEVRSAFRNYEEI

NGQSTSSLKYLHAVCLEALRIFPPLALALPRVVPEGGEMIDGHFVPEK (0)

TIVSTNPLAASMDPANFDTPWAFCPERWIRLSEKDQLEASQPFSMGSRSCLGRG (2)

LAWLELRLTLAKLYYRYDLKLVDDELDWHRDAAMHLLWVKPKLMTQVLPRAK*

>CYP567D1  Aspergillus nidulans

          AN3281.1

          41% to 567B1 53 clan

          revised 7/19/07 89% to A. clavatus CYP567D3

MSASWVDEPSSLLGIFEVVFVL (0)

KRHPNGSELQTLVYVSTRILYNIYFHPLAAFPGPLLARASM (0)

AWRIYHSMGGRFHRAIDEQHRRY (1)

GPVFRVSPNELSFASVASWKDIYGHRAT

GKPPLIKSKFYEIYGAGFGSLCIGSERDPEKHTRMKKSLSPAFSLRSLGD

QEVIVSQCVDRFVSRMGEPELNAGGLNMTKWYEMVAFDILGEL (1)

AFGESFHSIED (1)

GKPHFWSSLIEDHLYFITVADNFRHFPVVALIAKLLSPFLDSIRKKHTGYTRNKVAQ (2)

RIRSSSPRKDFMANLIGKVESNEMSREELTAHASTLV (2)

IAGGETVATFLAATTFYLLRDD

AVYQKLKAEIRGQFNTYEEITCATAQNLPYLQAVISEGLRIYPPGSQGFP

RISPGASIDGIWIPAG (0)

AEVYTSAWTVTHDEANFHDPHTFKPERWIDPDCADIKEASQPFSLGPRACLGRN (2)

VAYMEINLILARLIWTYDMELVNKSMDWESESSLHVMWSKPELKVRFRQARP*

>CYP659A1  Aspergillus nidulans

          AN3349.1

          poor match 25% to 640A1

          lower half 7 clan, revised 7/19/07

MDILDVASSELYTLVRSLVTSPVCQGVLFSLLT

WRLWRFTISPTLQPEDPKEAPYWIPCI (2?)

NQLGNTREPFALTLAGKTMYIIADPKDAAEL

IRNSHSLSTLTTELYTRMGIPQAVIERLFTVYPDAPFNARSNARPVHATD

AMIEMYRAHLSPGAQLDEFLERDVTKRILNAFAKIPGLFNK ()

GIVGAYYGDLIFSLNPGFIAQFMVWEKVNWKLLFGLPSFLSGDMLAARKGLVDGFVAYF

ALPRAERGHENYWVKGVEDSLRWLNVSNEDIARIFMLQTWA ()

ILGNMYKMTFWLVAHILHDAALVNAITAEVRPA(0)

IEIDHHYLSEQCPKLDSLFSEVLRLTLTAPMARDVSETTTVGGRRLREGNRVL (0)

VLYRQLHLDRAT

WGPTPQTLQPDRFLIDSGLKSSIAYRPWGAGKHICPGRFLARSAVFTFVA

YLLAGFEVRLRETGTGKSTRSAFPMADMSRPSPGIANIADGEDVLISVIRRDRSS*

>CYP620D1 AN3394.2 AACD01000055

47% to 620B1 64 clan

MTYFLLILTPDSTKMAIASLILWGIGTLICYLIYQHSTRSAQRLPLPPGP

KPLPIVGNLKDFPPDGKPEYQHWIHHKDRYGGISSVTLLGMTLVIIHDKK

AAHELLEQTSGRTSGRPTMVMANKLCGYESIVVCQDYNARFRRCRKFLHQ

ELGTKVSASQFSAAQELEVKRQLVRALNEPEKWLEHFKTTAGATVLKMAY

DYAVDYHKPDPLVDLIDRMMTEFSLAAVPMAWAVDIIPALQYLPGAPFKK

TARKWRKSIQAAAYIPYRFVQSQMAALTYKPSYVSKLVQLLKGEQSELDH

EDEQAIIWSAASLYGAAADTTVITLTTFTLAMILFPDVQRKAQEEIDRVV

GNRLPGFKDREKLPYINALVLEALRWWPIAPMGFPHTATEGFEYNGLYIP

KGAYLLPAVWWFLHDPEVYDNPEIFDPDRFLEPRNEPTPMTEAFGYGRRI

CPGRFFADSSLFLNIAQSLAVFNFKKAVSSDGKEIEIDVKPKPGLLTYPT

KFDFRIEPRSERHIQMIRELERQDPLAAGDAEHLESIDNFQPL*

>CYP623B2 AN3497.2 AACD01000059

53% to 623B1 54 clan

MHIMNAVDSLLGVGLYFLLPAALLYIINTVFFGAVYPRGVPFIRERPGKT

SFSLKTRLAYLTDCESLFREAYHKYLKNGKPVILPGFGVRTELILPVSSL

RWATTQPDSVLSPGEAFVEIDQADYSLGHSRYVVDAWQGMLVKNEMNAVL

ENIVAAMNEELGVAFDRYFGTDEENWRDIDLLEAAKLVVAQAASRFTVGL

SLCRNEKYLNDSFDAIDGCVITAGVVGGCPPVLRPLIGPIAGLKARLANR

RLRKHIEPLYHARMEALKLPIEDQPQDHFQMMLRFAQRERKEELYSLDQI

ATRVTVANFGSMHQTSIQVTNMLLNILASDPEYNTIAVLRDEIDQVLGSD

TAWTKAKVSKMTKADSVARETLRCHSFGGRAVFRKVLVDGVTTDTGLPLP

KGTLFSFLSQPAHVDEETYEDPFKYDPFRFSRVREAANDPAKAGSLSFVS

TGPSYLAFSHGKHACPGRFLVDFELKMIIAYVLKNYDIRFPEEYQGKRPA

NRWVAEAVFPPSGVRVLVKRRRA*

>AN3536.1

very poor match similar to Trichosporon cutaneum phenol hydroxylase

not a P450.  heme signature not conserved in phenol hydroxylase

MGDTVRTDVLIVGAGPSGLMAGVWMAQMGVNTMIIDQKHNLTRCGRADGL

ESRTLEILDSFGLADKIWTQANHTVEIALWGAGADGRLQRQSITANSKPG

WSRFYESTLSQGQVEEYLMQFVRARKHVEVRLETIPTSLEIDNMTIDHHD

AFPFRVNLETAPFSPQSSFDGVATPNSELSSGQSDDSGYAGMGTMVEAKY

ILGCDGAHSWVRKQLGLKLEGETYDDCWGVLDIIPLTDFPDIRKRFIIKS

MHGTLMMIPRERKLVRIYVELPFEAAERYRAEHNAGILMEQVATIMKPYS

IRTNYVDWSTINKVGQRICRKIGPHNRIFLAGDAIHTHSPKAGQGMNVSM

QDTFNLGWKLASVIKGVLHQSALETYQQERLPVAEQLIALDQRICRGMCT

KRNGGVEAQNGRFDEDHRRALEQENSSMSGLAVTYQPNSLVTPTVWDTSL

PSDVPPCTSRPSVARNLRVGARVPSVLILNQSDSQACHLHQILPSTGQWN

LIVFGGDIVAANQKRRVAALTDALNAPDSAFAKLNNRVSIAQRGFPVLGM

YLIHRAHRHSIELNDLPLVFRPWTNDGVDYGRAWVDAETYHHAGGGKLYS

SFGIGPKGCMALLRPDQHLAFLSDIDDVDGLELFLRSVMPGAT*

>CYP681A1 AN3609.2 AACD01000061

34% to 551A1 53 clan

MSFLGLLLSAVFPVAIYGIFLVVYRLYFHPLRRFPGPKLAAATFWYEVYY

DWFKGPYPGSSWNLDRLHNQYGPILRKTPDELSIRDPDYVDVFFAGGRRD

RYSRQGKEAQGSVQSTLLGSDHRRRRGALTGFFSKRSLDTLEPFIMDKVE

QLSASVEENFLKTGNILEAGVAFGALTLDTITDYCFDQSFGCLSKPDLAP

EWRRTFWDMLESIPFLKNWTFFAEMFFWVPQWVVKHTNPAMEQFFIMQAA

IRAKVARVTMEWEQDQALQLQGKDPFMKGKRKRTIFYDILNSAVLLPEDK

TPKRMAEEAFGMVVAGGYTTGKAMANLMYHLHANPKWLERVREELDSLMP

SPDQPVKLSDLQALPYLTACIKENLRISNIITDSIMLVEPVDTLTYKDWV

IPPKTPIGMTLYHMHMDEQIYPEPKAFKPERWIKGAEAKHDLDKYFAPFS

KGTRGCLGVNLANAQMYLGLGVILRRFDFQLFDVVKERDVDTVRDCFVGL

ESPESKGVRLRVMDKRE*

>CYP540B4 AN3861.2 AACD01000062

67% to 540B2 505 clan, revised 7/18/07

MLNQQFYLHGETASSAKSITLDETANLDQVKHIVAAHFAIVEPNGIGFQT

ENDCLVDVSSILTAPGPIAITIDGRAVREPEGPKGLPFVGNYFEVFPDHL

GNHQRLFDTYGPIIKTNNLGRTTYQTNDPQLSAIVLAESDFFTKKINEAH

PLYPLKTPEAGVFLGDTDTKEWRDAHKFLPPALGPKAVRHYAPTMDSCVK

DAFKVFDALDETGEAWNVYQYMLKLGSQAVGKLTLGLDFEHFTSPDAPTH

EMVHAIAELLSLNKEVTSRGDWYAKLPFGAPKRLRNLKARIEEMVDESVQ

RAARGGVSDLPLQEAALQASNMVDYAIRATDNKGEKLPKSSLIWALVVAT

GAGFTTTSSLLSWLIYGLVTYPGMQDRLLQELVDHGITEDTELTADLTEN

LPFLDKYIKEMQRRHNPSYQPGRTAKVDLVLPGGYKIPKDSVVIAALHHI

HNNPSIWDNPSRFDPDRWDTDEVKQRHKASYIPFAIGPRMCIGFNFALSE

IKVFLPRLVYRYNFIREGDGPIEYDPMFQLIRPNNL

YVRAERRVKWPAKTKSSE

 

>CYP539D1 AN3917.2 AACD01000064

52 clan

53% to 539A1 N-term 94aa dont match

49% to 539A2 first 43 aa dont match

42% to 52A1 N-term 100aa dont match

MIEELVSKTTPGQAVVYLLGAFFLACLARKIQVQWQLSRLGSRAPKIPFR

LPYGLLIPSISRNSHADRRLSSAMDFIYKSMQANKSDQDLEYFTDVMRNA

KGAPLAEDKKTVELDAGISSRIIFTRDPENIKAILTGQFSDYGKGESFHR

DWREFLGDSIFVTDGEQWSASRHLIRPMFVRDRLVDTEIFEKHVQHLIPL

LAGNNESKIVDXXXXXXXXXX

VTSLFFRYTLDAATNYLLGQGTDSLQNPETEFAEAFRYV

QRRQAQYFRLGVFKFVLSRTEFRRQLKVMDDFIKPYIDRVLAMSPAELDQ

KLSKSDTFLHALARFTRDRRTLRDQLVAILLAGRDTTAATLSFCLFELAR

NPEVTAKLREEIASRLGLGASAQKPSYTDLKEMKYLNAVLNESMRLYPVV

PFNVRFSLKDTTLPRGGGPDGLAPVAVRAGTRVVYSTMIMQRSPENYDPP

SAPNYFDPAQWNPERWLSGWQPKPWQFIPFNGGPRICIGQQFAMIEMGYT

VVRILQAFERIQAVPEAGKSVVEDPRLRFEVTLTPASELNCVFVRDGEGR

EDEKISR*

>CYP61A1     Aspergillus nidulans

            AN4042.1

            66% to 61A1 51 clan revised 7/19/07

MAEINGSFVSPAADATVFPQVFQPAGLIADFLNGLTLWKTLATLFALAVV

YDQFRYIYLKGAIVGPAWKLPFMGPFLQSVNPKFHEYKAKWDSGELSCVS

VFHKFVVIASTRDMSRKIFNSPTYVKPCVVDAAHKLLGKTNWVFLDGKEH

VDFRKGLNNLFTRQALSCYLPRMEEVYNDYYARFLKKSKNNNYKPTPWMP

EFRDLMCAVSCRTFVGHYISDEAIDKISVDYYNITAALELVNFPIILPFT

KTWYGKKAADMVLDEFAKCAAKSRARMAAGGEISCIMDAWIKAQLDSAKY

REKIAKGIEVDSSEKPPQVLRDFTDYEVSQTIFTFLFASQDATSSACTWL

FQLMADRPEILDKVREENLRLRNGDVNAPLTMDLLDSMTYTRAVVKETLR

YRPPVIMVPYIAKKDFPITDKITVAKGSMIIPSVYPATRDEEAYPNADSF

DPDRWITGTAEQHPKNFLIFGTGPHYCLGQTYAVLNLMAMIGKASMEMDW

VHTPTPQSEEIKVFATIFP (0)

DDCLLTFRPRA

>CYP660A1 AN4117.2 AACD01000067

35% to 636A1 cyp7 clan

MLEPFHLLILGAITAIGYILSQRGLDPREPPEVHSKIPIIGHILGLMRHG

MGYFSRIAAENSSHPIFTINLLTNKQYIVTSPSLMQAVQRNKRTLKFAPL

VNFTAERFAGIPESGMSLLRDREAGGAGLSAGTVHAMEKTLIGPSLDRMN

EEMARMLSPLVDELVASPQTVDLYAWCTRAITAASTNASYGPKNPYKDSA

IADAFWTFETNIAPLITGVFPSIMARKAYRARETTFAAVLTYFQTKGHEQ

GSELTKTRYRVMHAGGLSDTDIARAEVSMGLGLLSNTVPAAFWVLFDLYS

RPSLLCEIRREVMKHAVRVENTQTPMGRKRIIDISALRDSCPLLVSAYQE

ILRTRSVSAVTRVVTEDTVLDNRYFLKKSGVVSIPASAIGATESVWGPES

ASEFNPRRYMRQTTPHGSTSPRRTGGFMSFGVSPTICPGRHFASSEILAL

VAMVILRIDLTPVDDGAWKAPEKNSMAIASGMCPVKGEFWVKVARRESEG

EGVEWAVEAREGSGMFNLMVG*

>CYP682E1  Aspergillus nidulans FGSC A4

           AACD01000079.1 revised 7/18/07

MLSLDLVFSFPAWALLLVLTLLYTLYLA

TTRLLLSPIR

HIPGPTLAALSFWPEFYYDVVQRGQYFRQIDKMHQTYGPLVRINPFEIHI

QDPSFYPVLYTGPTRRRHKWLWAARMFGNNTSAFATVRHEHHRLRRSALN

PLFSKSAIQRLTPHLQHTLARLCSRLDGFAFTRQDVDLGIGLTAFAADVI

TEYCFGQSLELIGKDNFGKEWIDMVSAPSELGHLVKQCPWILVVCKWAPKALVRALLPGVALLFQIQE (0)

RMSAQIQPLVDRAAAVDKPA

DPLTVFDFLLSSTLPQHEKTVDRLKGEGQTLIGAGTLTTGNALKTIIFHVLNDPDI

FRKLRAEVDGALENMDILSMSDTAYLERLPYLSACIKEGLRISYGVTHRL

QLIAEEPLIYSGVTIPAGTPVGMTSIFMHDNPVVFPQPREFRPERWFEAD

FETVQAMNRHFVPFSKGSRMCLGMNLAYAEIYLVLAVLFRRYEISLSGVT

REDIEMAHDFFDPAPKEGARGLIVQLQKRG*

>CYP675A1 AN4643.2 AACD01000079

similar to 532B 53 clan revised 2/21/06

MDLIVPNYFKYVNIDTLLLFPLALLVSLAYCIMWITYTRWFHPLAQFPGP

FWASVSRIWTVLHVLPGNAEKTQRKLHEKY (1)

