1073 sequences + 21 name change notices

note a few (~8) are alleles or different gene models

of the same gene. About 1065 different sequences.

 

Now 1423 CYP entries Jan. 22, 2009 (added A. niger)

29 of these are alleles (v2) or name changes and do not

contribute to the sequence count, which leaves 1394.

 

Added 78 from Mycosphaerella graminicola now 1472

On 1/28/09 10AM count is 1680

 

After much manual annoation of P450s from the Fungal genome database

I have 2003 named P450 sequences in this set. 2/27/2009 DRN

 

CURRENTLY (4/16/2009) THERE ARE 2582 NAMED FUNGAL P450 SEQUENCES

 

On Aug. 11 2009 after putting all these P450s into a speadsheet

There were 2527 named fungal P450s after excluding variants.

There are 164 pseudogenes.

 

 

>CYP51F1 Mgr032 Mycosphaerella graminicola

63% to CYP51F1     Aspergillus fumigatus

MGLLQEVLAQFDAQFGQTSLWKLVGLGFLAFSTLAILLNVLSQLLFRGKLSDPPLVFHWVPFIGSTITYGIDPYKFFFSCREKYGDVFTFILLGKKTTVCLGTKGNDFILNGKLKDVNAEEIYSPLTTPVFGKDVVYDCPNSKLMEQKKFVKYGLTTSALQSYVTLIAAETRQFFDRNNPHKKFASTSGTIDLPPALAELTIYTASRSLQGKEVREGFDSSFADLYHYLDMGFTPINFMLPWAPLPQNRRRDYAQKKMSETYMSIIQKRRESKTGEHEEDMIHNLMQCKYKDGNAIPDKEIAHMMIALLMAGQHSSSATESWITLRLASRPDIQDELLQEQKDMLGVNADGSIKELTYANLSKLTLLNQVVKETLRIHAPIHSILRKVKSPMPIEGTAYVIPTTHTLLAAPGTTSRMDEHFPDCLHWEPHRWDESPSEKYKHLSPTTALGSIAEEKEDYGYGLVSKGAASPYLPFGAGRHRCIGEQFAYVQLQTITATMVRDFKFYNVDGSDNVVGTDYSSLFSRPLSPAVVKWERREEKEEKN

 

>CYP51F1 Mycosphaerella fijiensis

e_gw1.3.1317.1

81% to CYP51F1 Mycosphaerella graminicola

MGLLQDAAALFDAQFGQTATWKLVPLGFSIFFAVSVLLNVLRQLLFRNPNEPPLVFHYVPFIGSTISYGIDPYKFFFACR

QKYGDCFTFILLGKKTTVVLGTKGNVFILNGKLKDVNAEEIYSPLTTPVFGTDVVYDCPNSKLMEQKKFVKYGLTSSALQ

SYVKLITKETKDFFSKDNPSKKFASTHGTVDLPPAMAELTIYTASRSLQGKEVREKFDSSFADLYHDLDMGFTPINFMLP

WAPLPQNRARDRAQKKMAEVYTAIIKERREKGEPTSGEKEQDMIWNLMQCQYKNGQAIPDKEIAHMMIALLMAGQHSSSS

TSCWILLRLASRPDIQDELLQEQKDVLGVNADGSIKELTYADISRLPLLNQVVKETLRLHAPIHSILRQVKSPMPLEGTP

YVVPTTHSLLAAPGATSRMDEHFPEAMLWEPHRWDENPSEKYAHLAPKHVKEGVAEETEDYGYGLVSKGAASPYLPFGAG

RHRCIGEQFAYVQLQTITSEVIRDFKLYNVDGSDKVVGTDYSSLFSRPLSPAVVRWERREKK*

 

>CYP51F1  Erysiphe graminis f. sp. hordei AF052515

MGISESFMFPYLQPLLQLGFGIALASGILSLLLLLTFLNVLKQL

LFKNPNEPPIVFHWIPIIGSTISYGMNPYKFFHESQAKYGNIFTFILLGKKTTVYLGR

QGNNFILNGKLRDVNAEEIYTVLTTPVFGTDVVYDCPNSKLMEQKKFMKAALTTEAFR

SYVPIIQNEVKSFIEKCDDFRKSKGIINIDAVMAEITIYTASHTLQGKEVRDRFDSSL

AVLYHDLDMGFTPINFMLHWAPLPHNRARDHAQRTVAKIYMEIINSRRTQKETDDSNL

DIMWQLMRSSYKDGTPLPDKEIAHMMIALLMAGQHSSSSSSTWIMLWLAARPDITEEL

YQEQLELLGSELPPLKYEDLSKLSLHQNVLKEVLRLHAPIHSILRKVKNPMPVPGTSY

VIPKTHSLLAAPGWTSRDASYFPNPLKWDPHRWDTGSGGVIGTDMEDEKFDYGYGLIS

TGAASPYLPFGAGRHRCIGEQFATVQLVTIMATMVRSFKHNLDGRNSVAETDYSSMF

SRPMQPATIAWEKR

 

>CYP51F1 Uncinocarpus reesii

78% to CYP51F1    Ajellomyces capsulatus

UREG_07804.1

MGVLADLFAGARQACSTQPLWTLALLGLGAFITLSVVVNVLNQILFKNPNEPPVVFHWFPVIGSTITYGIDPYNFFFSCR

EKYGDIFTFILLGKKTTVYLGTKGNDFILNGKLKDVCAEEVYSPLTTPVFGRHVVYDCPNAKLMEQKKFVKFGLTSEALR

SYVTLITREVEQYLENSPAFKGDSGILSVAKVVAEITIYTASRSLQGKEVRDKFDSSFAELYGDLDMGFAAINFMFPWAP

LPHNRKRDRAQQKMAQIYTDIIRERRAAGGEKDSEDMVWNLMSSVYKDGTPVPDIEVAHMMIALLMAGQHSSSSTGSWIV

LRLASRPDILEELYEEQLRVLGPDLPPLTYESLQRLELHSNVIKETLRIHAPIHSILRAVKSPMPVDGTKYVIPTTHNLL

AAPGVASRLPDYFPDPMLWNPHRWEKGGAVNTTGVLDEGAEEKIDYGYGLVSKGANSPYLPFGSGRHRCIGEQFAYVQLG

TITAALVRALKLKKLDGDKEIPNTDYSVSRKGICH

 

>CYP51F1 Coccidioides immitis

89% to CYP51F1 Uncinocarpus reesii

CIMG_07469.2

MGLLANVLTGVSKACSGQSPWTLVLLGICAFLTLSVFVNVLKQVFFKNPNEPPVVFHWFPIIGSTISYGIDPYKFFFSCQ

KKYGDIFTFILLGKKTTVFLGTKGNDFILNGKLKDVCAEEVYSPLTTPVFGRHVVYDCPNAKLMEQKKFVKFGLTSEALR

SYVTLITREVESYLENSPAFQGDSGVFNVAKSVAEITIYTASRSLQGKEVRDKFDSSFAELYADLDMGFAAINFMFPWAP

LPHNRKRDRAQQKMTQVYTDIIRERRKAGGKKDSEDMVWNLMSSVYKDGTPVPDVEVAHMMIALLMAGQHSSASTGSWIV

LRLASRPDILEELYQEQLRVLGPDLPPLTYESLQRLELHSNVIKETLRLHAPIHSILRAVKSPMPVDGTKYVVPTSHNLL

AAPGVPSRMADYFPEPMLWDPHRWEKGGGVNATGVQDEAAEEKVDYGYGLVSKGANSPYLPFGSGRHRCIGEQFAYVQLG

TITAALVRALKLRKLDGDKEVPDTDYSSLFSKPLGNPKVAWEKRKPSSKQ

 

>CYP51F1  Debaryomyces hansenii

75% to CYP51F1   Candida guilliermondii

CAG88416.1

MALADYSIALYNYFTSLAIVQQASIIILFPFIYNLLWQFFYSFRKDRVPLVFHWMPWVGSAVVYGMQPYEFFENCRTKYG

DVFAFVLLGKVMTVYLGPKGHEFVLNSKLQDVSAEEAYTHLTTPVFGKGVIYDCSNSRLMEQKKFAKYALTKDSFRKYVP

KIKEEVLSYFTDSENFNMKGKSSGVVNVMESQPEITIFTASRSLMGDEMRKKFDASFAQLYTDLDKGFTPINFVFPHLPL

PQYRKRDAAQQKISSTYMSLISKRRDTGDIDPSRDLIDSLMTHSTYKDGVRMTDQEIANLLIGVLMGGQHTSASTSAWFL

LHLAENPSLQDEVYEEILSVLKQKNGSFNDLDYDDLQNMPLLNNIIKETLRMHMPLHSIFRKVKNPLLVPNTQYVVPKGH

HVLVSPGYAMTNEKWFPEAAKFKPHRWDETAKATGNEDTVDYGFGAITKGVASPYLPFGGGRHRCIGEQFAYVQLGTILS

TYVYNMKWSLKDGKMPEIDYASMVTLPMEPADICWEKRENCVI

 

>CYP51F1 Pichia anomala AF019903

EFVKGALTRDAFKSYVPQIREEIIHYFQNSKNFKFGERKHGISN

VMATQPEITIFTASRSLMGKQMRERFDESFAGYYSDLDKGFTPINFVFPNLPLPSYRR

RDYAQQKISSTYMGLIKERRENNDIKDRDLIDTLMKTSTYKDGVKMTDQEIANLLIGV

LMGGQHTSAATSAWFLLHLAEKPELQEEIYQEIMKVTGGEDVTYDDLQEMPLVNNVIK

ETLRMHMPLHSIFRKVKNPLPVPGTSYVVPKGHHVLVSPGFAMTNENYFPQPEVYNPH

RWDEDSTSKAAQDSSTVDYGFGAVSKGVSSPYLP

 

>CYP51F1 Pichia stipitis

71% TO CYP51F1    Debaryomyces hansenii

JGI model e_gww1.7.1.351.1

MALLDSAIVAYNYFVSLSLTQQVLIIVFAPFIYNIVWQFLYSLRRDRAPLVFHWIPWFGSAIPFGMAPYKFFEDSRQKYG

DVFAFMLLGRTMTVYLGPKGHEFVFNSKLNETNAEDAYKHLTTPVFGKGVIYDCPNHRLMEQKKFAKYALTRDAFKTYVP

KIREEIISYFKNPEGFNMGEKNSGVANIMKTQPELTIFTASRSLLGDDMRKRFDASFAQLFSDLDKGFTPLNFVFTNLPL

PNYRKRDNAQQKISATYKSLIEKRRATGDVDPNRDLIDSLMTYSTYKDGVKMTDQEIANLLIGILMGGQHTSAATSAWFL

LHLGARPDLQDELFEEVSNILKEKGTSNLNDLSYEDLQNMTLTNNVIKETLRLHMPLHSIFRKVSKLLLVPNTNYTVPAG

HYVLVSPGYTQTSDRFFPNASTFDPHRWDSNNLADKNADEGTVDYGFGAVSKGVSSPYLPFGGGRHRCIGEQFAYVQLGT

ILSAFVYNVKWSLKGEKVPANDFTSMVVLPEEPAEIIWEKRKTCTF

 

>CYP51F1   Aspergillus fumigatus

          GenEMBL AAK73660.1 also XP_749134.1, EAL87096.1

          14-alpha sterol demethylase

          79% to 51F1 A. nidulans

MGLIAFILDGICKHCSTQSTWVLVGIGLLSILAVSVIINVLQQLLFKNPHEPPVVFHWFPFIGSTISYGI

DPYKFFFDCRAKYGDIFTFILLGKKTTVYLGTKGNDFILNGKLRDVCAEEVYSPLTTPVFGRHVVYDCPN

AKLMEQKKFVKYGLTSDALRSYVPLITDEVESFVKNSPAFQGHKGVFDVCKTIAEITIYTASRSLQGKEV

RSKFDSTFAELYHNLDMGFAPINFMLPWAPLPHNRKRDAAQRKLTETYMEIIKARRQAGSKKDSEDMVWN

LMSCVYKNGTPVPDEEIAHMMIALLMAGQHSSSSTASWIVLRLATRPDIMEELYQEQIRVLGSDLPPLTY

DNLQKLDLHAKVIKETLRLHAPIHSIIRAVKNPMAVDGTSYVIPTSHNVLSSPGVTARSEEHFPNPLEWN

PHRWDENIAASAEDDEKVDYGYGLVSKGTNSPYLPFGAGRHRCIGEQFAYLQLGTITAVLVRLFRFRNLP

GVDGIPDTDYSSLFSKPLGRSFVEFEKRESATKA

 

>CYP51F1  Aspergillus oryzae

         GenEMBL BAE60239.1

         79% to CYP51F1 Aspergillus nidulans, 60% to CYP51F4

MGILAVILDSVCERCSGSSLWMLSTVALLSILVVSVVINVLRQLLFKNYKEPPLVFHWFPFIGSTISYGM

DPYRFFFNCREKYGDIFTFVLLGKKTTVYLGTKGNDFILNGKLRDVCAEEVYSPLTTPVFGRHVVYDCPN

AKLMEQKKFVKFGLTSDALRSYVRLITEEVEDFVQKSSALQGPNGVFDVCKTIAEITIYTASRSLQGKEV

RSRFDSTFAELYHDLDMGFAPINFMLPWAPLPHNRKRDAAQKRMTETYMEIIKERRKAGSKKDSEDMVWN

LMSCMYKDGTPVPDEEIAHMMIALLMAGQHSSSSTAAWIVLHLAASPEITEELYQEQLRILGHDMPPLTY

ENLQKLDLHAKVIKETLRIHAPIHSIIRAVKNPMPVEGTPYVIPTSHNVLSSPGVTARSEEHFPDPLEWK

PHRWDEAIAVSSEDEEKVDYGYGLVTKGTNSPYLPFGAGRHRCIGEQFAYVQLGAITAALVRLFKFSNLP

GVQTLPDTDYSSLFSKPLGNSKIQFEKREPVTKA

 

>CYP51F1  Aspergillus flavus

100% to CYP51F1  Aspergillus oryzae

AFL2G_06478

MGILAVILDSVCERCSGSSLWMLSTVALLSILVVSVVINVLRQLLFKNYKEPPLVFHWFPFIGSTISYGMDPYRFFFNCR

EKYGDIFTFVLLGKKTTVYLGTKGNDFILNGKLRDVCAEEVYSPLTTPVFGRHVVYDCPNAKLMEQKKFVKFGLTSDALR

SYVRLITEEVEDFVQKSSALQGPNGVFDVCKTIAEITIYTASRSLQGKEVRSRFDSTFAELYHDLDMGFAPINFMLPWAP

LPHNRKRDAAQKRMTETYMEIIKERRKAGSKKDSEDMVWNLMSCMYKDGTPVPDEEIAHMMIALLMAGQHSSSSTAAWIV

LHLAASPEITEELYQEQLRILGHDMPPLTYENLQKLDLHAKVIKETLRIHAPIHSIIRAVKNPMPVEGTPYVIPTSHNVL

SSPGVTARSEEHFPDPLEWKPHRWDEAIAVSSEDEEKVDYGYGLVTKGTNSPYLPFGAGRHRCIGEQFAYVQLGAITAAL

VRLFKFSNLPGVQTLPDTDYSSLFSKPLGNSKIQFEKREPVTKA*

 

>CYP51F1  Aspergillus niger

         estExt_fgenesh1_pm.C_150008|Aspni1

         84% to CYP51F1

MGLLAVVLDSLCERCSNTSVLVVLGFGLLSLLAVSVIFNILRQLFFKNPNEPPLVFHWFPFIGSTISYGMDPYKFFFDCR

AKYGDIFTFILLGKKTTVYLGTRGNDFILNGKLRDVCAEEVYSPLTTPVFGRNVVYDCPNAKLMEQKKFVKFGLTSDALR

SYVRLITGEVENFVEHSAAFKGSSGVFDVCKTIAEITIYTASRSLQGKEVRSRFDSTFAELYHDLDMGFAPINFMLPWAP

LPHNRKRDAAQKKMTETYMEIIKERRNGGNKKDSEDMVWNLMSCIYKDGTPVPDEEIAHMMIALLMAGQHSSSSTASWIV

LHLARNPQIMEELYAEQIRVLGSDLPPLTYDNLQKLDLHAKVIKETLRIHAPIHSIIRAVKNPMPVDGTPYVIPTSHNVL

SSPGVTARSEEYFPNPLKWDPHRWDETIAASAEEEDQIDYGYGLVSKGTNSPYLPFGAGRHRCIGEQFAYVQLGAITAAL

VRLFKFRNLPNVKDIPETDYSSLFSKPAGKSIIQFEKRATTIKS*

 

>CYP51F1  Aspergillus clavatus NRRL 1

         XM_001273213.1, ACLA_005420

         89% to 51F1 S. fumigatus

         61% to 51F2 A. fumigatus

MGLITDILDGVCKYCSTQSIWMLGGVGLLSLLAVAVVVNVLRQL

LFKNPNEPPLVFHWFPFIGSTISYGIDPYKFFFDCRAKYGDIFTFILLGKKTTVYLGT

KGNDFILNGKLRDVCAEEVYSPLTTPVFGRHVVYDCPNAKLMEQKKFVKFGLTSDALR

SYVHLITDELESFVKSSSAFQGPKGVFDVCKTIAEITIYTASRSLQGKEVRNKFDSTF

AELYHDLDMGFAPINFMLPWAPLPHNRKRDAAQRKLTETYMEIIKARRQAGNEKDSED

MVWNLMSCVYKNGVPVPDEEIAHMMIALLMAGQHSSSSTAAWIVLRLATRPDIMEELY

QEQLRVLGSDLPPLTYDSLQKLDLHAKVIKETLRLHAPIHSIIRAVKNPMPVEGTPYV

IPTSHNVLSSPGVTARSEEHFADPLEWNPHRWDEHIVENDEDEEKIDYGYGLVNKGTN

SPYLPFGAGRHRCIGEQFAYVQLGTITAGLARLFKFRNLPDIEGIPDTDYSSLFSKPL

GKSVVQFEKREPALKA

 

>CYP51F1  Aspergillus terreus NIH2624

         XM_001212028.1

         ATEG_02850.1

MGVFADIIGTLCEHCSTLSIWALGGAVLLAVFVLSVVINVLRQL

LFKNPHEPPVVFHWVPWIGSTIRYGIDPYKFFFECR AKYGDIFTFVLLGKKTTVYLGT

KGNDFILNGKLRDVCAEEVYSPLTTPVFGRHVVYDCPNAKLMEQ KKFVKFGLTSDALR

SYARLITAEVDDFVKNSPTFQQPKGTFDVCKTIAEITIYTASRSLQGKEVRNRFDSTF

AEMYHDLDMGFAPINFVLPWAPLPHNRKRDAAQKKMAETYMEIIKER RQAGGKKDSED

MVWNLMSCVYKDGTP LPDEEIAHMMIALLMAGQHSSSSTASWIVLRLAENPEITEELY

QEQLRVLGSDLPPLTWDSLQKLDLHAKVIKETLRIHAPIHSIMRAVKNPMPVEGTPYV

IPTSHNVLSSPGVTARSEEYFSEPLKWDPHRWDETAAPSTEEEEETIDYGYGLVTKGT

NSPYLPFGAGRHRCIGEQFAYVQLGAITAALVRLFKFSNPPGANKLPDTDYSSLFSKP

LGKSYVQFEKRETNTKA

 

>CYP51F1P  Aspergillus terreus

71% to CYP51F1 Aspergillus terreus

ATEG_10302.1 revised

MGLFAAALDKICKQCSTQAIYMLSGVGVITTLVLSVVINVLIQLSFKNPNEPPVVFHWFPLIGSTISYGTDPYKFFFECRRK (0)

YGDIFTFILLGKKTTVFLGTKGNDFVLNAKLHDLCAE*VYSSLTTPVFGNHVVYDCPNFKPMKQKK (0)

FVKFGLASDALRSYVELITKEVDEYITNANAFKQPRGTIDVGKVIADITIYTASRLLQGKEVREKFDSTFAELYHDLD

MGFAPINFILPWAPLPHNCKRDAAQKKMAQTYMEIIQKRR

*SGGEKNSEDMVWNLMSCVY

KDGTPVPDIEVAHIMIALLMAGQHSSSSTISWIILRLASQPEITEQ

LYQEQIRVLGADLPPLTYENLQKLELQTNVIKETLRLHAPIHSMLRTVKYPLQVEGTSYVIPNSHNVLSSPGFTA*SPE

YFSKPLDWEPHRWNGVNATG

DDEQVDYGYGLVSKGAGSPYLPSGAGRHRCIGEQFAYVQLCAICVALVRELKFKKLPNVEDVPATNYSSLFSRP

WANSVVQYERRDAAAKD

 

>CYP51F1  Neosartorya fischeri NRRL 181

         XM_001261294.1, NFIA_024690

         98% to CYP51F1 A. fumigatus = ortholog

         63% to CYP51F2 A. fumigatus

MGLIAFILDGICKHCSTQSTWVLVGVGLLSILAVSVIANVLQQL

LFKNPHEPPVVFHWFPFIGSTISYGIDPYKFFFDCRAKYGDIFTFILLGKKTTVYLGT

KGNDFILNGKLRDVCAEEVYSPLTTPVFGRHVVYDCPNAKLMEQKKFVKYGLTSDALR

SYVPLITDEVESFVKNSPAFQGHKGVFDVCKTIAEITIYTASRSLQGKEVRSKFDSTF

AELYHNLDMGFAPINFMLPWAPLPHNRKRDAAQRKLTETYMEIIKARRQTGSKKDSED

MVWNLMSCVYKNGTPVPDEEIAHMMIALLMAGQHSSSSTASWIVLRLATRPDIMEELY

QEQIRVLGSDLPPLTFDNLQKLDLHAKVIKETLRLHAPIHSIIRAVKNPMAVDGTSYV

IPTSHNVLSSPGVTARSEEHFPNPLEWDPHRWDEDIAASAEDDEKVDYGYGLVNKGTN

SPYLPFGAGRHRCIGEQFAYLQLGTITAVLVRLFKFRNLPGVDGVPDTDYSSLFSKPL

GRSFVEFEKRESATKA

 

>CYP51F1  Ajellomyces capsulatus NAm1

         XM_001540158.1

         63% to CYP51F2 A. fumigatus

         74% to CYP51F1 A. fumigatus

MGLLADVVARVCAHCSTLSPWAFLLTGSATLIVLSVIINVLHQL

LWKNPNEPPVVFHWFPIIGSTISYGIDPYKFFLNCREKYGDIFTFVLLGKKTTVFLGT

KGNDFILNGKLKDVCAEEVYSPLTTPVFGSHVVYDCPNSKLMEQKKFVKYGLTSESLR

SYVTLITDEFNQYIKTSPAFQGDKGVLDVCKSIAEITIYTASRSLQGKEVRSKFDSSF

AQLYHDLDMGFTPINFMLPWAPLPHNRKRDAAQQKMTKIYTDIIRQRREAGGKKDSED

MVWNLMSCVYKDGTPLPDIEIAHMMIALLMAGQHSSSSTFSWIILRLASCPHIIEELY

EEQKQVLGEDLPPLTYETLQKLNLNSHVIRETLRIHAPIHSILRAVKSPMPVDGTRYT

IPTTHNLLAAPGVTSRLPEHFPNPMTWDPHRWENPAMAPEGDQSDEKLDYGYGLVSKG

ANSPYLPFGSGRHRCIGEQFAYVQLGTLLVAIVRQLKLKKLDGETGVPATDYSSLFSK

PLGKPLVAWERRNPTQK

 

>CYP51F1 Histoplasma capsulatum G217B, teleomorph: Ajellomyces capsulatus

96% to CYP51F1    Ajellomyces capsulatus NAm1

HCB02684.1 model is a fushion protein, top part deleted

MGLLADVVARVCAHCSTLSLWALLLAGSASFIVLSVIINVLHQLLWKNPNEPPVVFHWFPIIGSTISYGIDPYKFFLNCR

EKYGDIFTFVLLGKKTTVFLGTKGNDFILNGKLKDVCAEEVYSPLTTPVFGRHVVYDCPNSKLMEQKKFVKYGLTSESLR

SYVTLITDEFNQYIKTSPAFQGDKGVLDVCKSISEITIYTASRSLQGKEVRSKFDSSFAQLYHDLDMGFSPINFMLPWAP

LPHNRKRDAAQQKMTKIYTDIIRQRREAGGKKDSEDMVWNLMSCVYKDGTPLPDVEIAHMMIALLMAGQHSSSSTLSWII

LRLASCPHIIEELYEEQKQVLGEDLPPLTYETLQKLNLNSHVIRETLRIHAPIHSILRAVKSPMPVDGTRYTIPTTHNLL

AAPGVTSRLPEHFPNPMTWDPHRWENPAMAQEEDQSGEKLDYGYGLVSKGANSPYLPFGSGRHRCIGEQFAYVQLGTLLA

AIVRQLKLKKLDGETGVPATDYSPLGKPLVAWERRNPTQK

 

>CYP51F1  Venturia inaequalis strain Ent27

         GenEMBL AF227920

         14 alpha-demethylase

MGLLSPLLAXLPGSDRSWLFYTLASFGFTVAIVAANLVKQLLFS

NPNEPPVVFHWFPFFGNTVVYGIDPIKFFAECKEKHGDIFTFILLGRKTTVYIGTKGN

EFILNGKQSHVNAEEIYSPLTTPVFGSDVVYDCPNSKLMEQKKFVKYGLTTE ALKSYV

TLIQQEVEDYTKRYPQFKGEKGSFDVCASMAEITIFTASRSLQGKEVRDKFDASFADL

FHDLDMGFSPINFMLPWAPLPHNRRRDAANKKMTETYLEIIQSRKAEGVKKDSEDMIW

NLMQCVYKNGTPIPDKEIAHMMIALLMAGQHSSSSTSSWILLRLATRPDIQEELYQEQ

IRVCGADLPPLQYEDLARMPLHNQIIKETLRMHSPIHSILRAVKQPMPVEGTPYTIPT

SHVLLAAPIASGGSPMYFPAPEKWEPHRWDEGSGGTNISGGENGGEEKEDYGYGLITK

GASSPYLPFGAGRHRCIGEQFAYMQLNTVLATQVREFKFSLREGESFPKTDFSSLFSG

PLRPAWLNWERREKSS

 

>CYP51F1 Issatchenkia orientalis S75391

MPWVGSAVVYGMQPYEFFENCRKQHGDVFSFLLLGKVMTVYLGP

KGHEFVLNAKLSDVSAEDAYTHLTTPVFGKGVIYDCPNWKLMEQKKFAKVALTKESFI

RYVPLIKDEMLKYFNANFRGDSGKTDVLKSQSEMTLFTASRSLFGDALRNRLDASYAE

MYSDLDKGFTPLNFVFSYLPLPNYWKRDAAHKNISNTYLDLINTKRAGGEIKNEDLVD

ALLKNSVYKDGTRMTDEELAHLMIGVLMGGQHTSSATSAWFLLHLGEKPQLQEEIYRE

IQSVLGENFERELTYDDLQKLDLVNATIKETLRLHMPLHSIFRKVTRDLPVPNTSYIV

PKGHYVLISPGYTMLSERYFPNASEFQPHRWDEIKSIDGGISFGAEGENAKETVDYGF

GKISKGVASPYLPFGGGRHRCT

 

>CYP51F1 Uncinula necator U72657

MYIADILSDLLTQQTTRYGWIFMVTSIAFSIILLAVGLNVLSQL

LFRRPYEPPVVFHWFPIIGSTISYGIDPYKFYFDCRAKYGDIFTFILLGKKVTVYLGL

QGNNFILNGKLKDVNAEEIYTNLTTPVFGRDVVYDCPNSKLMEQKKFMKTALTIEAFH

SYVTIIQNEVEAYINNCVSFQGESGTVNISKVMAEITIYTASHALQGEEVRENFDSSF

AALYHDLDMGFTPINFTFYWAPLPWNRARDHAQRTVARTYMNIIQARREEKRSGENKH

DIMWELMRSTYKDGTPVPDREIAHMMIALLMAGQHSSSSTSSWIMLWLAARPDIMEEL

YEEQLRIFGSEKPFPPLQYEDLSKLQLHQNVLKEVLRLHAPIHSIMRKVKNPMIVPGT

KYVIPTSHVLISSPGCTSQDATFFPDPLKWDPHRWDIGSGKVLGNDAVDEKYDYGYGL

TSTGASSPYLPFGAGRHRCIGEQFATLQLVTIMATMVRFFRFRNIDGKQGVVKTDYSS

LFSMPLGTPLIGWEKR

 

>CYP51F1 Lodderomyces elongisporus

77% to CYP51F1   Candida parapsilosis

LELG_03738

MALVDLAIQGYTFFMSLTTFQQVFILIVVPFVYNIAWQLLYSLRKDRVPLVFYWIPWFGSAVGYGQQPYEFFEQCRQKYG

DVFAFVLLGKVMTVYLGPKGHEFILNAKLSEVSAEEAYKHLTTPVFGKGVVYDCPNQRLMEQKKFAKFALTTDSFRKYVP

LIREEVLNYFTSNSNFNMKNQKSGVADVMKTQPEITIFTASRSLMGKEMRSRFDESFAELYSDLDKGFTPVNFVFPNLPL

PHYWKRDAAQQKISSTYMKEITKRRQAGAIDGDEDLISSLMVHSTYKDGVKMTDQEIANLLIGILMGGQHTSASTSAWFL

LHLGDKPELQEQLYEEIQQALQSKGGNLSDLSYEDLQKMTLVNNTIKETLRMHMPLHSIFRKVMSPMVVPGTTYVVPKGH

HVLVSPGYAHTNERYYKNANQFDPHRWDNANMSNKDSDEVDYGFGKVSKGVASSYLPFGGGRHRCIGEQFAYVQLGTLLT

TFIYNIKWKLKGGHVPHVDYASMVTLPELPAEIVWEKRDTCVV

 

>CYP51F1 Candida lusitaniae

72% to CYP51F1   Candida tropicalis

CLUG_04932.1

MALAEYVAWGYAQFCSLGLLSKIALLVFTPIVFNVLWQFVYSLRKDRVPMVFHWIPWFGSAIPYGMQPYEFFESCREKYG

DVFAFMLLGRVMTVYLGPKGHEFVLNSKLADVSAEEAYSHLTTPVFGKGVIYDCPNHRLMEQKKFAKFALTKDSFQKYVP

RIQEEILDYFKSCSDFSMTERNSGVANVMKTQPELTILTASKSLMGDDMRARFDTSFAQLYSDLDKGFTPINFVFPHLPL

PAYRRRDEAQRKISATYMSLINDRRKSGDIVPDRDLIDSLMLNSTYKDGVKMTDQEIANLLIGVLMGGQHTSAATSAWFL

LHLAEKPELQEELYNEVLSVLTKKGGKITDLSYEDLQEMHLVNQTIKETLRLHMPLHSIFRKVKHNLVVPNTSYVVPKGH

HVLVSPGYAQTSERWFPKADTFDPHRWDNDWASSVSEGDAVDYGFGKITKGVSSPYLPFGGGRHRCIGEQFAYVQLGTIL

ATYVYNIKWHYAKGHSLPDVDYQSMVTLPMAPAEIVWEKRETCVI

 

>CYP51F1 Candida dublinensis

93% to CYP51F1  Candida albicans, cdub_2-g61.1, GenEMBL AJ012573

MAIVETAIDGINYFLSLSVTQQITILLGVPFVYNLIWQYLYSLRKDRAPLVFYWIPWFGSAASFGQKPYEFFESCRQKHG

DIFSFMLLGKIMTVYLGPKGHEFIFNAKLSDVSAEDAYKHLTTPVFGKGVIYDCPNSRLMEQKKFAKFALTTESFKRYVP

KIREEILDYFVNDESFKLKEKNHGVANIMKTQPEITIFTASRSLFGDDVRKLFDRSFAQLYSDLDKGFTPINFVFPNLPL

PHYWRRDAAQKKISATYMKEIKLRRERGDIDPSRDLIDSLLTHSTYKDGVKMTDQEIANLLIGILMGGQHTSASTSAWFL

LHLGEKPHLQDAIYQEVVELLKEKGGDLNDLTYEDLQKLPSVTNTIKETLRMHMPLHSIFRKVKNPLRIPETNYVVPRGH

YVLVSPGYAHTSERYFDNPNNFDPTRWDTAAAKANSVSFNSSDEVDYGFGKISKGVSSPYLPFGGGRHRCIGEQFAYVQL

GTILTTFVYNLRWTVEGNRVPDPDYSSMVVLPTEPARIIWEKRETCMF

 

>CYP51F1 Candida glabrata S75389

CAG58795.1

MSTENTSLVVELLEYVKLGLSYFQALPLAQRVSIMVALPFVYTITWQLLYSLRKDRPPL

VFYWIPWVGSAIPYGTKPYEFFEDCQKKYGDIFSFMLLGRIMTV

YLGPKGHEFIFNAKLADVSAEAAYSHLTTPVFGKGVIYDCPNHRLMEQKKFVKGALTK

EAFVRYVPLIAEEIYKYFRNSKNFKINENNSGIVDVMVSQPEMTIFTASRSLLGKEMR

DKLDTDFAYLYSDLDKGFTPINFVFPNLPLEHYRKRDHAQQAISGTYMSLIKERREKN

DIQNRDLIDELMKNSTYKDGTKMTDQEIANLLIGVLMGGQHTSAATSAWCLLHLAERP

DVQEELYQEQMRVLNNDTKELTYDDLQNMPLLNQMIKETLRLHHPLHSLFRKVMRDVA

IPNTSYVVPRDYHVLVSPGYTHLQEEFFPKPNEFNIHRWDGDAASSSAAGGDEVDYGF

GAISKGVSSPYLPFGGGRHRCT

 

>CYP51F1 Candida parapsilosis

75% to CYP51F1   Candida tropicalis

AF019902, CPAG_03310

MALVDLALHGYNYFMTLSTLQQFGLLVFAPFIYNIIWQLLYSLRKDRVPLVFYWIPWVGSAVSYGQDPYGFFEQCREKYG

DLFSFVMLGRVMTVYLGPKGHEFVFNAKLSDVSAEDAYQHLTTPVFGKGVIFDCPNARLMEQKKFAKTALTTDSFRRYVP

LIRGEILDYFTKSKVFNMKKQKSGVVDVLQSQPEITIFTASRSLLGEAMRKRFDASFAQLYADLDKGFTPINFVFPHLPL

PHYWKRDAAQQKISETYMTEIARRRETGDIDENRDLIDSLLVNSTYKDGVKMTDQEIANLLIGVLMGGQHTSATTSAWFL

LHLAEKPQLQDELYQEVLNALSGKGGNLDDLSYEDLQQMPLVNNTIKETLRLHMPLHSIFRKVVSPLVVPNTKYIVPRGH

HVLVSPGYAHTNERFYKDASDFNPHRWDESASTNDAGEVDYGFGKVSKGVSSSYLPFGGGRHRCIGEQFAYVQLGTILTT

FVYNLKWKLANGKVPDVDYTSMVTLPQHPAEIVWEKRDTCVI

 

>CYP51F1 Candida albicans X13296, orf19_922

MAIVETVIDGINYFLSLSVTQQISILLGVPFVYNLVWQYLYSLR

KDRAPLVFYWIPWFGSAASYGQQPYEFFESCRQKYGDVFSFMLLGKIMTVYLGPKGHE

FVFNAKLSDVSAEDAYKHLTTPVFGKGVIYDCPNSRLMEQKKFAKFALTTDSFKRYVP

KIREEILNYFVTDESFKLKEKTHGVANVMKTQPEITIFTASRSLFGDEMRRIFDRSFA

QLYSDLDKGFTPINFVFPNLPLPHYWRRDAAQKKISATYMKEIKSRRERGDIDPNRDL

IDSLLIHSTYKDGVKMTDQEIANLLIGILMGGQHTSASTSAWFLLHLGEKPHLQDVIY

QEVVELLKEKGGDLNDLTYEDLQKLPSVNNTIKETLRMHMPLHSIFRKVTNPLRIPET

NYIVPKGHYVLVSPGYAHTSERYFDNPEDFDPTRWDTAAAKANSVSFNSSDEVDYGFG

KVSKGVSSPYLPFGGGRHRCIGEQFAYVQLGTILTTFVYNLRWTIDGYKVPDPDYSSM

VVLPTEPAEIIWEKRETCMF

 

>CYP51F frag. Candida guilliermondii X97680

this seq is 94% to Candida albicans but only 66% to

full length CYP51A1 for C. guilliermondii

This is a different gene

MTDQEIANLLIVILMGGQHTS--TSAWFLLHLGEKPHLQDVIYQEV

VELLKEKGGDLNDLTYEDLQKLPSVNNTIKETLRMHMPLHSTFRKVTNPLRSPNKYMS

SHTVYMFKFL

 

>CYP51F1 Candida guilliermondii

71% to CYP51F1   Candida lusitaniae

PGUG_03415.1

MAIADIATWVYSEFRGLPVSAQISIVVLFPFVYNLLCQFWYSLQKDRAPLVFHWVPWLGSSVVYSMQPYEFFESCRQKYG

DVFSFVMVGRVMTVYLGPKGHEFVFNSKATDVSAEDAYTHLTTPVFGKGVIYDCPNSRLMEQKKFAKFALTKDSFIKYVP

KIQDEVLSYFVEHDFKMKEKDSGVVNVMKTQPEITIFTASRSLMGDEMRKRFDTSFAQLYSDLDKGFHPIHFAFPHLPLP

MSRNRDRAQQKISATYKGLIDTRRSSGNIDPTRDLIDSLMATSTYKDGVKMTDQEIANLLIGILMGGQHTSAATSAWFLL

HLGERPDLQEEMYKEICGVFEKKNKSFKDLSYDDLQEMPLVNNVIKETLRMHMPLHSIFRKVKKPLLVPGTKYTVPKGHY

VMVSPGYAMVNDRWFPDAASFNPRRWDEQPLPTDGQDETVDYGFGNISKGVSSPYLPFGGGRHRCIGEQFAYVQLGTILA

SYVYNVTWELKDKLPGVDYASMVTLPLEPADIVWKKRRTCVF

 

>CYP51F1 S. pombe Z54096

MAFSLVSILLSIALAWYVGYIINQLTSRNSKRPPIVFHWIPFVG

SAVAYGMDPYVFFRECRAKYGDVFTFVCMGRKMTAFLGVQGNDFLFNGKLADLNAEEA

YSHLTTPVFGKDVVYDIPNHVFMEHKKFIKSGLGFSQFRSYVPLILNEMDAFLSTSPD

FGPGKEGVADLLKTMPVMTIYTASRTLQGAEVRKGFDAGFADLYHDLDQGFSPVNFVF

PWLPLPRNRRRDRAHKIMQKTYLKIIKDRRSSTENPGTDMIWTLMSCKYRDGRPLKEH

EIAGMMIALLMAGQHTSAATIVWVLALLGSKPEIIEMLWEEQKRVVGENLELKFDQYK

DMPLLNYVIQETLRLHPPIHSHMRKVKRDLPVPGSKIVIPANNYLLAAPGLTATEEEY

FTHATDFDPKRWNDRVNEDENAEQIDYGYGLVTKGAASPYLPFGAGRHRCIGEQFAYM

HLSTIISKFVHDYTWTLIGKVPNVDYSSMVALPLGPVKIAWKRRN

 

>CYP51F1 Schizosachharomyces japonicus

78% to Schizosachharomyces pombe CYP51A1  SJAG_03750

MVVSMVSILLSVGLAWYVGYIANQIFNRDPKRPPVVFHWFPFIGSAVTYGIDPYVFFRQCRAKYGDVFTFVLMGRKITAY

LGVKGNDFLFNGKLADLSAEEAYSHLTTPVFGKDVVYDVPNHVLMEHKKFIKSGLGFDQFRAYVPLIVNEMHDFLAKAPT

WGPGKSGVADLLATMPVMTIYTASRTLQGEEVRAGFNAGFADLYHDLDQGFTPINFIFPWLPLPRNKRRDRAHNIMAETY

LNIIKKRRAAHENPGTDMIWTLMGSRYRDGRPLKDHEIANMMIALLMAGQHTSAATIMWILSLLGSKPEVIEMLYEEQKR

VFGKELRPLDFDSYKDLHLVNYVIREALRLHPPIHSIMRKVKRNLAVPGTKIVIPAGHHLLAAPGVTATDEEFFAHAKDF

DPERWNSRVNEDEGDVERVDYGYGLVTKGAASPFLPFGAGRHRCIGEQFATMHLCTLVSTFVREYKWTTVGGVPKVDYSS

MVALPLGPVKIAWERRE

 

>CYP51F1 Schizosachharomyces octosporus

SOCG_01956

MAISLLPLVLSGILAWYVGYILNQITNRNPKRPPIVFHWVPFFGSAIPYGIDPYAFFHECREKYGDVFTFVCMGRKMTAY

LGVKGNDFLFNGKLADLSAEEAYSHLTTPVFGKDVVYDVPNHVLMEHKKFIKSGLGFPQFRSYVPLILNEMDAFLNTSPE

FGPGKEGIADLLKTMPVMTIFTASRTLQGAEVREGFDAGFADLYHDLDQGFSPINFVFPWLPLPRNRRRDRAHNIMQQTY

LNIIKQRRSSPENPGSDMIWTLMNSKYRDGRNLKEHEIAGIMIALLMAGQHTSAATIMWALTLLGSKPEVIEMLYEEQKR

VLGEGENFHVDFDKYKDLPLLNYVIRETLRLHPPIHSIMRKVKRDLPVPDSKMVIPAGSHLLAAPGYSATHEDFFTHAKE

FCPERWGERPDDEENAEQIDYGYGLVSKGGSSPYLPFGAGRHRCIGEQFAYMHLTTIICKFVHDYTWTTVGKVPDVDYSS

MVALPLAPVKIAWKRRD

 

>CYP51F1 Pneumocystis carinii

AY228706 58% to CYP51F1 S. pombe

contig_349-snap.1 from Fungal Genome DB

contig_349-snap.2 from Fungal Genome DB

MGFLKTILKVLGIENFTLSFVIIILTFFFLLHIFPQLYQKDSSK

PPVVFHWLPFIGSTIQYGMDPYKFFQKQKKKHGNIFTFILLGKKMTVALGPKGNDILF

NGKLSSLSAEEAYTHLTTPVFGTDVVYDVPNHVLMEQKKFVKTGFTIETFRAYVPLII

EEVKTYLETSPIFGKDKLSGVSSLMKALPEITIFTASRTLQGKEVRSNFDASFAKLYH

DLDGGFTPINFLAPWLPLPKNRLRDAAQKKMAQIYMNIIKQRRKTCQHEEKDMIWNLM

NQHYKDGRKLTDKEIAHLMIAILMAGQHTSAATGCWALLHLAEKPEYIKLLLEEQKRV

FGDNLDDLTYDNLKDMELLSYVIKETLRLHPPLHSIIRKVKSPILIENSPYIVPKNHY

LLAAPGVSSVDEEYFENALEFIPERWKCEKNTEDSDKIDYGYGLVTKGAFSPYLPFGA

GRHRCIGEQFAYMQLGTIITIFVHELEWTLPKNQITIPKPDYTSMVVLPERPSNIEWR

RRQKR

 

>CYP51F1 Yarrowia lipolytica

63% to CYP51F1   S. cerevisiae

CAG82748.1

MIILTTLNNMGIPVEGWHILAGLAILAVITEIYVIGSQLLARRNKTLAPMAFYWIPWVGSSIPYGIDPYEFFEDCRNRYG

DVFSFYMLGRVMTVSLGTKGHEFVFNSKLADVSAEEAYTHLTTPVFGTGVIYDCPNSRLMEQKKFCKGALTRDAFRSYVP

KIVEEVTNFFAVNFEGKTGKADVMTTQPQMTIFTASRCLLGDEIRSKLNGDFAKLYSDLDNGFTPINFVFPNLPLPSYRK

RDLAQQKIRDTYMSVIQRRRMEKDVQDRDLIDALLKNHTYKDGKRMTPQEIAHLLIGVLMGGQHTSASTSAWMLLRLGLD

PAIQDELYQEQVDILGEADGSFRQPTYEDILTMTKLQNTIKETLRLHMPIHSIFRQVMRDLPVPGTSFVVPKGHFVMASP

GYSQQAERYFPNAKKFDPRRWMTPTEKMAESETDAEAGETVDYGFGAISKGVSSPYLPFGGGRHRCIGEQFANCQLTTLM

SCYIQNFKWTVPEGSKLPAVDTTSMITLPVHPSYIVWSKRERN

 

>CYP51F1 S. cerevisiae yeast M15663 U10555

MSATKSIVGEALEYVNIGLSHFLALPLAQRISLIIIIPFIYNIV

WQLLYSLRKDRPPLVFYWIPWVGSAVVYGMKPYEFFEECQKKYGDIFSFVLLGRVMTV

YLGPKGHEFVFNAKLADVSAEAAYAHLTTPVFGKGVIYDCPNSRLMEQKKFVKGALTK

EAFKSYVPLIAEEVYKYFRDSKNFRLNERTTGTIDVMVTQPEMTIFTASRSLLGKEMR

AKLDTDFAYLYSDLDKGFTPINFVFPNLPLEHYRKRDHAQKAISGTYMSLIKERRKNN

DIQDRDLIDSLMKNSTYKDGVKMTDQEIANLLIGVLMGGQHTSAATSAWILLHLAERP

DVQQELYEEQMRVLDGGKKELTYDLLQEMPLLNQTIKETLRMHHPLHSLFRKVMKDMH

VPNTSYVIPAGYHVLVSPGYTHLRDEYFPNAHQFNIHRWNNDSASSYSVGEEVDYGFG

AISKGVSSPYLPFGGGRHRCIGEHFAYCQLGVLMSIFIRTLKWHYPEGKTVPPPDFTS

MVTLPTGPAKIIWEKRNPEQKI

 

>CYP51F1 Saccharomyces paradoxus

98% to 51F1 S. cerevisiae Spar_10379

MSATKSIVGEALEYVNIGLSHFLALPLAQRISLIIITPFIYNIVWQLLYSLRKDRPPLVFYWIPWVGSAVVYGMKPYEFF

EECQKKYGDIFSFVLLGRVMTVYLGPKGHEFVFNAKLADVSAEAAYAHLTTPVFGKGVIYDCPNSRLMEQKKFVKGALTK

EAFKSYVPLIAEEVYKYFRDSKNFRLNERSTGTIDVMVTQPEMTIFTASRSLLGKEMRQKLDTDFAYLYSDLDKGFTPIN

FVFPNLPLEHYRKRDHAQKAISGTYMSLIKERRKNNDIQDRDLIDSLMKNSTYKDGVKMTDQEIANLLIGVLMGGQHTSA

ATSAWILLHLAERPDVQQELYEEQMRVLDGGKKELTYDLLEEMPLLNQTIKETLRMHHPLHSLFRKVMKDMHVPNTSYVI

PAGYHVLVSPGYTHLRDEYFPHAHQFNIHRWNNDSASSYSVGEEVDYGFGAISKGVSSPYLPFGGGRHRCIGEHFAYCQL

GVLMSIFIRTLKWHYPEGKSVPPPDFTSMVTLPTGPAKIIWEKRNPEQKV

 

>CYP51F1 Saccharomyces mikatae

96% to CYP51F1   S. cerevisiae Smik_9639

MSATKSIVGEALEYVNIGLSYFLALPLAQRISLIIITPFIYNIVWQLLYSLRKDRPPLVFYWIPWVGSAIAYGMKPYEFF

EECQKKYGDIFSFVLLGRVMTVYLGPKGHEFVFNAKLADVSAEAAYAHLTTPVFGKGVIYDCPNSRLMEQKKFVKGALSK

EAFKSYVPLIAEEVYKYFRDSKNFRLNERSTGTIDVMVTQPEMTIFTASRSLLGKEMRQKLDTDFAYLYSDLDKGFTPIN

FVFPNLPLEHYRKRDHAQKAISGTYMSLIKERRKNNDIQDRDLIDSLMKNSTYKDGVKMTDQEIANLLIGVLMGGQHTSA

ATSAWILLHLAERPDVQQELYEEQMRVLDGGKKELTYDLLEEMPLLNQAIKETLRMHHPLHSLFRKVMKDMHVPNTSYVI

PEGYHVLVSPGYTHLRDEYFPHAHQFNIHRWNNDAASSYSVGEEIDYGFGAISKGVSSPYLPFGGGRHRCIGEHFAYCQL

GVLMSIFVRTLKWHFPEGKTVPSPDFTSMVTLPTGPAKIIWEKRDPEQKI

 

>CYP51F1 Saccharomyces kudriavzevii

96% to CYP51F1   S. cerevisiae Skud_Contig2067.14

MSASKSIVGEALEYVSIGLSYFLALPLAQRISLIIIAPFIYNIVWQLLYSLRKDRPPLVFYWIPWVGSAIPYGTKPYGFF

EQCQKKYGDIFSFVLLGRVMTVYLGPKGHEFVFNAKLADVSTEAAYSHLTTPVFGKGVIYDCPNSRLMEQKKFVKGALSK

EAFKSYVPLIAEEVYKYFRDSKNFRLNERSTGTIDVMVTQPEMTIFTASRSLLGKEMREKLNTDFAYLYSDLDKGFTPIN

FVFPNLPLEHYRKRDHAQKTISGTYMSLIKERRKNNDIQDRDLIDSLMKNSTYKDGVKMTDQEIANLLIGVLMGGQHTSA

ATSAWILLHLAERPDVQQELYDEQMRVLDGGKKELTYDLLEEMPLLNQTIKETLRMHHPLHSLFRKVMKDMHVPNTSYVI

PAGYHVLVSPGYTHLRDEYFPQAHQFNIHRWNNDAASSYSVGEEIDYGFGAISKGVSSPYLPFGGGRHRCIGEHFAYCQL

GVLMSIFVRTLKWHFPEGKSVPPPDFASMVTLPTGPAKVIWEKRNPEQKI

 

>CYP51F1 Saccharomyces bayanus

93% to CYP51F1 S. cerevisiae Sbay_23211

MSATKSIVAEALEYVNIGLSHFMGLPLAQRISLVIIAPFIYNIVWQLLYSLRKDRPPLVFYWIPWVGSAVTYGMKPYEFF

EQCQKKYGDIFSFVLLGRVMTVYLGPKGHEFVFNAKLADVSAEAAYAHLTTPVFGKGVIYDCPNSRLMEQKKFVKGALSK

EAFKSYVPLIAEEVYKYFRDSKNFRMNEKSSGTIDVMITQPEMTIFTASRSLLGKEMRQKLDTDFAYLFSDLDKGFTPIN

FVFPNLPLEHYRKRDHAQRAISGTYMSLIKERRKNNDIQDRDLIDSLMKNSTYKDGVKMTDQEIANLLIGVLMGGQHTSA

ATSAWILLHLAERPDVQEELYEEQMRVLDGGKKELTYDLLEQMPFLNQTIKETLRLHHPLHSLFRKVMKDMHVPNSSYVI

PEGYHVLVSPGYTHLRDEYFPHAHEFNIHRWNNDASSSYSVGEEVDYGFGAISKGVTSPYLPFGGGRHRCIGEHFAYCQL

GVLMSIFVRTMKWHFPEGKSVPSPDFTSMVTLPIGPAKIIWEKRNPEQKI

 

>CYP51F1 Saccharomyces castellii

78% to CYP51F1 S. cerevisiae Scas_Contig699.20

MSDSITEAGNSSLIGQVFQYLQLAFQIFQSLPLAQRISLIVLAPFLYSITWQFIYSFRKDRPPLVFYWIPWVGSAVPYGH

KPYVFFENCQKKYGNIFSFMLLGRIMTVYLGPKGHEFIFNAKLADVSAEDAYSHLTTPVFGKGVIYDCSNSRLMDQKKFV

KGALSKEAFKRYVPLFKEEILKYFKDSNNFKFNQREKGEIDVMVTQPEMTIFTASRTLLGKEMRDKLDTDFAYLYSDLDK

GFTPINFVFPNLPFLEHYKKRDNAQRTIASTYLSLIKKRRANNDIQDRDLIDTLMKNSTYKDGVKMTDPEIANLLIGVLM

GGQHTSAATSAWCLLHLAERPDVQEELYQEQMRVLDNGKKEITYDLLEQMPLLNQMIKETLRLHHPLHSLFRKVIRDMQV

PNTSYVIPKDYFVLVSPGYTHLQEHYFPQAHSFNIHRWDNDAESSYVVGEEVDYGFGAITKGVTSPYLPFGGGRHRCIGE

HYAYCQLGVIMAEFIREMKWHFPSKDQTVPVSDFTSMVTLPTGPAKIVWEKRVPHETV

 

>CYP51F1  Saccharomyces kluyveri

79% to CYP51F1 S. cerevisiae  Sklu_Contig2436.11

MSSNKVSIVQTAFEYVQLGFSHFLNLSLAQQISLVVLFPFFYSIVWQLLYSLRKDRVPMVFYWIPWVGSAVGYGTRPYEF

FAECQKKYGDVFSFMLLGRVMTVCLGPKGHEFVLNAKLADVSAEAAYTHLTTPVFGKGVIYDCPNNRLMDQKKFAKGSLT

RDSFKVYVPKIIDETYKYFRNSKNFLLNQNKSGVANVMETQPEMTIFTASRSLLGEEMRAKLDTDFAYLYSDLDKGFTPI

NFVFSHLPLESYRKRDRAQQLISSTYMSLIRKRRENNDIQDRDLIDALMKNSTYKDGVKMTDQEIANLLIGVLMGGQHTS

AATSAWLLLHLAEKPELQEELYAEQMRVLDNGKKELTYDLLQEMPLLNQTIKETLRMHHPLHSIFRKVMRDLPVPNTSYV

VPKGHHVLVSPGYAHLRDEYFPHAATFDPHRWDNDAASSYSSSEQVDYGFGSVSKGVSSPYLPFGGGRHRCVGEHFAYCQ

LGTIMSVYIRTLKWSFPPEMKGVPSPDFQSMVTLPCEPAKIKWEKREPAQTI

 

>CYP51F1  Kluyveromyces waltii

77% to CYP51F1 S. cerevisiae kwal_154-g13.1

MDSTNSSVVGKIFSKGIEIGSALLSRFLALSIAQQASLIIAAPFVYVIVWQFLYSMRKDRVPLAFYWIPWVGSAVTYGMR

PYEFFAECQEKYGDVFSFVLLGRVMTVCLGPKGHEFVLNAKLADVSAEAAYTHLTTPVFGKGVIYDCPNARLMEQKKFVK

GALSTESFRGYVPLIAEEVYQYFRNSKNFDMNHKKSGVANVMVTQPEMTIFTASRSLLGKEMRNLLNTDFAYLYSDLDKG

FQPINFVFSHLPLEHYRKRDHAQQTISSTYMKLIKQRRENNDIQDRDLIDTLMKNSTYKDGTKMTDQEIANLLIGVLMGG

QHTSAATSAWMLLHLAERPDLQEELYAEQMEVLDNGKKELTYELLQQMPLLNQTIKETLRMHHPLHSIFRRVERDLPVPK

TQYVVPRGHFVLVSPGYCHLQDEYFPKANTFDPHRWNNDYKSSYATGEEVDYGFGAISKGVSSPYLPFGGGRHRCIGEHF

AYCQLGVLMSVYIRTVKWKFTPKMHGVPKPDFASMVTLPLCPAEIEWEKRDPQQAL

 

>CYP51F1 Ashbya gossypii ATCC 10895

71% to CYP51F1 S. cerevisiae, NP_984259.1

MSESLLQTVVAYVELVLHHFMALSWTQQLSIVIVAPFIYSLVWQTLYSFRKDRVPLVPFMVPWVGSALAYGRAPYEFFGK

CQQKYGDVFAFMLLGRVMTVYLGTKGHEFILNAKLAEVSAEEAYTKLTTPVFGEGVVYDCPNHRLMEQKKFCKNALSTEA

FRRYVPMVMDEVRKYLRTSKHFMMNERSSGVVNVMETQPEMTIFTASRSLLGAEMHSMLDADFAYLYADLDKGFTPLNFV

FRDLPLDNYRRRDNAQRTISSTYMKVIERRRKNNDVQDRDLIDALMTSAQYKDGVKMTDQQIANLLIGVLMGGQHTSAAT

SAWVLLHLAERPDIQEELYEEQMRVLDGGAKELTYELLQEMPLLNQVIKETLRMHHPLHSLFRKVTRDMPVPNTSYVIPK

DHYVLASPGFCHLSEEYFPNAKEFNPHRWDNDAASSVSTGEKVDYGFGAISKGVSSPYLPFGGGRHRCIGEGFAYMQLGT

IFSVVVRSMKWHFPADMKGVPNPDFTSMVTLPSEPCRIAWERRVPDQII

 

>CYP51F1 Kluyveromyces polysporus

Kpol_1004p61

81% to CYP51F1 S. cerevisiae

MSDQSIVASLAEYVTIGLSYFMSLPLSQRISIVFIAPFIYSITWQLLYSLRKDRPPLVFYWIPWVGSAVTYGSKPYQFFG

DCQKKYGDCFSFMLLGRIMTVYLGPKGHEFVFNAKLADVSAEAAYAHLTTPVFGKGVIYDCPNHRLMDQKKFVKGALTKE

AFARYVPLMVEEMVKYLRSSPFFKINEKSEGTVNVLATQSEMTIFTASRSLLGKEMRDKLDTDFAYLYSDLDKGFTPINF

VFPNLPLEHYRKRDNAQRVISSTYLSLIKKRRDENDIQDRDLVDTLMKNSTYKDGVKMTDKEIANLLIGVLMGGQHTSAA

TSAWALLHLAERPDVQKELYEEQMRVLDNGKKELTYDLIQEMPLLNQCIKETLRLHHPLHSIFRKVMKDMKVPNTSYVVP

KDYYVMVSPGYTHLQDEYFPNAKQFNMHRWDNDATSSYSVGEEIDYGFGVVTKGVSSPYLPFGGGRHRCIGEHFAYCQLG

VLMSIFIRTMTWKFPEGRTVPNSDFQSMVTLPLNPADIIWTKRDAAQVI

 

>CYP51F1 Kluyveromyces lactis

76% to CYP51F1 Saccharomyces kluyveri

KLLA0E03553g

MSTKSESVVVKVFEAAQAVLGQFLAFSIAQQISIVILLPFVYTIVWQLLYSMRKDRVPLVFYWIPWVGSAVSYGMRPYEF

FEECREKYGDIFAFVLLGKVMTVYLGPKGHEFILNAKLADVSAEAAYTHLTTPVFGNGVIYDCPNHRLMDQKKFVKGALT

TDAFRKYVPLIAEEVQKYFLTSKNFSIGEKDHGKINVMVTQPEMTIFTASRSLLGSEMREKLNTDFAYLYSDLDKGFTPL

NFVFSHLPLDNYRKRDNAQRVISSTYLSLIKKRRDTNDIQDRDLIDSLMKNSTYKDGVKMTDQEIANLLIGVLMGGQHTS

AATSAWVILHLAERPDIQEKLYEEQMKVLDNGTKELTFDLLQEMPLLNQTIKETLRLHHPLHSLFRKVMNDMPVPNSSYV

VPKGHHVLVSPGYCHLQDKYFPNASEFNPNRWDNDAASSYASNEKVDYGFGSISKGVSSPYLPFGGGRHRCIGEHFAYMQ

LGTILSNYIRTLTWKFADPSATVPTPDFQSMVTLPLEPSEIEWTLRK

 

>CYP51F1  Kluyveromyces marxianus X97682

88% to CYP51F1   Kluyveromyces lactis

MTDQEIANLLSILMGGQHTSAATSAWAILHLAERPDVQQELYEE

QMRVLDNGKKELTYDLLQEMPFLNQTIKETLRLHHPLHSLFRKVMNDMPVPNTSYVVP

KGDHVLVSPG

 

>CYP51F1 Fusarium graminearum FG01000.1 AACM01000048 FGcontig1.48_scaffold1

MGLLQELAGHPLAQQFQELPLGQQVGIGFAVFLVLSVVLNVLNQLLFRNP

NEPPMVFHWFPFVGSTITYGMDPPTFFRENRAKHGDVFTFILLGKKTTVA

VGPAGNDFILNGKLKDVCAEEIYTVLTTPVFGKDVVYDCPNAKLMEQKKF

MKIALTTEAFRSYVPIISSEVRDYFKRSPDFKGKSGIADIPKKMAEITIF

TASHALQGSAIRSKFDESLAALYHDLDMGFTPINFMLHWAPLPWNRKRDH

AQRTVAKIYMDTIKERRAKGNNESEHDMMKHLMNSTYKNGIRVPDHEVAH

MMIALLMAGQHSSSSTSSWIMLRLAQYPHIMEELYQEQVKNLGADLPPLT

YEDLAKLPLNQAIVKETLRLHAPIHSIMRAVKSPMPVPGTKYVIPTSHTL

LAAPGVSATDSAFFPNPDEWDPHRWEADSPNFPRMASKGEDEEKIDYGYG

LVSKGSASPYLPFGAGRHRCIGEHFANAQLQTIVAEVVREFKFRNVDGGH

TLIDTDYASLFSRPLEPANIHWERRQ*

 

>CYP51F1 Aspergillus nidulans AN8283.1 51 clan

MGLVSLVLDNVCERCSALSVWALSGLGLLSVIIIAVVLNVLRQILFKNPN

EPPVVFHWFPFIGSTISYGIDPYKFFFNCRAQYGDIFTFVLLGKKTTVYL

GTKGNDFILNGKLKDVCAEEVYSPLTTPVFGRHVVYDCPNAKLMEQKKFV

KYGLTSDALRSYVQLITAEVEDFAQKSSVFQNAKGVFDVSRTIAEITIYT

ASRSLQGKEVRDKFDSTFAELYHDLDMGFAPINFMLPYAPLPHNRKRDAA

QRKMAETYMEIIKERRKSGEKKDSEDMVWNLMSCVYKNGTPLSDEEIAHM

MIALLMAGQHSSSSTLSWILLHLARHPEIVEELYQEQLKVLGSDMHMTYD

DLQKLELHSKIIKETLRIHAPIHSIIRAVKSPMPVPGTSYVIPTSHNVLS

SPGVTARSDEFFPNPLKWDPHRWDSNPIANSTEDEEKIDYGYGLVSKGTN

SPYLPFGAGRHRCIGEQFAYVQLITVTAALVRLFKFDTVSESDKSSVPET

DYSSLFSRPAGKCFVQYEKRNVTTKA*

 

>CYP51F1 Nectria haematococca fgenesh1_pg.scaffold_2000426

89% to CYP51F1 F. gram.