GPIVRIAPDELITSDPAAVKTLYGVKSGTLKTDFYLAFRPPW (1)

ARFPDHFSAIGGKQH

ADRRRIVSAVYSMSSILQSEQYVDACIDLWEEKLGEMADRKESFDLWLWTRM (2)

YAYDVIGELFFSKMFGFLEAGGDHLGYIAATD

DLIPVQFLAGIMPTYVRPLFLLTGFLLPKVRGALTALASLTEATNATIKR

RLFALSELDSNTKPQRADILGKLLDISHKNGKALNFELADIKMESFSGF (2)

FAGSETTALTLSGILYNIFRNRAVYEKLTSEIDAAITSHQLSRPHIT

YTEATRLPYLGACIKEGIRMHPITGVSFPRHAPSCGCEVGGYWIPGNTRV

GVNPAVIHFDKSVFGEDAGIFRPERWIEAGANVANMDCHIMQFGMGARVC

LGKNISMCEIYKAIPQLLHSFTFEMGAEEPVKTTSYWFHKPVAIHVKVRRR*

>CYP539B2 Aspergillus nidulans AN4858.1 53% to 539B1 49% to 539A1 52 clan

revised 7/18/07

MSQMDPKIYLLLFLSPVLAFSGLILIYILTRPIRLFLYDRRFYLKGGIHAPMIPRDIIS (1)

VTRFFFAVVKAQNEHRLYEFFKKSLEHGD

PASPNCVESNIFGSFRVIQTREPEHLKAVLTGKFADFGKGELFHKLWIPF

LGDSIFTTDGKEWQGSRNLIRPMFIKDRISDLDIFERKTQT

MLSLYSPCG

EPTDVVDLFYRMTLDAITEFLLGKGINSLENPQADFALAFADVQRIQTLL

TMLGPAQYLYPRGRYNQGLKVINDFVWPFVHDTLGFQADDLKSSDKSFTF

LHALANYTRSPKTIRDQVVSILLAGRDTTAATLSWAFYELSHYPEAYSKL

RAEILDKVGPTRAPTYDDLKNMPYLRHTINEVLRLYPAVPYNIRFALTDT

TLPIGGGVNGDLPITILKGDAVAYSTYAMQRRADLYPPVSEKFADPAIFS

PERWEVWSPKPWHYVPFNGGPRICIGQNFALAEMGYTIVRILQRYERIEY

VGDWERQFHKSEIVGTPGMGVKLRLYEARKP*

>CYP619B1 AN5045.2 AACD01000084

AACD01000084 revised

MNSLPLLLAAASVGFLYVILTKGRREKGLPP (1)

GPPTLPFLGNLHQIPVKGSYLKFTEWASQYGGLYSLKLGTGTAIVITDPRLVKEVID

RKSSKYSNRPESFVAHTITGGSHLLVMQYGPLWRTMRKLVHQHFMETAVE

KSHIHVQNAGAVQMLRDFCVRPDLHMLHPKRYSNSIIMSLVYGVRTPSVH

TAHMTQLYEMMVRILSL

PFLCTQGMPTDRAFVLFQENW

SKVMEPGNTPPV

DIYSFLHYIPQKLFGNWLSRAKEVRDEMCQLYGQYLDLVVSRRKKIGSTG

SFMDTVLDQNEKLGLTRHQLYFLGGVLMEGGSDTSSSIILAFIHAMTKWP

QVLKKAQAEIGNVIGEDRMPAWSDYGSLPYVAATVKEAMRWRPAVPLAFP

HAAAEDDWIDGHFIPKSSTIIVNGWGMHHNEARFGNPSVFDPDHYKGQTA

LAPELANASDYTTRDHYGYGTGRRICPGIHVAERNLFLAISKLIWAFSIE

PGVDESGKVIEPDLDPRTGYSEGFLVCANDFPCRIMPRSEAKRESIMREY

QRAQEEVFSRFESPSS*

>CYP657A1 Aspergillus nidulans AN5137.1 similar to CYP8 27% to 641A1 cyp7 clan

revised 7/18/07

MNTIQGAYDGLQPKTLVLAAIYILICV

IIFTRILTGLQSYKKTDTAQPRRPRTAPYWIPWFGHSLSFARNHIEFLEN

TRHRLNETVFAIVMSGAKHNVVMSPSMIKSVLTFRGVTTAPLVQHVSRNI

LGDRGVFQKLNPSDRHVFVHNVPNQFMHEPSLSQTSGAAARFIERETPNL

VTFSAAPIDQMLWERPGDVTVIEGKGQQVCEVDFFALIRYFVGTVTTTSL

FGQAILDTFPTLLQDVWSVDDQFATLSMGPPRYLTPGISAAYMARDRLLD

ALAIFHQALLLWDEGKDLGMEFRDLRDLEDVSEPIKNRARMAKDMGLTPQ

ESAPAHLALLWAMNGNSPNIVFYHLLHLYANPTLLEDLRKEIAPFVKVSR

PTREETGFPILEAPRLSIDIDKLCDSCELLKASFYETLRLDSAGLSFRQL

TADLTITESEEEASKAGRLTPESYSLKNGELVIIPHGVIHNDPTHFSNPD

QFDPLRFIRTDPQSGQKYAKSETMTPFGGGMPACKGRAFAEKKILALSAA

IISLWQITPAEGKKFKIPEHRISSAAFLPKNDIRVRMSPRYPS*

>CYP58C1 = OLD CYP579B1 AN5360.2 AACD01000093

40% to 579A2 53 clan

revised

MTVAQWMRWEVPLLLIISFYLTRTVYRLFFHPLTRFPGPKITAATGLYEF

YHDVVRGGKFLWEIEQMHQVY

GPIVRITPWEIH

VKDPHFYDEIYTSARKCNKDPNFVGMFGSPTSMIATVDHGHHRFRRGILS

SFFSKRSIRDISPLIRRKVQRLMERLAEFYQTDTEVDLSAAFAALTADII

STYSYGESFDFLEDGSFHSEVRDAIMETEKLDHISRLFPVVLTVIRHVPV

WAFAIVKPATAVIAGIQKRVAEKSAKALKMTGSSKEEWTMFDALTDPKLP

ACERTMSRIHDEGMILLSGGTEPTANALTVAAFHMINQKDILTTIREEVR

ASGRDVKKASLAELEQLPYLTAVVNEALRLSHGLSIRSPRISPTEALTYK

SYVIPAGTPVGMSNYFVHMDPSIFPHPASFNPNRWIEASKRGEKLDRFIT

AFGKGSRQCIGINLGYAELYFALASFATFFDYQLHDTTEENVRVARDRGV

PFPEAGHLTCLWRMWPSEGMILKAQISPEFRQCLLIVATRKAYARNGSML*

>CYP673A1 AN5433.2 AACD01000094

29% to 57a1 53 clan

MALLESAVVLQVFRDVTPMAILATLLLTTFLTYVVYMRHFHPLSQCPGPF

FASLSNTYKAYYVYKLTIHEKLLELHNTYGPIVRVGPNHLHTWKGDAIAL

IYKGGRSMGKSEFYDAFTAFRPNLFGGRDEDIHALRRRQLSHGFAQVSVA

KLEPLIDGQMAILISKLRHYARTGQAFDLKHALNLYVLDILGEVAFAKAF

DVQNTEDNEKLHAINDHLLLAGVIGELPCQNFTKFLSRLSPVPWMRRLMK

SRNKLKEICAGCVRFKIENLEATKSRPDLLRSLVEATDPESGKSVAGSHS

TAGTLTLLFWHLIQNPSIMRKVQAEIENTLGPLKDRTSYPIAGIESTLKY

TMACVRENFRINPVFTMPLWRRVGKSHVLEIDGHHIPEGTNICISNYVLH

HNPSVFGPDHNTFVPEKWLDESYNREKGRYLIPFSVGHRMCIGRNLAMTN

ILKSVCTLATLFEFEPVEKKKDVRVISPGIGEMKGGFEVRVRVREVKRGS

YKNALST*

>CYP539A4P AN5478.2 AACD01000094

Cterm only first part like CYP52

56% to 539A3 52 clan

PSEUDOGENE

LSAKGIDCAVRAVYQLLNYNFVEWTQNVLEENGRTVELHLAGARLVLTDDCENVKAIMFS

GKGKFTHEVFASVFGDSVFGS

LNRCGTRSPPSAKALKDLVFLKYVIRETLRLY

AMQDPVAITITSALFELVRHPEIAQRLREEVVRV

VVGFNIREAQRDTTIPIGGGPNGDLLITILKGQHVAYSVIGLQRRPDIVGPDADNWRPDGY

310339 MGTFHWAPQTWEFIPFNHGPRICLGRVFGYFQMEYTLCRIFQHFERVE

LHEPRVQRIKVELNTKMAYPVNCSFHRAVY*

 

VNCRNNEEACWLIIGCSPACALYIDPTRILGF

PTNGSLPSFHLLLSSLNAKPFPTLVDMEASKPLGAFSRLNSQIYQSKLPE

ADILLIQPVVGDMVWTPEYAQLQHLGPAVTAIDAFSDTRSDQSHRLVVHA

FSNAGSHAAVQLAEAYTAVHPSASLPVTGLILDSCPGAPSAILSANAMIL

ALPKSPLVRLLGAVLIYSVVATVALLDFLRLYQNVISKTRHVLNSPSGCF

LRHGVGRTYLYSRTDAMVPWTDILDHAGEARKLAESGDDLVQTVEFTGSG

HVGHLAVAGEEYTKAVLSVATSRE*

>CYP5080D1 OLD NAME = CYP532D1 AN5553.2 AACD01000095

43% to 532B2 53 clan

revised 7/19/07

MLSSLLSLPAILSFFLALCIIQLVRSLAKSPYGSIPGPALARFTNAWYLW

QMRRGDFHRTNIKLHQQNGPVVRIAPEYFSISDPSAVKPVYGHGTKFIKS

EWYKAWNVTPDPDQTNLFSEQVSQRHAENRRKVASMYSMSSLVAYEPYVD

NCIAVFKQRLNEISVQGKTVDMAHWLQCYAFDVIGEITFGSRFGFLDAGN

DVGGVMKSIEDGLAASSYLGLYPWIYPFYLRVLGYLRQGLSYMNEFSLLH

IQETRAAMKGSHKDLPSYMAVKLVQAQTENPHRISDWDILATVGANVGAG

SDTTAISLSSTLYHLYRNPGCLAKLREEIESAGIGTVIPAFKSTQEMLYL

QAVLKEALRVHPGTGFPLFRVVPKGGQVLAGQFFPGGVNVGINSWVLHYD

TNIYGADASIFRPERWLEADEEQLKTMEQNYMPFGIGSRTCLGKNISLLE

MGKLIPVLVRDYDFDIQGEGDLEARNRW

FVKPVDFWIKVTKK

>CYP531D2 AN5665.2 AACD01000098

52% to 531D1 39% to 531A1 53 clan looks intact

MTGVLLAGANASLWMQIPVVFAVLLLSKLIWDAFFSSLRVFDGPLPAKFT

DIWRAWQAFDGHIDRTYTKLHRKYGSVMRIGPNALSISDPSMIRVIYSTR

NPWKKSEAYRPNDVVLNGQRVSNLFNTQDEKWHNQNILPIRHLWQMTKVL

EYEPLIDKTLNKFVDKLAARFGGGEVCPADEWIGYFAWDVTANFSFGRHY

GFIDQEKDVDNLITDSTKGLIYFAPVSQIPWIDHLLDKNPIVRIGPKPTL

TGVLYAFKVVAEYQAQLNSNKVKPGNVDHTLDKYVQLKKTHPDVVNDVQI

VNWLMLSILAGGDTSSATMRATVYYLAKNADAYKKLVAELTTANLTMPAQ

WKDIRELPYLDAVIRESMRINPGIAMNFERVAPEGGYTLPDGRYIPAGTK

VGINPAVTNRDYAIFGEDSDSFRPDRWLKRDGESDEEYQERHKRMHDTCD

FVFGAGARVCMGRYLAMLEIKKLIATLYSTFDLHLVDPKHEWTYRNAWFV

YQQNMPMIITRRKLSA*

>CYP59C1 Aspergillus nidulans AN5766.2 44% to 59A1 586clan?

Revised 7/18/07

MAVTNLVLTLSIPLLTVIGYGLYCGFQHRRKINELRKRGIPMPKDWSWLT

GHLLSLKKYTDRLPADAHVLLPTHELAVEFADTEMFLMDTWPVFPALVMV

YDPDAALQISTKYNLPKSAIFPSLMHPITGGPSMISMNDAEWKKWRSIFN

PGFSAGNMVDQVSTVVDSVQVFCDILREKAGTGLVHLDDLTTRLTMEVIL

KVTLDMDSNYQRSDNEMVHALNTITKWHSFWDPRVRANPLRPLVQKYYGR

VMDRCIRKELDKRFAEMQQGQRSASTSKRVKSVIALALEAYLADYHQKDG

KASKLDDNFAQYATHQIRLFLFAGNDTTSSSIVYVYHMLSKHPKALARVR

QEHDRIFGTLPSAAPQLLKSNPALLNQCPYTLAVIKETLRLFPPASTTRE

GRDGVTLTDRLGNSYPLGHTIGAEIIHPTIHKNPRLWPQAEEFIPERWLV

DPGHELYPSPAAWRPFEHGPRNCIGQTLVYNEMRIVIVMTARTFNIRPAY

DEWDAMHAAKEGLL (0)

TVHGERAYQTEKAGTHPADGYPCHVALCSGSPIS*

>CYP630B2 Aspergillus nidulans AN5837.1 60% to 630B1 53 clan

revised 7/19/07

MITLTYAAITGLLVLVYFVIWPVFEYFRDPKGLRRYPNMSIFSGISAIP

FMLMASRKFRSKELQELHKKHPVLRTGPNSLSYGDVRAIKDIYGHNTRCG

KDPSYIVSAGSHYHLADVIDRADHSRKRKVLSSAYALKNLETWEHKVSDK

IARLVKHFDSVCTAPLPAGQEEPDPADLTVDFRAWTNFFSLDAIVDIGLS

EKLGFLDQGHDMCTAERKDGTTYRASLRDALYPNARKQSLLLWNYDWYPI

INRWVNIIPYFAKMQKSSDTWEDIVWHHAMQRRRRYEAGEKLEDFFSALM

EDKAGHPLGLEWGEVCAEINIMMNAGSVTTAIAITNVMYQLLRNPQCLAT

LREEIDSVYDSEDEVVASYDKVKHLPYLRACLDESLRIFPPTSHGLPRET

PPEGMEILGQWVPGKTSVSMSAYVAHRDETVFPEAYLYKPERWLGEEGKA

LQPYFVAFSAGARSCIGRNISYLEQTVILATLVRR

YEFALPSKDWELQREETMNLILGGMPVKVWRRQLDGDA

 

>gi|29570953|gb|AACD01000100.1|  Download subject sequence spanning the HSP Aspergillus nidulans FGSC A4 chromosome I ANcontig1.100, whole genome

              shotgun sequence

          Length = 337251

Score =  586 bits (1510), Expect(2) = e-170

 Identities = 292/494 (59%), Positives = 351/494 (71%), Gaps = 20/494 (4%)

 Frame = +3

 

Query: 8      ASTALCLVTYFILYPIFQYLRDAKGL 33

              A T L ++ YF+++P+F+Y RD KG+

Sbjct: 124927 AITGLLVLVYFVIWPVFEYFRDPKGM 125004

 

Query: 32     GLRRYPNFHPLAGVTNLPFVREAARGFRSKTLYEMHKTHPVIRTGPNSLSYGSVQAIKDI 91

              GLRRYPN    +G++ +PF+  A+R FRSK L E+HK HPV+RTGPNSLSYG V+AIKDI

Sbjct: 125046 GLRRYPNMSIFSGISAIPFMLMASRKFRSKELQELHKKHPVLRTGPNSLSYGDVRAIKDI 125225

 

Query: 92     YGHGTKCTKGEFYETLAGTHYHLADVVDKADHARKRRALSAAYALKNLENWEFKVADKAE 151

              YGH T+C K   Y   AG+HYHLADV+D+ADH+RKR+ LS+AYALKNLE WE KV+DK 

Sbjct: 125226 YGHNTRCGKDPSYIVSAGSHYHLADVIDRADHSRKRKVLSSAYALKNLETWEHKVSDKIA 125405

 

Query: 152    RFIRAADAACTLPLKRGFARPGPEDLKFDYRAFTNFFTLDAIADIGLSERLGFLDQGHDL 211

              R ++  D+ CT PL  G   P P DL  D+RA+TNFF+LDAI DIGLSE+LGFLDQGHD+

Sbjct: 125406 RLVKHFDSVCTAPLPAGQEEPDPADLTVDFRAWTNFFSLDAIVDIGLSEKLGFLDQGHDM 125585

 

Query: 212    VKGERMDGSIHHVNFRECLHSTARAQSILAWTEKWY---NANVKLSKLFSKDFRKWWNLN 268

                 ER DG+ +  + R+ L+  AR QS+L W   WY   N  V +   F+K  +     +

Sbjct: 125586 CTAERKDGTTYRASLRDALYPNARKQSLLLWNYDWYPIINRWVNIIPYFAKMQKS----S 125753

 

Query: 269    EGWNDIVYHRATQRLERYNKGEKLPDFFQALMDHSEANPPGLEWGEIVAEVSIMMNAGSD 328

              + W DIV+H A QR  RY  GEKL DFF ALM+    +P GLEWGE+ AE++IMMNAGS

Sbjct: 125754 DTWEDIVWHHAMQRRRRYEAGEKLEDFFSALMEDKAGHPLGLEWGEVCAEINIMMNAGSV 125933

 

Query: 329    TTAIAMNNVMYWLLKNPSCMAKLRQEVDSVLDPE-EVVAPYDKVKHLPYLRACLDESLRI 387

              TTAIA+ NVMY LL+NP C+A LR+E+DSV D E EVVA YDKVKHLPYLRACLDESLRI

Sbjct: 125934 TTAIAITNVMYQLLRNPQCLATLREEIDSVYDSEDEVVASYDKVKHLPYLRACLDESLRI 126113

 

Query: 388    TPPTTFGLPRRTPPEGWNIMGDYVPGDTTVSISAYVAHRDPHIFPDPESYVPERWLGEKG 447

               PPT+ GLPR TPPEG  I+G +VPG T+VS+SAYVAHRD  +FP+   Y PERWLGE+G

Sbjct: 126114 FPPTSHGLPRETPPEGMEILGQWVPGKTSVSMSAYVAHRDETVFPEAYLYKPERWLGEEG 126293

 

Query: 448    KDLQSYFISFSTGARGCI----------------VHRYEWALPYAKWEPSRTEAMNLAPG 491

              K LQ YF++FS GAR CI                V RYE+ALP   WE  R E MNL  G

Sbjct: 126294 KALQPYFVAFSAGARSCIGRNISYLEQTVILATLVRRYEFALPSKDWELQREETMNLILG 126473

 

Query: 492    PMPLKVWRRDLGGD 505

               MP+KVWRR L GD

Sbjct: 126474 GMPVKVWRRQLDGD 126515

 

 

>CYP52G1 AN6057.2 AACD01000104

38% to 539A1 46% to 52F1 52 clan

MLFLSVLLAFAAYLLIYQYAMTNWNHARRARLWGCSPLPRYPTDILGLAT

LRESLKADKEKKIPLLLQNRLKRMSAREKRPVTTFVIRQMGLDNIFTCDH

GNVQAILATKFKNFELGVGRRHTLYPMFGVGIFTSDGETWSRSRALLRPQ

FTRDQISDLDLEESHVQQAMRAMNVDPATGWTSSIDIQAIMFRLTIDSAT

EFLFGESAGSQAEALRNGGTLPLNHFSGDFDLGQWYVAQRSRFEKFYWLV

DNRESRAVVKRVHEYVDRFVHAVLTTAEDRIEKSQSSSYVFLEALAASTK

DPIELRSQLLNILLAGRDTTASLLSWSILMLARYPEVFTKLRSVILADFG

SYTSSRDKITFASLKSCRYLQYFLNEVLRLYPAVPINRRVATTATTLPKG

GGPAGDKPIYLRAGQVVTYSPFVTHRRTDLWGEDAEVFNPERWVNKKVGW

EYLPFNGGPRVCIGQQFALTEAGYVIVRLLQRFDAIMDCFPEREIRYGLT

LTLAPADGVFVRLHAAE*

>CYP671B1 AN6101.2 AACD01000104

34% to 628A1 53 clan

revised AN6101.2 AACD01000104

195432 MNSLLFREALQHASSTDISKLLLSAATLGVLSHVSLFRSLPVEEYLYGLLGLYTATVVAVTVLYLTAT  195635

195636  AFSP LQVLLRVGCISAAFNTGLASSIAIYRLFFHRLRRFPGPRLSKLSRFYDAYLAGKGL  195815

QYHVEIAEMHKRYGDFFRT ()

GPREICIVRKSAVPLLLSPQSKCGKSTFYAQAQTEAEYC

NVHQTRDFEDHRRRRKAWDRGLSVKALATYEPSIRAKADLLVLHIEKNRG

RAIDATKWSMFLSFDIMGKVGFGKEFNNLSTGVEHPGIKAIHDHMAILGV

MCHVPWLLNLISNLPGASFSMAEFFKWCEDEIVQKHRSWDIKETPQDITS

WLLKAYVHKEVSAAPTANALHEDSRAVIVAGSETTATTLASILYFLCKNP

EILAKLQLLLDEAMPGGSSEWTYDKIKTISYLDDIINETLRLRPAILTGG

YRVTPAEGLQVDEVYIPGDVNVFVPTQLIQTDERYYVDAKRFVPERWNEK

KEMIQDGAPYFPFLYGPYVCPKKNLALMSLRISVSKLAQLYDIHFAPGEN

GELFETRTLDTFTTTLPPLHVQFLSR*

>CYP619B2 AN6131.2 AACD01000105

86% to CYP619B1 42% to 619A1 547 clan

AACD01000105 revised

MNSLPLLLAAAFVGFLYVFLTKGRREKGLPS (1)

GPPTLPILGNLHQIPVKGSYLK (2)

FTEWASQYGGLYSLKLGTGTAIVIT

DPRLVKEVIDRKSSKYSNRPDSFVAHTITGGSHLLVMQYGPLWRTMRKLV

HQHFMETAVEKSHIHVQNAEAVQMLRDFCVRPDQHMLHPKRYSNSIIMSL

VYGVRTPSVHTAHMTQLYEMMGCRLTMRPSSFQERWSKVMEPGNTPPVDI

YSFLHYIPQKVFGNWLSRAKGVRDEMCQLYGQYLDLVDSRRKKVGSTGSF

MDTVLDQNEKLGLTRHQLYFLGGVLMEGGSDTSSSIILAFIHAMTKWPQV

LKKAQAEIDSVVGEDRTPVWSDYGSLPYVAATVKEAMRWRPAVPLAFPHA

AAEDDWVDGHFIPKGSTVIISGWGMHHNEARFGNPSVFDPDHYKGQTALA

PELANASDYTARDHYGYGTGRRICPGIHVAERNLFLAISKLIWAFSIEPG

VDESGKLIEPDLHPTTGYSEGFLVCANDFPCRIMPRSERRRETIMKEYQR

AQEEVFSRFENISS*

>CYP656A1 Aspergillus nidulans AN6321.1 related to CYP52 52 clan

MSAVLLGKRYVSTPDPENIKAVLATKFVDFDLGERNAAFRPLLETGVFTQ

DGREWERSRALLRPIFNRAQALPDLLLIEEHVQSRLYRIPRGYDIVNLQQ

LVRDLTLDSAFIHFLA (1)

GRPAKIAGSRRGDFDAEPFSHAFDEARSYLQVRANLGPFRGLVKNTKFVD

DVIVHAAVDEFVYEALEQRRSPAHENRGKLGRGCGN

ESESEGWYDLLSKVADTVSDGVQIRSQLLHVLLAARDT

TARLLSSVFYMLARHPSVWRKLEREVLVEFGLATQGDGKCPLPTYTQLRE

MKYVRAVLNE (1)

ALRLLPPVPTNIRCATQHTFLPRGGGVDGCQPIFVAKKAIVHYS (?)

AEQFRPERW (2)

VPLRRGWGFLPFSGGPRICLGQQKALTEAVYVVVRMVQTFCDIEARDERPWREQMG

LVLSSYYGVKVGLKSRNGGS*

>CYP552E1 AN6407.2 AACD01000108

AACD01000108.1 Aspergillus nidulans FGSC A4 revised

MDFLMEYGSPAGFFTIFATL

WLVYCLLRMLYNVSPLHPLSHIPGPNLAAATFLYESWFDLVLGGKYTHKIKRMHEQY (1)

GPVVRINPEELHFNDISFANEIYAGPGRKRNKQVHYLNIFAGPTTSS

MLATVEHGHHRVRRSAVNRFFSRAQISKLESNIKDLALGLCDKMIRL (1)

AYSCFSGDVISKYCFGEPFGFIAQEEWEPNYRNALKATQAPVHVFR

TFPFLKRLTDIAPLCARWASPGIREMLIESNEKMPARIRKARQDSKRGIT

ETQPSLFAALLDAPLPEAEKTDQRLGGEGFLMIAAGTETTAWTLTVITFH

LLNQPDTLNRLRCELQDADALNLQWFALERLPYLTAVIHEGLRLSYGVSQ

RISRIAPTETLVYQGEHNGRRIEYSIPSGTTMGMSNAINHHNEDAFPDSD

AFIPERWINIDDAQRRRMDSCLTPFSKGSRQCLGINLAYCNLYLALTALT

LRVLPWMSLYETTVDDVRYHSDLFAPLPKKGTKGVRAIISYP*

>CYP62C1 AN6414.2 AACD01000108

49% to 62B1 53 clan

revised

MMERSWKYIAIACALWVVQ (0)

IYSAITSPLRAIPG

PFYTSLTRLPLKLSIIAGQRIYFIHSLHQRYGPIVRVSPTEVSIASLPEF

REIHRVGSPFLKSNWYEKFVMGQHSPGVFAISDPKQHGARRRLFARAMSN

TELRRVWEDVVRSKVRLAVDRIKGELEADGARCDVLKWWTFLATDVVGHL

MFGEDFDMLNIGVKNEYIHVLESTMKGSGINAELPLVGCIGRHLPFSVVR

SMFRANDYLTNYGKRAVTNARAKSDSSRNIFSGMLYEAEKCTDSDSGLSE

LDIITEAGNMIVAGSDTTAVTLTYLVWVVLSRPQLQREIESEVLALEEGY

DDAKLETLPVLNAVIKETLRLYGAAPGSLPRTVPRGGATLGGYFIPEGMT

VSTQSWTVHRDENLFPDPDSFNISRWLEENDAGFPAAQLAFSPFGAGGRI

CLGIHLAYMELRLAAAEFFRRCRGVRLSPDTTWKIMKPMNYFLIAPTGNR

CDIMRG*

>CYP672A1 AN6434.2 AACD01000108

31% to 567B1 53 clan

MSLVMAVPHAFSVSDFGDIPTVLVSALSFILVSVWIKTSIDISQLETKLG

FLSGRSAYKFNSLHKKYGKIVRFAPNQLSFNTIKGMRNIYGAGLGKSNTF

LKTGFYKAISRRNIFTATDPYYHATVRKLFSPSLSPGCMAAHEPVIKGCI

ARFHALVKQRMQSQKAISLNDLYYSLSVDMVSEVLLGKSLGCIERGRPFF

WTEQLPRIFYWATIRDQFKGSGVPTLIKWMLRQILRKGIRQRSEEARMRL

IREQLKATHTRRDVMVEVLERADSSTLPEDEIAENFSAIMLAGFHTTSHA

ICATIWLVLSHPETRERLQNELRTAFQSTDEISLDVLAKLPWLNAVITEA

LRVYPPVPLGGARISPGAYVDGFVAFLTGPQVEVSTSLYALHHNGEYFKN

PYKFAPERWVNPESTDRKEAVQPFLLGSRSCIAKYFAQQMLLLTLASFFV

EFDGQYVGKVKDWTTESRCYAFWELPELKVQLQERFASAEVSE*

>CYP5077A1 OLD NAME = CYP532E1 AN6449.2 AACD01000108

42% to 532A2 53 clan

MAILVRLFFALFVVSVYFFRVRLRLSHIPGPFLASLTNINRRQWVTTGRA

HTIHTELHRQYGKVVRAGPNTVFVSDPAAIPAIYRFNEPYQK (0) SEFYDALMPYVRGKSIPDVFATRDEHIHRTMKQPIAAIYSMSNL

VSFEPYVKSTIEYFFSRLDSLFVETGKVCNFGLWLHLFASDVMGEITFSR

RLGFLETGGDMENVMANNWKFFVQAAPATQMPWLDYFWKRNPLLPGSVKP

NKVIEFGVARIQERLHL

SEKHPDHVNSRDFLSRFIAAKEKNSQIGPDAIM

TWANSNIQAGSDTTAILLSALFYHLLKNPTSLAALCTEIDAAAKRGCLSS

ILTWKETRDLPYLDACVKEAARLHPPISLPLERVIPESGTVIGGFKIPGG

TRVAMNPWAVHRDRDVFGADADTWRPERWLEGEEKAKTLYNSLLTFGGGH

RSCLGKNISYLEIYKLVPSILLRYEIGLAEPEKEWHLENRCCWTKLGTIR

LVSRFLG

 