Necha1/scaffold_2:1348428-1350174

89% to Fusarium graminearum  CYP51F1

FG01000.1 AACM01000048 FGcontig1.48_scaffold1

This gene model seems correct DRN 2/4/06

MGLLHEIAGHPLAQQFQELPLGQQVGIGFGAIVVLSVILNILSQILFVNPNEPPMVFHWFPFIGSTVTYG

MDPPRFFKENRAK (0)

FGDVFTFVLLGKKTTVAVGPSGNDFILNGKLKDVCAEEIYTVLTTPVFGKDVVYDCPNAKLMEQKK (0)

FMKIALTTEAFRSYVPIISGEVRDYFKKSADFKGKTGIVDIPKKMAEITIFTASHALQGSV

IRSKFDESLAALYHDLDMGFTPINFMLHWAPLPWNRKRDHAQRTVAKIYMDTIRERRIKDNDDSEHDMMK

HLMNSTYKNGTPVPDHEIAHMMIALLMAGQHSSSSTSSWIMLRLAQYPQIMEELYQEQVKALGADLPPLK

FEDLAKLPLNQAIIKETLRLHAPIHSIMRAVKSPMPVPGTKYVIPTSHTLLAAPGVSASDPAYFPNPDEW

DPHRWEAGSPNAPTIARNNAEEEEKIDYGYGLVSKGSASPYLPFGAGRHRCIGEHFANVQLQTIVAEVVR

EFKFSNVDGGNTLIGTDYASLFSRPLEPANIRWERRQ*

 

>CYP51F1 Magnaporthe grisea MG04432.4  75% to CYP51 AACU01001110 cont2.837

MGLLQDTTGPLVDAFYQLGTGAQVGVAFVSFIFLSVFFHVAQQIFFKNPH

EPPVVFSWFPVVGSTVTYGKDPPQFFRDMAKKYGNIFTFILLGKKTTVYI

GTEGNEFILNGKLRDVNAEEIYGPMTTPVFGKDVVYDCPNAKLMEQKKFM

KIALTTEAFRSYVPIIADEVSSYLKRTPAFKGPSGVVNIPPKMAEITIFT

ASHALQGKEIRDQFDETLADLYHDLDMGFHPVNFKLHWLPLPRNIRRDKA

QKTIAKIYMDTIQRRRAKGKDSEAKDMMYHLMNSTYKNGTPVPDHEIAHM

MIALLMAGQHSSSSTSSWIMLRLASRPDIMEELYQEQVRALGADLPPLRY

EDLANLPLHLAVIKETLRLHAPINSILRAVKQDLPVPGTNYVIAKDTTVL

AAPGYSAGDPNHFPEPELWEPHRWEADSRLAPRISMSNDNDEEEKIDYGY

GLVSKGTTSPYLPFGAGRHRCIGEHFANVQLQTIVAMIVREFKFRNVDGS

GKVVGTNYASLFSRPEEPAKIYWERR*

 

>CYP51F1 Ustilago maydis Z48164

MVASSSSATASLLDQLFALTPLADSSAWIKTITVLVLLPLLAVV

LNVASQLLLATPKNHPPVVFHFVPVIGSAIYYGIDPYKFFFECREKYGDVFTFVLLGR

KITVALGPKGSNLVFNAKHQQVTAEDAYTHLTTPVFGKEVVYDVPNAVFMEQKKFVKV

GLSIENFRVYVPQIVDEVREYIKSDARFSALKTRKTITVDIFQAMSELIILTASRTLQ

GKEVRQGLDKSFAQLYHDLDSGFTPINFVIPNLPLPSNFKRDRAQKKMSQFYQDIVAK

RRAAGASTSADDASGENDMIAALIEQKYKNGRALSGVEIAHMMIALLMAGQHTSSATS

SWAFLRLASRPEIIEELYEEQLNVYSDGHGGLRELDYETQKTSVPLLDAVVKETLRLH

PPLHSIMRYVKSDLAVPPTLSSPTSTKSEPDAHYVIPKGHYIMAAPGVSQVDPQIWKS

SDQFDPHRWLDATTAAAMQDSGEDKQDFGFGMISTGANSPYLPFGAGRHRCIGEQFAY

LQIGVILATFVRIFKWHLDSKFPDPDYQSMVVLPSKNGCAIVLTPRAESLHLD

 

>CYP51F1 Puccinia graminis f. sp. tritici

55% to CYP51F1   Malassezia globosa with a short seq gap.

PGTG_07202 revised

MSSLIDPLIEFIGSFSTFNQILIYFLLSITSIISINIFNQLAIPKDPTTPPVVFHLFPFIGSAVSYGIDPYAFLESCRKK

YGNVFTFVLLNKKVTVALGLEGNALILNGKLSQVNAEEAYTAL (1)

TATPVFGTKMVYDVPNAILMXXXXXXXXXXXXX

NFRKYVTLIADETISYLEDHVFE (1)

KPKTQQAVKDCFKVASEITICTAS

ATLQGPEVREGLNKSFANLYHDLDGGFTPLHFAFPNLPLPSYRRRDRAQVAMRNFYMNIIQKRREDNREGQLGDMIDSLQ

GQTYKDGRPLTDKEIAHIMIALLMAGQHTSAATGSWLLLHLASRPDIVAELRQEQIEVFGKPGQTDDKELDPLDLERVQS

PLMLACIKEVLRLHPPIHSIMRKVKSPITVPRTLASHNEDTPYIIPSSNFVLAAPGASQIDPAIWSSPHEFEPSRWLKLT

SPFKAGGGETQEEMVDYGFGMISSGANSPFLPFGAGRHRCIGEQFAYLQLSTLGATVIRNCELELVSNQFPKPDYTTMLV

CPIKPRDVKFTRRNTHS

 

>CYP51F1 Sporobolomyces roseus

55% to CYP51F1   Ustilago maydis, e_gw1.1.480.1

MGLATLALTAVLYFAGASLSIVALNVLHQLLAPRDPTKPPLVFHYVPVIGCAVSYGMDPLGFLDDCKQKYGPVFTYPLLG

RRITATLGPLGSNFVLNGKLAHVNAEEAYTHLTTPVFGTEVVYDVPNHVLMEQKKFVKFGLTTDNFRRYVGLIRQEVLGY

VSTHVFDQDVLANGVDAFTTSSEITILTASATLQGREVRQAMDKSFAELYHDLDGGFTPLNFVFPNLPLPSYRRRDRAQL

KMREFYISILEKRRASTDEPDLDMLTALQNQSYRNGEPLTDKQIAHIMIALLMAGQHTSAATGAWAILRLGENQDLQRRL

WEEQVEYHMDKETNTLNELTYENFQTPLLVATIKELLRMHPPLHSLMRKVISDCPVPSSVGSPSAEPRASHAFKKSNESK

EYVIPKGEFVLAAPGYSQVDESIWGKDAKEFRVERWLESEGGNKVPGDEDEGEEDYGWGKISRGGKSAYLPFGAGRHRCI

GEQFAQVQLGTIIATLVRELTWTLDQPFPGNDYTVRPSLFLLEAHESACTDCAPFV

 

>CYP51F1 Malassezia globosa

67% to CYP51F1   Ustilago maydis, MGL_2415

MLQEIGAWPVWQQALTFLVGGLALIVGINVLVQVLVPRNKSLPPMVFHWVPVVGSAITYGMDPYRFFFNCREKYGDVFTF

KLFGRNVTVALGPKGSNLVFNGRLTQVSAEEAYTSLTTPVFGKGVVYDVPNAVLMEQKRFVKSGLSMENFRMYVTQIESE

VKDFINNDAAFLPLQKGATSVTVDIFNVFSEITILTASRTLQGKEVRESLDKTFAKLYHDLDSGFTPINFVIPNLPLPNN

FRRDRAQRLMSDFYLGIIKKRREGNTEGTEHDMISALMEQSYKNGRNINDREIAHMMIALLMAGQHTSSATGSWAMLRLA

SRPEIIEELYEEQKRVYSDGTGGFAPLDYDIQKSSVPVLDAVIRETLRLHPPIHSIMRKVKSDMVVPPTLAAPISSKGSR

DETYVIPKGHYVIAAPGVSQVDPKIWEDASRFDPHRWLGDKANVMNQTDDAQEDFGWGMVSTGANSPYLPFGAGRHRCIG

EQFAYLQLGTIISTFVRAFDWRLETKLPAPDYTSMVVLPTQPANLVFTPRKNKA

 

>CYP51F1 Penicillium italicum Z49750

MDLVPLVTGQILGIAYYTTGLFLVSIVLNVIKQLIFYNRKEPPV

VFHWIPFIGSTIAYGMDPYQFFFASRAKYGDIFTFILLGKKTTVYLGVEGNEFILNGK

LKDVNAEEVYGKLTTPVFGSDVVYDCPNSKLMEQKKFIKYGLSQEALESYVPLIADET

NAYIKSSPNFKGQSGTIDLAAAMAEITIFTAARTLQGEEVRSKLTSEFADLFHDLDLG

FSPINFMLPWAPLPHNASAIKHTTYARDLSGNYPSATGSWRRRQRRRQDKSKGTDMIS

NLMRCVYRDGTPIPDKEIAHMMITLLMAGQHSSSAISCWILLRLASQPEMAEKLHAEQ

IKNLGADLPPLQYKDMDKLPLLRNVIKETLRLHSSIHTLMRKVKNPMPVPGTDFVVPP

SHTLLSSPGVTARDERHFRDPLRWDPHRWESRVEVEDSSDTVDYGYGAVSKGTRSPYL

PFGAGRHRCIGEKFAYLNLEVIVATLVREFRFFNPEGMEGVPDTDYSSLFSRPVQPAT

VRWEVRS

 

>CYP51F1 Candida tropicalis M23673

 

MAIVDTAIDGINYFLSLSLTQQITILVVFPFIYNIAWQLLYSLR

KDRVPMVFYWIPWFGSAASYGMQPYEFFEKCRLKYGDVFSFMLLGKVMTVYLGPKGHE

FIYNAKLSDVSAEEAYTHLTTPVFGKGVIYDCPNSRLMEQKKFAKFALTTDSFKTYVP

KIREEVLNYFVNDVSFKTKERDHGVASVMKTQPEITIFTASRCLFGDEMRKSFDRSFA

QLYADLDKGFTPINFVFPNLPLPHYWRRDAAQRKISAHYMKEIKRRRESGDIDPKRDL

IDSLLVNSTYKDGVKMTDQEIANLLIGVLMGGQHTSASTSAWFLLHLAEQPQLQDDLY

EELTNLLKEKGGDLNDLTYEDLQKLPLVNNTIKETLRMHMPLHSIFRKVMNPLRVPNT

KYVIPKGHYVLVSAGYAHTSDRWFEHPEHFNPRRWESDDTKASAVSFNSEDTVDYGFG

KISKGVSSPYLPFGGGRHRCIGEQFAYVQLGTILTTYIYNFKWRLNGDKVPDVDYQSM

VTLPLEPAEIVWEKRDTCMV

 

>CYP51F1 N. crassa AABX01000052.1 cont3.136 NCU02624.1 (version3)

2384 MGILQVVAGPLSQQFSQLGTVSQIGVAIASFLFVAVVLNVLQQFLFKKPN

EPPLVFHWFPLIGSTITYGMDPPRFFKENREK (0) 2139

2066 YGDCFTFILLGKKTTVYVGPKGNDFILNGKIRDVNAEEIYTVLT

TPVFGKDVVYDCPNSKLMEQKK (0) 1869

1806 FMKIALTTEAFRQYVPIISDEVTSYLKR

TADFKGKSGIVDIPPKMAQITIFTASHALQGKEIRDKFDETLADLYHDLD

MGFSPINFMLHWAPLPWNNRRDYAQRTVAKIYMDTIKERRARGETGAQDI

MWHLMNSTYKGDVPVPDHEIAHMMIALLMAGQHSSSSTSSWIMLRLASRP

DIMEDLYNEQVKNLGADLPPLTYEDLAKLPLHAAIVKETLRLHAPIHSIM

RAVKTPMPVPGTKYVIPTDHVLLAAPGVSATDESYFPQPDLWEPHRWEKD

SPLAPTIVRNVPSEEDDEKIDYGYGLVSKGANSPYLPFGAGRHRCIGEQF

ANVQLQTILAIIVRNFKFRNVDGSDKVIGTDYASLFSRPLEPAKIYWERR

EGCQL* 655

 

>CYP51F1 ug.2.6.1(CYP51)  Phanerochaete chrysosporium
MSLSQYGPIAGLVGQAYDALASMSTSRLVLFLLINIPILSVVCNVIYQLLPKDKSLPPVVWHWFPWFGSAAAYGEDPIKFFFDCKEKYGNVFTFILMGRKVTVALTPAGNNFIMGGKHTTFSAEEVYGGLTTPVFGKDVVYDCPNELLMEQKKFVKFGLSTENFRQYVGMIEEEVLQFMRNDASFKIYQMNDINEWGAFDVLKVMSEITILTASRTLQGKEVRANITKDYAQVYNDLDGGFTPLHFMFPNLPLESYRKRDAAHKKISDFYISIIRKRRENPGQEEHDMIAALMNQKYRVGRPLKDHEIAHIMIALLMAGQHTSSATGSWALLHIADRPDVAEALYEEQVKHFRQSDGSWRTPEYEELKELPVLDSVIRETLRIHPPIHSIMRAVREDVVVPPTLAAPSEDGRYVIPKGHVVLSSAAISQVDPMLWKNANDWDPSRWSDPEGVAAQAYKQYDDAEGAKVDFGFGLVSKGTDSPYQPFGAGRHRCIGEQFAYLQLGTIISTFVRHVEMRLPETGVPPPNYHAMITLPKAPRNILYRRRNFD

 

>CYP51F1 Cryptococcus neoformans var. neoformans B-3501A chromosome 1

56% to CYP51F1 Phanerochaete chrysosporium

AAEY01000001

CNBA0300"

ESTs gb|CF192489.1|CF192489,

gb|CF192488.1|CF192488, gb|CF191439.1|CF191439;

EAL23379.1"

MSAIIPQVQQLLGQVAQFFPPWFAALPTSLKVAIAVVGIPALII

GLNVFQQLCLPRRKDLPPVVFHYIPWFGSAAYYGEDPYKFLFECRDKYGDLFTFILMG

RRITVALGPKGNNLSLGGKISQVSAEEAYTHLTTPVFGKGVVYDCPNEMLMQQKKFIK

SGLTTESLQSYPPMITSECEDFFTKEVGISPQKPSATLDLLKAMSELIILTASRTLQG

KEVRESLNGQFAKYYEDLDGGFTPLNFMFPNLPLPSYKRRDEAQKAMSDFYLKIMENR

RKGESDHEHDMIENLQSCKYRNGVPLSDRDIAHIMIALLMAGQHTSSATSSWTLLHLA

DRPDVVEALYQEQKQKLGNPDGTFRDYRYEDLKELPIMDSIIRETLRMHAPIHSIYRK

VLSDIPVPPSLSAPSENGQYIIPKGHYIMAAPGVSQMDPRIWQDAKVWNPARWHDEKG

FAAAAMVQYTKAEQVDYGFGSVSKGTESPYQPFGAGRHRCVGEQFAYTQLSTIFTYVV

RNFTLKLAVPKFPETNYRTMIVQPNNPLVTFTLRNAEVKQEV

 

>CYP51F1 P450-40 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

46% to CYP51F1  Aspergillus fumigatus = CYP51F1

RO3G_11790.1

MAVISTLLPTLESIPLYAVLALGVFVIINILSQWFGPKNPKEPPVVFSWIPFMGNAIEFGINPIAFLQKCQKKYGDVFTFYMVGKRVTVFLNADGNQFVFNAKQNLTSAADAYNHMTKHVFGPEVVYDAPHSVFMEQKRFIKAGLNSESFRQHVPMIVEEVEGFFKNYKKPTGAFDAYHTLGELIICTASRCLMGKEIRASLDDSVAGLYYDLDQGFKPINFIFPNLPLPSYRKRDVARQKMTDLYSSIIARRKAENDFSNADLLQALMDANYKDGSNVPDHHIAGMMIAVLFGGQHTSATTSAWTLLELAARPDLIRDLREEQITKLGSLKADLTFDNLKELTLLDSCVRETLRLHPPIFQMMRRVTANKVVFEKTGHEIPKGNFLCAVPGVTQVDSQYFNEPLKYDPLRWINLTDPVHSMEAGDDSNIDYGFGAVGISSKNPFLPFGAGRHRCIGEQFGYLQIKTIIATIIRLFDIELEDGKGVPKSDYTSMVVVPERPSNIKYTWRE

 

>CYP51F1P Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

60% TO CYP51F1 Rhizopus oryzae

RO3G_08504.1 revised

NSIALYKNAKKKKSNVFTFHLVGKRVTLFLKAEDNQFVFNAKQNLISAANTHNYMTKHVFGPENVYSVPQCVFMEQK ()

XXXXXXXXXXNYSQHVL

MIVEEVESFFKDFKKPTSASDAYHILEKLIICTASRCLTDKETRVYLDDSAASLYYVLGQRFKSISFIFPNLPSHSYGKH

DVVRQKMADFYSNIIACRKVENDF (0)

SNADLLQSLMDAIYKNRIHISDHDITSMVIAILL &

E*YTFTTTSAWTLLELANRTSL &

IHGLRKEQITRLGSLKSSLTLDKFKKSTSLDDCIHKTLRLHPSIF*IRATADKIIYEK

TGHEISKDNLLCAVSSVTQINDQYYNSPLKYSRL**INLINPFHLREVGDDNDVDDNFDAVSVFSSNLFLPVGVVR &

HKCAGEQFGYQLLPL*PRLFDTKLEASRGVPKTNYTLMVVAPKRSSTIKYMERE

 

>CYP51F1 Phycomyces blakesleeanus (Zygomycete fungus, Mucoromycotina)

73% to CYP51F1 Rhizopus oryzae

estExt_fgeneshPB_pg.C_10567

MAILSLITQVVPSITSVFLYGTLSLVVVFSIHILSQLVVPRDPNQPKLVFSWVPFLGNGVEFGMNPIGFIQKCQKLYGDV

FTFKLVGKSVTVCLGADGNQFVFNNKQNLSSAAEAYNDMTKHVFGFDVVYDAPHSVFMEQKRFIKAGLTLESFRAHVPLI

VKETTEFFKDFKKPTGYMDAYSTFSKLIICTASRCLMGKEIRSALHEGVADLYYDLDQGFQPINFMFPNLPLPSYRRRDV

AREKMAELYSKIIRRRKEENDTSNNDLLQALIESTYKDGTPIPDHHIAGMMIAVLFGGQHTSATTSAWTTLELANRPDLV

QALREEQIAKLGSLKADLTFENLKELTLMEACIKETLRLHPPIFQMMRKVIADKVVFEKTGHEIPKNDFLCAVPGATQVD

EQYFNEPLTYNPYRWIEKSDPVHQMEVGEDANADYGFGIVGISSRSPFLPFGAGRHRCIGEQFGYLQLKAVMATVIRLYD

LSLEEGKGVPESDYTSMVVVPKHPANVVYTCRE*

 

>CYP51F1 Batrachochytrium dendrobatidis JEL423 (chytrid)

43% to CYP51F1 Rhizopus oryzae

note this species has no obvious CYP61 sequence

BDEG_01891

MGLFFEAYESVRNVSGLPPDQFHTVVAITSLVFVLTVWLLSYALNQPLKSKDTGSEPPRVPVSIPFIGAAIAYGVDPIKF

LIECRQKYGDCFTFVMLGRKMTFCLGPDGNHYVFNVPVADATAEGAYKKLTVPVFGAGVVYDVHNAMFMEQKKFVKDAFN

SNSFNAYMLNIWNETNAFFNDWEDHYDANMIFDEMSELTIRTASHCLLGKEIRQQLHSTVAQLYHDLDSGLAPINVFFRW

LPLPVYFKRDRANKIMSKTFVDIIKKRRATNSTDNADLMQTLMFARYRDGTSMTDDEIAHLLIATLMGGQHTSSTTLCWM

LFELARRQDIVDKLLHEQSMVLTGKPDTPPEDLPEFTHEQIRQLTFLDCVMKETLRLHPPIHTVMRKVEKSMTYRGMTIP

AGHFICGSAAVSHLDPTRFPDPLKFEPSRFLNNDEGSGEWSINTIDIAQKSARSHFLPFGAGRHRCIGEAFAYIQNKTIL

SAFIRRYTHKLYVDPNTGKEHFPSSDYTSLITIPEKPARLSITRRSVKA

 

>CYP51F1 Fusarium oxysporum

92% to CYP51F1   Fusarium graminearum

FOXG_00394

MGLLQELASHPLAQQYQELPLGQQIGIGFGAFIILSVVLNVLNQLLFKNRNEPPLVFHWFPFVGSTITYGMDPPKFFKEN

RAKHGDVFTFVLLGKKTTVAVGPTGNDFILNGKLKDVSAEEIYTVLTTPVFGKDVVYDCPNAKLMEQKKFMKIALTTEAF

RSYVPIISAEVRDYFKKSPDFKGKSGIVDIPKKMAEITIFTASHALQGSVIRNKFDESLAALYHDLDMGFTPINFMLHWA

PLPWNRKRDHAQRTVAKIYMDTIKERRAKDNDDTEHDMMKHLMNSTYKNGTPVPDHEVAHMMIALLMAGQHSSSSTSSWI

MLRLAQYPHIMEELYQEQVRELGADLPPLTYDNLAKLPLNQAIIKETLRLHAPIHSIMRAVKSPMPVPGTKYTIPTSHTL

LAAPGVSATDSAYFPNPDEWDPHRWEVDSPNFPRMATRGDDEEKIDYGYGLVSKGSASPYLPFGAGRHRCIGEHFANAQL

QTIVAEVVREFKFRNVDGGNTLIDTDYASLFSRPLEPANIHWERRQQ*

 

>CYP51F1 Fusarium verticillioides

98% to CYP51F1 Fusarium oxysporum

FVEG_01123

MGLLQELASHPLAQQYQELPLAQQIGIGFGAFVVLSVVLNVLNQLLFKNRNEPPLVFH

WFPFVGSTITYGMDPPKFFRENRAKHGDVFTFVLLGKKTTVA

VGPTGNDFILNGKLKDVSAEEIYTVLTTPVFGKDVVYDCPNAKLME

QKKFMKIALTTEAFRSYVPIISSEVRDYFKKSPDFKGKSGIVDIPKKMAEITIF

TASHALQGSVIRNKFDESLAALYHDLDMGFTPINFMLHWAPLPWNRKR

DHAQRTVAKIYMDTIKERRAKDNDDTEHDMMKHLMNSTYKNGTPVPDHEVAH

MMIALLMAGQHSSSSTSSWIMLRLAQYPHIMEELYQEQVRELGADLPPL

TYDDLAKLPLNQAIIKETLRLHAPIHSIMRAVKSPMPVPGTKYTIPTSHTL

LAAPGVSATDSAYFPNPDEWDPHRWEADSPNFPRMANRGDDEEKIDYGYG

LVSKGSASPYLPFGAGRHRCIGEHFANAQLQTIVAEVVREFKFRNVDGGN

TLIDTDYASLFSRPLEPANIHWERRQQ*

 

>CYP51F2 Fusarium graminearum FG04092.1 AACM01000179 FGcontig1.179_scaffold2

MFHLLIYPLWVLVALFAVIIANLLYQQLPRRPDEPPLVFHWFPFFGNAVA

YGLDPCGFFEKCREKHGDVFTFILFGRKIVACLGVDGNDFVLNSRLQDAN

AEEVYGPLTIPVFGSDVVYDCPNSKLMEQKKFVKFGLTQKALESHVQLIE

REVLDYVETDPSFSGRTSTIDVPKAMAEITIFTASRSLQGEEVRRKLTAE

FAALYHDLDLGFRPVNFLFPWLPLPHNRKRDAAHIKMREVYMDIINDRRK

GGIRTEDGTDMIANLMGCTYKNGQPVPDKEIAHMMITLLMAGQHSSSSAS

SWIVLHLASSPDITEELYQEQLVNLSVNGALPPLQYSDLDKLPLLQNVVK

ETLRVHSSIHSILRKVKRPMQVPNSPYTITTDKVIMASPTVTAMSEEYFE

NAKTWNPHRWDNRAKEEVDTEDVIDYGYGAVSKGTKSPYLPFGAGRHRCI

GEKFAYVNLGVIVATLVRNFRLSTIDGRPGVPETDYTSLFSRPAQPAFIR

WERRKKI*

 

>CYP51F2 Aspergillus nidulans AN1901.1 64% to 51F2, 60% to 51F1

MLSPTLFSAYVLVGAIVAVLVNVIRQIFFRNKNEPPMVFHWVPFVGSTIS

YGMNPYKFFFSCREKYGDIYTFVMLGKKMTVYMGVKGNDFILNGKLKDLN

AEEVYSPLTTPVFGSDVVYDCPNSKLMEQKKFIKFGLSQSALESHVPLIE

KEVLDYIKTSPRFKGDSGVLDAPAAMAELTIYTAGSALQGKEVRKKLTAE

FADLFHDLEMGFTPINFILPWAPLPQNRKRDIAHARMRETYMEIINQRRK

NPDAQDHDMIWNLMHSTYKNGNPVPDKEIAHIMITLLMAGQHSSSSISAW

ILLRLASEPQILEELYQEQLANLKRDPRTGAFEPLQYKDLDLLPLHQNVI

KETLRVHLSIHSILRKVKNPIPVPDTPYIIPTSHTLLASPGATALSDEYF

PNANMWDPHRWENQRPDKEDEEGELIDYGYGAVSKRMSSPYLPFGGGRHR

CIGEKFAYVNLGVIVATIVRNLKLYNVDGKTGVPATDYSSMFMGPMKPAV

VGWERRFPARS*

 

>CYP51F2  Aspergillus niger CBS 513.88

         XM_001394187.1, CAK40582.1

         80% to CYP51F2 Aspergillus fumigatus

MALLAVAGVYAFAALLVAIVLNVTRQLLFRNEKEPPVVFHWIPF

LGSTISYGMDPYTFFFSCRKKYGDIFTFVLLGQKTTVYLGVQGNDFILNGKLKDVSAE

EVYSPLTTPVFGSDVVYDCPNSKLMEQKKFIKFGLTQAALESHVQLIEKETLDYLRDS

PRFNGASGVIDIPAAMAEITIYTAARALQGEEVRKKLTAEFAELYHDLDKGFSPINFM

LPWAPLPHNQKRDAAHARMREIYTDIINERRKNPDEEKSDMIWNLMHCTYKSGQPVPD

KEIAHMMITLLMAGQHSSSSISSWIMLRLASEPQVLEELYQEQLASLSNRNGVFEPLQ

YQDLDKLPFLQSVIKETLRIHSSIHSIMRKVKNPLPVPGTSYIIPEDHVLLASPGVTA

LSDEYFPNATRWDPHRWENQPDKEEDGEMVDYGYGSVSKGTASPYLPFGAGRHRCIGE

KFAYVNLGVIIATIVRHLKLFNVDGRKGVPGTDYSTLFSGPMKPAIVGWERRFPDHSK

GSLN

 

>CYP51F2  Aspergillus terreus NIH2624

         XM_001215095.1

         78% to CYP51F2 Aspergillus fumigatus

         ATEG_05917.1

MSLLTITSYAAVGILALIAWNVIRQLLFQNKSEPPVVFHWIPFL

GSTISYGIDPYAFFASCRQKYGDIFTFILLGQKTTVYLGVQGNEFILNGKLKDVNAEE

VYSPLTTPVFGSDVVYDCPNAKLMEQKKFIKYGLTQAALESHVQLIEREVLDYLRTSP

NFHGASGVVDISAAMAELTIFTAGRALQGEEVRRKLTAEFADLYHDLDKGFTPINFML

PWAPLPHNRKRDAAHARMRAIYMDIIRERRAHKNPDQVEAGSDSDMIWNLMRCTYKDG

QPVPDKEIAHMMITLLMAGQHSSSSISAWIFLRLASEPRVLEELYQEQVASLGKPDAD

GVFPPLQFRDLDRLPLHQNVVKETLRLHSSIHSIMRKVKNPLPVPGTPYVVPTSHVLL

ASPGVTATSDEYFPNASRWDPHRWENQAEPDDDGEMVDYGYGRVSKGTASPYLPFGGG

RHRCIGEKFAYINLGVIVATVVRHLKLANVDGRKGVPQTDYSSLFSGPVKPAIIGWER

RFPTA

 

>CYP51F2  Aspergillus clavatus NRRL 1

         XM_001271578.1

         ACLA_046180

         81% to CYP51F2 Aspergillus fumigatus

MLSLTLFGLYLVSATAVVILVNVVYQHLFRLRNRTEPPMVFHWI

PFIGSTITYGIDPCKFFFACREKYGNIFTFILLGQKVTVYLGVEGNEFILNGKLKDVN

AEEVYSPLTTPVFGSDVVYDCPNSKFMEQKKFIKFGLTQSALEAHVPLIEKEVLDYLE

TSPRFQGTSGLVDIAAAMAEITIFTAARALQGEEVRSKLTAEFADLYHDLDRCFTPVN

FMFPWAPLPRNKKRDAAHVRMRAIYVDIINQRRRDGGEDTQKSDMIWNLMNCSYKNGQ

QVPDKEIAHMMITLLMAGQHSSSSIGSWIMLRLASQPEVLEKLYQEQLDKLAQGGPGS

NLRPLQYKDLELLPYHQHVIRETLRLHSSIHSILRKVKNTLSVPGTSYVIPPGRVLLA

SPGVTALSDEHFPNASRWDPQRWENQTTKEDSGEMVDYGYGAVSKGTASPYLPFGAGR

HRCIGEKFAYVNIGVILATLVRHLRLSNMDGKEGVPATDYSSLFSGPMKPSIIQWGKR

SNDLSK

 

>CYP51F2  Ajellomyces capsulatus NAm1

         XM_001540591.1

         70% to CYP51F2 Aspergillus fumigatus

MSWFTIGTFGVLAFVAAVTLNLVYQLLFRFLNKTRPPLVFHWIP

FLGSTIRYRTDPYKFFFSCRQKEASRLFQHGDIFTFVLLGRPTTVYLGIKGNEFILNG

KLKDVNAEEVYGPLTTPVFGPDVVYDCPNSKLIEQKKFIKYGLTQAALESHVPLIEKE

VMDYLDSSPNFLGASGEVDISAVMAEITIFTAGSALQGEEVRSKLTTEFAVLYHDLDK

GFSPINFMLPWAPLPHNKKRDAAHTLMHAIYLDIIEKRRRAARNANGSQTQDMIENLM

QCTYKNGQKLPDKEIANIMISLLMAGQHSSSTTSSWIMLHLASEPAVVEQLYQEQLDN

LPRTGPNGSLGPLQYGDLNRLPLHRNVIRETLRLHTSIHSLLRKVMNPMPVAGTPYVI

PPSHVVLSAPGVTALSDEYFPNPTMWDPNRWETQEPKVDEKEDMVDYGYGTISKGTSS

PYLPFGAGRHRCIGEKFAYVNLTVIVAIMVRHLQFSNIGGKTGVPRTDYSSMFSAPMK

PARINWKRRTAKSG

 

>CYP51F2 Histoplasma capsulatum G217B

94% to CYP51F2  Ajellomyces capsulatus NAm1

two identical sequences

ABBT01000205.1 Ajellomyces capsulatus G217B 481620-479996 (-)

ABBT01000207.1 Ajellomyces capsulatus G217B 78633-77009 (-)

HCB05685.1 identical to HCB06140.1

MSWSTIGTFGVLAFVAAVAFNLVYQLLFHFLNKTRPPLVFHWIPFLGSTIRYGTDPYKFFFSCRQKHGDIFTFVLLGRPT

TVYLGIKGNEFILNGKLKDVNAEEVYSTLTTPMFGPDVVYDCPNSKFIEQKKFIKYGLTQEALESHVPLIEKEVMDYLDS

SPNFLGASGEVDISAVMAEITIFTAGSALQGEEVRSKLTAEFAVLYHDLDKGFSPINFMLPWAPLPHNKKRDAARALMHA

IYLDIIEKRRRAARNANGSQTQDMIENLMQCTYKNGQKLPDKEIANIMITLLMAGQHSSSTTSSWIMLHLASEPAVAEQL

YQEQLDNLPRTGPNGSLAPLQYGDLDRLPLHRNVIKETLRLHTSIHSLLRKVMNPMPVAGTPYVIPPSHIVLSAPGVTAL

SDEYFPNPTMWDPNRWETQEPKVDEKEDMVDYGYGAISKGTSSPYLPFGAGRHRCIGEKFAYVNLTVIVAIMVRHLQFSS

IGGKTGVPRTDYSSMFSGPMKPARINWKRRTAKSG

 

>CYP51F2   Penicillium digitatum strain GL-01

          DQ355161.1, also AJ439081 (5 aa diffs)

          67% to CYP51F2 Aspergillus fumigatus

MDLVPLVTGQIKCIAYYTTGLVLASIVLNVIKQLVFYNRKEPPV

VFHWIPFIGSTVAYGMDPYQFFFASRAKYGNIFTFILLGKKTTVYLGVEGNEFILNGK

LKDVNAEEIYGKLTTPVFGSDVVYDCPNSKLMEQKKFIKYGLSQEALESYVPLIADEI

SSYIKSSPSFKGQSGTIDLVPAMAEITTFTAARTLQGEEVRSKLTTEFAKLFHDLDLG

FTPINFMLPWAPLPQNRKRDRAHRRMREIYVDIIQARREAGEEANDNGRDKTKGTDMI

SNLMRCVYRDGTPIPDKEIAHLMITLLMAGQHSSASISCWILLRLASQPEMTEKLFAE

QVNNLGADLPLLQYKDLDKLPLHRNVIKETLRLHSSIHTLMRKVKNPMPVPGTDFVIP

PSHTLLSSPGVTARDERHFRDPLRWDPHRWGSRVEAEDSSDTVDYRYGAVSKGTRSPY

LPFGAGRHRCIGEKFAYLNLGVIIATLLREFRFFNPEGMEGVPDTDYSSLFSRPMQPA

TVRWEVRS

 

>CYP51F2 Nectria haematococca fgenesh1_pg.scaffold_7000156

57% to CYP51F1 like seq fgenesh1_pg.scaffold_2000426,

Necha1/scaffold_7:419968-421550

80% to Fusarium graminearum  CYP51F2

FG04092.1 AACM01000179 FGcontig1.179_scaffold2

Note only one intron, not two as seen in CYP51F1

This gene model seems correct DRN 2/4/06

MLLLVWYPVLAIGAFLGIILIHALRQKLFRKAGEPPLIFHWLPFIGNAVSYGLDPCNFFMKCREK (0)

HGDVFTFVLFGRKIVCCLGVEGNDFVLNSRLQDANAEEIYGPLTIPVFGSDVVYDCPNSKFMEQKKFVKFGLTQK

ALESHVQLIEREVLDYIHAVPAFSGSEGTVDISNAMAEITIFTAARSLQGEEVRRKLTAEFAALYHDLDL

GFKPVNFLFPWAPLPHNRKRDAAHAKMRDIYMDIINKRRAEGGDLGEYSDMIANLMGCTYKNGQPVPDKE

IAHMMITLLMAGQHSSSSASSWIMFRLASRPDIAEELYQEQLTHLSVDGYLPPLQHSDLDKLTLLQNVVK

ETLRVHSSIHSILRKVKTPMQAPGTQYTITTDKVILASPTVTALSEEYFSNARTWDPHRWDNKEKEEVAG

DDVVDYGYGKVSKGTKSPYLPFGAGRHRCIGEKFAYVNLGVIVATMVRNFKLSTMDGKSGVPATDYNSLF

SRPVQPAYIRWERRKA*

 

>CYP51F2v1 Aspergillus fumigatus

          GenEMBL AAF32372.1 also AAK73659.1

          cytochrome P450 sterol 14 alpha-demethylase variant

MVPMLWLTAYMAVAVLTAILLNVVYQLFFRLWNRTEPPMVFHWVPFLGSTISYGIDPYKFFFACREKYGD

IFTFILLGQKTTVYLGVQGNEFILNGKLKDVNAEEVYSPLTTPVFGSDVVYDCPNSKLMEQKKFIKYGLT

QSALESHVPLIEKEVLDYLRDSPNFQGSSGRMDISAAMAEITIFTAARALQGQEVRSKLTAEFADLYHDL

DKGFTPINFMLPWAPLPHNKKRDAAHARMRSIYVDIINQRRLDGDKDSQKSDMIWNLMNCTYKNGQQVPD

KEIAHMMITLLMAGQHSSSSISAWIMLRLASQPKVLEELYQEQLANLGPAGPDGSLPPLQYKDLDKLPFH

QHVIRETLRIHSSIHSIMRKVKSPLPVPGTPYMIPPGRVLLASPGVTALSDEHFPNAGCWDPHRWENQAT

KEQENDEVVDYGYGAVSKGTSSPYLPFGAGRHRCIGEKFAYVNLGVILATIVRHLRLFNVDGKKGVPETD

YSSLFSGPMKPSIIGWEKRSKNTSK

 

>CYP51F2v2 Aspergillus fumigatus Af293

          GenEMBL XP_752137.1 also EAL90099.1

          14-alpha sterol demethylase variant

          74% to 51F2 A. nidulans 62% to 51F1 A. nidulans

          only 5 aa diffs to CYP51F2v1, may be another gene or an allele

MVPMLWLTAYMAVAVLTAILLNVVYQLFFRLWNRTEPPMVFHWVPYLGSTISYGIDPYKFFFACREKYGD

IFTFILLGQKTTVYLGVQGNEFILNGKLKDVNAEEVYSPLTTPVFGSDVVYDCPNSKLMEQKKFIKYGLT

QSALESHVPLIEKEVLDYLRDSPNFQGSSGRVDISAAMAEITIFTAARALQGQEVRSKLTAEFADLYHDL

DKGFTPINFMLPWAPLPHNKKRDAAHARMRSIYVDIITQRRLDGEKDSQKSDMIWNLMNCTYKNGQQVPD

KEIAHMMITLLMAGQHSSSSISAWIMLRLASQPKVLEELYQEQLANLGPAGPDGSLPPLQYKDLDKLPFH

QHVIRETLRIHSSIHSIMRKVKSPLPVPGTPYMIPPGRVLLASPGVTALSDEHFPNAGCWDPHRWENQAT

KEQENDKVVDYGYGAVSKGTSSPYLPFGAGRHRCIGEKFAYVNLGVILATIVRHLRLFNVDGKKGVPETD

YSSLFSGPMKPSIIGWEKRSKNTSK

 

>CYP51F2  Aspergillus oryzae

         GenEMBL BAE57417.1

         77% to CYP51F4, 75% to CYP51F2 Aspergillus nidulans

MASFTLVSAYAAAGLLAIIVLNLLRQLLFRNKTDPPLVFHWIPFLGSTVTYGMDPYAFFFSCRQKYGDIF

TFILLGRKITVYLGIQGNEFILNGKLKDVNAEEIYSPLTTPVFGSDIVYDCPNSKLMEQKKFIKFGLTQA

ALESHVPLIEKEVLDYLKTSPNFKGTSGRVEITDAMAEITIFTAGRALQGEEVRKKLTTEFADLYHDLDR

GFTPINFMLPWAPLPRNRKRDAAHARMREIYMDIINERRKNPDRETSDMIWNLMHCTYKNGQPLPDKEIA

HMMITLLMAGQHSSSSISSWIMLRLASEPAVMEELYQEQITKLSPDGRTLPPLQYRDLDLLPLHQNLIKE

TLRLHLSIHSLMRKVKNPMPVPGTPYVVPADHVLLASPGVTALSDEYFPNASRWDPHRWENRVEKEDEED

IVDYGYGTVSKGTSSPYLPFGAGRHRCIGEKFAYVNLGVIVATMARHMKLFNVDGKKGVPATDYSSMFSG

PSKPAIIGWERRFPEKS

 

>CYP51F2  Aspergillus flavus

99% to CYP51F2  Aspergillus oryzae, 1 aa diff

AFL2G_02771

MASFTLVSAYAAAGLLAIIVLNLLRQLLFRNKTDPPLVFHWIPFLGSTVTYGMDPYAFFFSCRQKYGDIFTFILLGRKIT

VYLGIQGNEFILNGKLKDVNAEEIYSPLTTPVFGSDIVYDCPNSKLMEQKKFIKFGLTQAALESHVPLIEKEVLDYLKTS

PNFKGTSGRVEITDAMAEITIFTAGRALQGEEVRKKLTAEFADLYHDLDRGFTPINFMLPWAPLPRNRKRDAAHARMREI

YMDIINERRKNPDRETSDMIWNLMHCTYKNGQPLPDKEIAHMMITLLMAGQHSSSSISSWIMLRLASEPAVMEELYQEQI

TKLSPDGRTLPPLQYRDLDLLPLHQNLIKETLRLHLSIHSLMRKVKNPMPVPGTPYVVPADHVLLASPGVTALSDEYFPN

ASRWDPHRWENRVEKEDEEDIVDYGYGTVSKGTSSPYLPFGAGRHRCIGEKFAYVNLGVIVATMARHMKLFNVDGKKGVP

ATDYSSMFSGPSKPAIIGWERRFPEKS*

 

>CYP51F2  Neosartorya fischeri NRRL 181

         XM_001267337.1, NFIA_109350

         97% to CYP51F2 Aspergillus fumigatus

MVPMLLLTAYMAVAMLTAILLNVVYQLFFRLWNRTEPPMVFHWV

PFLGSTISYGIDPYKFFFACREKYGDIFTFILLGQKTTVYLGVQGNEFILNGKLKDVN

AEEVYSPLTTPVFGSDVVYDCPNSKLMEQKKFIKYGLTQSALESHVPLIEKEVLDYLR

NSPNFQGSSGQVDISAAMAEITIFTAARALQGQEVRSKLTAEFADLYHDLDKGFTPIN

FMLPWAPLPHNKKRDAAHARMRSIYIDIINQRRLDGEKDSQKSDMIWNLMNSTYKNGQ

QVPDKEIAHMMITLLMAGQHSSSSISAWIMLRLASQPKVLEELYQEQLANLGPVGPDG

SLPPLQYKDLDKLPFHQHVVRETLRLHSSIHSLMRKVKSPLPVPGTPYMIPPGRVLLA

SPGVTALSDEHFPNAGCWDPHRWENQAAKEQENDEVVDYGYGAVSKGTSSPYLPFGAG

RHRCIGEKFAYVNIGVILATIVRHLRLFNVDGKKGVPETDYSSLFSGPMKPSIIGWEK

RSKDTSK

 

>CYP51F2 Magnaporthe grisea MG04628.4  62% to CYP51 Penicillium AACU01001139 cont2.870

MAFFFPSAPVWVYSAGAALLFIIGSIILNFIWQQLPRPKSEPPLVFHWLP

FIGNAVSYGMDPYRFYSQCREKHGDVFTFVLFGRRMTVFLGVQGNDFILN

GKLQDLNAEEIYSPLTTPVFGSDIIYDCPNSKLMEQKKFVKFGLTQKALD

SYVPLIEREVLDYIESSPVFQAGNHGIVDIPSMMAEITIFTASRTLQGPE

VRKKLTGEFARLYHDLDLGFRPINFLAPWAPLPQNRRRDVAHARMRDVYM

DLINKRRRQKDDQEEEEEAEPDMIRHLMGSCVYKNGQALPDKEIAHMMIT

LLMAGQHSSSSSSAWIMLRLASRPDIAEEVYQEVQRLGHASLQHSDLDKL

PLLANVVKETLRVHSSIHSIMRKVKRPMRIPGSDYVVTPGKVLVSAPIMT

HLDEEHFRDARAWEPHRWDDAVDAQDDEIVDYGYGATSKGTKSPYLPFGA

GRHRCIGEKFAYLNLAAIVSTLVRNFKFSTLDGKATVPPTDYTSMFSRPM

QPATVRWERRSPKTA*

 

>CYP51F2 Fusarium oxysporum

83% to CYP51F2   Fusarium graminearum

FOXG_11545

MFSLLYYPLWAFASCLVIITLNVLYQKLPRNANEPPLVFHWLPFVGNAVAYGLDPYGFFVKCREK HGDVFTFILFGRKIV

ACLGVDGNDFVLNSRIQDANAEEIYSPLTTPVFGSDVVYDCPNSKLMEQKKFVKFGLTQKALESHVQLIEREVLEYIQAV

PSFSGKSGTVDVSKAMAEITIFTAARSLQGEEVRRKLTAEFAALYHDLDLGFTPVNFLFPWLPLPHNRRRDAAHAKMREI

YMDIINGRRRGVGDLEKGTDMIANLMNCEYKNGQPIPDKEIAHMMITLLMAGQHSSSSASSWIILHLASSTDIAEELYQE

QLINLSADGVLPPLQYTDLDKLPLLQNVVKETLRVHSSIHSILRKVKRPMQAPGSPYTITTDKVLLASPTVTALSEEHFT

DAQRWNPHRWDNKPQEEAVTDDVIDYGYGAVSKGTKSPYLPFGAGRHRCIGEKFAYVNLGVIVATLVRNFRLSTLDGKPG

IPATDYTSLFSRPAQPAYINWERRRA*

 

>CYP51F2 Fusarium verticillioides

94% to CYP51F2 Fusarium oxysporum

FVEG_10277

MFSLLYYPLWAFASCLAIITLNVLYQKLPRNANEPPLVFHWLPFFGNAVAYGLDPYGFFVKCREK (0)

HGDVFTFVLFGRKIVACLGVDGNDFVLNSRIQDANAEEIYGPLTTP

VFGSDVVYDCPNSKLMEQKKFVKFGLTQKALESHVQLIEREVLEYIQAVP

SFSEKSGTVDVSKAMAEITIFTAARSLQGEEVRRKLTAEFAALYHDLDLGFT

PVNFLFPWLPLPHNRRRDAAHSKMREIYMGIINERRRGGGDLEKRTDM

IANLMSCAYKNRQPIPDKEIAHMMITLLMAGQHSSSSASSWIVLHLASSPDI

TEELYQEQVINLSASGALPPLQYSDLDKLPLLQNVVKETLRVHSSIHS

ILRKVKRPMQAPGPPYTITTDKVILASPTVTALSEEHFPDAQRWNPHRWDNKP

QEEAVTDEVIDYGYGAVSKGTKSPYLPFGAGRHRCIGEKYAYVNLGV

IVATLVRNFRLSTLDGKPGVPATDFTSLFSRPAQPAYIKWERRKA

 

>CYP51F3 Fusarium graminearum FG11024.1 AACM01000457 FGcontig1.457_scaffold8

MESLYETLRTLPLSVSIPLTTSIIIILSIVTNVVKQLWFPNPHRPPVVFH

IFPFIGSTVQYGIDPYAFFFDCRDKYGDCFTFILLGKSTTVFLGPKGNDF

ILNGKHADLNAEDVYGKLTTPVFGEEVVYDCSNARFMDQKRLLKLGLTTD

SLRCYIPKFVKEVEDYVKNSPYFKGDTGIVNITEVMAEITIYTASGSLLG

NEVRSMFDSTFATLYRHLDDGFQPINFVMPGLPLPQNFRRNHARKVMEKL

FSDIISKRRETGNQGDETDMIWMLMNAQYKDGEPLPDHHAARMLIAILMG

GQHNTAVSGAWLLLNLAHKPHLVQELYEEQTQVLGSPQEPLTWENLQKLT

LNGQVIKETLRLHSPIHSILRQVKSPMRVPGTEWVVPPSHTLLSSPGTMA

RSEEFFPRPSEWDPHRWDKIEPLVKTAEDGQTVDYGFGVMSKSVSSPYLP

FGAGRHRCVGENYAYAQLGAIVATFIRLVHIEQPDPKAPLPAPDYSSMFS

RPMNPAEIRWRRRETVE*

 

>CYP51F3 Nectria haematococca fgenesh1_pg.scaffold_6000765

52% to fgenesh1_pg.scaffold_2000426,

Necha1/scaffold_6:2267196-2268844

81% to Fusarium graminearum  CYP51F3

FG11024.1 AACM01000457 FGcontig1.457_scaffold8

Note two exons, but the second exon is not seen in CYP51F1 or CYP51F2

This gene model seems correct DRN 2/4/06

MESLYGSFRALPLSISIPFTVGLVVVIAIARNVIGQLYFPDRNRPPVVFHVFPFIGSSVQYGIDPYKFFF

DCKAKYGDCFTFILLGKPTTVFLGQKGNEFILNGKHADLNAEEVYGKLTTPVFGKEVVYDCSNARFMDQKR (0)

LLKLGLTTEALRAYIPKFVKEVEDYVNTSPYFKGETGQVNITEVMAEITIYTASGSLLGNEVRSMFDST

FALLYRHLDDGFQPINFVMPWLPLPQNRRRDHARNVMEGLFANIIRQRREQGNQGDETDMIWTLMDAQYK

DGTVLPDIHVARLLIAILMGGQHNTAASGAWLFLNLAHKPHLVEEMYQEQLEVLGSPPAPLTWENVQKLT

LNGQVIKETLRLHSPIHSIMREVKSPMPVPGTEWVVPPSHTLLASPGTLARSEDFFPRPLEWDPHRWDKA

DPVEGPVDDSQKVDYGFGMMSKAVSSPYLPFGAGRHRCVGEHYAYAQLGAIVATFVRLCHMEQVDPKAPI

PATDYS (1)

SMFSRPMNPAVIKWRRRKPE*

 

>CYP51F3 Fusarium oxysporum

87% to CYP51F3 Fusarium graminearum

FOXG_13138, note: gc boundary at DQKR

MEALYSNWRSFPLSLSVPITAFLIIAIATITNVIKQLWFPNPHRPPVVFHIFPLIGSTVQ

YGIDPYKFFFDCQAKYGDCFTFILLGKSTTVFLGPKGNDFILNGKHADLNAEDVYGKLTT

PVFGKEVVYDCSNARF MDQKR (0)

LLKLGLTTDSLRCYIPKFVKEVEEYIATSPYFKGSTGIVNITEVMAEITIYTAAGSLLGNEVRSMFDSTFATLYR

HLDDGFQPINFVMPGLPLPQNFRRDHARKVMEELFSDIIRKRREIGNQGGETDMVWTLMNAKYKDGEDLPDHHAARMLIA

ILMGGQHNTAASGAWLLLNLAHKPHLVQELYDEQLEVLGSPQEPLTWENLQKLTLNGQVIKETLRLHSPIHSILRQVKSP

MRVPGTDWVVPPSHTLLASPGTQARSEEFFPRPMEWDPHRWDKIESLEDSKGNGETVDYGFGVMNKSVSSPYLPFGAGRH

RCVGENYAYAQLGAIIATFVRLLHIEQPDPNAPLPAPDYSSMFSRPMNPAVIRWTRRNTEAN*

 

>CYP51F3 Fusarium verticillioides

95% to CYP51F3 Fusarium oxysporum

FVEG_12391

MDALYTNWRSLPLSLSIPITAFLIIVIATITNVIKQLWFPNPHRPPVVFHIFPLIGSTVQ

YGIDPYKFFFDCQAKYGDCFTFILLGKSTTVFLGPKGNDFILNGKHADLNAEDVYGKLTT

PVFGREVVYDCSNARF

MDQKRLLKLGLTTESLRCYIPKFVKEVEDYIATSPYFKGNTGIVNITEVMA

EITIYTAAGSLLGNEVRSMFDSTFATLYRHLDDGFQPINFVMPGLPLPQ

NFRRDHARKVMEELFSDIIRKRREMGNQGDETDMVWTLMNAKYKDGEDLPN

HHAARMLIAILMGGQHNTAASGAWLLLNLAHKPHLVKELYDEQVEVLGS

PQEPLTWENLQKLTLNGQVIKETLRLHSPIHSILRQVKSPMRVPGTDWVV

PPSHTLLASPGTQARSEEFFPRPMEWDPHRWDKIESLDDAKNGETVDYGF

GMMSKSVSSPYLPFGAGRHRCVGENYAYAQLGAIIASFVRLLHIEQPDPK

APLPAPDYSSMFSRPMNPAVIRWTRRNAETG

 

>CYP51F4  Aspergillus oryzae

         GenEMBL BAE63554.1

         72% to 51F2 Aspergillus nidulans, 77% to 51F2 Aspergillus oryzae

         60% to 51F1 Aspergillus oryzae

MSWPRIGAYALLAFVAIMALNVTYQFLFRMLNKTRPPLVFHWIPFIGSTIHYGTDPYGFFFSCREKYGDI

FTFILLGRPTTVYLGTQGNEFILNGKLKDVNAEEVYSPLTTPVFGSDVVYDCPNSKLIEQKKFIKFGLSQ

AALEAHVPLIEKEVEDYLAMSPNFHGTSGEVDIPAAMAEITIFTAGSALQGEEVRSKLTTEFAVLYHDLD

KGFTPINFMLPWAPLPHNKKRDAAHARMRAIYIDIINKRRNAGDNVPEKLDMIGNLMQCTYKNGQPLPDK

EIAHIMITLLMAGQHSSSSISSWIMLRLASQPAVVEELYQEQLANLERTGPNGSLAPLQYKDFDNLPLHQ

NVIRETLRLHSSIHSLLRKVKNPLPVPGTPYVIPTSHVLLAAPGVTALSDEYFPNAMAWDPHRWETQAPQ

ENNKDDIVDYGYGAMSKGTSSPYLPFGAGRHRCIGEKFAYLNLAVIVATMVRHLRFSNLDGQTGVPDTDY

SSLFSGPMKPARIRWERRAAKSG

 

>CYP51F4 Aspergillus flavus

99% to CYP51F4  Aspergillus oryzae

AFL2G_10953

MSWPRIGAYALLAFVAIMALNVTYQFLFRMLNKTRPPLVFHWIPFIGSTIHYGMDPYGFFFSCREKYGDIFTFILLGRPT

TVYLGTQGNEFILNGKLKDVNAEEVYSPLTTPVFGSDVVYDCPNSKLIEQKKFIKFGLSQAALEAHVPLIEKEVEDYLAM

SPNFHGTSGEVDIPAAMAEITIFTAGSALQGEEVRSKLTTEFAVLYHDLDKGFTPINFMLPWAPLPHNKKRDAAHARMRS

IYIDIINKRRNAGDNVPEKLDMIGNLMQCTYKNGQPLPDKEIAHIMITLLMAGQHSSSSISSWIMLRLASQPAVVEELYQ

EQLANLERTGPNGSLAPLQYKDFDNLPLHQNVIRETLRLHSSIHSLLRKVKNPLPVPGTPYVIPTSHVLLAAPGVTALSD

EYFPNAMAWDPHRWETQAPQENNKDDIVDYGYGAMSKGTSSPYLPFGAGRHRCIGEKFAYLNLAVIVATMVRHLRFSNLD

GQTGVPDTDYSSLFSGPMKPARIRWERRAAKSG*

 

>CYP51F5 P450-46 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

62% to P450-40

42% to CYP51F1 Ustilago maydis in the CYP51 family

45% to CYP51F1   S. pombe

RO3G_16595.1

MAIISTLLSETSLSSLLYKAIVFLATYYVIHLLSQFQPKDPKAVPLVPSWIPFFGNAIEFGKNPIEFLQTCQKKYGDVFTFRLLNKRVTACLGPDGNQFVFNAKQEVASAAAAYNHMTKYVFGNDIVFDTAHSVFMEQKRMIKSGLNIEAFRKDVPLIIEECDAFFDGLEPQGEMDLYKMFGTLIIYTASRTLLGPEIRQALDSGVSELYYDLDQGFRPINFMFPNLPLPSYRRRDEAREKLAKIYAGIIQKRRQSEHGESDLLQTLIEARYKDGSAVPDAQICGILTAALFGGQHTSSTTAAWTILELAQRPDIIQALRQEMITQCGSLEVDFTYDHLERLTLLEHVVKETLRLHPPIFNMMRRVVAPKCVFSGREIPQGDYLLAAPGVTQLDPHYFHQPTVWDPYRWSQLKDPVHQLEQGEDANADYGFGVVGISSKSPFLPFGAGRHRCIGEKFGYLQLKTIIGTFVKRFDVEPLSHTVPKPDYTSMVVVPENSHIRYRARKQ

 

>CYP51F6 Kluyveromyces polysporus

Kpol_1023p61

65% to CYP51F1 S. cerevisiae

MELVKSLLLFIISFSFWQIVTIIIVTPLAYNIFWQVYESFRTDRPPLVMHWVPWVGNYASYNLKPYKFLQDCQKKHGDIF

SFVMLGQIITVYLGPNGNDFIFNANVDEVSAKDVYSRMTTPVFGKGVIYDCDHDKLIEQKRFVKKALTIESLKKYVPLIQ

DEIQKYFTNSKFFRLGKYNSGITNVMATQPEMTIFTSSRTLLGEQLRKKLDTDFAYLYSDLDKGFTPINFVFKNLPLEHF

RSRDNAHKLISTTYLSLIKERRATNDIKDRDLIDSLLKNSTYKDGTKMTDQEIANLLIGVLMGGQHTSAATSAWFLLHLA

EKPQIQEELYKEVMEVLDNGRLPLTYESLQKMKLVNQTIRETLRLHHPLHSLFRKVRKNIPIPRTNYIIPKHRLLLVSPG

YTHLQDKYFPNAKEFDIHRWSDNQINESVEHIDYGFGKISKGTSSPYLPFGGGRHRCIGEDFAYCQLGTLLVTFVTKIKW

SLPENKAIPETDYQSMVTLPLGSAHILWEKR

 

>CYP51F7 Uncinocarpus reesii

58% to CYP51F   Uncinocarpus reesii from PPVV on

62% to Aspergillus terreus CYP51F1

UREG_00593.1, model is short. Seq. runs into a gap, missing last exon

MESFLVFSPTTQLLPAVLIVGVLTVFIGNLLLQFSSRGGAK

PPVVFHWVPFVGSAISYGLDPYRFFASCREK ()

YGDIFTFVLLGRKITVYLGVKGNDFILNGKLQDVNAEEVYSPLTTPVFGSDVIYDCPNQKLMEQKK

FIKFGLSSEALASYVPLIQHEVEQYIATSPHFRGESGTVNIAQ

IMAEITILTAARTLQGEEVRSKLDSSFANYYHDLDAGFTPINFLLPWAPLPHNRKRDAAH

KKMRDVYMGIIKQRRASGQTRGHDMLWNLMDNCVYKDGSALPDKEIAHIMITLLMAGQHT

SSAVSSWAMLQLAAHPEIGEDLYQEQIRVLESSQALTLRDIDRLTLNQMVLKETLRLHSP

IHSIMRKAKNTMSIPGTDLVVPESHILLSAPGFTARSEDHFRDAVEWNPRRWLSAPEPSE

DDDEKIDYGYGVTMKGTKGPYLSFGGGRHRCIGEKFAYLNLG (1)

 

>CYP51F7 CIMG_00573.2 Coccidioides immitis

84% to CYP51F7  Uncinocarpus reesii (ortholog to second CYP51 in this species)

CIMG_00573.2

MESLPFPSPTVQLLPTVVIIGVLSIFIGNLLRQFAPHRGAKPPVVFHWVPFIGSAISYGLDPYRFFTSCREKYGDIFTFV

LLGRKVTVYLGVKGNEFILNGKLQDVNAEEVYSPLTTPVFGSDVIYDCPNQKLMEQKKFIKFGLSSEALASYVPLIQHEV

EQYIASSPHFKGESGTMNVLQVMAEITILTAARTLQGEEVRSKLDSSFANYYHDLDSGFTPINFLLPWAPLPHNRKRDAA

HKKMRDVYMDIIKKRRISGQERGHDMLWNLMDNCVYKDGTALPDKEIAHLMITLLMAGQHTSSAISAWAILQLAAHPEVM

EGLYQEQVQVFGPSKSITLGDIDRLSFSQMVIKETLRLHAPIHSIMRKAKNTMAVPGTNLVIPESHILLSAPGFTARSED

HFKDAAKWNPHRWLSVIERSEADEKIDYGYGVTIKGTKSPYLPFGAGRHRCIGEKFAYVNLGVILAVMVRHFKLRNPDNR

VGVPATDYRSLLSRPMEPSSVHWEKRNFVSE

 