>CYP65U1 Aspergillus nidulans AN6466.2 37% to 65B1 53 clan

revised 7/18/07

MGVYLFSSSLWATLLLAILIYRLVRITYNLYFHPLSGIPGPSAWAASRLP

FVYALIRGTIIQDFQKLHEQYGPIIRIAPNEVTFAHPEAYTDIFQPRPEK

SQGQFLKDPLWWARQPGHPDSLLSVINPERHAQMRRVLSPGFTARALRKQ

EPFVQKYVNLLVAQLQDLVSKSPSAHINMTPWFNYTTFDIFGDLGFGESF

DCLQHSRYHPWIALLFDSVKAAGFVIATRYYPLIEAVLLKCVPPSMRKIQ

RDHYQQIVDKVQRRLGWELQRPDFMSYVIDERGGLRLDAGELYATFMILT

TAGSETTATALTGTLNYLVNHSPESLQRLENEIRGAFSGLDAITLDAVRN

LPFLNAVIQEGLRLCPPIPWVLPRLVPQGGSMICGTWLPGGTPVSIQAYT

LNRDPTLFNRATSFLPERWLASSTSDSSSCFFNDQRQVVQPFSTGPRACL

GQHLAWAEMRLILAKLVWVFDFGAIDGQGVNWEDLRTYLLVERKPIN

VRISSRTV*

>CYP678A1 AN6485.2 AACD01000108

poor match 53 clan

MNYVAYIPLLAIALLAWVIIRRLLFNPLLGIPGPWTARIFGFYEFYHNIW

RDGEWCKTFPELHKRYSSPVVRIGPNHVHINNIEAYEHIFRLGTDFYKDE

SFYTCADNHGSVFSLSDRDDHRERRKVLAPRFSKQAAELAAPKIQARLQD

LVQFMVKQSRKGEGCNITDLFRAVAINWVADVFLGDCGDWVNYEARKLDM

LEDIDGLSALIPTLRFFPYLATLNSLLPSSVVNYLTPSAVAGFKKICKDH

TRPLLNTPTKEMARRTEASVAELLIFHRLENTGKPPTLDYLAEEAFAFID

AGVDTTGGTLVTALYHVLKSPEILRKLRKELDEAMRRQAKSTDIDPRKLG

ELPYLNAIIKESHRIWPAIPGPLPRVVPPAGINIGSYFIPGGTTVSATHH

SLHYNETIFPEPHKFNPERWLKEEKSEGGRYLNPYSRGTRACIGINLAQI

QLRLTLTHLFGQYELELCDPVPSRHEWKDHFVAHPKEPIFVKFRERKGQV

ESVVQSGDEEGRGCKTNFVM*

>CYP682C1 Aspergillus nidulans AN6787.1 34% to 579A1 35% to 58A1 53 clan

revised 7/19/07

MELLRLLLDHPYAVAGAAVSVYIASIVIYRLYLSPIAHFPGPRLAALTVM

YEFYWEAIRHGKFTFHIGELHKKY

GPIVRISPTELHVNDPEYYEVIYSRDSPRNKYPYYQRTFNAPYAL

ITAEDHYRHRLLRSQLNPFFSIQRIRQLEPTLKALVDKLCRRLEELKGTG

QPIDIEYPLTCYTTDVITDYTMGEGGYHYLDEPDFIPQWQHMLCGTAKTL

VFIRPIAFLLPVLVAMPEALTAWLNPGMELFFAFQHRCRKRIAEITKRHR

ENGPLETKDGRQNLFDNVLNSNLPEQEKSEARLAQDMQVFVSAGAETTAK

AMSYIMFYLHNEPALLQRLKDELAPLGNDPSLVQLEQLPYLTSVMLEGLR

LSYGVTARLPRIAPYNALKYKDWTIPPGTPISMSCLLMHHDESIFPDSYR

FNPDRWMDPTERKHLEKYMVAFSRGSRMCIGMHLAR

SEILLVISSLLRRLNFELYETTVEDVRVAHDIFIPFVKLDSKGVRFLIK*

>CYP505A8 AN6835.2 AACD01000113

55% to 505A1 505 clan

MAEIPEPKGLPLIGNIGTIDQEFPLGSMVALAEEHGEIYRLRFPGRTVVV

VSTHALVNETCDEKRFRKSVNSALAHVREGVHDGLFTAKMGEVNWEIAHR

VLMPAFGPLSIRGMFDEMHDIASQLALKWARYGPDCPIMVTDDFTRLTLD

TLALCSMGYRFNSYYSPVLHPFIEAMGDFLTEAGEKPRRPPLPAVFFRNR

DQKFQDDIAVLRDTAQGVLQARKEGKSDRNDLLSAMLRGVDSQTGQKMTD

ESIMDNLITFLIAGHETTSGLLSFVFYQLLKHPETYRTAQQEVDNVVGQG

VIEVSHLSKLPYINSVLRETLRLNATIPLFTVEAFEDTLLAGKYPVKAGE

TIVNLLAKSHLDPEVYGEDALEFKPERMSDELFNARLKQFPSAWKPFGNG

MRACIGRPFAWQEALLVMAMLLQNFDFSLADPNYDLKFKQTLTIKPKDMF

MKARLRHG

LTPTTLERRLAGLAVESATQDKIVTNPADNSVTGTRLTILYG

SNSGTCETLARRIAADAPSKGFHVMRFDGLDSGRSALPTDHPVVIVTSSY

EGQPPENAKQFVSWLEELEQQNESLQLKGVDFAVFGCFKEWAQTFHRIPK

LVDSLLEKLGGSRLTDLGLADVSTDELFSTFETWADDVLWPRLVAQYGAD

GKTQAHGSSAGHEAASNAAVEVTVSNSRTQALRQDVGQAMVVETRLLTAE

SEKERRKKHLEIRLPDGVSYTAGDYLAVLPINPPETVRRAMRQFKLSWDA

QITIAPSGPTTALPTDGPIAANDIFSTYVELSQPATRKDLRIMADATTDP

DVQKILRTYANETYTAEILTKSISVLDILEQHPAIDLPLGTFLLMLPSMR

MRQYSISSSPLLTPTTATITISVLDAPSRSRSNGSRHLGVATSYLDSLSV

GDHLQVTVRKNPSSGFRLPSEPETTPMICIAAGSGIAPFRAFLQERAVMM

EQDKDRKLAPALLFFGCRAPGIDDLYREQLEEWQARGVVDARWAFSRQSD

DTKGCRHVDDRILADREDVVKLWRDGARVYVCGSGALAQSVRSAMVTVLR

DEMETTGDGSDNGKAEKWFDEQRNVRYVMDVFD*

>CYP670A1 AN7066.2 AACD01000118

29% to 67A1 34% to 628A1 53 clan

MDDFKIYYYASAGAGIAGILSHLVYFIRGEHHQYAHRWITRALAGTAAVA

IATLRLTDWQPLLSLILTALISTSYFLGLYSSIGIYRVFFHPLRRFKGPF

WARASNLYHMYIIRKSDNYLVMKKMHEKYGPIIRTGPANLSVNDPAAIPL

VLSDRATCVKGPWYDRSLPLVNLHTVRDKRVHDARRKVFTKAFTPSALRE

YEERVAVHCEEFVRQMTRLSGKPFDASEWFKYFAFDVMGDLGLGREFHMM

TSETNRWIPTLLETSMAHVGPTSPVPWMAPILHNLPWAGRGARAWLEFVG

SQVKERTQKKSDRRDQILSHLVEAYNQSEKKNIDYQWLRGDTRLTIVGGS

DTTAATLTFLFYHLAQNPSHVDKLRAELEPLLNGQPRLDPKDVSKAQHLN

GVIQETLRLHPAIPSGFPRTTPPEGITINGTYIPGGTTIVIPVYALQHDE

ANYTHAEEFIPERWYSRPELIKNRDAFLTWNIGTNGCIGRALALTEMRNL

VTYFIHHFSRVKFAHGEDGKALLTETKDHFTVGVKPLRLIFEK*

>CYP52H1 AN7131.2 AACD01000121

45% to 584B1 52 clan

MWSPFLEVAKALREGHVVEFITQKYNEYGWTFEQNVLGRSGISTIEPENL

KALLATQFNDFCLGTREREFGPLLGQGIFTLDGAGWSHSRALLRPQFTRD

QVADLDLMESHISRLIELVPKDGSAFDIQRLFFLMTLDSSTHFLFGESVH

CMDEGNVLARSTVNNAQGFANAFNTALDYLNWRSVAGNFYWMITSKEFRD

ANKRVHEVVDYYVHQAIEAKRHPEKKEPGRYIFAEALAADNDNPKVLRDN

MLNILLAGRDTTASLLSSAFFYLSRHPAVWEKLRRVIIEEFGDVQNPKGE

ITHAKLKDLPYLRYVLNEVLRLQPPVPLNLRVAVKDTSLPVGGGPDGKSP

VFVEKDQPVLYSVYAMHRRKDLWGPDADSFRPERWEENAKHGWEYLPFNG

GPRICLGQQYALTEASYTMVRLMQRFSKVENGEPGLDEPLIRATLTMSHE

NGVKVRFKLQHVRRKPSPLQTCTR*

>CYP5078A3 OLD NAME = CYP532C2 AACD01000128 AN7359.2 AACD01000128

62% to 523C1 41% to 532A2 53 clan

MPTTLSTLQSSLPLPLPVLAIIALFLLRFIWRRFGSGLRGIPGPALAKCT

RLWKLHSVWKGDHHLTEINLHRQHGPLVRIGPRHVSVADPKAIPVIYGLN

KGFTKTGFYPIQCISWNKKPQMNLFSTRDEQFHRDQKRPVANAYSMTSLL

ELEPAVDSCTAIFLSRLRDFAGKKRPVDLGTWLQYYAFDVVGEFTFAKKL

GFLEEGRDVDDMMAGIQGILAYASLIGQVPEAHKVLLGNPLMPILMPSME

SWNQVLQFTLKQVNSRTSLARDGELDKGDLEEGKDMLSRWMAIHVADPEK

MSTRDVIVHLSTNVFAGSDTTAIALRAIMYFLLKNPDKMEKAVGEIEAAD

SAGRLSSPISYKESMTHLPYLGAAIKEAMRLHPSVGLILERHVPEGGVTV

CGRYIPAGTTVGINAWALHHDEKVFPSPGAFMPERWLESPPAKLKEMEQS

FFAFGAGSRTCVGKNISLIEMHKIIPQLLRDFTFRLHRPGDEWKTKNAWF

VQQEGLVVDLERRR*

>CYP663A1 AN7399.2 AACD01000128

35% to 546B1 64 clan

MTADIKTLLLAALGAVAVAWLAQSFGKRSSLPLPPGPKPALLIGNIHQLP

KSLQWLHLYHLSKEYGPIMHFSMAGQPLIILSTHQVAHDLLNRRSGRYSD

RPRMVMAGELVTKNMHMLLRPYDERYKLHQRMEAPLLVLRSASNYRPLQD

LESQQLLFDVLGEWDKFGEKGVDFHHHFERAMASTIYCLNYGYRLQTGYE

KELMDGKKVQAEFARTGQVGAYLVDSFPSLNYLPKFLAPWKKEGEGLYEL

ERQLHVGNLKKGLSNRGWNFTKYMKDSPEAVTMPEEELAFDLGILADAGL

DTSTVALDWFIVAWITSGSTWVKKAQQLLDEVVGKDRMPTFEDRPKLAYI

DAIASETLRWRPVVVSGVPHFTKVQDEYMGYHIPANSTVLPNAFAISHDE

SIFGEDVDSFIPERWLAEDPPSEPSIDACGFNTSALKDLPHIGFGWGRRI

CTGRFIARNQLFIQMARMLWAFDVDAGVVDEKTGRRHNVDDMDCTEGFVT

LPKPFRAVMRPRGEWVRQRILERGTTHGLDHAKILQNAKLGRS*

>CYP65T1 AN7522.2 AACD01000129

38% to 65A1 53 clan

MPLTLSLILWPLVGFCLYVAIITTWYTLFSPLRVIPGPKSWTFFPILRHI

SAILGRFDTDMRRFHAQYGPVVRFGPREVSFITADAWKTIYGHGHTQLPK

YMHSAADPQSIISTNDTDHSRYRRALSHAFSARGLQEQEPLIQSYVDKLI

VRLKGVAESGRPEDMVKWFNLTTFDIIGDLAFGEPFGGLDSAEYHHWVST

IFQSIKVNPFILLKDNYPMLGWLLLRAFVPETLRQAKKRQIEHSRVTVQK

RLSSDIHTRPDFMDSMLRSRHYTYNQNDWKKAPDALTDSEIVSNSNILII

AGSETTATLLSGVTYWILRNPRVLSRVVCEVRSVMKSEADITVQKVSTEL

PYLLACFDEAFRLYPPVPTGLQRRTLAPTFISGYEMPPGTIVSVHQSGAY

RSESNFHLPNNFIPERWLPDAKTNPSSQFYHDNRAVVQPFSVGPRNCIGR

NLAFAEMRVILARVLWNFDLELCKESENWSDQKSKLWAQPDLATEEAIRL

H*

>CYP53A3 AN7589.2 AACD01000129

64% to 53A4 53 clan

MMAEPSRPATARFPPSRQVRGTRLNTIIEDARETQYADNRGPSPTDNGPK

SPTPRLKLKTTGLSLPLVRQQRKFLSPLSAGSVSSCSDVDWQNQMRTFDE

LYDATDDESDFSDECMSFTSTRPTSLTTPTTRADSVTSSNSRRRYPALSI

PTSSIWPSLNGAPKSSPVPPTPPQRIPVSPAALSLLSRSVPAMHATPSLD

GSVSSDQVSNLSTPSTPSLRSLPDTDWNSREIHVLPDLDDSQHPNIANPE

TEEVPSIEIPIEDADDDWRRFIGEFPQIPGQTTSQAGYVGVEPAREDTPS

DPGVALPEGALATLQFIPLEGTPEPWSETSEPNEEMWQVAAPPEPRRLDD

ETPVSELSEYSFTGLSIPSPGGFFNSLAPRARHTWSLPKLNQPPTSATAE

RFYNLPFNREEGEIIEQVIDLPERLNDEQLTAIYAPPTAIKIPESPAHPP

TEGSISPVSERVHEISRPATAYDPDEQDENYAEELHKKALSSLDRTSVWL

AAQASYLAALRETNPVNNLPDEDERPQDVDESPQHVSPALERNASVCFTG

MFPEPPSSLPAANASKDSIYWRGFRFLLDQSRSRDTFVHRSTRFDAVQSF

RLGLSGLHNKCLLGNYELVLPDRPAYSGPFAKAPRHSVLPGILQQKAEFS

MIEKEQLVLSQISQPMWAMEALRYLQGGNLVVSPARKRFSKRATAAAPHK

TPKRRQVRVLDLGGHATAEWAWHLAHDYPHVKVYTVYTEHQQVNKAIKGP

PNHRHIQVPQLWKLPFPDNKFDVISARSLPAFLKTERPAGDCLDEYDLCL

KECRRCLKPGGYLEYLVMDAEIARAGPYASATSIEFSFSLKIRGYDPVPT

KQFVGRLRKQGFVGIKRGWMYLPMGTEPPKPQVPRETPDPRVKSLIEDYE

AVQGPLGSTADIASITGLLGGWIWEQWLLKLQVEMGRDKSKLLEGIGTIG

DISYETMLYDFYFMRASHVNKSVPPRAPPRLKTQSHCQPIFTKNLHNQNA

LFQTLTNQVVTIELKNDIRIRGTLKSVDQYLNIKLDDIDVLDLDKYPHLS

SVKNMFIRGSVVRLHRADGPPKSTTKQARITQFTTQGERPGSRVTAPRPR

LLKREGSSNASGGGDEGLFLEDKKSRDARLGQEKNIERERSRSPDIWGSR

SGDKENENAGAARSLEEGMEEGIDRYNESENAVKRRKVDLEAPHARSVER

LSSKAQKISGPFIDESDSENEGLEAFREYADGEADVAPEKDVKESEAHSD

ENQTAGKRDLAADISPLVREATSHMQEDEYPDFDDIEAGGVEDEGLDFEC

EAAVDEETFGFDANDTTADTIHADEKPTCPVCQGSLEGFDEMKVMAHVND

CLDGRPSAISPMQESPKVSTPEQKAVAADRAAIAKPAQRDPAQYQTSRAG

TAFSKIMAGNAEDAAWAEAAASDVASRGFSISVDAFRYGAVESCNAYFLS

HFHSDHYIGLSKSWRHGPIYCSRATANLVRQQLKVDPKWVVDLDFEKKTE

VPGTGGVQVTMIEANHCPGSAIFLFEKAVSSGASTRIQRVLHCGDFRASP

QHVQHALLRPDVVDPKTGKRWQQRIDACYLDTTYLSPKYAFPRQSDVINA

CAELCVRIDQGQYDSLGHMPFQTATPTTKSKNPISKFMSAATAAVKPSTQ

PEPKGRLLVVIGTYSIGKERICLAIARALKSKIYATPAKQRVCACLEDPE

LSALLTDDPLQAQVHMQTLFEIRAETLCDYLDSMKPHFTRVIGFRPTGWT

YRPPAGRTLENPPVSTVLYSSHWKTPFSVRDLTPQRGSTRESACFGVPYS

EHSSFRELTMFCCALRIGRIIPTVNVGSQKSRERMKAWFEKWEAEKRKTH

NTKRRIALELRSVGLLSQHNRNSELRNTRPAFIYRQRHPVI

P450 part

MITDFLTPE

NITPERIALALLGLLAAYYVVPYLQTWRLSDIPAPGLAAWTNFWLLLQTR

LGHRFISVDNAHKKYGKLVRIAPRHISIADDAAIQAVYGHGNGFLKSDFY

DAFVSIRRGLFNTRDRAEHTRKRKTVSHTFSAKSIGQFEQYIHHNIENLV

KQLTRISNLQRNPKNGYATVDALNWFNFVAFDIIGDLAFGAPFGMLDKGQ

DIAEMRKSPDSPPQYVQAVEVLNRRGEVSATLGCYPALKPFAKYLPDRFF

RDGLEAVENLAGIAIACVNERLKPEVMANNTRVDLLARLMEGKDANGNKL

GRAELTAEALTQLIAGSDTTSNTSCAILYYCLRTPGVIDKLHKVLDEAIP

QDVEVPTHAMVKEIPYLQWVIWETMRIHSTSAMGLPREIPEGNPPVEISG

HIFKPGDILSVPTYTIHHSKEIWGADADEFIPERWAPERLTARQKAAFIP

FSTGPRACVGRNVAEMELLVICSTVFRMFDWELQQKGPMETREGFLRKPL

GLTVGVKRRTIV*

>CYP5080B1 OLD NAME = CYP532F1 AN7772.2 AACD01000132

40% to 532A1 49% to 532B1 53 clan

MHLLAFLLLPPLFLIARYLATLLYTIYRTRTLYSIPGPFWARFTRLWYFR

RLWNGHFEEDNVNLHKQYGPVVRIAPDHYSINDHAALKTIYGSGTKFAKS

AWYEGWKHPDPQRWTLFPDRDIKRHGETRKRFSSLYSMSSLVHYEEFVDQ

CADVFFDRLGEFADRDVKFNLGEWFQFYAFDVIGEITYGERFGFLDKGQD

IDGTIGALQNLMAYSSLIGIYHEWHPLLFGPLSRFSWSGAGGRAYIMRYV

QQKIARHSLQKPQSDVEHGPLKTQTFLEKMILARDKDPEKVTDYHVFMMG

LSNVIAGSDTTAISLSSIMYYLLRNPDVLDKLRNEIDEFTVQGKCSDRVT

FKESQEMPYFQAVMKEALRMHSATGLPFWRVVPAGGAEIAGYFFPEGTVV

GVNAWVPHYDDTVFEDAEAFQPERWIEAQKEDPEKWKVMNDMYMPVCCHK

LLQTFGLGSRTCIGKHISILEMSKLIPRILREFDFTTGEKKWNTANHWFV

KPTDFEVKYMTPSRKRK*

>CYP573A3 AN7773.2 AACD01000132

57% to 573A2 53 clan

MGLGELALSQLTLANVVLGGIAYIVLKFIYQIVYYRFFHPLSVFPGPFWG

SVTRLWIAWHNLKETELPTIYGLTKKYGPVVRVTPTLLLVSDPTKLPEIY

HRNADKTGHYITGSFGETESLFNMRSHKTHAAFRKHAAGPYSFSSVKRME

PLIDARIRDWSNKLNEKYVQTGEAFDFSWWAVYMAYDIISEVGFGAPFGF

VEKGEDVGGLIQGFHDGLPAFGLLARLHPFTSWMKTTFLKKYLVAKPEDD

SGIGVLMRFRDGLIEKRVQDLKSNKDIGRIDLLQTFLEARTEDGQPLTMD

YIKAEILLVLLAGADTTGTVFQAMIYYLLTNQSVYERMMDEVDTAIRKGL

ITDDVPQYIEIQEHLPFFVAIVRETLRMCPPAPNIFPRYVSEPGLDLYGK

VAPAGTEITGNPWIMHRDEAVFGKDAEEFNPDRWMDPERAKIMNKYLFTF

GYGARVCLGRDIAMMELFKGPLQFFRYYKPYPVQGKPEAKFVIKGGVGFW

RDMWVKIEKRPLVKPE*

>CYP59A1     Aspergillus nidulans

            AACD01000132.1

            stcS L27825 revised 7/20/07

MPSFSLLTGHFGALKQTIDGMPPNATLHSIMLKLSQKFRSGMFY

INMWPFSGTWLVVATPSGAAQIQSLNLSKPNILRRPLETITGGPSLMSMHGETWKRWR

ALFNPGFNPNYLIGLAPLIADEVVVFCEQLRQKARTGTVFQLEPLTLRLTVDTICSVT

LYVVTPVGRWPFLTPDLEIHSSTTKLRTTPLPQRCNGRSNGPRLELPSTPLRRYLTVR

PLVMWYNNRLMNRFIDQEVDRAYREQSGRQSKSVISLALRDYMKEKDGSLEDFKRRVA

PQLRVFLFAGRDTTSSTLLYAFYLLSRHPEALAKVRLEHDQVFGPYHQQVHEKIHQDA

KLLNQLPYTTAVLKETLRLFPPSASMREGGPGVEITDDNGQVYPTAGCNVWTLTVALH

HNSAHWAEAESFIPERWLVGSDHPLYPAKGAWRAFEFGPRSCIGQTLAMLELRVALAM

TLREFDIAPAYDKWDHIYPNDAVKEFNGHRAYQAEKGGGGAHPADGMPCLVTFRV

>CYP60B1    Aspergillus nidulans

            GenEMBL U34740 (501 amino acids) AN7813.2, revised 7/18/07

            Brown, D.W., Keller, N.P. and Adam, T.H.

            Proc. Natl. Acad. Sci. USA 93, 1418-1422 (1996)

            gene stcL

MAFLSLPILTALGA

VVYVLFQLVYNLYFHPLRDYPGPLLW

RASSLPWKLTLLRGTMHHDLMRHHQTYGDTVRIKPDEISYANGQAWRDIHAHVPGRPE

FLKDPVRLPLAPNGVMSILVSDTRNHARFRSLFGHAFSDKGLRAQEPTIARYADLLVE

VLREVADTGKSVEMVRYFNMAIFDSIGALSFGESFDSLRNRELHPWVDTIHKNLKSVA

ISHVLRSMGVEFLAPYLMPAELRGKRQENYTYAIEKLKKRMQKTGDQGDFWDRVIVKS

ADGNQSGDGMSYGEMINNAAVMVVAGSETTSSALCGCTYLLCKFDKMDKAVAEVRGAF

AAADQIDLVSVSRLPYLTAVIDETLRMYPSVPGQPPRVVPEGGAIVCGRFVPAETRVG

VSHLGAYYAPYNFSHADKFIPERHLAGAKLEEPFRHDNYAAYQPWSVGVRNCIGRNLA

YAEVRLTLAKLLWHFDISLDEERTGNFLDQKIWSIWAKRELYLEIRTREF

>CYP60A2 stcF Aspergillus nidulans U34740 AN7818.1 53 clan

revised 7/19/07

MILPLILVLYLLSTAAYRLWLHPVRNYPGPCWWAVWRVPYLKGT

IRGTIVRDIQRLHNQYGPVVRIAPDELSYITPEAAKPIYTSSPEFPKDPMLLPPFHNG

APGILAADYAHHRRYRRLLASAFSEKGLRAQQGMIQSHIDRLMTRLQGNCSSGSLDMT

VWFNWATFDIIGDLAFGEPFGCLERMETNPWIASIQGNVKSIPILNALRRYRLDRLIE

FLAPPRLLEMRRRNAQFTAEKVDRRLKHATTTRGDLWDSVLADPPDGEPPMSRAEMVS

NASAIVLAGSETSATTLSGCLWLLLTNPEYLQQLTERIRARFSTATVIDAQTVTQIQG

LQAVLDESLRLYPAVPMQSNRIVPPPGARLAGSWVPGGTSVAVQQFAACRSPTNFHRP

DEFIPERWEKEGEFINDRREASQPFSIGPRNCIGRQLALAEMRLILVHLLWHFDIELD

RRRMENMDWMAVQGI

WILWDKKPLWVVLKNRST*

>CYP62A1 AN7824.2 AACD01000132

not a complete match 53 clan

MISQICNEVIGLVPKKEEPGWLSVTGHPGAVYCENSISSGPEATGADVSQ

AIRIAYFTPLKHIPGPWYASLTGLRLSWSVFANNRIHYVHSLHQKYGPIV

RIGPQEIDVADPVAGREIHRMGSGFMKAPFYELLSPGPVDNIFNFRDPKL

HAARRKLYARGFTLQSLRNEWEPKVRDIIKLTVEKIKCDAVKGEAEIMGW

WTLMANEIVCQLTFGGGAGIVAKGVKEPFVLMLERRMGDLAHLLKHFAPP

GYYLGRALAWFIPPLQDIFYSQERMFAAGGDVVSRAREAKKAQAEPRNLF

NKALEAGNLTDTDIITDAGALLLAGSDPTAISLTFLLWCVLSRPEVQKQV

EAEVATLEGELTDEACERLPILNAVIDESLRLYGAAPGCMPRSPPSGGVT

IGGYFIPDDTIVATQNWSLQRNPSIWDDADTFDHTRWLSNSRITDQAKLA

FNPFGYGARQCLGIHLGRMEMRLAAAMFFRECVGARLGRSVTDESMHVVD

SFIAGVPRDRRCAITLT*

>CYP548C1 AN7881.2 AACD01000135

38% to 548A3 43% to 548B1 (partial seq) 40% to 548A2 53 clan

MLPTYFGTSNFLAAFAVWMGVVVLAFAIFCVRRLYFHPYSKYPGPLLGKL

TNYYAVYHSWKGDQHIDMWRCHEKYGPYVRYGPNELSINTAAGLKEIYSH

GRNFKKSVKYNAMVHQAANTLTTIDKRKHGKKRRLISQAFSDAAFRSYEE

TIQQKIAQLCTALRRRDDDSNEIVPDGNWGPAKNMSHWCDWFTFDVMCSV

IFGVPWSSLTEKTYRNVPHLIEVSNVRVGCLIEAGGSKNMKIDKYLFPAA

IAARNQFVKFVNDIIRQGMAMSAKGSLKGAFALLRDATDPETQEPLSFKE

LCGESATLVVAGTDTTSTALAASIYYLCNHPKVYERAVQEVRSTFQSRAE

IGLGPKVNSCTYLRAVIEESMRLSPSAPGPLWRQADAGGATVDGQYIPQG

LEAGTCVYAIQHHPEIYPQPFKFVPERWLGPEAVPEQYRSDYSPFAGFTP

FSIGPRGCIGKPLAYIELTLTLCHILYAFDMRLPQGVNVNEDAEYQLALH

ITAAKEGPLVEFRPRTVV*

>CYP682A1  Aspergillus nidulans FGSC A4

          AACD01000135.1 revised 7/19/07

MAILWSYLFSSYAVIIGLVTSVYLLGLGIYRLFLHPLAKFPGPKYAALGR

WHEAYYDIYLSGKLIFWIEEQHKKYGPVVRIAPDELHILDADLWETIYTK

AGRVDKYDRMSSRFGNDTSVLATIPDSLHRVRRGALNPFFSRQRILGLQD

IIRQKLNIFIKRVEEYKALNAPMPINRGFLAFSEDVIMQYCFGHDYAALN

KRGWAPTLHDPIVNVTLAGNTALHFPIVPKIMNVLPQSWIAKLDPVYVPI

FQMQRIREIKDSLTGESPKIDKQTVFSDLIQGDLPASEKADRRLQDEAQL

VIGAGLATTGWALTVGTFYLLSNPKVLARLRRELDEAIPARNPENPSGAL

EWAELEKLPYLTGVIKEAVRLSHSTTSRNVRRLPKPITYKDWVIPPRTPV

SMTIPFLHLDEDIYPEPKSFIPERWLDNPKTKNGAPLERYFVGFGKGTRSCLGLN (2)