>CYP52A1 Candida tropicalis M24894

 

MSSSPSIAQEFLATITPYVEYCQENYTKWYYFIPLVILSLNLIS

MLHTKYLERKFKAKPLAVYVQDYTFCLITPLVLIYYKSKGTVMQFACDLWDKNLIVSD

PKAKTIGLKILGIPLIETKDPENVKAILATQFNDFSLGTRHDFLYSLLGDGIFTLDGA

GWKHSRTMLRPQFAREQVSHVKLLEPHMQVLFKHIRKHHGQTFDIQELFFRLTVDSAT

EFLLGESAESLRDESVGLTPTTKDFDGRNEFADAFNYSQTNQAYRFLLQQMYWILNGS

EFRKSIAIVHKFADHYVQKALELTDEDLEKKEGYVFLFELAKQTRDPKVLRDQLLNIL

VAGRDTTAGLLSFLFFELSRNPEIFAKLREEIENKFGLGQDARVEEISFETLKSCEYL

KAVINETLRIYPSVPHNFRVATRNTTLPRGGGEGGLSPIAIKKGQVVMYTILATHRDK

DIYGEDAYVFRPERWFEPETRKLGWAYVPFNGGPRICLGQQFALTEASYVTVRLLQEF

GNLKQDPNTEYPPKLQNTLTLSLFEGAEVQMYLIL

 

>CYP52A2 C. tropicalis X17560

 

ISLLNILVAGRDTTAGLLSFVFFELARTPRVANKLREEIEDKFG

LGQDARVEEISFESLKSCEYLKAVLNECLRLYPSVPQNFRVATRNTTLPRGGGKDGLS

PVLVRKGQTVMYSVYAAHRNKQIYGEDALEFRPERWFEPETKKLGWAFLPFNGGPRIC

LGQQFALTEASYVTVRLLQEFSHLTMDPNTEYSPKKMSHLTMSLFDGANIQMY

 

>CYP52A3 Candida maltosa P450cm1. X51931

 

MAIEQIIEEVLPYLTKWYTIIFGAAVTYFLSIALRNKFYEYKLK

CENPVYFQDAGLFGIPALIDIIKVRKAGQLADYTDTTFDKYPNLSSYMTVAGVLKIVF

TVDPENIKAVLATQFNDFALGARHAHFDPLLGDGIFTLDGEGWKHSRAMLRPQFAREQ

IAHVKALEPHVQILAKQIKLNKGKTFDLQELFFRFTVDTATEFLFGESVHSLYDEKLG

IPAPNDIPGRENFAEAFNTSQHYLATRTYSQIFYWLTNPKEFRDCNAKVHKLAQYFVN

TALNATEKEVEEKSKGGYVFLYELVKQTRDPKVLQDQLLNIMVAGRDTTAGLLSFAMF

ELARNPKIWNKLREEVEVNFGLGDEARVDEISFETLKKCEYLKAVLNETLRMYPSVPI

NFRTATRDTTLPRGGGKDGNSPIFVPKGSSVVYSVYKTHRLKQFYGEDAYEFRPERWF

EPSTRKLGWAYLPFNGGPRICLGQQFALTEASYVIARLAQMFEHLESKDETYPPNKCI

HLTMNHNEGVFISAK

 

>CYP52A4 Candida maltosa ALK3-A X55281

 

MPVSFVHNVLEVVTPYVEYYQENLTKWYILIPTILLTLNFLSIL

HTKYLEYKFNAKPLTNFAQDYSFGVITPLMLMYFKWHGTVMEFACNVWNNKFLVLNGN

VRTVGLRIMGLNIIETTDPENVKAILATQFNDFSLGTRHDFLYSLLGDGIFTLDGAGW

KHSRAMLRPQFAREQVAHVKLLEPHVQVLFKHVRKSQGKTFDIQELFFRLTVDSSTEF

LFGGSVESLRDASIGMTPSTKNIAGREEFADAFNYSQTYNAYRFLLQQFYWILNGSKF

NKSIKTVHKFADFYVQKALSLTEADLEKQEGYVFLYELAKQTRDPKVLRDQLLNILVA

GRDTTAGLLSFLFFELSRNPTVFEKLKEEIHNRFGAKEDARVEEITFESLKLCEYLKA

CVNEALRVYPSVPHNFRVATRNTTLPRGGGKDGMSPIAIKKGQNVMYTILATHRDPNI

YGEDANVFRPERWFEPETRKLGWAYVPFNGGPRICLGQQFALTEASYVTVRLLQEFHT

LTQDADTRYPPRLQNSLTLSLCDGANIQMY

 

>CYP52A5 Candida maltosa ALK2-A X55281

 

MTSDSTIHELIQSYITKWYVIVPLAIIIYKVFDYFYVLSLRKRL

GAAVPTNEETDGYFGFHLPFVLMSKKKDGTIIDFSIERYPELKHPETPTFEFPIFTVK

LISTIDPENIKAILATQFSDFSLGTRHAHFAPLIGDGIFTLDGAGWKHSRAMLRPQFA

REQVGHVKLLEPHVQVLFKHIRKNKGREFDLQELFFRFTVDSATEFLFGESVESLRDA

SIGMTSKSKDVDGIEDFTGAFNYSQNYLASRSIMQQFYWILNGKKFRECNAIVHKFAD

HYVQKALNLTEADLEKQAGYVFLYELVKQTRDPQVLRDQLLNILVAGRDTTAGLLSFV

FFELARNPDVVAKLKDEIDTKFGLGEDARIEEITFESLKQCEYLKAVLNECLRLYPSV

PQNFRVATKNTTLPRGGGKDGLSPILVRKGQTVMYSVYATHRMESVYGKDATTFRPER

WFEPETRKLGWAFVPFNGGPRICLGQQFALTEASYVTVRLLQEFSTLTLDPNLEYPPK

KMSHLTMSLFDGTNVQMY

 

>CYP52A6 C.tropicalis alk3 Z13010

 

MATQEIIDSALPYLTKWYTVITLAALVFLISSNIKNYVKAKKLK

CRDPPYFKGAGWTGISPLIEIIKVKGNGRLARFWPIKTFDDYPNHTFYMSIIGALKIV

LTVIQENIKAVLATQFTDFSLGTRHAHFYPLLGDGIFTLDGEGWKHSRAMLRPQFARD

QIGHVKALEPHIQILAKQIKLNKGKTFDIQELFFRFTVDTATEFLFGESVHSLYDEKL

GIPTPNEIPGRDNFATAFNTSQHYLATRTYSQTFYFLTNPKEFRDCNAKVHYLAKYFV

NKALNFTPEEIEEKSKSGYVFLYELVKQTRDPKVLQDQLLNIMVAGRDTTAGLLSFAM

FELARHPEIWSKLREEIEVNFGVGEESRVEEITFESLKRCEYLKAILNETLRMYPSVP

VNSRTATRDTTLPRGGGPNGTDPIFIPKGSTVAYIVYKTHRLEEYYGKDADDFRPERW

FEPSTKKLGWAYVPFNGGPRICLGQQFALTEASYVITRLVQMFETVSSPPDVEYPPPK

CIHLTMSHDDGVFVKM

 

>CYP52A7 C.tropicalis alk4 Z13011

 

MIEQVLHYWYYVLPAFIIFHWIVSAIHTNSLRRKLGAKPFTHTQ

LDGFYGFKFGRDFLKAKRIGRQVDLINSRFPDDIDTFSSYTFGNHVIFTRDPENIKAL

LATQFNDFSLGGRIKFFKPLLGYGIFTLDGEGWKHSRAMLRPQFAREQLPMSPSLEPH

FNVKAYPQEQRWVFDIQELFFRFTVDSATEFLFGESVNSLKSASIGCDEETELEERKK

FAEAFNKAQEYISTRVALQQLYWFVNNSEFKECNEIVHKFTNYYVQKALDATPEELEK

QSGYVFLYELVKQTRDPNVLRDHHSISLLAGRDTTAGLLSFAVFELARNPHIWAKLRE

DVESQFGLGEESRIEEITFESLKRCEYLKAVMNETLRLHPSVPRNARFALKDTTLPRG

GGPDGKDPILVRKMSCSIFISGTQIDPKHYGKDAKLFRPERWFESSTRNLGWAYLPFN

GGPRICLGQQFALTEAGYILVRLAQSFDTLELKPDTEYLTKISHLTMCLFGAFVKMD

 

>CYP52A8 C.tropicalis alk5 Z13012

 

MYEQVVEYWYVVLPLVFILHKVFDMWHTRRLMKQLGAAPVTNQL

HDNFFGIINGWKHLSSRKKVELKNIMIINLPIRKFQVWVHMLVPSLEQSSSSQKIRRN

IKALLATQFSDFSLGKRHTLFKPLLGDGIFTLDGQGWKHSRAMLRPQFAREQVAHVTS

LEPHFQLLKKHMVKNKGGFFDIQELFFRFTVDSATEFLFGESVHSLKDETIGSYQDDI

DFVGRKDFAESFNKAQEYLAIRTLVQDFYYLVNNQEFRDCNKLVHKFTNYYVQRALDA

TPEELEKQSGYVFLYELVKQTRGPNVLRDQSLNILLAGRDTSAGLLSFAVFELARNPH

IWAKLREDVESQFGLGEQSRIEEITFESLKRCGYLKAFLNETLRVYPSVPRNFRIATK

NTTLPRGGGSDGNSPVLVKKGEAVSYGINSTHLDPVYYGDDAAEFRPERWNEPSTRKL

GWAYLPFNGGPRICLGQQFALTEAGYVLVRLAQSFDTLELKPPVVYPPKRLTNLTMSL

QDGTIVKID

 

>CYP52A9 Candida maltosa D12717

 

MIDEILPKLVQYWYIVLPTLLIIKHVVSYINTQRLMRKFRAKPV

TNVLNDGFFGIPNGIKAIKEKNKGRAQEYNDEKFAAGPKPKVGTYLFKLFTKDVLVTK

DPENIKAILATQFEDFSLGKRLDFFKPLLGYGIFTLDGEGWKHSRAMLRPQFAREQVG

HVKLIEPHFQSLKKHIIKNKGQFFDIQELFFRFTVDSATEFLFGESVESLKDESIGYD

QQDFDFDGRKNFAEAFNKAQEYLGTRAILQLFYWLVNGADFKKSVAEVHKFTDYYVQK

ALDATPEELEKHSGYIFLYELVQQTRDPKVLRDQSLNILLAGRDTTAGLLSFALFELA

RNPEVWSRLREEIGDKFGLDEDATIEGISFESLKQCEYLKAVVNECLRMYPSVPRNFR

IATKHTTLPRGGGPDGKDPIFIKKGAVVSYGINSTHLDPMYYGPDARLFNPDRWSKPE

TKKLGWAFLPFNGGPRICLGQQFALTEASYVLVRMIQNFKELELTPNTVYPPRRLTNL

TMSLYDGAYIKVN

 

>CYP52A10 Candida maltosa D12719

 

MIFTAFILDYWYFTLLFLIAAYFIGKHVYTNYLMRKHHAEPILD

VVDDGAFGFKFGFQSLKAKKIGNQIDLLFLKFNEAKHPSIGTFVTRSFGMQFIATKDP

ENIKAMLATQFNEYTLGQRLNFLAPLLGKGIFTLDGNGWKHSRAMLRPQFSRDQIGHV

KMLEPHFQLLKKHIIKNKGTFFDIQELFFRFTVDSATEFLFGESVSSLKDESIGYDQE

EIDFAGRKDFAEAFNKSQVYLSTRTLLQLLYWLVNSADFKRCNKIVHKFSDYYIKKAL

TATPEELEKHSSYIFLYELAKQTRDPIVLRDQSLNILLAGRDTTAGLLSFAVFELGRN

PEVWSKLRQEIGHKFGLDSYSRVEDISFELLKLCEYLKAVLNETLRLYPSVPRNARFA

AKNTTLPHGGGPDGMSPILVRKGQTVMYSVYALQRDEKYYGKDANEFRPERWFEPEVR

KLGWAFLPFNGGPRICLGQQFALTEASYVLARLIQSFETLELSPEAAYPPAKLSHLTM

CLFDGTPVRFE

 

>CYP52A11 Candida maltosa D12719

 

MVFTAFILEYWYFTLLSLAAGHFIGKHVYTNYLMRKHHAEPILD

VVDDGAFGFKFGFQALKAKKIGKQIDLLFKKFNEAKHPSIGTFVTRSFGMQFIATKDP

ENIKAMLATQFNDFTLGQRLSYFAPLLGKGIFTLDGEGWKHSRAMLRPQFSRDQVGHV

KMLEPHFQLLKKHIIKNKGSFFDIQELFFRFTVDSATEFLFGESVSSLKDESIGYDQE

EIDFAGRKDFAEAFNKSQVYLSTRSLLQLLYWLVNSSDFKRCNKIVHKFSDYYIKKAL

TATPEELEKHSSYIFLYELAKQTRDPIVLRDQSLNILLAGRDTTAGLLSFAVFELGRN

PEVWSKLREEIGDKFGLDPDSRIEDISFELLKLCEYLKAVINETLRLYPSVPRNGRFA

AANTTLPHGGGPDGMSPILVRKGQTVMYSVYALQRDEKYYGKDANEFRPERWFEPEVR

KLGWAFLPFNGGPRICLGQQFALTEASYVLVRLIQSFETLELSPDAPYPPAKLTHLTM

CLFDGAPVRIE

 

>CYP52A12 Candida tropicalis

AY230498

MATQEIIDSVLPYLTKWYTVITAAVLVFLISTNIKNYVKAKKLK

CVDPPYLKDAGLTGISSLIAAIKAKNDGRLANFADEVFDEYPNHTFYLSVAGALKIVM

TVDPENIKAVLATQFTDFSLGTRHAHFAPLLGDGIFTLDGEGWKHSRAMLRPQFARDQ

IGHVKALEPHIQIMAKQIKLNQGKTFDIQELFFRFTVDTATEFLFGESVHSLYDEKLG

IPTPNEIPGRENFAAAFNVSQHYLATRSYSQTFYFLTNPKEFRDCNAKVHHLAKYFVN

KALNFTPEELEEKSKSGYVFLYELVKQTRDPKVLQDQLLNIMVAGRDTTAGLLSFALF

ELARHPEMWSKLREEIEVNFGVGEDSRVEEITFEALKRCEYLKAILNETLRMYPSVPV

NFRTATRDTTLPRGGGANGTDPIYIPKGSTVAYVVYKTHRLEEYYGKDANDFRPERWF

EPSTKKLGWAYVPFNGGPRVCLGQQFALTEASYVITRLAQMFETVSSDPGLEYPPPKC

IHLTMSHNDGVFVKM

 

>CYP52A13 Candida tropicalis

AY230499

MTVHDIIATYFTKWYVIVPLALIAYRVLDYFYGRYLMYKLGAKP

FFQKQTDGCFGFKAPLELLKKKSDGTLIDFTLQRIHDLDRPDIPTFTFPVFSINLVNT

LEPENIKAILATQFNDFSLGTRHSHFAPLLGDGIFTLDGAGWKHSRSMLRPQFAREQI

SHVKLLEPHVQVFFKHVRKAQGKTFDIQELFFRLTVDSATEFLFGESVESLRDESIGM

SINALDFDGKAGFADAFNYSQNYLASRAVMQQLYWVLNGKKFKECNAKVHKFADYYVN

KALDLTPEQLEKQDGYVFLYELVKQTRDKQVLRDQLLNIMVAGRDTTAGLLSFVFFEL

ARNPEVTNKLREEIEDKFGLGENASVEDISFESLKSCEYLKAVLNETLRLYPSVPQNF

RVATKNTTLPRGGGKDGLSPVLVRKGQTVIYGVYAAHRNPAVYGKDALEFRPERWFEP

ETKKLGWAFLPFNGGPRICLGQQFALTEASYVTVRLLQEFAHLSMDPDTEYPPKKMSH

LTMSLFDGANIEMY

 

>CYP52A14 Candida tropicalis

AY230500

MTAQDIIATYITKWYVIVPLALIAYRVLDYFYGRYLMYKLGAKP

FFQKQTDGYFGFKAPLELLKKKSDGTLIDFTLERIQALNRPDIPTFTFPIFSINLIST

LEPENIKAILATQFNDFSLGTRHSHFAPLLGDGIFTLDGAGWKHSRSMLRPQFAREQI

SHVKLLEPHMQVFFKHVRKAQGKTFDIQELFFRLTVDSATEFLFGESVESLRDESIGM

SINALDFDGKAGFADAFNYSQNYLASRAVMQQLYWVLNGKKFKECNAKVHKFADYYVS

KALDLTPEQLEKQDGYVFLYELVKQTRDRQVLRDQLLNIMVAGRDTTAGLLSFVFFEL

ARNPEVTNKLREEIEDKFGLGENARVEDISFESLKSCEYLKAVLNETLRLYPSVPQNF

RVATKNTTLPRGGGKDGLSPVLVRKGQTVMYGVYAAHRNPAVYGKDALEFRPERWFEP

ETKKLGWAFLPFNGGPRICLGQQFALTEASYVTVRLLQEFGHLSMDPNTEYPPRKMSH

LTMSLFDGANIEMY

 

>CYP52A15 Candida tropicalis

AY230501

MSSSPSFAQEVLATTSPYIEYFLDNYTRWYYFIPLVLLSLNFIS

LLHTRYLERRFHAKPLGNFVRDPTFGIATPLLLIYLKSKGTVMKFAWGLWNNKYIVRD

PKYKTTGLRIVGLPLIETMDPENIKAVLATQFNDFSLGTRHDFLYSLLGDGIFTLDGA

GWKHSRTMLRPQFAREQVSHVKLLEPHVQVFFKHVRKHRGQTFDIQELFFRLTVDSAT

EFLFGESAESLRDESIGLTPTTKDFDGRRDFADAFNYSQTYQAYRFLLQQMYWILNGS

EFRKSIAVVHKFADHYVQKALELTDDDLQKQDGYVFLYELAKQTRDPKVLRDQLLNIL

VAGRDTTAGLLSFVFYELSRNPEVFAKLREEVENRFGLGEEARVEEISFESLKSCEYL

KAVINETLRLYPSVPHNFRVATRNTTLPRGGGEDGYSPIVVKKGQVVMYTVIATHRDP

SIYGADADVFRPERWFEPETRKLGWAYVPFNGGPRICLGQQFALTEASYVTVRLLQEF

AHLSMDPDTEYPPKLQNTLTLSLFDGADVRMY

 

>CYP52A16 Candida tropicalis

AY230502

MSSSPSFAQEVLATTSPYIEYFLDNYTRWYYFIPLVLLSLNFIS

LLHTKYLERRFHAKPLGNVVLDPTFGIATPLILIYLKSKGTVMKFAWSFWNNKYIVKD

PKYKTTGLRIVGLPLIETIDPENIKAVLATQFNDFSLGTRHDFLYSLLGDGIFTLDGA

GWKHSRTMLRPQFAREQVSHVKLLEPHVQVFFKHVRKHRGQTFDIQELFFRLTVDSAT

EFLFGESAESLRDDSVGLTPTTKDFEGRGDFADAFNYSQTYQAYRFLLQQMYWILNGA

EFRKSIAIVHKFADHYVQKALELTDDDLQKQDGYVFLYELAKQTRDPKVLRDQLLNIL

VAGRDTTAGLLSFVFYELSRNPEVFAKLREEVENRFGLGEEARVEEISFESLKSCEYL

KAVINEALRLYPSVPHNFRVATRNTTLPRGGGKDGCSPIVVKKGQVVMYTVIGTHRDP

SIYGADADVFRPERWFEPETRKLGWAYVPFNGGPRICLGQQFALTEASYVTVRLLQEF

GNLSSDPNAEYPPKLQNTLTLSLFDGADVRMF

 

>CYP52A17 Candida tropicalis

AY230504

MIEQLLEYWYVVVPVLYIIKQLLAYTKTRVLMKKLGAAPVTNKL

YDNAFGIVNGWKALQFKKEGRAQEYNDYKFDHSKNPSVGTYVSILFGTRIVVTKDPEN

IKAILATQFGDFSLGKRHTLFKPLLGDGIFTLDGEGWKHSRAMLRPQFAREQVAHVTS

LEPHFQLLKKHILKHKGEYFDIQELFFRFTVDSATEFLFGESVHSLKDESIGINQDDI

DFAGRKDFAESFNKAQEYLAIRTLVQTFYWLVNNKEFRDCTKSVHKFTNYYVQKALDA

SPEELEKQSGYVFLYELVKQTRDPNVLRDQSLNILLAGRDTTAGLLSFAVFELARHPE

IWAKLREEIEQQFGLGEDSRVEEITFESLKRCEYLKAFLNETLRIYPSVPRNFRIATK

NTTLPRGGGSDGTSPILIQKGEAVSYGINSTHLDPVYYGPDAAEFRPERWFEPSTKKL

GWAYLPFNGGPRICLGQQFALTEAGYVLVRLVQEFSHVRSDPDEVYPPKRLTNLTMCL

QDGAIVKFD

 

>CYP52A18 Candida tropicalis

AY230505

MIEQILEYWYIVVPVLYIIKQLIAYSKTRVLMKQLGAAPITNQL

YDNVFGIVNGWKALQFKKEGRAQEYNDHKFDSSKNPSVGTYVSILFGTKIVVTKDPEN

IKAILATQFGDFSLGKRHALFKPLLGDGIFTLDGEGWKHSRSMLRPQFAREQVAHVTS

LEPHFQLLKKHILKHKGEYFDIQELFFRFTVDSATEFLFGESVHSLKDETIGINQDDI

DFAGRKDFAESFNKAQEYLSIRILVQTFYWLINNKEFRDCTKSVHKFTNYYVQKALDA

TPEELEKQGGYVFLYELVKQTRDPKVLRDQSLNILLAGRDTTAGLLSFAVFELARNPH

IWAKLREEIEQQFGLGEDSRVEEITFESLKRCEYLKAFLNETLRVYPSVPRNFRIATK

NTTLPRGGGPDGTQPILIQKGEGVSYGINSTHLDPVYYGPDAAEFRPERWFEPSTRKL

GWAYLPFNGGPRICLGQQFALTEAGYVLVRLVQEFSHIRSDPDEVYPPKRLTNLTMCL

QDGAIVKFD

 

>CYP52A19 Candida tropicalis

AY230506

MLDQILHYWYIVLPLLAIINQIVAHVRTNYLMKKLGAKPFTHVQ

RDGWLGFKFGREFLKAKSAGRSVDLIISRFHDNEDTFSSYAFGNHVVFTRDPENIKAL

LATQFGDFSLGSRVKFFKPLLGYGIFTLDAEGWKHSRAMLRPQFAREQVAHVTSLEPH

FQLLKKHILKHKGEYFDIQELFFRFTVDSATEFLFGESVHSLKDEEIGYDTKDMSEER

RRFADAFNKSQVYVATRVALQNLYWLVNNKEFKECNDIVHKFTNYYVQKALDATPEEL

EKQGGYVFLYELVKQTRDPKVLRDQSLNILLAGRDTTAGLLSFAVFELARNPHIWAKL

REEIEQQFGLGEDSRVEEITFESLKRCEYLKAVLNETLRLHPSVPRNARFAIKDTTLP

RGGGPNGKDPILIRKDEVVQYSISATQTNPAYYGADAADFRPERWFEPSTRNLGWAFL

PFNGGPRICLGQQFALTEAGYVLVRLVQEFPNLSQDPETKYPPPRLAHLTMCLFDGAH

VKMS

 

>CYP52A20 Candida tropicalis

AY230507

MLDQIFHYWYIVLPLLVIIKQIVAHARTNYLMKKLGAKPFTHVQ

LDGWFGFKFGREFLKAKSAGRQVDLIISRFHDNEDTFSSYAFGNHVVFTRDPENIKAL

LATQFGDFSLGSRVKFFKPLLGYGIFTLDGEGWKHSRAMLRPQFAREQVAHVTSLEPH

FQLLKKHILKHKGEYFDIQELFFRFTVDSATEFLFGESVHSLRDEEIGYDTKDMAEER

RKFADAFNKSQVYLSTRVALQTLYWLVNNKEFKECNDIVHKFTNYYVQKALDATPEEL

EKQGGYVFLYELAKQTKDPNVLRDQSLNILLAGRDTTAGLLSFAVFELARNPHIWAKL

REEIESHFGSGEDSRVEEITFESLKRCEYLKAVLNETLRLHPSVPRNARFAIKDTTLP

RGGGPNGKDPILIRKNEVVQYSISATQTNPAYYGADAADFRPERWFEPSTRNLGWAYL

PFNGGPRICLGQQFALTEAGYVLVRLVQEFPSLSQDPETEYPPPRLAHLTMCLFDGAY

VKMQ

 

>CYP52A21 Candida albicans SC5314

putative P450 drug resistance protein

XM_705082, orf19_10

MLEEISFESWYLYLIICGVLYFCTNYLYIQYLNKKLGAKSPGSC

KSDGCFGFRSGFEMLKAKKIGRQVDLLHERFNDLSNPEVNDTFTSYNFGFPMIITKDP

ENIKALLATQFNDFSLGRRYDFFKPLLGKGIFTLDGEGWKHSRSMLRPQFAREQIAHV

KALEPHFQLLKKHITKNKGQFFDIQELFFRFTVDSATEFLFGESVSSLKDESIGYNQD

EFDFAGRKDFPEAFNKSQIYLSTRSLLQNLYWLVNPKDFQNCNAIVHKFSDYYVNKAL

NATPEELEKNSGYVFLYELVKQTRDPQVLRDQALNILLAGRDTTAGLLSFAVFELARN

PQVWKKLREEIIERYADGATEISFETLKQCEYLKAVINETLRLYPSVPRNGRFANKNT

TLPRGGGPDGMSPILIKQGQAVMYSIYSTQRDPKYYGKDADVFRPERWFEPETRKLGW

AFLPFNGGPRICLGQQFALTEASYVLVRLAQCCENLQLTEGIEYPPAKLTHLTMCMFD

GVPIKVD

 

>CYP52A22 Candida albicans SC5314

79% to CYP52A4 orf19_7512

MSPSLVHQILAITHPYVEYLEENITKWYILVPGILIVLNVLTTLHTKYLEYKFNAKPVTNFIQDYTFGVITPLILIYYKS

QGTVMEFANNFWNFKFLIKNPDVGTGELRIFGMHLIETKDPENIKAVLATQFNDFSLGTRHGFLYSLLGDGIFTLDGAGW

KHSRSMLRPQFAREQIAHVKILEPHMQVFFKHIRKNKGKTFDIQELFFRLTVDSSTEFLFGSSVESLRDETIGMSPSVKN

LAGRDEFADAFNYSQTINAYRFLLQQFYWLCNGTKFRKSIAAVHKFSDFYVQKALSLSQDELDEQKGYVFLYELAKQTRD

PKVLRDQLLNILVAGRDTTAGLLSFVFFELARNPEVYAKLKEEIYNKFGSGEDARIDEITFESLKQCEYLKAVINESLRL

YPSVPHNFRTATRNTTLPRGGGPDGMSPIVVKKGQSVMYTVLVTHRDTKTYGADANEFRPERWFEPETRKLGWAYVPFNG

GPRICLGQQFALTEASYVTVRLLQEFEHLTMDAETRYPPKLMNSLTLSLLDGANVEMY

 

>CYP52A23 Candida albicans SC5314

78% to CYP52A5 orf19_7513

MSVSDIVQEYITKWYVVIPTLFVVYQVVDFFYVRSLRSRLGAKAPTNNESDGYWGFHLPFLLVSKKAEGTIIDFAGERFK

SIAHPEVPTFQFPIFTVKVISTVDPENIKAVLATQFNDFSLGTRHNQFAPLLGDGIFTLDGAGWKHSRSMLRPQFAREQV

AHVKALEPHMQVLFKHIRKSGGRTFDLQELFFRFTVDSATEFLFGESVESLRDESIGMALEAVDFDGKKEFAEAFNFSQN

YLASRAVMQQMYWLLNSSEFKSCNSKVHKFAEYYVNKALELSHEELEKQQGYVFLYELAKQTRDTKVLRDQLLNILVAGR

DTTAGLLSFVFFELARNPRVFAKLREEVEEKFGVGEDARVEEISFESLKSCEYLKAVLNECLRLYPSVPQNFRVATKNTT

LPRGGGSDGMSPILVRKGQTVMYSVYVTHRDTKVYGKDADEFRPERWFEPETRKLGWSFVPFNGGPRICLGQQFALTEAS

YVTVRLLQEFGHLTMDPNTDYPPKKMSHLTMSLYDGTNVEMY

 

>CYP52A24 Candida albicans SC5314

78% to CYP52A3 orf19_5728 partial sequence

MSSTTFNDIIDSVLPYLTKWYTILIGAGLIFVLSTNLKNAYYSYKLGCKNPVHLKRAGWTGIPALIDAIKAKNSGKLAEF

GGDTFDELNSKNFYLNVAGVLKIIFTIEPENIKAVLATQFNDFSLGTRHAHFYPLLGDGIFTLDGEGWKHSRAMLRPQFA

REQIAHVKSLEPHIQILAKQIKLNKGETFDLQELFFRFTVDTATEFLFGESVHSLYDDKLGIPPPNDIPGRDNFATAFNT

SQHYLATRSYSQTFYWLTNNKEFRDCNAKVHHLAKYFVDKALNSTEKEIEEKSQGGYVFLYELVKQTKNPKVLQDQLLNI

MVAGRDTTAGLLSFAMFELARNPKVWNKLREELEANYGVGEEARVEDITFENLKKM

 

>CYP52A25 Candida dublinensis

79% to CYP52A3   Candida maltosa

cdub_593-g99.1

MSSATTSSNIIDSVLPYLTKWYTILIGAGLIFILSTNLKNAYYSYKLGCKNPVYLKRAGWTGIPALIDAIKAKNSGKLAE

FGDDTFEELNTKTFYLNVAGVLKIIFTIDPENIKAVLATQFNDFSLGTRHAHFYPLLGDGIFTLDGEGWKHSRAMLRPQF

AREQIAHVKSLEPHIQILAKQIKLNKGETFDLQELFFRFTVDTATEFLFGESVHSLYDDKLGIPPPNDIPGRDNFATAFN

ISQHYLATRSYSQTFYWLTNNKEFRDCNAKVHYLAKYFVDKALNSTEEEIEEKSQGGYVFLYELVKQTKNPKVLQDQLLN

IMVAGRDTTAGLLSFAMFELARNPKVWNKLREEIETNFGVGEESRVEDITFENLKKCEYLKAILNETLRLYPSVPINFRT

STKDTTLPTGGGRDGTSPIFVPKGSTVAYTVYKTHRLEEYYGKDSYEFRPERWFEPLTKKLGWAYLPFNGGPRICLGQQF

ALTEASYVITRLAQLFPVLETREKQYPPNKCIHLTMNHDEGVFVSMN

 