LAWCELYLVFAAFFRFFDFELYETDFSDIELQHDFFLPFPKWDSKGVRVFVKERSA*

>CYP674A1 AN7969.2 AACD01000135

32% to 532A 53 clan

MAMSFSYSPADIFWPCVKLGVFLALVYITSLIVYNRYFHPLRHFPGPAWA

AISPLWYFKRIRSGNPQDVQHSLHERFGDIARIGPNILAVRHPDAIETVF

GTKNGKAWRKAAFYDSFDPHIPNARTDSFSERDDAKNAERRRLVGGLYAQ

DNVLRYEPCVDRLIHLFQQRMQEHSESGKVFDMSVWLERYTFDVVGEIFH

GRREGFGMLRDGADYNGWCYLMGVMPDIGAATTYLPWGFRSLYLLSQLVF

QSSRDGVRGMLDVTKQAERATLERWEEMKKGKVLSESDILTGLLDMVQER

GKNDSVMASWTVADVVTEVWAVIWAGSDTTATALTSIFYHLHRNPCKLAG

LREEIDAAFEDGRLRFPIRFNDARKLPYLHAVILESMRVHPSLGIGLPLE

SPADGANIGGTYIPGGVEVIVNPAAVHFDERSFGADAKEWIPERWLVDAE

ATRRMERSMLQFGYGPRMCIGRHISNIEMYKLLPALIRNFEFEMLVDSWE

VKGSWFHRAHNVSADPPPLDKQSFSENGGNLRS*

>CYP541B1 AN8004.2 AACD01000138

49% to 541A1 505 clan

MPTPIPQPKGLPVLGNLFSLDSKNPWGSFNKLAAASPSNRPIFKISILGH

DIVFVTSAALLEEICDETRFRKCVTGPIVQIRDAVHDSLFTAYHSESEIW

GVAHRIMKPLVSPEAIEGVFNEMRETTDDLIKKWTASSKQRVNVCNDLDR

SNHEANMLAFFHQKVSIMNGTEPAVIASCQNATMEAVKRSSRPKFLTWLM

GHQKRYDSDIKIMRNYGAEIVRKRREEYPDGGPKDMLHALLHGVDSETGK

KLSESQVLDEIINIFIGSATAPNLLSFGLYYLATNPDVVTKAREELDAVV

GSGPFEHAHLSQIPYTEGILRESLRLSATAPGFNIEPIPSPGNEPVLLAG

GEYQVPRTQPLIALLTAVNRDPEVFEDPESFKPERMVGEKYDALPSGVKK

GFGNGKRQCFGTRYAWEWSLLVLARLIKEVDFELADKKYKVTNEGVNYNG

AFSTRPVGFFLLASPRASV*

>CYP504A1 AN8078.2 AACD01000139

64 clan

MSLQTIGIAAVAVVYFLIRYFNRTDIPKIKGLPEVPGVPIFGNLIQLGDQ

HATVAQKWAKKFGPVFQVRMGNKRVVFANTFDSVRQLWIKDQSALISRPT

FHTFHSVVSSSQGFTIGTSPWDESCKRRRKAAATALNRPATQSYMPIIDL

ESMSSIRELLRDSANGTMDINPTAYFQRFALNTSLTLNYGIRIEGNVNDE

LLREIVDVERGVSNFRSTSNQWQDYIPLLRIFPKMNREAEEFRVRRDKYL

TYLLDVLKDRIAKGTDKPCITGNILKDPEAKLNDAEIKSICLTMVSAGLD

TVPGNLIMGIAYLASEDGQRIQKRAHDEIMKVYPDGDAWEKCLLEEKVPY

VTALVKETLRFWTVIPICLPRENTKDIVWNGAVIPKGTTFFMNAYAADYD

ETHFTNPHAFEPERYLTASSDGSGTPHYGYGAGSRMCAGSHLANRELFTA

YVRLITAFTMHPAKRAEDRPILDAIECNAIPTALTTEPKPFKVGFKPRDP

VLVRKWIAESEERTKHLN*

>CYP652A1 AN8139.2 AACD01000141

37% to 68D1 54 clan

MLQSLLQNNFVAVLGLLIVFGTATSLTWTAFTILSPYLRVKGAKIFNDRT

GSEILWTNARKRFQRGARELFKAAFAQHPNAFYIMTDTDVELILDSKYAP

EVRNDRRFDIGKYNEDMFHGTIAGFEMFENDHVLERVFVETVRNKLTRAI

GKFVKPISLEAADGLREYWTDDTGIPAPTRNHSCVLRTIAKQSSRVFQGP

PLCYNPDWLRITVNHTVTFFEAAESLKVWPHPLRPLAAKFLPLCKKLRAE

AQEARRIITPILEERLKRAQARMAEKNNLPEKKTEVKEEGDSDGNMIEWA

EETANGAIYDAALLQMKVSLASIHTTSDLVSQTLFNLCSRPELVNDLRKE

VIEVIGQQGWVKPALYQLKLMDSVLKETQRLKPISIGTMVRTTTSPVTFS

DGLQVPANTRTLVSCHNMWTESVHENPEVFDGYRFLKLRQLPGQENWTQL

VSTSNNHLGFGHGMHACPGRFFAATTAKVLIAHVVLKYDLKLLDGQKPVI

IEHGAAQYANVWCPIGVRRRREEIDLSDL*

>CYP5073A1 old name = CYP68M1 AN8141.2 AACD01000141

37% to 68A1 54 clan 39% to 68D1 LEFT OUT OF TREE

MALYDVFSTSLTDPLHLTLGILSISLPLLWYLRRGKQTQEQAQSNAPRSW

PFNPASLDRKESESPILTFGNSIILPNRYAHEIRNNDLLSFRDGLEKDFL

TTVPGLEAMFTGTFHNHIVWDTASAFSRKLGALIEPLTTETGIFLRENWS

DDTEWHAISLNETMNLLIAQLTARIFIGEELCRNRDWIQNAISYTAHRTA

AMKELHWYGRLIPLAHWFLPSCRALRGCVRAGRPFVERVLEARRTTQGKG

EDKSIDALSWIDGVAGENGTKYDATLTQLRLAYAAVHTTSDMMTKVVAAL

CEHQELIQPLREEIVTVVKEHGWSEAALAKMVLLDSVLKETQRLEPLASF

TLSRIAREPVVLNDGTRIPKGAQVRLTTDNMWNSSVYPDAAIFDGYRFVK

LREQERGANTGTVGGGGGLSFVSVSANHMGFGYGKHACPGRFFAGAETKV

ALCHILLKYDFDLVDRALAGAQTDGMMIWRDKRAMLRVKRREAEIDI*

>CYP653A1 AN8184.2 AACD01000141

33% to 503A1 54 clan

MSPMVLCTSLLVLLAWLLSKSPTDTTPVNVPTVTLGRFVPCFVDRLLFCA

KGPFLIYDGYKKSVCGDYTNILSDSFLPAQTVVKKLTPALGRIVPDVIDE

LKHAFDVEVPECYDKWVTVTIYSMILKLINRSTSRIIVGDSLCRSEDWLN

TVLDYTYNLGTIIFLLRPLPRFLRPLVAGLLPQVRHARKILDHVKNDIIV

PMILERRQKEANDSNYRKPDDFMQWMMDTADNDYDKQPGNIAQGLMIIMA

LAVIHTSTITITQSLYDLLIRPEYVQPLRQEIIDTLKHGWANATRADFAT

QVRLDSFLRESQRLNPTHEVNVQRIAKETLVFKDGFVVPKGTHICFAAGP

LSRDPELIDDPETFDGFRWCKDRQYNKKGHNNSLVALSKLNLHFGYGRQA

CPGRFFAENTSKAILSRLLVEYDLKFPEGKEGRRPWNIRNGEQIVPNVYT

KVLIRKRLVNL*

>CYP647A1 AN8250.2 AACD01000145

37% to 623B1 54 clan

MSTAWTNSWIAIAVTTFLVAVFVLLYSAPQSEIDIPLVRDRGRKRFRTST

FVSYLFNANDILQEAYDTYLKHGKTCRVPDKSLGTMILIPNRYMKWMLSQ

PTGVLNSYEAIAEIVQARWTLGDTRYLSDDWHLNMLRDALRPLSKSGIVE

FQEELERSMEDVLGNDHVNWKDVNPTIATKRIILQATTRYLVGSPLCADE

QFLRWILIFIEWITPVGELLRLTPRGLRSVVGHIFSIPRFIVIQKLKAIL

RPQYDKRLSFIRSGQSPEDGPQDLLQMMMRDLYERNSTDLNLHFITINVL

VFVIAAVVQTYMLAPSVLYDILESNAEYNTISKLQEELVCVLGEPAQGQR

WSQNEARQMAKLDSVLRESLRTNTLVSQTMPRKVMVDSLQTPDGITLPRG

ATVALLARAAQTDPDIYPNPNKFIPFRHAVPGGKQFAATGENFLAFGHAK

HACPGRFLVSVELKMLVAHILRHYHIELPAEYGGKRPKAVWFTDLNLPPQ

HGVIRVKRCV*

>CYP51F1 AN8283.2 AACD01000145

51 clan

MGLVSLVLDNVCERCSALSVWALSGLGLLSVIIIAVVLNVLRQILFKNPN

EPPVVFHWFPFIGSTISYGIDPYKFFFNCRAQYGDIFTFVLLGKKTTVYL

GTKGNDFILNGKLKDVCAEEVYSPLTTPVFGRHVVYDCPNAKLMEQKKFV

KYGLTSDALRSYVQLITAEVEDFAQKSSVFQNAKGVFDVSRTIAEITIYT

ASRSLQGKEVRDKFDSTFAELYHDLDMGFAPINFMLPYAPLPHNRKRDAA

QRKMAETYMEIIKERRKSGEKKDSEDMVWNLMSCVYKNGTPLSDEEIAHM

MIALLMAGQHSSSSTLSWILLHLARHPEIVEELYQEQLKVLGSDMHMTYD

DLQKLELHSKIIKETLRIHAPIHSIIRAVKSPMPVPGTSYVIPTSHNVLS

SPGVTARSDEFFPNPLKWDPHRWDSNPIANSTEDEEKIDYGYGLVSKGTN

SPYLPFGAGRHRCIGEQFAYVQLITVTAALVRLFKFDTVSESDKSSVPET

DYSSLFSRPAGKCFVQYEKRNVTTKA*

>CYP682B1 = OLD CYP552F1 AN8309.2 AACD01000150

39% to 552B3 53 clan

AACD01000150.1 Aspergillus nidulans FGSC A4 revised

MLSFGLANDAWGHPWVVLPLAVILYIV

VLGVYRLFFHPLSRFPGPVLAALTVWYEFYYDGIRRGLYTFEIQRMHE

KYGPVVRISPNELHVNEPSFIDELYAGSGKRRDKYPYSTCQFGIPDSVFG

TPGHDLHRLRRGALSRFFSKTSVTKLEPIIENAIGKLCTQLESYSGSQQP

VKMDMAFSCMTTDVVTEYAFAKSYNFLDSPTFEPNFHRPIVAGADLGPWV

KQFPVLLKVMNDLPKWILTRINPEAAVYIQFQEDLRRQIREVQSQVDKGE

SNGKIPTIFHELLTGDLPEQEKRIERLWQEGQIVVGAGTETTAWTLSVTL

FYLLDNPRIMRQLQEELERIIPDAAQSVTWHQLEQLPYLSAVICEGLRLS

YGVSSRLQRINPLGPLWVRSRDAKGGPHGKGRWVEYEIPKGTPVGMTSTL

IHTNPELFPDPHEFKPERWLDGAGKRHHSLDGYLLSFSRGSRQCIGINLA

YAELYMGLGLLIRRLGHRLELFETTSADVEIHYERFLPTPKDGTQGIRVL

VHPESE*

>CYP671A1 AN8338.2 AACD01000150, revised 2/21/06

33% to 628A1 34% to 574A1 53 clan

MGIVTALATFLSPDLTRTAFAFCVLGVASHQCIRHGEIDNRLRPLSALYL

LAFLGLCLCYVRIFSLSWPRALGETILAASSFNLGLLTSIITYRAFFHRL

RHFPGPWMAKVTRISAVLKAVERTQYHLDLKE   MHRKYGDFVRTGPREISV

NRPSAVYLTSGPHSVCTKPTWYSHVSDDITKVSLNSTRDPEVHRRRRRAW

DRGFSMKALPTYEPRLQHKVDVLVSQIRSRIDRPLNITQWTMYLAFDVMG

LVGFSKDFRQLEDAVEHAAIEELHGQMLMYGILRPVPWVLTILGATLGLA

GKYGQFMTYCVARTAERKAEWNASEDKVPQDVISWLFKASDEKDQSAPPG

EQALNEDGQLLIITGSDTTSGALANAFYYLAKHPAVYKKLQAELDNAFSS

GKQSPKINNETLRKLPYLEAIINETLRLKPAVPSGQPRQTPPQGLQIDEV

WMPGDTIIIVPQYVIQRDDRYFPSGDEFIPERWLDEKDSLIKHEEAFFPFQL (1)

GRYGCVGKQLALMEMRLVIARIAMEFDLAFAPGETGEAFDRDAKDTFTFN

IGPLMLDFKPRSA*

>CYP530A3 Aspergillus nidulans AACD01000151.1 revised

revised 7/19/07

MLPLTPILAIAGLLALIFRLSLIGRRPKNYPPGPPTLPLLGNIHQMPSRD

AHLQFAKWAKEYGPIYSLMLGTQCLIILSSDEAVKELLDRRSGIYSHRQE

MYTGQQLCSGGLRMLMMGYGPTWRIMRKMVHGLLNVSTSRNYIPYQMLEN

KQMLYQFLTEPDDFLKHIRRYSNALTTTMVFGWRTPTYEDPKMKQLFDGF

SEFAEINQAGAAAFLDFFPLLQKLPDFLVPTKRKAKELHKHEMGLYKGHW

MKAKEEIEAKNIKPCFCQGMYEVQKKEGFSDDQAAYISGTLLEAGSDTTS

STLYAFVQAMLLYPEIQRKAQAEIDRVIGPDRLPVMDDLADLQYIRSCMK

ETLRWMPTTILGAVPHAVTQDDSYMGYFIPKGAGVMNNVWAIHHDEKRHP

NPRQFNPDRYKDDTQSLGDAAANPDASKRD

AFTFGAGRRICPGIHVAERSLFLGMSRILWAFNISPKKDASGKEIIPDQERLTQGFVCMP

EEFPATITPRDEKRAEMVRNEWRQAEKELDSETKQWVVAPVDIKI*

>CYP685A1 AN8408.2 AACD01000153

28% to 613A1 613 clan

MGFVNTLTQASDQENQRLRASPQVFKLFVLILFVLLVLKIRRHRANRITN

QYGRQICELHGDARVAKFAFSKQLSDQGKALAGDEPFIIRNGRARELVVT

KPEHIYDFYKGDTKPCSLLGHAVGALAGERWSMIRRYFDPAFSFQSARQA

IPELSASIDRWLDDLPLQGTGTGKGFALEIKKPCRFLPLRLAAEFVYGEI

FDDKLFSALLDLNVLHEVILHDVIANKRLATRLGCWFDRAAAKRMEEFRS

RWMEFNLGIIQSARGASKACPAERIYHGVEKGDLKLEEFLHTLDEILFAN

VDVSSAVLGTLFEHLAVNTAFQQKLRAEIETHIQTRTHTPDTDSDIDINT

ETGKYLSKQDTLMNFAVMEAMRLSPAFDCDFAAFSLPECTAVPKEIGGYR

VPARCPVVIDAKRLNADRATWGKDGDTYRPERFRDIPPSKSRYGFMRFGV

GAASGRCLGKHLADTLFKLTLIAVIERYSLHSVHDGPEVELREVVVRV*

>CYP655A1 AN8411.2 AACD01000153

33% to 52F1 52 clan

MSLASTLPRASFETLLQHTNFMDGIKFVFFAFVVYSCFTIAVGWVVYEWK

RKAHGCGKIPRYPHRDPFFGFDIVFGMAKSLRNDYFLVWLNKVHENLPKT

FLVNFVGTRFIYTIEPENMKSMSAINWQDFAVGPMRRNNKATAPFADKGV

NTVDGHEWEFSRFLIKPFFKRETFTDTSRLTLHVDRVLEQLPADGETVNI

QPLIQRWFLDVTTASLFGESIESLVYPERAPICWAMVDVLRGLRLRLQWY

KYLWLFRHQAWLDAVEVVHRYLNAHIDRTYKELDEYKRQGKNPEAADRND

LLWYMASNLQDKEALRSQICLIFVPNNDTTSIFISHILWNLARHPGIYEK

CRQEVLALGDAELSFSVLRNMKYLNAVLNETHRLFPNGVTQVRKCIRDTT

LPVGGGPDGKQPIFVRKGDVVQVNKNVIHRDHDIWGPDAEDFRPERWENL

RPYWNFVPFGGGPRRCPAQMLVTAEASYFLARLMRVYKRIEARDPNPYVG

VMRVGPSNKTGVHIALFKE*

>CYP658A1 AN8438.2 AACD01000153

poor match 26% to 640A1 7 clan?

MPPYVIVSELLLIRLVCGLVGYVLWRLWRFTVHPLLQPNLPRELPYTIPF

IGKDLRPSQTIQSTDSLRPCNFPATEPARFNIVYHDALEVLRDRPEVINT

EHIKDLLHGLGCSKPGILEIDSHQRGNISVPDSKAALTNRPPLFKVAEGL

LSKQLLDRSLGNDLLARTLEVLETQGIPQVSLMIMSRWTNDLWKLLFKVP

EPFARDVYTARTRVQRCLQEFLRLPESEKSDQSWAIEAAVAEMRSRGMSE

ADTASYLLVVFWAINANTFKIIFWLIAHIISNPTILTAVTTEISSILSDW

PSNESLSSLSIRLERNTLLEALHNEAHRLALNTSSARTMKQDVNINGRIF

TSGTHAVIPYRYLAMRHPLLSQDWDAFQPERFLSNPGLGQSKSFLPFGGG

KHKCMGRFLSRRLVLTFTSLFLHRFKVRPLDGVPKMGFRPVSSGPASPVD

DMRLVISHKEY*

>CYP686A1P  Aspergillus nidulans

           GenEMBL AACD01000154 AN8510.2

           Revised sequence, now a pseudogene

           pseudogene two stops and two frameshifts

           33% to 613A1 613 clan? Similar to CYP5082 family

MAAVQFPIEADPQWPSNGTSPVQSLPGPFNTRF*ELFHHDQPQPPRI

PILALTARYRAVDRKRSLTGPDYVWPFGNFRHMFAESRALSHKW

RKEYGDIYRIWTGFYSEV (2)

VISTPADIATFYSDSASHKKTLALRSN*VVNKLLGACVGFTNGX

RWKRNRKAFDPLLANNVAVKHNSRSHQEAAEFVSSIATTRVDG

GSNEETMIIKAAGSFLPFTLNETTSIFFGPLTDEEKIELWDVCL

AFMGIVDTALLKG

PFRWGLGYWMLSREKYQSAKAYLARWEAFLMRTSQARKDQTDLPITR

LWRDVEVGNLSKDE (0)

LLQTLTESTVFNLEPTSHALIMTIFLISDNQAFQDNLVAELDANRSAITRYLGRKDTLL

HYALLEAVRLQPVL (1)

PFTLPEAASVDKGLGGYLIPKG (0)

TSVIADSYGINVRNPFWGPDATSYRPSRFTTLTPAEIHRNLSMFWFGARKCLGQFFA

KQVRAVVFNLFDRYKVTCSDYSGIAPGINVDKTEYVDRFGLEFLL*

>CYP68L1 AN8530.2 AACD01000155

45% to 68A1 54 clan

MDSLSLSNSQSIAGVLALLLLSGIYVYLNSPSYPVVNGKRPWELRIIHAQ

KRFLSNARDLIDSGLARWPAFHLVTEAGYRLVLDPKYANEIRSHEALSFG

KATAQDFHAGIHGFEPFEQGTRSDQIVSDVVRMKLTQSLGNVTKPLSDET

AIALQKNWTDEADWHTIPVKKTVLDIVAQLSSKVFLGDQICRNPEWLRIT

VAYTVDSFLAAQALRMWPTFMRRLVAPFIPGVQKIRAELEEARRIILPVL

EKRKAEKQTAIAAGKTPARYNDAMEWMEQCAKGRPYDAAVSQLSLSLGAI

HTTSDMLTQVLYDICGHSDLVDELRQEVLTVIAAEGWQKTTLYKLKLMDS

VLKESQRVKPIGIVKLSDGTVIPKNANLIVSSQRMWDESIYPSPDKFDPY

RFLRLRETPGHETSAQFVSPSPDHMGFGFGKHSCPGRFFAANEIKIALCH

ILLKYDFRLTEEWRNPRPIASGAGLTAEPRATMEIRRRKEEIQL*

>CYP677A1 AN8615.2 AACD01000158

37% to 551A1 partial 53 clan

AACD01000158.1 Aspergillus nidulans FGSC A4 revised

64% to 677A2 42% to white rot seq Scaffold_86a

MDAYTSLLALAGALISYSLSYVCYTFYWHPLARFPGPPLAALTRFYRAYI

DISWKHSFVHHLGELHKKY (1)

GDIIRIGPNE (0)

LHFRSPAAYLEIFNPANRWDKEERLYHSFGEDRSSFG

YLRYAEAKERKDILSRRFSRKAVQDAQKIVEGI (0)

VLDLCKTLGQNSEEAVDLFYAFRCMSVDVIT (1)

YLCFANSVNAVHAPKYESPLLLAMDASMTVFPAFKHFGFYKEMIMNC

PPKLSKILSPATAGLVDLQTLLKAQIEDLTSDPSQLEKLPHNTTIYHELLRP

EAYRTKTQPSKGSLYEESQALMFGGADTTGMTLMHGCFYILQEKSRGIYE

RLKTELVEAWPSLDGAAPTWEELEKLPYLTAVIKESLRMSPGVASPLPRV

VPKSGAVITKTHIPGGTIVSQSSHFVHTNPDIFEDPHSFIPERWLGEKGK

SLDKWLLAFSRGPRSCLGQQLAWAELYLTYAHVFRKFDLQIDPSR (2)

SPNELKWKDTFLAHYLGPHLKAKLTPVIS*

>CYP547C1 Aspergillus nidulans AN8895.2 38% to 547A1

43% to 547B1 547 clan, 73% to 547C3, revised 7/18/07

MIPMLAATLAEAFILQRSVFTDTPLRTVVFGSAAVNLLILAIYNVWIWPF

FLDPLRHLPRAPGRFNMLRFIFDNPRGRLPLLWMKTVPNDGLIYFRDLLN

RTQLLATNHQALLDVMSTNTYDFEKPWRAREFLARIIGFGLILSEGAAHK

RQRRALTPFFTIKNVRALYTLMWDKTNQLLVEMDKQISRCPMEGTSPDSG

WGKVEMSVWARYFTLSRLTLDVIGPAAMGRDFRSLQNAENKVADSFLAIL

EPTKEKIAFLAINFLLPQWFAKKLPWRLNQVIEEQVGYLRDLCKEIVHEK

RAAITATKVTASELEADILGSMMLSGDFTDDELVDQMLTFLAAGHETTAS

ALTWTCYLLTLHPEVQDRLRAEIRTAIPHSTHPVTHSDLESLPLLNGVCQ

EVLRLYPTVPSTIREAVRDTTVAGKHVPKGTKIMLCPYAINRAPEFWGAD

GDAFRPERWIDTDPVTGKTSVNNHGGAATNYAQITFLHGQRSCIGKDFAR

AELRCAVAGVVGRYEFAMQDPKQ

VIHISGAVTTKPVEGMHLRMRRVEGW

>CYP537B1 Aspergillus nidulans AN8905.1 45% to 537A2 53 clan

revised 7/19/07

MLTFYLAASIIVTVLFMRRLCSPIAKLPGPWYATFTSWVLKYHEFTSNRR

LFIHDLHKKYGSTVRIAPNEISFASLEAIKEIYGSGGSGYDKTELYDLFRQFGIK

TMFST

LDKHSHSQRKRELADRYAMSNILREEHVSAIVDRARAVVSRCAASAESVD

VYVWLHCYALDGVTNFMFSPGGLHSLDSEHDFKIMEELTYHQSLQKNLLH

YYLPTVAAYFPPCLTPRRSPKTNEYVLKMCAQQLPSQHSLVAKLARKDSP

LNHTQVAAECKDHMAAGIDTTGDGLCFLMWKLSQPHNIRFQERLWEELRT

ARPDIPLDKLPYLDAVVKEGLRCAPPIPMSFPRYVPTGGRSIDGHFVPEK

TIVSCQPYTVHRLDENVFPEPDSFNPDRWMVEKGAVERNRLFFAFSTGGR

GCTGRNLALVEMKILLREVYSRFRTTVAKDMHGCMDIDDQIISSRPLGQT

CKLRFSET*

>CYP540A2 AN8919.2 AACD01000165

48% to 540B1 68% to 540A1 check introns 505 clan

MRPPTVQCQFYLIGDEPSSAQSVTVDTRWKFEDLQRAVGLVFHVAQPLGT

LSTVDEVLTLANSSSAIGILVDGKPVQSPQGPPGLPLVGSFYEIFPDHLG

NHYRLFRKYGPVIKTTNMGKTIYLTDSPQVAASCFAESIYMTKKITEDHP

LWGVKDNTAIFIGDTETENWRLAHKYLPPAMGPKAVRHYTGLMQNCARKA

LPVFDELDARDESWNVYQYMVKLASQTIGSFSLGKDFGHFASIDSPLHPI

VTNIASLLSLNKKITARGEWYRLLPFGDPARLRSVQHTIYTLLQEAIDEV

AARSASKDAPMSDAALSASCVVDYLLHAVDEKGEHFPTGLILANMLIVTG

AGFTTTSALLSWLIYCLVTYEGTQDRLYSELVEYGIVGPSGEPNKTTWTP

DLAHSLPYLNNFVKETQRLHNASFQPGRTTKTDVVLPGGYRIPENSVIVP

ALYAIHTNPSIWHDPFRFNPDRWDSDEVKNLHRCAYVPFATGPRGCIGFN

FALLEVKIILAELVSRYEFVRDGVESIEYDPEFQLIRPLNFYVRAKRRS*

>CYP676A1 AN8952.2 AACD01000166

36% to 629A1 53 clan

MSSPWKVMDPNLADMHQIASFLGLHRVALFLIAAVIVRVLYRRYWSPIRD

VPGPFWASFSSLWRVYHVVKGHTEQQILKLHKEHGIAHPLLLRWRLEEKI

TSGTIGDFVRIAENEISVAHPDAVKQLLHANLAKGTFYSVFSLPDYRYVN

QMSELDPTRHIQKTRNLSAGFSLSNITKTEPYIDRCLKVLSRQLDGLAAS

DAPVHFQDWFSFFAFDVLGEVTFSKSFGFLQEGLDIRNAIANTGSLVYYI

SIMGNYVWFHNLTLGNPLVSRLGLQPNSHIFDTCLLAIDSRKNNPELRHD

MMQRWLDMRASHPERMSEEDIFGAAVANVGAGAETISSTAQAVIYYLLKN

PQYLATVRKELDEAQAKGELSDVIQYGEATKLPFLQACLKEAYRFHPGVC

HNLPRISPKGGMTIAGRYFPEGVILSVHPWVIHRNADIFGADCDTYNPTR

WLQGDTKRMDYFLIHWGAGYNQCPGRNLAQFELSKVLATVLRDYDIKLMN

PKSEWRFETRFLAVPYGWPCQIQRRKRGMVQVAA*

>CYP548D1 AN9007.2 AACD01000168

46% to 548A3 53 clan

MLQLLLPRSWPAALLAAGTILSFVWIAYYRFIHPLSRVPGPFLASVTPLV

QLYHGLKGDRHLWIYELHQRYGDHVRLAPNFVSINNVEGLHKIYGHGNKF

RKADFYNGFLAIPGVYNTHNAIDKLVHGRKRRVLSQAFSDTALKGMEDVM

LLHVRQLCSILGRERPTSQSGDKDGATFNMANWFGYLTYDVMGELCFGKS

FDMLIDGAKRRMIHLVDRAAYRHYVCGLWMPLHRWHLDQIFIRRLTNDRW

NFIMESRQEANIRAKERTSLGQDAKKDFFYYLLNARDPETGKGLATQELW

GEANVLMIAGSDTTSTSLSAAIFYLVRNPHALEKLKNEVRSHFSDVEEIV

TGSKLNQLTYLKACIDEAMRLAPAVPGSIPREASDPVVTVDGLVLPEGTG

CGTPPYCIHRRPDYYREPLSYLPDRWIEGSTCKTADAAWTVTREEVDLAR

KAFCPFSIGPRGCIGKSMALMEMRVTLARLMYLFDFELADATGEDENGHF

KMVDHFVVSKTGPNVINIITRSL*

>CYP683A1 AN9030.2 AACD01000168

poor match 53 clan

MIFAQLPTLTAQVVHFMQSRLLLCITAFVVLCIIHTFLYAFLLSPVRHVP

GPWWARVSRIPLLYATWQRRRSRYASDLLRKYGRLVVIAPDQIHTSDETA

MKTIYAKSSIKTRFYAGMGSWKGVKSTLGFVDYRSAAPTRNNLIQCFQNR

NLDTLVDSMACHITEFCDMLKPKVSNNKAVDGVVIFRLLALDIVTDILWG

EKDTLLSKGFDQTPVFLRRFHAFSSWNALKSFIPGLDTYVRFLGSSNMRQ

LRADCNDMDVTAREALDRWHARPEERHQKDVLSMLQAMSNSDDPTKRIPS

EHIPAYMVEMLAAGSSTTSHTAAFACDQLARYPKALEALQKELIEAFPDK

ENIDERKMLSLRYLEGVIYETMRLYPMIPGPLERHLGEWIEVDGMKVGPG

VIASTAAYDQGRLPDVFPEPEKWNPERWLQATDRMKLNWIPFGHGCRSCP

GSNLALTELKYILGTLFRRFRVQLPEDYPNEPLELADVFAAGSKTGHCWL

EFEEMPK*

>CYP662A1 Aspergillus nidulans AN9210.1 33% to 59B1 59 clan

revised 7/19/07

MLALLLVLVALTSYFLVRMRQQRGMFRNLPGPPHHAIWGHFLIMRDIASS

LPPDATPQLFAHLMRQRYGLGDFFYLDLWPLAPPQLVIAHPELATQIVHK

MNLPKESAVMQKWTGPILGEKSMVSANGHDWFIARKSFTPGFQPRKLQQH

IPHIVDETQAFADILREHFHMNDIFKMEDLVARMIFNISAGVILGIKCNA

QRDDDEFLELFRKQAALAPQDFWSRYLYDVSPRRYYRKWSNGRALDRYVG

RLVDQRVVSGPAANPDQKTKYYAIDDAIATSRTLNKNIPHTSSLDKYTRD

MLITSVKTLIFAGHDTSASTLCYTFAAISKHPQVLNTLRKEHNALFGTDP

SAAADLLRDDPNLVNNLPYTLAVIKEALRLWPPTGISLRRGQPDQTLFAE

GKEWPTYPFAVLVNNCATMRREDLFKDAERFYPERHLVNDPTDPYFVPRD

AWRPFEKGPRMCLGQTLALMQLKIALVMTVRTFDFEIVYEEGTFMYQVLD

VTAKPSLGLPTRVKLVE*

>CYP550B2 Aspergillus nidulans AN9214.1 55% to 550B1 7 clan

revised 7/19/07

MDCISQNSVIQRALLALYEHPVAYSVI

TAVFISVLCRKLLYKPRNYALFPVWATIEVAIASYLLRGDGIGRRVF (2)

SVIRRYGGSLFGITSTHQILVDFPGLDRFMARSLHTLNAEPVQYTIFTRTFGG

VDSPELKRKLKNSWKDLLAPIERLFLNDASAAAALDRACVLQQAASFVSF

SSSPAQMKRWELSAGIRVIPPAESGSPHKVEANLQSLTRDFGACMAIPLL

YGRHFLDGNPTLLDDFWKFDNELFPLLMIGVPEWTPLRIVKDGCAARARI

LRELEALYRRIDQSQCGEPVESGIDMSDVSGALFERSRIYKREGWSFPER

AAGDFAIFWGQNANTHPLLFWFLAYIYSTPGLLDTLRAEIAPYTCFASSQ

AKVPEITSIDFPGLSANCQLLKACLYETYRLVNEPISIRYVERPVTLTDG

SLQHTLKTGTWVSAAHSLTQHNASIFDNPAEFRPERFLETDQVSGKRVAR

YGRLRPWGAGAAMCKGRTFAEKELTSAAASIVSLWDIEPAYGQVWKLPGM

VPGTGVKRPVRDIRVLISRRQSIVVKGNDMSPSKGENHGKPLGV*

>CYP540D1 AN9218.2 AACD01000170

46% to 540B3 505 clan

MTVQTFYLIGEKERSTRELDVGDPKTVNALRQGLAEVFNILSAEGIDFHD

CHGPISTIESILRSESVGITVNGHPVRYPQQPQGIPIFGNHFEIYPDHLG

NHERLFNKYGSVIRTNNMGRVTYLTNDPDIAALAFRDNDYFTKAPSSASH

PLYGIRDQTALFLCDTESPAWKEAHKFIPPSMTPRAVRHYTPLLQQSVDT

VFNVLDKFDNNGQAFNVYHLTAKLASQVICQLVLGVDLHHFDAVDSPVHP

IIVLLQRYLTLNRRVQTKGAWYSYLPFGDPVALKNTRRELYGLIEEAVIT

CQKKNGGTTGDLPIQTAALHATCLVDYLARATDEHGNKLRHEYILSNTLA

LVGAGFVTSSAFLSWLIYSLVEYPGQQDRLLQELVDHGAVSDKRWTYDEI

QALPFLDAFVKEAQRMHSPSFQPARNVKKDIILPGGWALPQGSILIPSIP

HLHHHTAYWENPDRFDPDRWRTEKVKNRHRSVYVPFAAGPRSCIGFNVAL

QEVKISLAELVYRYEFVNATNEGIEYDPDFIVIRPVNFYVRAIRRTEWPA

RSP*

>CYP664A1 Aspergillus nidulans

          AN9222.1

          37% to 530A1 66 clan

          revised 7/18/07

MTMAALDVFNVPYSVPLLGSTVVILIGFIAIKALRVGSRPKGLPPG

PPTEFIWGNTKQIDLFYPQYQYRKWAQQYGPVYTVMLGDTAHVVVSGLRD

VRDIFIKQGASSQNRPPSRFQLLMRDGFFPGLNNGEKWRQSRRMWQAVLN

NSAAKQYLPYQELETRQLLFDLLRAPTEWRDHIERYSNSVAMTMVNGRRI

IDAADPRVKETIQDLYDLAETGVRGAFLDSWPFLWKLPEWMFPVCRQARK

IAAKHREYIWRNYSDVAKRTSQGEVLPSVNHAIQEKLKQGWPGVSEIEGA

EIGHHLLTGTTDTTASTLINWVAAMCLHPEAQKKAQEEIDRVVGPNRLPT

DADAANLPYVQQVIQEAQRWITAVPLSLPRAANAPVHWGKYTIPEETGLI

MNSHALHNDPDIFPEPDKFKPERWEGKPNASSNGDAQLLFTFGAGRRVCP

GQHLAERSLFLVISHWLWGFDTLQATDDDKNKIPIDKDDLRPGFIVCLNP

FPAKITPRTAQHRELIERIWKEELEVSLDESQQWKATPEGIARLLERVGK

*

>CYP679A1 AN9225.2 AACD01000170

poor match 53 clan

AACD01000170.1 Aspergillus nidulans FGSC A4 revised AT not AG

MTLTPLMESFHILAVLLSSQKCLMVHLSPLITAALATT

GLVLYLIATRLLFHPLAKVPGPRLAALTKWYEFYYDVVCDGEYVKHIEKLHIIY (1)