>CYP52A26 Candida dublinensis

89% to CYP52A21   Candida albicans

cdub_14-g136.1

MLEEISFESWYIYLFICGVLYFGSKYFYTQYLNNKFGAKLPGSFRSDGLFGFKNGFEMLKAKKVGRQVDLVHSRFNDLSK

THVNDTFKEYNFGIPVIVTKDPENIKALLATQFNDFSLGRRSDFFYPLLGKGIFTLDGEGWKHSRAMLRPQFAREQIAHV

KALEPHFQLLKKHITKNKGKGFDIQELFFRFTVDSATEFLFGESVSSLKDESIGYNQDEFDFDGRKDFPEAFNKAQIYLA

TRAILKDLYWLVNPKDFQNCNAIVHKFSDYYVNKALNATPEELEKNSGYVFLYELVKQTRDPQVLRDQALNILLAGRDTT

AGLLSFAMFELARNPQIWQKLREEVIEKYADEVTEIAFETLKQCEYLKAVINETLRLYPSVPRNGRFANKNTTLPRGGGP

DGMSPILIKQGQGVLYSIYSTQRDTKFYGKDADVFRPERWFEPETRKLGWAFLPFNGGPRICLGQQFALTEASYVLVRLA

QSYENLQLTENIEYPPPKLTHLTMCMFDGVPIKIA

 

>CYP52A27 Candida dublinensis

94% to CYP52A23   Candida albicans

cdub_14-g720.1

MTVSTLEIQDIIQQYITKWYVIIPTLFVVYQVVDFLYVRSLRSRFGAKAPTNNESDGYWGFHLPFLLVSKKAEGTIIDFA

GERFKNITHPEVPTFQFPIFTVKVISTVDPENIKAVLATQFNDFSLGTRHNQFAPLLGDGIFTLDGAGWKHSRSMLRPQF

AREQVAHVKALEPHMQVFFKHVRKSGGRTFDIQELFFRLTVDSATEFLFGESVESLRDESIGMALEAVDFDGKKEFAQAF

NFSQNYLASRAVMQQMYWLLNSSEFQSCNTKVHKFAEYYVNKALELSPESLEKQQGYVFLYELVKQTRDTKVLRDQLLNI

LVAGRDTTAGLLSFVFFELARNPRVFAKLREEIEQKFGVGEDSRVEEISFESLKLCEYLKAVLNECLRLYPSVPQNFRVA

TKNTTLPRGGGPDGLSPILVRQGQTVMYSVYVTHRDTKVYGKDANEFRPERWFEPETRKLGWSFVPFNGGPRICLGQQFA

LTEASYVTVRLLQEFGHLTMDPNTQYPPKKMSHLTMSLFDGTNVEMY

 

>CYP52A28 Candida dublinensis

93% to CYP52A22   Candida albicans

cdub_14-g719.1

MSPSLVHQILAIAHPYVEYLQANFTKWYILVPGILIALNVLTFLYTKYLEYKFNAKPVTNFIQDYTFGVLTPLILIYYKS

QGTVMEFANNLWGNRFFIKNADVGTGELRIFGMHLIETKDPENIKAILATQFNDFSLGTRHGFLYSLLGDGIFTLDGAGW

KHSRSMLRPQFAREQVSHVKILEPHMQVFFKHVRKNKGKAFDIQELFFRLTVDSSTEFLFGSSVESLRDETIGMSPSVKN

LAGRDEFAEAFNYSQTINAYRFLLQQFYWLCNGSKFRKSIATVHKFSDFYVQRALSLSKAELDDQKGYVFLYELAKQTRD

PKVLRDQLLNILVAGRDTTAGLLSFVFFELARNPTVYAKLKEEIYNKFGSGEDARIDEITFESLKQCEYLKAVINESLRL

YPSVPHNFRTATRNTTLPRGGGPDGMSPIVVKKGQSVMYTVLATHRDTKTYGADANDFRPERWFEPETRKLGWAYVPFNG

GPRICLGQQFALTEASYVTVRLLQEFGHLTMDPETCYPPKLMNSLTLSLLEGANVEMY

 

>CYP52A29 Candida lusitaniae

55% to CYP52A13   Candida tropicalis

CLUG_03984.1

MSLHGVFGGMSIWSSVLLFIGIYLAGSYIRRYIAYKRSGAMWPAYGTDKCLGFKVVREMLKMRQIGRAPDFFQSKFEITG

VYTGGLLVGGRYAITTRDPENVKAILATQFNDFNLGNRNQHIKVTLGDGIFTLDGAGWKSSRAMLRPQFAREQIAHVQSL

ERHVQRLAQKVRGTKGERFDIQPLFAKLTIDSGTEFLFGESCESLVDGESESETGLDPALKAVFAEAFNYTQTILFQRLS

LQKLYFLVDGFKFRRQNRIVHQVTDFFVERALHASDKEAHSSSRGGYVFLYELMKQTRDPKVLRDQCLNVLLAARDTTSG

LLSFCFFELARNPAVFARLREEISFHFGLGESADLSAISFESLKKCEYLRAVLHETLRMYPSVPANFRVATRDTTLPHGG

GPDESKPIFVPKGTMCIYQVYSVHRSEVHYGKDYNDFRPERWFEERTKKLGWAFLPFNGGPRICLGQQFALTEASYVIVR

LLQMFEHIESFDSVYPPAKATHLTMSLFDGANIALW

 

>CYP52A30 Candida lusitaniae

55% to CYP52A23   Candida albicans

CLUG_04851.1

MLLSELKTAWDSFSSHLSDNVFLYYAELLILTLVVYHTYRTSKKWYLRKKLGAESAKWLQTSSAGWINSLPMREILDAKR

EGYLLRELWKYWHDDDENFMVKVAGTEMFVTTDPENYKALLATQFNDFKLGIRHSHFKPLLGDGIFTLDYGGWKHSRALL

RPNFSREKVGHLHSLETHLQVLFKHIRKHNGKPFDLQELFFRLTVDTATEFLFGHSANTLEDESIGIHKEETFEGEKEFY

DCFNISQAICATRAWTQKGYFLTIPFLYKEFTRCNRVVHNFADYYVNMALNMSQDELEKESNDGYIFLYELAKETRDPKV

LRDQLLNIMIAGRDTTAGLMSFIFFELAKRPDVWAKLKAEIYERFGYGDNVRFDEITFETLKKCTYLKNVVNETLRLYPS

VPVNYRQANINTTLPRGGGPDGDKPVLIEKGNAVGYIVSATHRNEKYYGKDAAEFKPERWDDKNLKPGWAYLPFNGGPRI

CLGQQFAITEASYVVTRMIQEFPNIADHDVEPDTYPPRMISQLTNSLAAGCYVSLTK

 

>CYP52A31 Candida lusitaniae

52% to CYP52A18   Candida tropicalis

CLUG_04098.1

MSLFRELDPVQLVYVVISLFFASFVYNELKGIYLSRKWHTKSPVKTYRGLFSLPQLVRSRKAVDSGHFVDYFRDQYIKYG

ADTLDFTGFGSKIFFTKNPHNVKSLFATNFDDWSIGARKRAFKPFLGVGVFVTDGEVWKHSRTMLKPQFSREQIAHVHSV

ESHYKLFAQHIRSYRGQEFDIQPLFMKLTMDASSEFLFGESIHLLHDDSIEHEKDTSDIKGKKELAEDLSFLQTYLMFRV

MLLDWFWLENSKKFSEAIKRVHAFTSQFVDRVLSLTPEEREANSKDGYTFLYELAKVTNDPIVMRDQILNVMLAGRSTTA

SLLCSVLLELSRNPEVYEKLKNEVYEQFGNGKTKGEEITFETLKKCTYLRWVLNEGLRMYPPVPSNLRQAVRDTTLPKGG

GPDGESPVLVRKGQYVALHIYSMHRSEEFYGKDALSFRPERWADLSKIGWAFMPFGSGPRICLGQQFALTEASYILVRMV

QDFPHIASHNKTYPPRTYSRSTMHYIDGIRISLY

 

>CYP52A32 Candida parapsilosis

71% to CYP52A5   Candida maltosa

CPAG_03577

MSDLTLFDYATKWYVLAPALIVLYAVYIQVYNAYLIKKLGAAKEANCEGDGLFGFRLPFWLIERKENGTVVDYVAERFDE

VSHPSIPTFSIRIFMVKLWMTKDPENIKALLATQFNDFCLGTRHAQFKPLLGDGIFTLDGQGWKESRQMLRPQFARDQIS

HVKMLEPHIQVLFKQIHKNKGQVFDLQELFFRFTVDSATEFLFGESVDSLKDASIGMQAVSNEVEGKEQFAKSFNFSQNY

LASRTTMQGLYWLLNSKKFRDNNAVVHKFAQYYVKRALSLTPEELEKQNGYVFLYELAKHTRDPKVLQDQLLNILVAGRD

TTAGLLSFVFFELARSPAVLTKLREEIGAKFGLDKEARVDEITFESLKNCEYLKAVLNECLRLYPSVPQNFRVATKNTTL

PRGGGPDGMSPIFVTKGQIVQYCVYATHRMEEFYGKNANEFRPERWFEPQTRKLGWAFVPFNGGPRICLGQQFALTEASY

VTTRLVQEFSSLWMDPNTQYPPHKMSHLTMSLYDGCNVKME

 

>CYP52A33 Candida parapsilosis

73% to CYP52A5   Candida maltosa

CPAG_04394

MSDFDIMEYSTKWYIIAPALIVFYVVYKKINEAYLMKKLGAVRETNPEGDGYLGFKLPFWLIERKKNGTLVDFSEQRFHE

ISHPEVPTLSMRIFTVKLWATKDPENIKALLATQFNDFSLGTRHPQFKPLLGDGIFTLDNQGWKDSRQMLRPQFAREQIS

HVKMLEPHIQVLFKHVRKNKGQVFDLQELFFRFTVDSATEFLFGESVDSLKDASVGMQADSNEIDGKEQFAESFNFSQNY

LASRAVMQGLYWLLNSKKFRDSNAVVHRFAQHYVKRALSLSPEELEKQNGYVFLYELAKHTRDPKVLQDQLLNILVAGRD

TTAGLLSFVFFELARNPAVLAKLREEIGTKFGLGKEARIEEITFESLKNCEYLKAVLNECLRLYPSVPQNFRVATRNTTL

PRGGGPDGMSPILITKGQTVNYSVYATHRSEEYYGKDANEFRPERWFEPQTRKLGWAFVPFNGGPRICLGQQFALTEASY

VTTRLVQEFSSLWMDPNTQYPPHKMSHLTMSLYDGCNVKME


>CYP52A34 Candida parapsilosis

71% to CYP52A5   Candida maltosa

CPAG_04395

MRGQCGLPFFFRKNTCNSTITLESCNGYLTRATLATDIKRWAILFSCSTSIQTCLFFNYYNEVSMLDFNIMGYTISLFVL

APALIVLYVVYKIITEVYLMKKLGASRETNVVSDGAFSLKLAFTLIASKNNGTLIDYVAEMYRGAPHPEVPTFSSRIFTV

KFYLTKDPENIKALLATQFNDFCLGTRHAQFQALLGDGIFTLDGKGWKDSRQMLRPQFAREQISHVKMLEPHIQVLFKHV

RKNKGQVFDLQELFFRFTVDSATEFLFGESVDSLKDASVGMQADSNEFDGKEQFPQSFNFSQSYLASRVVISFMYWVLNS

KQFRDSNAVVHRFAQHYVKRALSLSPEELEKQNGYVFLYELAKHTRDPKVLQDQLLNILVAGRDTTAGLLSFVFFELARN

PAVLAKLREEIGTKFGLGKEARIEEITFESLKNCEYLKAVLNECLRLYPSVPQNFRVATRNTTLPRGGGPDGMSPILVTK

NQEVHYSVYSTHRMEEYYGKDANEFRPERWFEPQTRKLGWAFVPFNGGPRICLGQQFALTEASYVTTRLVQEFSSLWMDP

NTQYPPHKMSHLTMSLYDGCNVKME

 

>CYP52A35 Candida parapsilosis

65% to CYP52A21   Candida albicans

CPAG_05481

MIDSAIATYWYITIPSVFLLYIIISYINEQYLMRKFKAKPFTNYISGGFFGFQEGIAALKHKKAGTAIERYRDLYEELPN

PDVPTYKSFVFGTPLVFTKDPENIKAILATQFNDFSLGIRHAHFDPLLGDGIFTLDHQGWKDSRAMLRPQFARDQIAHVK

ALEPHFQFLLRHIEKNNGQFFDIQELFFRFTVDSATEFLFGSSVSSLQDESIGCDTTELDFVGRKEFPEAFNKSQLILST

RALLQKMYWIYNPKEFKKCNAIVHQFSDYYINKVLSCTPEEIEKQSGYVFLYELVKQTRNPKVLRDQALNILVAGRDTTA

GLLSFVLFELARNPDIYKKLRDEILDKFGTSNLEEITFESLKKCEYLKAVLNEALRMYPSVPRNYRVSTRNTTLPRGGGS

DGTSPIFIPKGRSVIYNIAATHMDPRYYGKDVEEFRPERWFEESTKKLGWAYLPFNGGPRICLGQQFALTEASYVVARLA

QTISKLELKDGYTYPPKKMTHLTMCMFDGVYVKMEKDATAAAAKSG

 

>CYP52A36 Candida parapsilosis

65% to CYP52A21   Candida albicans

CPAG_05482

MIETVSIANIVAYWYITIPAVLLGHFVIGYIHEQVLIRKLGAKPFANNVNGGFFGSALGVKSIVAKGKGRAVEFYQNLYH

VSPHTEVPTIKTYIFGTPIVFTKDPENIKAILATQFQDFCLGNRYHFLKPLLGKGIFTLDHEGWKDSRAILRPQFARDQI

AHVKALEPHFQFLLRHIEKNNGQFFDIQELFFRFTVDSATEFLFGSSVSSLQDESIGCDTSALDFSGRLEFAEAFNVSQV

YLSTRALLQRIYWLCNNQEFKKCNKIVHQFSDYYINKVLNCTPEEIEKQSGYVFLYELVKQTRDPIVLRDQALNILLTGR

DTTAGLLSFVLFELARNPEMYAKLRHEILDKFGTSNLEDITFENLKKCEYLKAILNETLRMYPSVPRNARVATRNTTLPR

GGGSDGTSPVFIPKGKAVIYNIAATHMDPRYYGKDVEEFRPERWFEESTKKLGWAYLPFNGGPRICLGQQFALTEASYVV

ARLAQTISKLELKEGYEYPPKKMTHLTMSMFDGVYVKMEL

 

>CYP52A37 Candida parapsilosis

58% to CYP52A12   Candida tropicalis

CPAG_05523

MALDLASISSFITIHLFTWYGAIISFALIYATVGKIKREIFIRKHGCKEAYVFPDGGPLGLVLAFILQKYKSDGTILDFA

LSLYEDYGKRTTFTAYLFGVRVVVSGEPENMKAVLATQFNDYSLGSRHAHFAPLLGDGIFTLDNEGWKESRQLLRPQFAR

EQISHVKMLEPHVQVLAEHIRKHKGQTFDIQELFFRLTVDASTEFLFGESVHSLYDESIGRKCDPEVAGFADAFNAAQVA

LGVRTYLQVMYFLYNPPSFWKNTRTVHNFARKFVDKALSLTPEQVEERTQKHGYTFLYELVKHTRDPKVLQDQLLNIMVA

GRDTTAGLLSFTIFELARHPKVWNRLKDEIYHHFGSGEDSDVENISFETLKQCTYLKWVLNEILRLYPSVPVNFRVANKD

TTLPVGGGPDGTSPVFIGKGTTFAYSPYMTHRLEKFYGKDSFEFVPERWENSPKLGWAYLPFNGGPRICLGQQFALTEAS

YVIVRLAQMFPNLSSSYNGPEPCRKLVHLTMSLMDGAEIQMS

 

>CYP52A38 Candida parapsilosis

74% to CYP52A25   Candida dublinensis

CPAG_02285

MSSILDQASDFGEKLLPYLTKWYSIVFIILLTYIPLLNIRNAYVGWKLGCQDPPKFRKAGFTGVFALIEAVKKKNQGRLV

DWGDEQFDEYPNHSMYLNVTGLLKIVLTVDPENIKAVLATQFNDFSLGTRHAHFAPLLGDGIFTLDGNGWKDSRAMLRPQ

FAREQIAHVKSLEPHLQILAKHIKSTNFQTFDLQELFFKFTVDTATEFLFGESVHSLYDDKLGIAPPNDIPGREHFADAF

NKSQKYLATRTYLQMFYFLINPKEFRDCNKKVQHLAQYFVNKALNFTPEELEEKSKDGYIFLYELVKQTKNPQVLQDQLL

NIMVAGRDTTAGLLSFTMYELARNPQVWQKLRQEIVENFGDGEDARVESITFETLKKCEYLKAVLNETLRLYPSVPVNFR

TATRDTTLPRGGGADGTKPIFVPKGSTVAYTVYKTHRLEEYYGKDSKEFKPERWENIKRLGWAYLPFNGGPRICLGQQFA

LTEASYVVARLVQMFPTLESQDDTYPPKKCVHLTMNLDEGVFVKMK

 

>CYP52A39 Candida guilliermondii

66% to CYP52A14   Candida tropicalis

PGUG_01238.1

MFDVDTVHNFFTSWYGILLAVLIGYHVFDYIRIQIVMKKLGCVSPPVESDGFFGFKLLYTSLKHKKEGTLVNFIKERFET

VGKDTFSFRIAGTPVISTKNPENIKALLATQFSDFALGTRHAQFKPLLGDGIFTLDGSGWKHSRAMLRPQFAREQVAHVK

SLEPHIQMLAKHVRRAKGGAFDVQSLFFRLTVDSATEFLFGESVESLQDESIGMAKDAVDFDGKAGFAEAFNTAQVYLSI

RSLAQKAYFLVNNKEFRSSNEKVHKFADYYVQKALNSSPEELEKHSQDGYIFLYELVKQTRDPHVLRDQLLNILLAGRDT

TAGLLSFTFYELARNPQVWSKLKEEIYEKFGKGDDARLEDITFESLKKCEYLKALLNEVLRLYPSVPQNFRVAQKDTSLP

RGGGPNRDQPIFIAKGQTVTYTVYAMHRDEQFYGKDSEVFRPERWFEPETRKLGWAFLPFNGGPRICLGQQFALTEASYV

IARLAQLFPNLASHDDEYPPRKASHLTMCHQSEVKISLA

 

>CYP52A40 Candida guilliermondii

60% to CYP52A25   Candida dublinensis

PGUG_05855.1

MSELLDSIQPYLTKWYVVISALLVSFFIAHKISVARFKATHNCAASPEYYKVNWFSLPLLYRLIQVKREGRLLDFAQKIY

DDVKALTFVIKIVGVPVIITRDPENMKAVLATQFNDFALGTRHAHFKPLLGDGIFTLDGNGWKQSRSMLRPQFSREQVAH

VQALEPHLQRLAKHIRLADGETINIQDLFFKLTVDTATEFLFGQSVYSLKDAAINDPPTEDFDGRSSFANSFNTAQTYLG

TRAYLQMFYFIVNNSDFRKCCNQVHDFTRFYVQKGLDMTPEELEKKSENGYVFLYELVKQTRDPKVLQDQLLNILLAGRD

TTAGLLSFTFFELARHPRVFNKLKEEIYEAFGKGDDARVSEITFESLKKCEYLKWVMNEMLRLYPSVPVNFRVATKRTTL

PRGGGPDGNSPIYVGKGTTVAYSVYSTHRMEEYYGKDADEFKPERWAESRKLGWAYVPFNGGPRICLGQQFALTEASYIV

TRLLQMFDKLELHDDRPYPPAKSVHLTMCHQDGVYVSLS

 

>CYP52A41 Candida guilliermondii

52% to CYP52A12   Candida tropicalis

PGUG_04005.1

MLSATYVILTLVAFFTVRQVIITIKRRKFAREHGCQNFTKTVGMVSVIDNIKKVYKARREGRLTEQLQESYDLYGVDTFQ

ARAIGTSAVFTRHPENIKAMIATQFDDFDIGKRQQVFRPLLGFGIFAAEGQRWKHSRAMLRPQFAREQVAHVQSLEVHLQ

NFVKLIKEQNGSFFDIQHLFHRLTMDASTEFLFGESVGSLKSPNNEFEAAFNTSQHYLTMRATLRGAYFLVNPKEFRDAN

EVIFKTVRYYVNKALNTSPQELAKQTEEGYTFLYQLVNQTRDPQVLQDEMLSIMLAGRNTTASLLSFLFLELSRNKHIWK

KLREEVHEHFGNGENARLEDITFESMKRCNYLKWVINETLRMYPSVPTNFRHAAKDTTLPRGGGPTGDSPVFIKKNTDVY

YTIYSTHRMKEYYGKDAEEFRPERWADLKNIGWAYMPFSSGPRICLGQQFALTEASYITIRLAQIFTELDTSDHAYPPLK

IANATMRPMNGVNVRFQ

 

>CYP52A42 Candida guilliermondii

62% to CYP52A23   Candida albicans

PGUG_05670.1

MNGFEEVHNFLTSWYGIVLAAIVAYNVFDYVRVKVVMKKLNCVGPTVESDGFFGFRVIFTLLKHKREGTLVDFRKDMELD

TLRFRVAGTPMVITRNPENIKAILATQFNDFVLGGRHDHLGPLLGDGIFTLDGSGWKHSRAMLRPQFAREQVAHVKSLEP

HIQLLAKHIRKFQGEPFDIQKLFFRLTMDSATEFLFGESVDSLHDETIGFSKSAIDFDGKNEFAEAFNTSQIYLSIRALA

QQVYFLINNKEFRDANAKVHKFADYYVQKALSFSTEELDKYSQDGYIFLYELAKQTRDPKVLRDQLLNILLAGRDTTAGL

LSFTFFELARNPDIWSKLKEEIYNRFGSGDDSNLEDITFESLKKCEYLKALLNEALRMYPSVPQNFRVAQKDTTLPTGGG

PNRDLPVFIRKGQTVAYMVYALQRDQRYYGKDSEVFRPERWFEPETRKLGWAFLPFNGGPRICLGQQFALTEASYVIARL

AQLFPNLASFDDEYPPRKASHLTMCHQNGVVISMT

 

>CYP52A43 Debaryomyces hansenii

54% to CYP52A3   Candida maltosa

CAG85755.1

MNWYIIIFIAYFVRRLIILCKNYWLARQWGCEPMQEFGGRFGIISLINVIKARREGFLVDYQKQTYIETDTDTIKSRLFH

KQLIHTKNAENVKAVVATQYDDFSIGKRHKFFKPLLGNGIFASEGERWQHSRTMLRPQFARERVAHVQALEPHLQVFAKH

VRKSEGGVFNIQILFHKLTIDAATEFLFGESVDSLRDASIGYESLPTDIDGKAGFDDAFNISQNYMMLRALAQDLYFLFD

SKEFREANRKIHKFTGHYVHKALETTQEELDAKSRDGYIFLYELVKQTRDPIILQDELLSIMLAGRNTTASLLSFLFFEL

ARNPEIWSKLKREVYEHFGNGDDVKLEKITFESMKKCTYLKWVINETLRMYPSVPQNFRVAKKDTTLPRGGGKDQQSPIF

VPKGQFVLYTTYSMHRLEAYYGKDADVYRPERWENLRNIGWAYMPFSSGPRVCLGQQFALTEASYITIRLAQMFPNLESH

DSKYPPPKLTNSTMRHLDGVFISLH

 

>CYP52A44 Debaryomyces hansenii

63% to CYP52A25   Candida dublinensis

CAG85832.1

MSTDKLKSYVEEISPYLTQWYVIALGGILVWYIGTSIKAYQFKQKYGCKEPPLVPGGFLSIKLLLDLLKTKSEGTMLEYA

EHFFSLVKSQTFKLKLATVPIIFTQDPENIKAVLATQFNDFALGTRHAHFKPLLGDGIFTLDGDGWKNSRLLLRPQFARE

QVAHVQTLEPHLQTLAEHISNKKGETFDIQELFFRLTVDAATEFLFGESVYSLRDGTVKDVAPLDFDGKSSFADSFNLSQ

SYLASRAYSQMFYFLINNKEFRNSNTKVHKFCKHYVEQALATSQDELDKKSKDGYIFLYELVKQTRNPKILQDQLLNILL

AGRDTTAGLLSFTFFELARNPDVFEKLKNEIYTHFGDGANPRIETITFESLKRCEYLKFVLNEVLRLYPSVPINFRVSTK

DTTIPRGGGPDKQDPVYVAKGTTVAYSVYTTHRLEQYYGKDSREFRPERWAENKKVGWAYVPFNGGPRICLGQQFALTEA

SYVVVRLIQMFPNLVSRDDRPYPPRKNVQLTMCHQDGVFISLNK

 

>CYP52A45 Debaryomyces hansenii

62% to CYP52A14   Candida tropicalis

CAG88380.1

MSSDTFHEFGVLFDRIQPYLTSLWAICIGAYILFSISTRINDRILMKKLGAKPMQMNAPNSFWGIPLMFRLLKAKREGTM

VDVTKERYKELGVDTFNVNIAGTHAVVTRDPENIKAILATQFNDFALGKRHTHFKPLLGDGIFTLDGAGWKHSRTMLRPQ

FAREKVAHVKALEPHLQTLAKHIINSKGERFDIQPLFFRLTIDSATEFLFGESVENLHDESVGLTRDPVDFDGKSGFADA

FNTSQTWLASRAVTQNLYFLVDGRSFRSSNAKVHKFADYYVRKALEASSEDLEKASRDGYIFLYELVKQTRDPVILRDQL

LNILLAGRDTTAGLLSFTFFELARNQDVYDKLKEEIYEKFGEGEDSRVDEITFESLKKCEFLKCVLNEILRMYPSVPQNF

RFAIRNTTLPKGGGPDGKSPIFVSKGKNLFYSMYSAHRNPKYYGKDAEEFRPSRWLEPEIRKVGWAFLPFNGGPRICLGQ

QFALTGASYIVVRLIQMFPNLSSFCEEYPPRKNTQLTMSHQNGVYIGMF

 

>CYP52A46 Debaryomyces hansenii

63% to CYP52A14   Candida tropicalis

CAG88381.1

MSSSAHELFRSIEPYLTNWWIICIGTYVLFSILTWINERILMKKLGAKPIQFIAPDPFWGIPLMFRLLRKKKDGTMVDMT

KERFEEFGIETFSFRVGGTPVITTKDPENIKAMLATQFNDFALGKRHTYFKPLLGDGIFTLDGAGWKHSRAMLRPQFSRE

QVAHVRALEPHLQTLAKHIINSKGERFDIQPLFFRLTIDSATEFLFGESVENLHDESVGLTRDPVDFDGKSGFADAFNTS

QAWLASRAVSKNLSLFVDGKEFRNSNAKVHKFADYYVRKALEASPEDLEKASRDGYIFLYELVKQTRDPVILRDQLLNIL

LAGRDTTAGLLSFTFFELARNQDVYDKLKEEIYEKFGEGEDSRVNEITFESLKKCEFLKCVLNEILRLYPSVPLNTRCAT

KNTTLPRGGGPDGQSSIFIPKGKSVLYSVYATHRNPKYYGKGAEEFRPSRWLEPEIRKVGWAFLPFNGGPRICLGQQFAL

TEASYIIVRLIQMFPNLNSFCEKYPPRKSSHLTMCHQDGVSIGMF

 

>CYP52A47 Debaryomyces hansenii

65% to CYP52A14   Candida tropicalis

CAG88382.1

MSSNFHEVVESIEPYVTNWWFICIGAYVLFSILTWINKRILMKRLSAKPMQVTARDAFVGIPLVFNLLKAKREGTMVDMT

KERYEEFGVDTFDFRIAGTHAIATRDPENIKAVLATQFNDFVLGKRHAHFKPLLGDGIFTLDGAGWKHSRAMLRPQFARE

QVAHVKALEPHLQTLAKHIINSKGERFDIQPLFFRLTIDSATEFLFGESVESLHDESVGLTRDPVDFDGKSGFADAFNNS

QAWLASRAVSQNFYFLLNGKDFKDSNANVHKFADYYVNKALETSPEDLEKASRDGYIFLYELVKQTRDPVILRDQLLNIL

LAGRDTTAGLLSFTFFELARNQDVYDKLKEEIYKKFGEGEDSRVDEITFESLKKCEFLKCVLNEILRMYPSVPQNFRFSI

KNTTLPRGGGPDGKSPILIPKGQNLLYSVYATHRNPKFYGKDADEFRPSRWLEPEIRKVGWAFLPFNGGPRICLGQQFAL

TEASYIIVRLIQMFPNLGSFCEEYPPRKSSHLTMCHQDGVFIGMS

 

>CYP52A48 Lodderomyces elongisporus

73% to CYP52A38   Candida parapsilosis

LELG_04957

MSSTFVQQVASLGQEIVPYFTKWYTVLILLVVTYIAAFNIKDAYMTWKLGCKNPLYYKPAGYTGVYSLYEIIQRKNKGEL

AEFAQEAFDEYTTNTVYVKIGGLMKIMFTVDPENIKAVLATQFNDFSLGIRHAHFAPLLGDGIFTLDGDGWKDSRAMLRP

QFAREQIAHVKALEPHVLMLAKQIANTKYETFDLQELFFRFTVDTSTEFLFGESVHTLYDDKIGVAPPNDIPGREAFADA

FNFSQHYLATRTYSQVFHWLFNSKEFRENNAKVHHLAQYFVKKALNFTPEELEEKSQDGYTFLYELVKQTRNPKTLQDQL

LNIMVAGRDTTAGLLSFCMFELARNPEIWQRLRTEVLDNFGDGSTKEQIDSITFENLKKCEFLKSVLNETLRLYPSVPIN

FRTATRDTTLPHGGGSDGSKPIFVPKGSTVAYAIYKTHRLEEYYGKDSQEFKPDRWTDMKRLGWAYLPFNGGPRICLGQQ

FALTEASYVLARLAQLFPTLQSRDETYPPKKCIHLTMNHAEGVFVGMK

 