ASIIRTGPNQVHV

NDAGVYKRTFAVASPFPKSEFFYSSVGVGDAIGAMTDTKKHRVRRSILGP

RLRAKAIAPYTPSLQKLVIACMDIMAGKARQGKVINLLRYTRALTVDVIS

DFTFGRPMGVVNEAEEMPDLLNDLEVFGRHFHILKHFPISRKLLDIIPES

FARKLMPLPGFFELREKATTAVNEAVVERQAGKTISNNTDGASFLDLLLN

QIDENPSVLVDEGCAFITGGSDTTGFTMENATYLILSHPHILQSLLQELD

TSPHIRDTFDLDHILRLPFLTAIIKETLRLYTPAPSPLPRTVPAEGIDVH

GHFLPGGTILTHSLYLIHHNPVLFADPKSFKPERWLGTQGKVLEQYYVPF

SKGSRSCIGMALAYHEVYTYLSLLFSRFEMEIFETSQSDMDWREHFFVKR

NGQLRIRIVRDRWTGEAFPTRAVEADLR*

>CYP650B1 AN9248.2 AACD01000172

40% to 68a1 54 clan

MAMGNPELRTHFFRSSHEPGIPNSLRFPNGFLVTCGLPWLLLLFSVTIIL

FHPLRKKSDLPLINPGKGRIGILRGYRSRKTFTTELPRLVADGLSKASAF

RIAAPDGVNIVLAPSYAHEIAEHPDLNPGPIAGDEFNSHINGFEVFAQLG

TSDVISESVRTRLTRQLTKLTPLLTSETPLLLQSQWKDAPDWVEVSPHET

ALFILSRLSSLVFVGDDLGRNPDWIRILTSYNTEAFAAAEELNLWPQILR

PLIARLKPSCRQLRRYIRDARALLVPVLEQRRHAQSQGDRREYNDAIEWL

DETSRSTGQPYDPILSQMLLAIGSFHTSSDLLGQVLLDLCMRPDWKVLVR

ELRKEIISSLQGEGWDKIALNNLKLMDSVLKESQRLKPASTVTMGRYASR

EITLSDGTIIPKGSTVFIANVAMRDSNIYPDPDDFVPDRF

TTRREKGDSSAYLVSASPEHLGFGLGRHACPGRFFAANELKIVLSHMLMK

YDIKLPDNGA

VAPSKSGIFLATNPDARICVRRRKEEIVI*

>CYP650A1 Aspergillus nidulans AN9251.1 40% to  54 clan

revised 7/19/07

MIIFNISALGPPKPMLQFVGRELVETSRATMLRLPIDSAMHPFSTLPNHE

LGLYIMWMMSAVFVIFKLLAPAKCDIPTVNGRRRFEIGQYQARRRFSVDG

RGIILNGLQMARVFRVVSQKGPKIILGPEYANEVKSHPACNADVFIAKEF

HAHVSGFEVLRPQQVMKDAIRLRLTRSIGALMKPISAETALILESQWGNS

NCWHELDLNFTIA

SLVSRVSAVMFVGEELGRDQKWLSIVTNYSSDMFVADLDLCKWPEALR

PIATYFLPSCGKLRRHIREAALMLYPILSEGYSAHQNKQNFLDWLEEIAG

DRKYNPVLAQLSLAAAAIDTTSDLIIKTLTDICRFRDSQKLQEDLREEMV

RVLRADGWEKSAMYNLKLLDSVLKETQRVKPVVVFGMGRYVTEQITLHDG

TVISKGETINVVNTRIWDPAVYPNPLEWDPYRF

VRRRDSGDHAAHLVSPTPDHMGFGLGKHSCPGRFFAATKIKIILCHILLK

YDVKIPDEEISTVISSG

NFLFPDSTLRISVRRRQDNLTIWD*

>CYP651A1 Aspergillus nidulans AN9253.1 34% to 68D1 54 clan

revised 7/19/07

MLQETISLTPLGQPLIAGFVVVSAVLYLLYNTQQWRPNNLPLLNDGGPFD

FLQVTAVNRFRRDARRLIKSGFDS

MRTDVGVELFASPEYADQFRNHPSLKVFPFTAKMHHGHLPGFELCRSQPV

EDRILIESVRTQLAQSLGKLIQPLASDIGEAISDRWPSESGWQEIVLGSV

VERTIAQGTSSVYCLDEAWPEFVVKMEMALGMASAALSAWPVMLRRIVAK

FLPECLELYRIMKSGRELMSRDMRRRTALQASTGEEPLNFFEWFKEASHG

EEYDELILNLRIAFASMHGLCDHLVKILLRLSEDPQLVSDLRKEVIQVYE

THGWSKTALYHLKLMDSAFKEVQRVDPILFVGRVAVADVTLKDGLIIQKG

QSIRISGHTMWDEDKYPDAAHFDPYRFYRLRQAPGQENTAQFTSPTSDHL

GFGYGGRACPGRFFAAAVLKISLCHVLMKYDIKPANGETGQHVWEFAAAI

NANMTAKVLVRRRQPEIQI*

>CYP535D1 AN9296.2 AACD01000172

40% to 527C1 N-term does not match 39% 570C2 53 clan

MPLATLREPAIPLLCGLLALYVLRVIMTYAKLMRFRGPAWTGISNWPHSI

AMLRGSCHEFYAQANEKYGTRTWQPCLPILTVLNRARPNRPSRPSSAHHL

VSGGLDARQQQAWLQALRLTPADSVFGAKYSGRENTDLEFSVDKQLQNLL

DLIRAKYVSSCEQAVPMNLAKKVQYFTLDVISSVGLGKAFGMLEADRDVD

QYLQSSDEGLAIGNAALALGFSNINQAPFIGKFFAPSPKDNNGFGRLMTT

CFRFVDERAASATDKRSDMLASFIRHGLSGEELRTEALEQILAGSDTTAG

AIRGTLLHLMTNPRVYVKLQREIDDAVHRGLAPSAGQGLITAAQAKQLPY

LQAVIREALRVWPPVSNIFPRDVPKDGDTVVVNGQSIFLPGGVCIGYSAY

AMHRSEKIYGKDAKAFRPERWLLEPNPTKLALMVRTNDLIFGHGKFQCLG

KPVAQVEIGKMIFELLRNFDLALLNPTHPWDARNNLGLFTISNMWVQVTE

RTAGLL*

>CYP58D1 AN9313.2 AACD01000172

39% to 579A1 53 clan

AACD01000172.1 Aspergillus nidulans FGSC A4 revised

MNRILAVTVSALASASERLTVSIPVLLILGLVVRTIYRLYFDPLHHIPGPKLAAI

THLYEFYHDVIRGGLFIWEIEKMHREY (1)

GPIVRINPREVHIKDSQFYEEIYAPASGGRRDKDRQAVEIFSSPTA

MVATVDHDTHRIRRKLLTFFFSRRSIERLEPVVHESLSKFLDSLVAAYKE

DTVVDLIDRLQGLTGDVITQYAYGNSYGLQEPQNIGRGITKVVQEGTTQI

HLHRFFPFFERLLRVVPKWFMAQMLPARAAIYDLLNGVREQSIEALKQRD

MSAPPPKKTTMFHALTAPEVPPEERTLQRLQDEGLVLFAAGTETTATILG

VALFHILNNKEVHRKLRNELDQELPTPQAGTTWRQLEKLPYLNATIHEAL

RCSGLTMRQQRIAPTEVVKYKNYVIPPGTPVSMISHFVNMDPDIFDDPQT

FKPERWILAAEKKQNLSRFLVTFGKGNRNCIGMNLAYAELYNTLAAVVRR

FDLELYQTTEENVRFVRDMLLPRSTNGPWKVRVKVIGIREE*

>CYP687A1 AN9335.2 AACD01000172

26% to 645A1

47% to 223A1 Novosphingobium aromaticivorans bacteria

PROBABLE LATERAL GENE TRANSFER FROM BACTERIA

revised 7/18/07

MEGVVTMTEARTQSNVSVSDFSLVTDN

NPEKIYAQFAELRSRCPVARTADNGGFYLLTRYEDIKNAASNTEIFISSV

KAVIPSDPRGIRRPPLNTDPPAHTPYRTALDRTLRPKRLRRLEPVLREHA

EREFAKLVAKGGGDICGDFAAIFAAWVETTWLNLEDGTAPMLANTAAAWV

NAWRRQDAKETSEQSEKLYLIARELFADRRVSPRDPEQDPASSLLQERDT

NGQPLKDELLIGALRQSLVVGMVAPPLLFGNICNHLSRDKELQNRLRSNP

SLIPAAIEEFVRLYVPYRGFCRTPSRDVELCGRTIPAKSPITMTYAAANR

DPSIFSQPDEFILHRPNITSHLGFGRGRHRCAGMPLARMALQIGLVVILQ

QSSDFEVNGPLQYAGMPEMGISSCPLRITPRDSVEPLRQT*

>CYP584E1 AN9384.2 AACD01000172

44% to 52F6 41% to 584A1 52 clan

MALLGLLETYRDPLAFVAALSAVFYLLSCLHRRWRRYQFAKENGCEPVVG

KIPSYDPFLSLDRLYRLTKLARNRKLLENNVQRFKEFGNTHRAKRITTPM

IVTRDPQNIKAILSLKFGDYSMGDRIRIFGPLLGHGIFTSDGEDWARSRH

MIRPNFVKEQVAHLEIFEELMDDLFALIPTDGSTVDLQELFFGFTIDSAT

EFLCGHNVHSLKKRRSGVIDDEPDFAEAFNYSLDNISKNGRFGPLMFLNR

DPKAVESHRICHESMDQFVDKAIRMRERYNEE

(37aa gap)

KIVDEAAERRYMFLYGLA

QQTGDRRRIRDEVLNILLAGRDTTASLLSNMFFLLAKHPSTWAKLQEEVA

TLEGRAPTYEQLRNMKYLKYCLNETLRLFPVVPVNSRTAIRDTVLPVGGG

PDGQSPAFVPKGTMVAYSVYAMHRREDYYGADAEEFRPERWADLRPGWEY

LPFNGGPRICVGQQYALTEAAYVTTRLAQRYSILESRDPGPWEEKLTLTL

CSYNGTQVSLRH*

>CYP5116B1  Aspergillus nidulans FGSC A4

           GenEMBL AACD01000061.1

           39% to 5116A1

363827  MTARSMASTVSLYLILFVLFVLFYRRCYRSSKKPAEFRTTAECRAIIDGSQFPDARKNQLTRL  363639

363638  EARALPNQPLIGAFGIKNAFTTGNEAEAKDFVENVRRLIEVSAVDWHGLAGALQCMLESI  363459

363458  IEENRDGARVKVSLTPTVQALVLRESFWILFQMGEDAHLEFKQLADLGKITNS  363300

363299  TWVRMKEERALEFKDNIVLQACLTAVFANHKTDINILDPGSNPLKLILPSFETVWRIVL  363123

363122  RLFIVLHCHDNEDYKRALLEFVRDPTLTQFRLRPDNAVSVEFLVKEALRLYPPTRR  362955

362954  IRRAFQFPGSSPNNQISNIGRANVEACHLNEEVWGPDALEFMPARWSKMSSVQRRSFLAF  362775

362774  GGPPFLCPASHAFGPMVIGLLAGVMLDVFGKMNGYGKEWVLGSDDERDMSEVHSRERLRN  362595

362594  ERDAYGGLFLDLYSRRIDVSS*

>CYP5120B1  Aspergillus nidulans FGSC A4

           GenEMBL AACD01000093.1 new not in known set

           this p450 belongs to a group of sequences without

           Cys at heme region CYP5102, CYP5120, CYP5121 families

           weakly similar to CYP532

           38% to CYP5120A1

        MVAWA

214086  VLLLAVVAATLLHLLYNYSRLKSVSGPILAAFTDAWRANAQRSSSSSEYGRLLKELHRKY  213907

213906  GVAVRLGPGFVSLSEVGDITRVYHTLLQDE (0)

213711  YESAADTAMRNLVHTVRRCRTVDMTTLLHFFADEVNTRLFWSACA  213577

213576  PSAASSASSRTHRIQPSFSFFATIEELVLRGPVALLKRERLSCYCLSGDVSAKIYGNE  213403

213402  LVLPTGPSATRKLAISAPDGLILAASIQIITKAFVSVFFFLLNNPLIMRRLR  213247

213246  QEIESIPRFRNRTKLPSSRDLGGLYYLDAVFKETMRLVILQSQPMEVRVTFESLYISSKH  213067

213066  VPRGTVLSWHPHVVLTNDAIYENNLYVFRPERWLTPNRQRQTLMEASLLPFMVCRIHYPK  212887

212886  LEAAWLLLKKTVVVLLREFCD (0) 212824

        INLTQTEGQTVADGMELPPWSMVVDFIPRPATAEEYVGQLL*

>CYP5125A1    Aspergillus nidulans

             Genome gene number AN8437.3, 34% to XP_755777.1 Aspergillus fumigatus

             34% to Chaetomium globosum CYP5127A1 XM_001227760,

             34% to NW_001509762.1 Neosartorya fischeri

MEITAYFCGALLLLLWYRVCARQSVDKTQVQLRQNIIL (0)

VKNTPYAIPTPEAYQVHFSSATHIKQLIQAPDTHLSLHALAKD (0)

MFQPTHTMDGLAVDDCMSANGT

IHQRALQAELRSHLPALTQPLSECIARTLTKEVSQASGSLAAVGDGWRALQL

FPLAKRLVVSANALTFFGPEVSSNPIFL

NAALEYPEHMMQTAEILRLLPS (2)

ALTVLLDTLIPIIERRLYEHQSRPEQAEARVPRDCIQFFVNAV

KHKKQLDKWHAQRIVQVLLGIWFASVHQPAMCLFYALDDLCLHPEYVVPLREKISQAVQ (0)

IDISTLPLLDAFLKESARLHPTDSISVRRKALRPFTFSDGTSLAKGDVACIPLQPALQNPESYANPLTFNPHR (2)

FLKDKMTSTYIRSSRSRFTDADVAFPIWGLGKHACPGRHYASLLLKLVLAHVLLRYEIKLPDRNRRSEKRS

FYWRSAIVPRSGAVLYFRERGSCTE*