>CYP52A49 Lodderomyces elongisporus

72% to CYP52A37   Candida parapsilosis

LELG_03506

MAISLETLPLAIVQHLFTWYGAITLLITTYFTGLYIRREIFRRQRGCMEPFVYPEGGPLGIKLGYDLQDKKKKGEIVDFM

CKLYHKFDRVKTFSAYLFGVRVVVGVEPENLKAVLATQFNDFGLGTRHAHFKPLLGNGVFTLDGEGWKESRQMLRPQFAR

DQIAHVQALEPHIQILAKHIRASKGKSFDIQELFFRFTVDTSTEFLFGESVHSLYDASIGLECDPEVAGFAEAFNETQKD

LAVRTYLQVLYFLYNPPSFWKNTKVVHKFAKRFVNKALNLSKDELEEHCKHHYTFLYELAKHTRDPKVLQDQLLNIMVAG

RDTTAGLLSFTFFELARNPEVWQKLKDEIYQHFGSGEDADVSKITFETLKQCTYLKWVLNEILRLYPSVPINFRTALKDT

TLPTGGGPDGTAPVFIGKGTTFAYSVYLLHRIEEYYGKDANEFRPERWADLKQLGWAYLPFNGGPRICLGQQFALTEASY

TICRLAQMFPNLASNYDQPDPCKKLIHLTMSLMDGAWIEMS

 

>CYP52A50 Lodderomyces elongisporus

71% to CYP52A37   Candida parapsilosis

LELG_03505

MMETIISNTGHALQPPYSSHTIWFGILFIIFGTYFICIFIKREIFRRAHHCKEPIIFPEGGPLGLRLGYLLQRLKTTGEL

VDFPMVLYEKFGRRTTFSAYLFGVRVVASVNPDNLKAVLATQFNDFGLGTRHAHFKPLLGNGVFTLDGEGWKESRQMLRP

QFAREQVAHVQTIEPHLQTLAKHIKTHNGGTFDIQELFYKLTVDTSTEFLFGESVHSLYDASIGLECDPEVAGFAEAFNE

TQKALAVRTYLQVLYFLYNPPSFKRNTKIVHKFAKRFVNRALCLTPKELEEHCKHNYTFLYQLAKHTRDPQVLQDQLLNI

MVAGRDTTAGLLSFTIFELARHQNVWEKLKKEIYQHFGSGEDALVNKITFETLKQCTYLKWVLNEILRLYPSVPINFRVA

TKDTTLPTGGGLDEKSPVFIGKGTTFAYSPYLLHRMPMHYGEDATVFRPERWADLKQLGWAYLPFNGGPRICLGQQFALT

EASYTICRLAQMFPDLKSMDDSPDPCKKLIHLTMSHMDGVWIQMSE

 

>CYP52A51 Lodderomyces elongisporus

75% to CYP52A35   Candida parapsilosis

LELG_03309

MLLDEFITYLNHWYVIIPLAFTTYHVFHYIYLNQLAKKFGAKPITNVLSDGWFGFKNGTQAIALKNKGQAVEWAQEKYYE

TKHPEIPTFKERIFGLYLVFTKDPENIKAMLATQFSDFSLGHRLAYFDPLLGKGIFTLDHEGWKDSRAMLRPQFAREQIA

HVKSLEPHIQYLFKHIDKNQNIQSKNKIENADYETSISASYFDIQELFFRFTVDSATEFLFGGSVSSLQDETIGCDTRDI

DFAGRRQFADCFNKAQNYLATRNLLQKLYWLVNPKEFRECNKVVHEFTNYYVNKVLSYSPEELEKISDGYVFLYELAKQT

RDPNVLRDQSLNILLAGRDTTAGLLSFVIFEMAKNPQMWTKLRNEILERFGTTNLEDITFENLKKCEYLKAVLNETLRLY

PSVPRNARVATRNTTLPRGGGPDGLSPIFIAKGSTVGYNISACQRDETHYGKDVDEFRPERWFEESTRKLGWAYLPFNGG

PRICLGQQFALTEASYVITRIAQTYSKLELKPGYGYPPKRMTHLTMCLFDGCWVKMERAQV

 

>CYP52A52 Lodderomyces elongisporus

70% to CYP52A5   Candida maltosa

LELG_00044

MSDLLPPIIQEYATKWYILLPAIVLVYLTFSFLFEIYLKRKLGAKGFTNTERDGYFGFYTPFLLLRLKKEGNLVDFGTER

YQFLQNPDVPTFKLRMFGIPIVTTKDPENIKAILATQFSDFLLGLRHAQFMPLLGDGIFTLDGQGWKDSRQMLRPQFARE

QISHVKLLEPHMQVFFKHVRKHKGMTFDIQELFFKLTVDSATEFLFGNSVECLKDSSIGMRPNSADFEGKEQFADAFNYS

QTYLSTRVVFQKFYWLLNGKKFKECNKIVHSFAQYYVNKALQLTPDDLQKQENYVFLYELAKNTRDPQVLQDQLLNIMVA

GRDTTAGLLSFVFFELARNQDVLAKLKEEIYGKFGFGADARVDEITFESLKGCEYLKAVLNECLRLYPSVPNNFRTALRD

TTLPRGGGKDGMSPILIRKGQNVIYSVYALHREEKFYGKDAAEFRPERWFEPETRKLGWAFVPFNGGPRICLGQQFALTE

ASYVTTRLIQEFEHLTMDPDTEYPFKKMSHLTMSVYGGVNVQMY

 

>CYP52A53 Pichia stipitis

65% to CYP52A40   Candida guilliermondii

JGI model e_gww1.3.1.449.1

MSAELAFEYLTKWYSILIGAALIYGIARYIKIQLFIRKHGCEETPFLPDAKWFAIPIMSRVLKAKNEGRLVDLAQSFMTS

DRRTTHVYLGPARIIFTIDPENMKTMLATKFNDYALGFRHTHLAPLLGDGIFTLDGEGWKHSRSMLRPQFAREQVAHVRA

LEPHVQVLMKHIRLNKGKTFDLQELFFKLTLDTSTEFLFGESIYSLYDSSIGLTPPTDIQGRSEFADAFNTSQKYLGTRA

WLQFMYWVVQNREFYQCNAKVHKVAKYYVKRALNFTPDELEKASANGYTFLYELVKQTRDPVVLQDQLLNILVAGRDTTA

GLLSFTFFELARNPDVFEKLKNEIYEHFGKGDESRVEDITFESLKQCEYLKFVLNEALRMYPSVPLNFRVSTKDTVLPNG

GGKDGTKPVFVGKGTTVAYTVYCTHRDEKYYGKDANVFRPERWATLNKLGWAYLPFNGGPRICLGQQFALTEASYVIVRL

LQNFPNLVSKDDRPYPPAKSMHLTMCHQDGIFVELS

 

>CYP52A54 Pichia stipitis

63% to CYP52A44   Debaryomyces hansenii

JGI model e_gww1.3.1.459.1

MYEKTIIALLYLSKWYVLLGSAVAVLALYRYITVQLIIRKHGCKDPIKFTQGGFLCIPIILELLRRMKTGEMIDEGFRLF

NEYPDTTQYVNLFGVRVLLTGEPEVYKAVLATQFNNFALGFRHSHFAPLLGDGIFTLDGEGWKNSRAMLRPQFARQQVSH

VQMLEPHIQTLAKHIKARKGTTFDLQELFFRLTMDSATEFLFGESVRSLHDEVIGMQRPDIEGISNFSEAFNTSQRYLAV

RAYSQVLYWLTNPKEFRDCNAKVQKVAQYFVNKALSFSDSELEEKSKKGYIFLYELTKQTRDPKVLQDQLLNILIAGRDT

TAGLLSFTFYELARNPAIFEKLKAAIYADFGRGDVSEISFESLKKCEYLKFVLNEALRLYPSVPVNFRVATKDTVLPTGG

GPDGQSPMFVRKYTTVAYGVYFTHRMKQFYGEDAEVFKPERWAENRKLGWAYLPFNGGPRICLGQQFALTEASYVVVRLI

QMFPNIVSKDDGPYPPRKSVQLTMCLQDGVKIQMS

 

>CYP52A55 Pichia stipitis

63% to CYP52A14   Candida tropicalis

JGI model  fgenesh1_pm.C_chr_3.1000237

MANFIEFVTTNWYIIIPALLVLHKVFDLLYVQYLYRKLGAKPCTNQTDDHAFGIRAGFEMLKKKNEGTVVDFGAERFESR

IDPKIPTFSMRLFLIPIVLTRDPENIKALLATQFNEFVLGSRFEQLAPLLGKGIFTLDGEGWKHSRAMLRPQFAKEQVAH

VQSLEPHIQALAKHVRNAKGKLFDIQELFHRLTVDSATEFLFGQSVESLRDESVGMADEATDFAGKSTFAASFTIAQNWL

ANRAVAQKFYFLINPKEMRDSIKDVHRFVDYYVQVALDTPQDELDKKSKDGYIFLYELVKQTRDPYVLRSQLLNVLLAGR

DTTAGLLSFAFFELARRPDIWSKLKDEIYENFGLGENSKVDEITFESLKRCEYLKAFLNETLRLYPSVPVNFRVATKDTT

LPRGGGKDGSEPILVRKGQSVFYSVYATHRSEAYYGKDRHVFRPERWFEPSARKLGWAYLPFNGGPRICLGQQFALTEAS

YVVARLIQLFPNIENYEPEEVYPPFKNSQLTMNLLNGLHIGLY

 

>CYP52A56 Pichia stipitis

59% to CYP52A38   Candida parapsilosis

JGI model  fgenesh1_pm.C_chr_8.1000042

MFMTTDPENFKAMLATQFNDFSIGRRYQILSPVIGDSIFTLDGEGWKHSRAMLRPQFVREQVGHVQALEPHLQLLAKHIR

SYKGETVDLQQLFTKFTLDTATEFLFGQSVHTLYDERIGMKTPDDVPYAKDFTDGLFITQKYTSERGYAQQFYWLIDGKE

FRTAIANVHKFARFYVDRALNFSQAELEKKSQESYTFLYELVQQTRDPKVLQDQLLAIMLAGRDTTSSLLSFIFYELSRN

PGIWEKLKKEVYENFGSGTEKDIAKITFESLKKCNYVKWVINETLRMYPTVPVNLRVSNKDTLLPKGGGEDGKSPIFIPR

GTTVGFRVYSTQRNKEYYGEDPDVFRPERWADIGKLGWAYLPFLGGPRTCIGQQFALTEAGYILVRIAQLFPNLKSKNSV

HYPPKKTLNVIFNLFEGCLVEMGE

 

>CYP52A57 Pichia stipitis

62% to CYP52A39   Candida guilliermondii

JGI model  e_gww1.3.1.1392.1

MTVETIVQYLLCWQVYVLAVLVYHIFNWIHEQILYKKFGASPCINNERGGFLGIRLLRTLLKAKLDGTLSDVVKNRYYEM

EHPEIETFTLRVFSQTVIATRDPANLKAILATQFNDFSLGIRHAQLYPLLGDGIFTLDGEGWKHSRAMLRPQFAKEQIAH

VQSLEPHIQVLAKHIRKSEGKSFEMQELFFRLTLDCATEFLFGESVESLRDASIGMARADVEVEGKDRFAEAFNLAQTQI

ATRSMMNKMYFLYNTEELRNSCDVVHRFTDYYVNLALRTSTAELDKKSKSGYTFLYELVKQTRNPQILRDQLLNILLAGR

DTTAGLLSFAFFELARQPHIWAKLKDEIYSAFGSGENSRIDEITFESLKRCEYLKAVLNETLRMYPSVPNNGRIAVRNTT

LPRGGGPTGTEPMLVRKGQKVVYSVYTTHRSKTHYGEDAEVFRPERWFEPSSRKLGWAYLPFNGGPRICLGQQFALTEAS

YVVTRLIQMFPNISSDPTIEYPPRKASQLTMCLQDGLLISLY

 

>CYP52B1 C.tropicalis alk6 Z13013

MSLTETTATFIYNYWYIIFHLYFYTTSKIIKYHHTTYLMIKFKA

SPPLNYINKGFFGIQATFTELKHLICHTSIDYAIDQFNNVPFPHVHTFVTKVLGNELI

MTKDPENIKVLLRFPVFDKFDYGTRSSAVQPSLGMGIFTLEGENWKATRSVLRNMFDR

KSIDKVHDFEPHFKTLQKRIDGKVGYFDIQQEFLKLGLELSIEFIFGQVVSEDVPHYD

DFTQAWDRCQDYMMLRLLLGDFYWMANDWRYKQSNQIVQAFCDYLVQKSLENTCNDKF

VFVHQLAKHTTNKTFIRDQALSLIMASRDTTAELMAFTILELSRKSHHLGKLREEIDA

NFGLESPDLLTFDSLRKFKYVQAILNETLRMYPGVPRNMKTAKCTTTLPKGGGPDGQD

PILVKKGQSVGFISIATHLDPVLNFGSDAHVFRPDRWFDSSMKNLGCKYLPFNAGPRT

CLGQQYTLIEASYLLVRLAQTYETVESHPDSVYPPRKKALINMCAADGVDVKFHRL

 

>CYP52C1 C.tropicalis alk7 Z13014

 

MYQLFCFLAGIIVVYKAAQYYKRRTLVTKFHCKPARISPNKSWL

EYLGIASVVHADEMIRKGGLYSEIDGRFKSLDVSTFKSITLGKTTYVTKDIENIRHIL

SATEMNSWNLGARPIALRPFIGDGIFASEGQSWKHSRIMLRPVFAKEHVKQITSMEPY

VQLLIKIIKNHEGEPLEFQTLAHLFTIDYSTDFLLGESCDSLKDFLGEESNSTLDTSL

RLAFASQFNKTQQQMTIRFMLGKLAFLMYPKSFQYSIQMQKDFVDVYIDRVVGMSEEE

LNNHPKSYVLLYQLARQTKNRDILQDELMSILLAGRDTTASLLTFLFFELSHHPEVFN

KLKEEIERHFPDVESVTFGTIQRCDYLQWCINETMRLHPSVPFNFRTAANDTVIPRGG

GKSCTDPILVHKGEQVLFSFYSVNREEKYFGTNTDKFAPERWSESLRRTEFIPFSAGP

RACLGQQLPRVEASYVTIRLLQTFHGLHNASKQYPPNRVVAATMRLTDGCNVCFI

 

>CYP52C2 Candida maltosa D12718

MIDALYILIVALVIYKTAQFVHRKSLEKKHHCQPVKQIPLVSIL

SGLGFDMFFKDTAEMTKNGGLHKKLQQMLESLQTTTFRSRMLTGSQIVTMEPENERTM

CSSAHMKDWTIGYRPFALKPLLGDGIFSSEGESWKHSRIMLRPIFAKEHIKQITAMEP

YMLLLIEIIKSSSANEGPVDLQPLFHAFTIDYASDFLFGESCDVLKENLGGKSTSGMD

AQVKRDFASVFNDVQNYLTKRMMLGPLAFLVSSKDFHDGIKKQHEFVSYFVQKAISMS

DEELNDESKNYVFLYQLAKQTKDAKVLQDELLSILLAGRNTTASLLSFLFFELSHHEN

VWTTLKEVVDQSFPDVESITFETIQNCDYLRWCLFESLRVNPSVPFNSRTANKDTILP

RGGGEDCSHPILVKKGDQVLFPLYASNRQEKYFGRKPEEFIPERWRDLPKTGGPAFMP

FSTGPRMCLGQQFALIEASYVTIRLVQTFSKLKSHSLEYAPKRLVAATIRLIDGCFVS

FE

 

>CYP52C3 Candida albicans SC5314

60% to CYP52C2 orf19_6574

MLILLPIAVIAASIYYIAEYWKRESIKRKYDCQPVKQAPLVTWYDIFGIKALVDNSNLTKSGYFYQDIQRKLDNLDTTTM

KTTALGKNQIITIEPENFRTMCSSADLNNWTIGTRPIALKPLLGNGIFSSEGESWKHSRIMLRPIFAKEHIKQITAMESY

IQSLIKVIKLQQQGEGEFDLQHLFHCFTIDYATDFLFGESCDCLKSILGETSISTMSEEEKSKFAPNFDVMQYHMTKRLV

FGYFSFLVNPPEFKNAVKHLHEFVFHFVDRAINFTDEELNDPSKNYVFLYQLAKQTKDRKVILDELLSVLLAGRNTTASL

LSFMFFELAQNKPVWNKLKKEITEHFPDVESITFETIHNCEYLRWCIHESLRINPPVPINTRTANRDTVLPKGGGKGNNY

PIFVRKGEQVIFPLFSSNRQERFFGPEPEKYIPERWANLPRNGGVAFGPFGTGPRLCLGQQLALVEASYVTIRLLQTFSQ

LDSNHTECRRSVGATMRLMDGCQVTLK

 

>CYP52C4 Candida dublinensis

94% to CYP52C3   Candida albicans (ortholog)

cdub_588-g100.1

MLILLPVAVLAAIIYYIAEYWRKESIKRKYDCQPVKQAPLVTWYDIFGIKALIDNSNLTKSGYFYQDIQRKLDSLDTTTL

KTTALGKNQIITIEPENFRTMCSSADLNNWTIGTRPIALKPLLGNGIFSSEGESWKHSRIMLRPIFAKEHIKQITAMESY

IQLLIKVIKIQQQQQEEFDLQHLFHCFTIDYATDFLFGESCDCLKLILGETSISTMSEKEKSKFAPNFDIMQYHMTKRLV

FGYFSFLINPPEFQNAVKHLHEFVFHFVDRAINFTDEELNDPSKNYVFLYQLAKQTKDRKVILDELLSVLLAGRNTTASL

LSFMFFELAQNKPVWNKLKQEINQHFPDVESITFDTINNCEYLRWCIHESLRINPPVPINTRTANKDTVLPKGGGKGNNY

PIFVRKGEQVIFPLFSSNRQERFFGPEPEKYIPERWANLPRNGGIAFGPFGTGPRLCLGQQLALVEASYVTIRLLQTFSE

LDSNHTECRRLVGATMRLMDGCQVTLK

 

>CYP52C5 Candida parapsilosis

48% to CYP52C3  Candida albican

There is one 52C seq per Candida species except this species has two.  They all seem to be orthologs even though the percent identity is not high

CPAG_01250

MNYILYSALAAIYIIYRVIDHVQVTRKAQKYGCKPVAQVPKRTLLSWLGLQLILNLKRNHERGRAHEALDEAFDRLKTTT

FATYVGIEPNVFTVEPENFRHMVSSSHTSEFNLGVRLDVFSILLGDGIFSSEGTSWKHSRIMLRPFFARENIKQIQSMEP

FTQSIIKAIKQAPGMTIDMQEIFQDFTMDYTTHFLLGESCGCLKTYLGEPTSDSISTEVKSSFAETFDKGAEYMLQKLVM

GRYHFLYRPKQLYVDVKNQHAFVDYYVQKALRMNQQDLKDSSNDGTLFLYDLAQQTKDPKVLRDEILSIIVAGRSTTSAL

MTFLFLELGRHQDVFERLKGIVRAHFPDIESITFESIQQCEYLRWCLNETLRHDPPVPFNSRTVTQDTILPKGGGQDNES

PIFVRKGTKIVYPLWTAHRMEKYFGKDPYTFNPDRWSSLPANGGFAFMPFGAGPRNCLGQQLALLETSYVTIRLLQTFNS

LKADSGEVRKKSTATMVLMDGCKLTFG

 

>CYP52C6 Candida parapsilosis

50% to CYP52C2   Candida maltosa

CPAG_01665, 53% to to CYP52C5 this species

MTYIPYLIVIASYIIYKLLHRVQLHQRAIKLGCKPVKHIPPRNLLDRLGIYEIVHRKKLMHSGTTFEMLEEAFDRAQVKT

FEGTALFSSFIMTIEPENLRHMMSSAHFNEWNIGYRPQAFGILLGDGIFSSEGTQWKHSRVMLRPSFTKENIKQITKMEP

FAARVIDLIKQKSGQAIDMQDVFQFFTMDFTTDLLLGESSDSLKDALGQHSSTGIDPELKRQFSIAFDESSNYLMTRMIL

GPLMFLVNPKTLQDAIKIQHKFVDYYIEKALAMTSHELNEKSDDGTIFLYQLAHETKDPINLRNQILSIILAGRNTTSGL

MTFLFAQLSKNPEIYCKLRDIIRQDFPNVESITFDSIQNCDYLRWCINETLRINPSVPFESKTASVDTTLPRGGGVDEKA

PIFIAKGTRIVYPLWVANRNEEHFGENTGEFIPERWEQLPRSGGIAFMPFSVGPRACLGQSLALTEAAYITIRLLQTFDS

CESHLGPEPLRKTSSATMRLMDGCELSFK

 

>CYP52C7 Lodderomyces elongisporus

54% to CYP52C6   Candida parapsilosis

48% to CYP52C3   Candida albicans

LELG_05768

MMIHLPLFIVLTLLLVLYNIIRFYRKQVIKRKYKCQKIPNAQTSTFLSYLGLEFIVNYNKIQEEGRIHQNMYKQFKDLKT

STLAQTMLFLKVVFTTDPENYRYMSSSANFNNWTIGDRPDAFDPLLGDGIFSSSGESWKHSRIMLRPFFSKDHIKQIEYM

EPYVKDVVRLINIYQRDGVVVDMQDIFQYFTIDYATKFLLGESCDTLKDALDEPTSVTIDPELKSRFAKAFDISLKYLML

RVSLGKPLMWLVNPKELREANKIQHDFVRYYINKALAMNEEELNKHSDNGNCFLYEIAKQTKDPKILQDEVMSIILAGRN

TTSSLLSFLFFELSRDANKEILKKLVDAVRSNFDSIESITYEKIHNCDYLRWCLYETLRFHPSVPLASKTAAVDTILPKG

GGLDNESPVFVPKGRRVVYPLYTANRNSKFFGSDTEVYRPERFADLPKSGGPAFMPFSTGPRLCLGQQLALTEASYITIR

LLQTFDIIEKVGDEPYPPRTSSSATMRLMDGAKVRMRTSSSTTP

 

>CYP52D1 Candida maltosa D12716

MAIFTPELWLICFAVTVYIFDYIYTKYLMYKLGAKPITHVIDDG

FFGFRLPFLITLANNQGRLIEFSVKRFLSSPHQTFMNRAFGIPIILTRDPVNIKAMLA

VQFDEFSLGLRYNQFEPLLGNGIFTSDGEPWKHSRIMLRPQFIKSQVSHVNRLEPHFN

LLQKNITAQTDNYFDIQTLFFRFTLDTATEFLFGQSVHSLNDGENSLQFLEAFTKSQA

ILATRANLHELYFLADGIKFRQYNKMVQDFSQRCVDKVLNMSNSEIDKLDRYFFLYEM

VKITRNPQVLRDQCLNILLAGRDTTASLLSFAFFELALNEPIWIKLRTEVLHVFQTSL

ELITFDLLKTKCPYLQAILHETLRLYPSVPRNARFSKKNTTLPHGGGVDGMSPILIKK

GQPVAYFICATHVDEKFYTKDALIFRPERWCEEPLIKKNLAWSYLPFNGGPRICLGQQ

FALTEASYVLTRLAQCYTKISLQPNSFEYPPKKQVHLTMSLLDGVHVKISNLSIS

 

>CYP52D2 Candida tropicalis

AY230503

MAISSLLSWDVICVVFICVCVYFGYEYCYTKYLMHKHGAREIEN

VINDGFFGFRLPLLLMRASNEGRLIEFSVKRFESAPHPQNKTLVNRALSVPVILTKDP

VNIKAMLSTQFDDFSLGLRLHQFAPLLGKGIFTLDGPEWKQSRSMLRPQFAKDRVSHI

SDLEPHFVLLRKHIDGHNGDYFDIQELYFRFSMDVATGFLFGESVGSLKDEDARFSEA

FNESQKYLATRATLHELYFLCDGFRFRQYNKVVRKFCSQCVHKALDVAPEDTSEYVFL

RELVKHTRDPVVLQDQALNVLLAGRDTTASLLSFATFELARNDHMWRKLREEVISTMG

PSSDEITVAGLKSCRYLKAILNETLRLYPSVPRNARFATRNTTLPRGGGPDGSFPILI

RKGQPVGYFICATHLNEKVYGNDSHVFRPERWAALEGKSLGWSYLPFNGGPRSCLGQQ

FAILEASYVLARLTQCYTTIQLRTTEYPPKKLVHLTMSLLNGVYIRTRT

 

>CYP52E1 Candida apicola X76225

MIIGLSDAFALGGIALSFLVAYQFIYFYFIYSPRAKKLGCAPPV

IVFSFPLGLPALYKFATAMLHDNLLEYISIRIADMKVRTGFQTLAGQRWLVTLEPENI

KTVLATSFKDYSLGFRYDIMYGLLGNGIFTLSGDGWKHSRALLRPQFSREQVSHLESM

RTHINLMINNHFKGGQVVDAQALYHNLTIDTATEFLFGESTNTLDPDLAQQGLPGPKG

LVTGEQFAEAFTSALEILSVRVIVGAAWFLIWTPKFWRSCKVCHNFIDYFVYKALATP

MEKDQEADRYVFIRELTKETSDPRVIRDQALNILLAGRDTTAGLLSFITYYLGAYPEV

YAELREAVLSEFGSTDVETPTFEQLKQCKVLQNVIREVLRLHPNVPLNFRQAIVDTKL

PTGGGPNGDQPVFVPKGQNVFYSTYSMQRRTDIWGPDATTFRPDRWNEPREALASGWD

YIPFNGGPRICLGQQFALTEASYTIVRICQEFSRIEVLHPDVITSKNSMKQRMRLTQT

ASGGVITRFIR

 

>CYP52E2 Candida apicola X87640

MNINFSDALMLGGISLSFLLASQAIYFYFIYSPRAKKLGCAPPP

IFFSFPLGIPDLIRLVNAWFHDDLLEWFTHRFEEFGRRTAFQSVAGQLWIGTIEPENI

KTMLATSFKDYSLGFRYNAMYGLLGNGIFTLSGDGWKNSRALLRPQFSREQVSHLESM

RTHINMMINNHFKGGQVVDAQVLYHNLTIDTATEFLFGESTNTLDPALAQQGLPGPKG

LVTGEQFAEAFTSALELLSVRVMAGAAWFLVWTPKFWRSCKVCHNFIDYFVYKALATP

MEKGQDADRYVFIRELTKETSDPRVIRDQALNILLAGRDTTAALLSFTTYYLGAYPEV

YDELREAVIADFGSADAEPPTFEQLKQCKVLQNVIREVLRLHPNVPLNFREAIADTTF

PTGGGPNGDQPIFVPKGQKVFYATYVMQRNAGIWGPDSTSFRPDRWNEPREALASGWD

YIPFNGGPRICLGQQFALTEASYTLVRICQEFSRIEVLHPDVITARNVMKQRMRLPNS

SSGGVITRFIR

 

>CYP52E3 gene2 Candida bombicola 92% to 52E2, 82% to 52E1

EU552420 alternative name Starmerella bombicola

MNINFSDVLVLGGISVSFLLAYQAIYFYFIYSPRAKKLGCALPPVFFSFPLGIPEVXRLVNAWFNDDLLEYFTFKFEEFQRKTGFQSVAGQLWIGTIEPENIKTMLATSFKDYSLGFRYEAMYGLLGNGIFTLSGEGWKHSRALLRPQFSREQVSHLESMRTHINMLINNHFKGGKVVDAQVLFHNLTIDTATEFLFGESTNTLDPALAQHGFPGPKGLVTGEQFAEAFTSALELLSVRVMAGAAWFLVWTPKFWRSCKVCHNFIDYFVFKALATPMEKDQEADRYVFIRELTKETSDPRVIRDQALNILLAGRDTTAALLSFTTYYLGAYPEVYDELREAVIADFGKEDAEPPTFEQLKQCKVLQNVIREVLRLHPNVPLNFREAITDTKFPTGGGPNGDQPVFVPKGQKVFYATYVMQRNEGLWGPDSTTFRPDRWNESREAIASGWDYIPFNGGPRICLGQQFALTEASYTLVRICQEFSRIEVLHPDVITSRNVMKQRMRLTNSSSGGVIAKFIR

 

>CYP52F1 Yarrowia lipolytica gene for ALK1 AB010388

CAG80007.1

MSNALNLSLALGVFLLAYYGFSVIQYRIKTRKLEKKWKCGKPKD

ISRFPFSASFFIPFLVESKKNRLLEFVQWMFESQVYPGYTCKTTVFGVDMYHTVDPEN

LKAVLATQFKDFCLGERHAQFLPVLGNGIFTLDGQGWQHSRAMLRPQFARDQVSDVEM

IEEHIQYMTSRIPKDGSAFDAQELFFNLTLDTATEFLFGQSVGSQTVETNPTAVPTDM

PVHLRKSFQEDFNTAQEHLGQRARLQMFYWAWRPRELYSSGERVHAFVDHYVKKALEE

SEKHVDDGKYVFLRELAKETKDPIVLRDQALNILLAGRDTTASLLSWCLYLMARRPEV

YAKLREEVIENLGDGEDLSTITFESLKRCDYLRYVLNEVLRLYPSVPANMRYATRDTT

LPRGGGPDGMQPIVVRKGNLVSYHVFTTHRLKEFWGEDAEEFRPERWYEDGASQAKGW

EYLPFNGGPRICLGQQYALTEAGYALARIAQLYDTIENADDKPEPPVKFHALTMCHHT

GVLVKLYNSKTTKAQ

 

>CYP52F2 Yarrowia lipolytica gene for ALK2 AB010389

CAG77659.1

MIILYVLAVAVSFLIFKRVTYTMRSRELAKKWHCEEPHNLNEFP

LNLPLFFLIINASRRHELLDTLLGLFRSFAPTKTVKQVLLGSFTIIPTNDPENIKAVL

ATQFKDFCLGQRHGQLAPVLGDGIFTLDGQGWQHSRAMLRPQFARDQVSDVEMIERHV

QMMLLRIPNNKKFDIQELFFNLTLDTATEFLFGQTVGSQTVEMPNEDKSTVSDMPKDM

RKSFQEDFNVAQHHGGIRTRFQMFYWLWRPTELFSSSKRVHAFVDHYVEKALANSDEE

KSDDKYIFLRELAREVKDPRVLRDQALNILLAGRDTTAGVLSWIVYELARHPEVWKKL

RAEIHQDFGDGSDLSQITFEGLKRCEYLRFVINETLRLYPSVPLNVRYASRDTTLPRG

GGPDESKPILVRKGDTIVYNVFSMHRTEEFWGKDCDEFRPERWAEKGSRGWEYLPFNG

GPRICLGQQYALTETSYVITRICQLFTNIENADTAVEPPQKLHALTLCHLNGVFVKMT

RDEAAFAETEKLINA

 

>CYP52F3 Yarrowia lipolytica gene for ALK3 AB010390

CAG79910.1

MIIIETLIGAVVFVAVYVAFVKLDYYRRKAKFETSDMPVAYNGL

LGWKGLRHMLTVFNNDIGPVGWREVFATYGKTLKYYAFPSNTILTYDPDNIKAMLATQ

FKDFSLGLRKEALAPSLGYGIFTLDGSSWSHSRALLRPQFSREQISRLESVETHVQEM

MSCIDRNQGAYFDIQRLFFSLAMDTATDFLLGEAVGNLQEILHPEMPRTGTTFQVAFD

RAQRLGSLRIICQEAFWVVGSLFWRRDFNNTNQHIHDYVDRYVDKALLARKEKSEIYT

NPDKYIFLYELARETTNKITLRDQVLNILIAGRDTTASTLSWIFMELAKKPDIFHKLR

EAILNDFGTSCESISFESLKKCDYLRQVLNEGLRLHPVVPVNLRVAVRDTTLPRGGGP

QGDKPIFVAKGQKINYAIFWTHRDKEYWGEDAEEFRPERWETTSGGALGKGWEFLPFN

GGPRICLGQQFALTEMGYVITRLLQEYSDISIQPSDAAVKVRHSLTMCSAQGINISLT

RAKEE

 

>CYP52F4 Yarrowia lipolytica gene for ALK4 AB010391

CAG83106.1

MLTNLTIVLITLLVTYTVLTRTALRIQRARKAKQMGATLPPRVN

NGILGWYGLWLVIQNARSMKLPHTLGKRFANGPTWLTPVAGNEPINTIDPENVKAILA

TQFKDFCLGIRHRALSPSIGDGIFTLDGEGWTHSRALLRPQFSRQQISRVHSLERLMQ

ILFKLIRKENGEYFDLQNLFFMFTLDSATEFLYGASVDTLADLLGEPVEGDHGGVGEE

VRKAYQQSINNAQDISAIRTRLQGLYWIAGNIYQRNLYQKSNKGVKDFSQFFVDKALN

TSKEKLKEMEDSDNYVFLYELVKSTRNPVVIRDQLINILVAGRDTTASLLSFTFYTLG

RRPDVLKKLRAAILEDFGTSPDEITFESLKRCDYLRYVLNEVLRLYPSVPINARSATR

DTTLPRGGGPDGKQPVFVYKGQMVAYCVYWMHRDKKYWGEDALEFNPDRWDPKVQPQN

KGWEYLPFNGGPRICLGQQFALTEAGYVVTRMLQEFDTVHCKNQKEEEHPPYALDLTM

RHGEGVWVSMK

 

>CYP52F5 Yarrowia lipolytica gene for ALK5 AB010392

CAG83107.1

MLQLFGVLVLALTTALLAQLAYNKYEYNRKVKQFGCGELTVAKN

GFLGWKGIRAVLHVLKTKKGPAALKERIDAYGRTYVFHIGPAPVISTMEPENIKAMLA

TQFKDFSLGTRYRSLAPTLGDGIFTLDGHGWTHSRALLRPQFAREQVSRLDSLEAHFQ

ILKMCVDKEMREKGNDPRGFDIQNLFFLFTLDSATEFLFGSSVDSLVDFLDDPSVRTG

DHGGVDEAARKGFNNSFNHAQELCALRSRLHTLYWIVGSVVKKEPFERYNKEIKTFVD

FFAAKALKARKEKDMSLMDNDQYIFMYELVKETTNPVTLRDQMLNILLAGRDTTASML

SWIYFRLARDPKLYAKLRSAILEDFGTTPEAITFESLKQCDYLRYVLNEALRLYPVVP

INGRTATRDTTLPRGGGPDQSQPIFIPKGQTVSYSVYWTHRDPRFWGEDAEEFIPERW

DPRNGNIGRGWEYLPFNGGPRICLGQQFALTEVGYVLSRLVQTYETLETCDHKPLPPL

YNHALTMCHEEGVWVKMYKGEKA

 

>CYP52F6 Yarrowia lipolytica gene for ALK6 AB010393

CAG82620.1

MIQSVFLALAILIAYLGFAEWFSRFQHRRISKKKGCGMPPMANG

GFLGWYGLYKTYQITSERTYPHSMRMGLEAFGHTFVYPVPGTDMLQTIHPDNIKAILA

TQFKDFSLGTRHKIMLPTLGDGIFTLDGEGWTHSRALLRPQFARDQVSHVASLERHIQ

VLFKTIKKENKECDPAKGFDIQELFFMLTLDTATEFLCGDSVDSLTDYLADPTAPQLD

HSGIDENVRRAFPEAFNTAQWFCSIRAKLMKLYFFAGTVFYRKKYADANKIVHDFTDF

YVSKALAARKEKFQELDQEGKYIFLYELAKETRNPKVLRDQMLNILLAGRDTTASLLS

WVMFRMARQPETWKKLRQAVINDFGDTPDELSFESLKRCEYLRYVLNEGLRLYPSVPM

NFRVATRDTTLPKGGGPDLDQPIFIPKGGIVVYSVYHTHRAEEYWGKDTEEFIPERWD

PAEGYQIARGWEYLPFNGGPRICLGQQFALTEAGYVLARLAQEFETVTSCDDKPLPPK

YNTHLTMSHDDGVWLKME

 

>CYP52F7 Yarrowia lipolytica gene for ALK7 AB010394

CAG84028.1

MFQLFSILVLAFTTALVAQLAYNQYDYQRKVKKFGCGQLRVAEN

GLFGWKGLREVLRINKYKLGPAALKDRFEKYGKTHVFHVGPSPLITTMDPENIKAMLA

TQFKDFCLIARYKALGPMLGDGIFTLDGHGWTHSRALLRPQFAREQVSRLDSIEHHFQ

ILKKCISKEMSDKRDTQRGFDIQNLFFLMTLDTATEFLFGSSVDSLVDFLDDPSIQTG

DHGGIDEAARKGFSNAFNRAQELSSLRTRLHKLYWVIGTLAVREPYHRYNREVKTFVD

HYAAKAIKARNEKNTDLLDNDKYIFMYELVKETSNPITLRDQMLNILLAGRDTTASML

SWIYFRLARDPKRYAKLRAAVLADFGPGPENITFESLKKCDYLRYVLNESLRVYPVVP

INARTASRDTTLPRGGGPDGSQPIFVPKGQTVSYSVWWTHRDPEFWGQDAEEFIPERW

DTKNGSIGRGWEYLPFNGGPRICLGQQFALTEVGYVLSRMVQTYETLESGDTKPLPPL

YNHALTLCHQEGVWIKTE

 

>CYP52F8 Yarrowia lipolytica gene for ALK8 AB010395

CAG82058.1

MIPFTKINLELLLLPLLIIPITLFLLVLNVQVNTVHRRYKEYRL

KLARCPQQSTGLFGWWLIYAVVRCNRDRFYSAKVVDYFTKLRTFIVSLGGELVIYTSE

SENIKALLATQFSDYDLGKTRHALLFTLMGDGIFTLDGQGWAHSRALLRPQFSKETVS

PLSSLETSLQQLMAIVKRRVALKGEVDIQELFFMLTMDTATNLLYGESVDSLGDCLKE

TKKETHVMTDGKRNLLQSRDHHSNVPNEWEPIYGTYEKKGLGIGSENSLQSGVSPRDS

PVFEVSVSEDIRKAYPAALTTALEFSAMRSKLQRFYWIWGDVLYRQKFHSAVNTVHAF

SNHFVNQALKLTPQELQMKSAEKYTFLYELAQRTRDPVAIRDQLINILIAGRDTTAAL

LSFVFLCLVANPEKLAKLREGIMTDFGTSTDSITFESLKRCVYLRYVINEALRLCPPV

PINMRQANKDTTLPTGGGKNHDEPIFVAKNQIVTYSVLFMHHNQNIWGPDASEFRPER

WGEPACPKGWEYLPFNGGPRICLGQQYALTEAAYVIVRLVQEFTEIEWRDRKGLPVLF

KTHITMSLGEGLRVHMK

 

>CYP52F9 Yarrowia lipolytica

64% to CYP52F3

CAG84211.1

MLEILIGVTLFFTLWRVLVLADLKRRQKKSGYGYPPIASNGLLGWRGLVHQLSGFVKDIGPAGWGAQFKEHGKTHLYPVF

PTQLLVTRDPDNVKAILATQFKDFSFGIRKEALCPSLGYGIFTVEGSSWSHSRALLRPQFSREQISRLDSVEHHFQEFAQ

CVDNFKGEYFDIQKLFFAQSMDTSTDFLLGESVGCLKELLETRDGDESSKKFGANFQHAFDRVQRLVALRVVFQENYWII

GDVFFRNEFRQVNELIQKFVQGYVDKALKARAHKAPIYTNPDKYIFLYELARDTTNPRVLRDQVLNILIAGRDTTAATLS

WLMFELAQKPHIFHKLRKAVIEDFGTTIENISFESLKQCEYLRYVLNEVLRLHPVVPINLRVALKDTTLPRGGGPNGDEP

IFVPKGQKINYAVYWTHRDEQYWGEDAEEFKPERWDTTNHPGPLGKGWEFLPFNGGPRICLGQQFALTEMGYILTRLVQE

YSDIGIDEEYHDRPLRVRHSITMSHGDGVHVRLSREGTVVS

 

>CYP52F10 Yarrowia lipolytica

71% to CYP52F1

CAG82791.1

MLGRTLLVSDHCVDITASIFPGSSHPFTTTNPAMNTFHLLIALATFVVVYILSSSFVYQRRTNALEKQWKCGKPLYYASF

PRSLWHFYVFLRESRKHKLLEGFQRSFEAKKPFLTNKVNIFGKDIFNTCDPENLKAMLATQFKDFCLGERHAQLFPVLGD

GIFTLDGNGWQHSRAMLRPQFARDQVSDVHMVETHLKFLTSRITGSKPVDMQELFFNLTLDTATEFLFGQSVGCQIAESD

PGAYSSDMPLDLRKSFQKDFNKAQEHLGERVRLQMLYWLWNPKELQTAGARVHAFVDHYVSKALVEAEEKVDDDKYVFLR

ELARETKDPKVLRDQALNILLAGRDTTASLLSWCFYLMARDDRVWQKLRSEVIEHFGDGENLENITFESLKRCDYLRYVL

NEVLRLYPSVPANMRFATKDTTLPRGGGPVGQDPIVIRKGNVISYHVFTTHRLTQYWGEDAEEFVPERWAEGKARGWEYL

PFNGGPRICLGQQYALTEAGYVLVRLAQMYDTLENADDKPEPPVKLHALTMSHLTGVHVKLYKKN

 

>CYP52F11 Yarrowia lipolytica

69% to CYP52F2

CAG83401.1

MILLYVLAFLVSYLIFTRLRYRYQSYKLAQKWKCSPVRDVSSFPMAFPEFLFFFKSGKNNVLLDEFVNFFTKRQPNLTVG

LVLAGNDVTVTLEPENLKALLATQFKDFCLGVRHNQLAPILGDGIFTLDGQGWQHSRAMLRPQFARDQVSDVDMIERHVQ

NLVRKIPQGDSFDIQGLFFNLTLDTATEFLFGQSVSCQTVDNPAEDDSTVTDMPIPMRKSFQSDFNLAQHHGGYRVRLQM

FYWLWRPQELFTASKSVRKFVDHYVKKALVESEKEKQADDKYVFLTELAREVKSPQVLSDQALNILLAGRDTTASLLSWC

IYLLARHPETWNKLRDEILSTFGSGSDLSLITFESLKRCEYLRFVINETLRLYPSVPVNVRYATRDTTLPRGGGPDESQP

ILIRKNSVLVYSVFATHRLKKFWGEDADEFRPERWGEGISRGWEYLPFNGGPRICLGQQYALTETSYVLTRIVQLFGTLE

NADASPEPPMKLHALTMCHLTGVHVKMSTNNLP

 

>CYP52G1 Aspergillus nidulans AN6057.1 38% to 539A1 46% to 52F1 52 clan

MLFLSVLLAFAAYLLIYQYAMTNWNHARRARLWGCSPLPRYPTDILGLAT

LRESLKADKEKKIPLLLQNRLKRMSAREKRPVTTFVIRQMGLDNIFTCDH

GNVQAILATKFKNFELGVGRRHTLYPMFGVGIFTSDGETWSRSRALLRPQ

FTRDQISDLDLEESHVQQAMRAMNVDPATGWTSSIDIQAIMFRLTIDSAT

EFLFGESAGSQAEALRNGGTLPLNHFSGDFDLGQWYVAQRSRFEKFYWLV

DNRESRAVVKRVHEYVDRFVHAVLTTAEDRIEKSQSSSYVFLEALAASTK

DPIELRSQLLNILLAGRDTTASLLSWSILMLARYPEVFTKLRSVILADFG

SYTSSRDKITFASLKSCRYLQYFLNEVLRLYPAVPINRRVATTATTLPKG

GGPAGDKPIYLRAGQVVTYSPFVTHRRTDLWGEDAEVFNPERWVNKKVGW

EYLPFNGGPRVCIGQQFALTEAGYVIVRLLQRFDAIMDCFPEREIRYGLT

LTLAPADGVFVRLHAAE*

 

>CYP52G2  Aspergillus fumigatus Af293

         GenEMBL XP_755288.1 also EAL93250.1

         60% to 52G1

MGLPLLTIAAVAVALRLLWTLAARWQHAQNARRLGCGSIPLYPSDPLGISVLKETLAADKAKKLLPLVER

RVALMSDREGRYVTTFRFRQMGRENYFTTDPKNIQAILATQFKDFELGAPRRQALHPLLGAGIFSSDGEE

WFHARGLLRPQFTRDQISDLDLEERHVQKAMQAMPVVNGKWTDAVDIQSIFFRLTIDSATEFLFGESVES

QLSALNGGQTPVDTFPYYFDKSQWYAAQRARFEKLYWIVNNKECRHAQNEVHAYVDRVVHKALKAAREGK

LANPNKPSQYVFLHALVSVTQDPIELRSQLLNILLAGRDTTASLLSWTVLMLARHPAEFHKLRQTIVDEF

GTYDQPRNITFAALKSCQYLQYCLNETLRLFPVVPGNRRSATRDTTLPRGGGSDGTQPIYIRKGQTVVYN

VHILHRRKDIWGPDAEEFKPSRWVDRKVGWDYVPFNGGPRICIGQQFALTEAGYVLVRLLQRFDAIEDMQ

PHLEIRHSLNLTSAPADNVTVRLREAA

 

>CYP52G2 Neosartorya fischeri

97% to CYP52G2 Aspergillus fumigatus = ortholog

NFIA_085030

MGLPLLTIAAVAVALRLLWTLVTRWQHAQNARRLGCGSIPLYPSDPLGISVLKEALAADKAKKLLPMVERRVALMSDREG

RYVTTFRFRQMGRENYFTTDPKNIQAILATQFKDFELGAPRRQALHPLLGAGIFSSDGEEWSHARGLLRPQFTRDQISDL

DLEERHVQKAMQAMPVVNGKWTDAVDIQSIFFRLTIDSATEFLFGESVESQLSALNGGQTPVDKFPYYFDKSQWYAAQRA

RFEKLYWIVNNKECRHAENEVHAYVDRVVHKALKAAREGKLANPDKSSQYVFLHALVSVTQDPIELRSQLLNILLAGRDT

TASLLSWTVLMLARHPAEFHKLRQTIVDEFGTYDQPRNITFAALKSCQYLQYCLNETLRLFPVVPGNRRSATRDTTLPRG

GGSDGTQPIYIRKGQPVVYNVHILHRRRDVWGPDAEEFKPSRWVDRKVGWDYVPFNGGPRICIGQQFALTEAGYVLVRLL

QRFDAIEDVQPHLEIRHSLNLTSAPADNVTVRLREAA*

 

>CYP52G3  Aspergillus oryzae

         GenEMBL BAE65166.1, AP007171.1

         58% to CYP52G4, 63% to 52G1

         14 P450 genes and 2 pseudogenes on this contig

MIPLLILAALAVVFRLVWSIFTSLRHAQNARKWHCGAIPTYPGDILGINTLKEVLRADKEKLIPVLSAQR

VETMTAREGRYVSTFRLRQMGRESIFTSDPKNMQAILATQFKEFELGSLRRNSLHPLLGSGIFSTDGEAW

SRSRSLLRPQFTRDQVSDLDLEERHVQKAMAGMLADPATKWTPEIDIQSIFFRLTIDSATEFLFGDSVES

QTAALSGSRIIEDKFPSYFDRGQWYAAQRARFEKLYWIVNNKESRETDRFVHAYVDRFIDAALAAVKEGK

IDPEKRNSDHYVFLHGLTTATQDPVELRSQLLNILLAGRDTTASLLSWCVLLLARHPDIFQKLRNTILAD

FGDYRNPRNITFSSLKSCRYLHYFMNEVLRLYPIVPGNRRVALKDTTLPRGGGPDGSEPVYVRKGQPVVY

SVFVTHRRKDIWGADAEVFNPDRWEDLKVGWEYLPFNGGPRICIGQQFALTEAGYVLVRLLQRFDQIVDA

RPEREIRFNATLTSAPWENVIVRLREGA

 

>CYP52G3  Aspergillus flavus

99% to CYP52G3  Aspergillus oryzae

AFL2G_05445

MIPLLILAALAVVFRLVWSIFTSLRHAQNARKWHCGAIPTYPGDILGINTLKEVLRADKEKLIPVLSAQRVETMTAREGR

YVSTFRLRQMGRESIFTSDPKNMQAILATQFKEFELGSLRRNSLHPLLGSGIFSTDGEAWSRSRSLLRPQFTRDQVSDLD

LEERHVQKAMAGMLADPATKWTPEIDIQSIFFRLTIDSATEFLFGDSVESQTAALSGSRIIEDKFPSYFDRGQWYAAQRA

RFEKLYWIVNNKESRETDRFVHAYVDRFVDAALAAVKEGKIDPEKRNSDHYVFLHGLTTATQDPVELRSQLLNILLAGRD

TTASLLSWCVLLLARHPDIFQKLRNTILADFGDYRNPRNITFSSLKSCRYLHYFMNEVLRLYPIVPGNRRVALKDTTLPR

GGGPDGSEPVYVRKGQPVVYSVFVTHRRKDIWGADAEVFNPDRWEDLKVGWEYLPFNGGPRICIGQQFALTEAGYVLVRL

LQRFDQIVDARPEREIRFNATLTSAPWENVIVRLREGA*

 

>CYP52G4  Aspergillus oryzae

         GenEMBL BAE55312.1

         54% to 52G1

MSDARTTLMETWFTPALVAAIVAARLLFSLYSAWRHAQRARSLNCQEAPLYPSRDPFGVATLLETLRADR

DKFLPKLSQKRVDLISSQQNRYVSTFRVRQAGRENFFTVDPKNIQAMLATQFNDFFLGDMRRNAGAPVIR

SGIFVSDGADWSHSRSLIRPQFTRTQINNLELEERHVQNALRAMPTQSNGWTSEVDIQTILFRLTLDSAT

EFLFGKSCNSQLTALEKDAGEMSDSFLNSFDRCAWYLAARLRFERLYWIVNNKEFRECTRVVHELVDGYV

HAALQRAQQAEKPADPERGSHYVFVDALTATTQDPNQLRDECLNVLIAGCDTTASLLSWNILLLARHPDI

FQRLRKEIIERFGTYSEPRDINFSSLKSCQYLQHFINETLRLHPVVPFNRRCANKDTTLPRGGGKDGNSP

VYLQKGQPVLYSSYVLQRRKDIWGEDAEEFNPDRWYGRKAIWEHIPFSGGPRTCIGQQFAITNTSFVLVR

LLQRFDSIEDVYPEREIRYGVTLTNCPADRVTVRMHQAEL

 

>CYP52G4  Aspergillus flavus

99% to CYP52G4  Aspergillus oryzae

AFL2G_00228

METWFTPALVAAIVAARLLFSLYSAWRHAQRARSLNCQEAPLYPSRDPFGVATLLETLRADRDKFLPKLSQKRVDLISSQ

QNRYVSTFRVRQAGRENFFTVDPKNIQAMLATQFNDFFLGDMRRNAGAPVIRSGIFVSDGADWSHSRSLIRPQFTRTQIN

NLELEERHVQNALRAMPTQSNGWTSEVDIQTILFRLTLDSATEFLFGKSCNSQLTALEKDAGEMSDSFLNSFDRCAWYLA

ARLRFERLYWIVNNKEFRECTRVVHELVDGYVHAALQRAQQAEKPADPERGSHYVFVDALTATTQDPNQLRDECLNVLIA

GRDTTASLLSWNILLLARHPDIFQRLRKEIIERFGTYSEPRDINFSSLKSCQYLQHFINETLRLHPVVPFNRRCANKDTT

LPRGGGKDGNSPVYLQKGQPVLYSSYVLQRRKDIWGEDAEEFNPDRWYGRKAIWEHIPFSGGPRTCIGQQFAITNTSFVL

VRLLQRFDSIEDVYPEREIRYGVTLTNCPADRVTVRMHQAEL*

 

>CYP52G5P old name = CYP-un1 pseudogene Nectria haematococca e_gw1.8.757.1

Necha1/scaffold_8:999970-1000262

PSEUDOGENE very short piece

57% to 538A3, 54% to 584D1, 61% to 52A3, 68% to 52G2

DESLRLYPVEPINARYANKDTTLPRGGGKDGNSPILIPKGSSTAFSVHIIHRRKDIRGPD

ANEFKPERWEGRRVGWEYVP ()

FNGGPRICIG**FALIGASYVTVRLLQRFDKMESLEKDAVVRHNLKLINYVANGVKVRLHAAS

 

>CYP52G6 Aspergillus niger

fgenesh1_pg.C_scaffold_15000225|Aspni1

57% to CYP52G2

MGLATLLLVLVGLTFILRIVSEKWRHRQNAKRLGCQPAPMAPSKDPLAIGDILEIIQADKDKVVPELLESRTNIMRDNNA

GRYVSTFRLKRGLGENLLTFDPENLQAMLAKQFKDFSVGGERLGCMGPLLGKGIFINDGAEWSHSRTMLRPQFTREQISD

LGLEERHVQNAMRAIPAAGSNGWTEVDIQSIYFRLTLDSATELLFGESCYSQLAAMGDAEDRMASGGKVTDFGKNFDRAQ

WYMAQRLRLPRMKFLYDNKEFRTCCQEVHRFVDECVAKALHDHKKKKQQQQLLEEGASEHYIFVHAMAETTKDPIELRSQ

LLNVLLAGRDTTAALLSWTTLLLSRHPEVFHKLREAIIADFGTYENPQNITFATLKACTYLQQVMNETLRLFPPLPTNAR

YATKDTSLPRGGGPDGQSPVYIKKGQAVLYNVHMLHRREDVWGKDAKEFKPERWEARRSGWEYLPFNGGPRICIGQQFAL

TEAGYVLVRMLQRFDGIEDVHADQRIRWGLTLVSAPGDTVTVRLHEASR*

 

>CYP52G7 Aspergillus niger

e_gw1.7.657.1|Aspni1

67% to CYP52G3

MSTLLFVATASPILYLLYVLLSRWQHAQNARKWNCGSVPSYPGDLLGINTLKEALAMDKARQVPTVTRRRVETMSARENR

YTTTFQFRQLGTDVISTCDPKNVQALLATQFKDFELGQSRRNALHWLLGRGIFTADGDHWSRSRALLRPQFTRDQISDLD

LEERHVQVAMKAMPVDATGWTPATDIQTIFFRLTMDTATEFLFGESVQSQAAALSNGAIPQDDFPAQFDRGQWYSAQRAR

FEKLYWIINNKESRAINKAVHAYVDRFVTAALNSDPEKKPTGHYVFLHGLAEATRDPVELRSQLLNILLAGRDTTASLLS

WCVLFLARHPAYFSSLRATILAEFGSYSSPRDITFANLKSCRPLQNFLNEVLRLYPIVPGNRRTAVRNTTLPTGGGPAGT

DPVYVKKGQPVFYSTYVMHRRPDLWGADADEFRPDRWNERKAGWEYLPFNGGPRICIGQQFALTETGYVLVRLLQRFDVI

EGVGKTKEGEINMQMSLTNAPGDNVTVRLHEDASN*

 

>CYP52G8 Aspergillus clavatus

83% to CYP52G2

ACLA_081330

MAFPLVTIAAVAVALRLLWVLVSKWQNAQNARRLGCGSTPLYPSDFIGISVLKEALKADKAKQLLQLIERRVALMSDREG

RYVSTFRLRQIGREMYFTTDPKNIQAVLATQFKDFELGAPRRNAIHSLLGTGIFTSDGEEWSRSRALLRPQFTRGQISDL

ELEERHVQNAMRAMRVVNDKWTDAVDIQSIFFRLTIDSATEFLFGESVESQLSALNGGGTPADQFPYYFDRSQWYCAQRG

RFEKLWWVVNNRESRHAEKEVHAYVDRFAQNAIKTAQEGKLATDDSSRYVFLHALASVTQDPVELRSQLLNILLAGRDTT

ASLLSWTMLLLARHPAEFQKLRQAVVDEFGTYDQPRNLTFGALKSCQPLQHCMNEVLRLFPVVPGNRRIATKDTTLPRGG

GSDGSQPIYVRKGQPVAYSMHILHRRKDIWGPDAEEFKPSRWVDRKVGWDYVPFNGGPRICLGQQFALTEAGYVLVRLLQ

RFDAIEDVQPHLEIRYALNLTSAPADNVTVRLREASK*

 

>CYP52G9 Aspergillus terreus NIH2624

CH476602

62% to CYP52G2

complement(join(1144551..1145711,1145779..1146177))

ATEG_06678

GenPept EAU33222.1

MATLLSISVLAVVVLRLFWTLAAKFNHARKARRWGCAPYPTYPS

DLLGIGLLKETLAADKADVLCPMFERRIAHISAREGRHVATLSWMSLGRETCFTIDPE

NVRAVWATQFKDFVAGDLRWNVSHQLTGKNIASTDGAEWARYRALLRPQFSRSQISDL

DLEERHVQKVMLAIPVINGKWTEPVDIQEIFHRFTIDSSTEFLFGKSVESQISAITGQ

KTAEADFAHHLDKSMEYIGKRARLDKLYWLANNQESRFSESEVHKYVDRYVQDAIKAG

QEGKLQADPERSPQYILLHALTTATQDPIELRNQVLTLLLAGRDTTASLLSWTVLLLA

RHADEFQKLRQAVLEDFGSYDNPHNLTFGALKSCSHLRHCLNESLRLYPVAPFNRRIA

VRDTTLPRGGGSDGRQPIFVRKGQAIMFSAYSMHRRRDIWGPDADDFRPGRWEARKTL

WEYLPFSGGPRICLGQQFALTEAGYVLVRLVQRFDAMEDVNAETEIKQKVTLTSAPAQ

SVTVRLHAPRA*

 

>CYP52G10 Aspergillus terreus

68% to CYP52G4

ATEG_07540.1

MHTLLFVPALVLAGIAVRLVISFALSWRKARNARRLGCEEAPLYPSKDPFGFSNLLETLRADRAKVLPELAERRIDLLSQ

RHGRYISTFRVRQPGKESLFTADPKNIQAMLATQFKDFGLGDGRRNVGGPLVGRGIFTTDGEAWSHSRSLLRPQFTRAQV

SNLDMEERHVQNAMRALPVLSNGWTRAVDIQTIFFRLTLDSATEFLFGKSCDSQLAAVRTDVGRGSDSFLYGFDRSVWYL

SERLRFDRFYWLVDNREFRESIRMVHAFVDKYVNAVLERQAGDTKLPDSSQSTSQYVFLEALAASSKDPLQLRYESLNVL

LAGRDTTASLLSWAVLILARRPDIFSRLRKDIVEQFGTYKTPRGITFASLKSCQYLQHFINETLRLYPVVPFNRRCALRD

TTLPSGGGKDGSSPIYIPKGQQVLYGSYVLQRRKDIWGDDAEAFNPDRWIGRKVTWEYIPFNGGPRTCIGQQFALIKTSY

VLVRLLQRFDSIVDVHADQEIRYGVALTCAPADLVTVKLHEADD

 

>CYP52H1 Aspergillus nidulans AN7131.1 45% to 584B1 52 clan

MWSPFLEVAKALREGHVVEFITQKYNEYGWTFEQNVLGRSGISTIEPENL

KALLATQFNDFCLGTREREFGPLLGQGIFTLDGAGWSHSRALLRPQFTRD

QVADLDLMESHISRLIELVPKDGSAFDIQRLFFLMTLDSSTHFLFGESVH

CMDEGNVLARSTVNNAQGFANAFNTALDYLNWRSVAGNFYWMITSKEFRD

ANKRVHEVVDYYVHQAIEAKRHPEKKEPGRYIFAEALAADNDNPKVLRDN

MLNILLAGRDTTASLLSSAFFYLSRHPAVWEKLRRVIIEEFGDVQNPKGE

ITHAKLKDLPYLRYVLNEVLRLQPPVPLNLRVAVKDTSLPVGGGPDGKSP

VFVEKDQPVLYSVYAMHRRKDLWGPDADSFRPERWEENAKHGWEYLPFNG

GPRICLGQQYALTEASYTMVRLMQRFSKVENGEPGLDEPLIRATLTMSHE

NGVKVRFKLQHVRRKPSPLQTCTR*

 

>CYP52H2  Aspergillus fumigatus Af293

         GenEMBL XP_746567.1 also EAL84529.1

         cytochrome P450 alkane hydroxylase

         72% to 52H1

MLAPAVALFAAVYTTFLVLRYFQQLYKHRKQARSLRCQPPADGEAGFLGIASFLRLRKAAKEKRWIELIA

EQYGKYGNTFTQTIFGQPLVSTIEPENLKALLATQFNDFELGTRHREFYPLLGDGIFTLDGAGWSHARAL

LRPQFTRDQVADLDLMDGHVSRLIDLVPKDGSAFDIQRLFFLLTIDSATHFLFGESVGSLHAGTDTGLLG

RSAVGNAEGFAEAFNKAQEYLAARSRAVVFYWMINPKEFRDANKRVHEVVDHYVQLALESRRNPEKKQPG

GRYIFAEALAAENDNPKVLRDNMLNILLAGRDTTASLLSSTFFYLARHPNVWIKLRQVIVDAFGDAEHPK

EEITQTKLKDIPYLRYVLNEVLRLLPPVPANFRVANKDTTLPVGGGPDQKSPVYIRKGTIVTYSVYAMHR

RTDFYGPDANEFRPERWEENGKRGWEYLPFNGGPRICLGQQYALTEASFTIVKLLQRFDRIENGDPDLIE

PIQQTNLTLAHDRGVYIRLYSSKAL

 

>CYP52H2 Neosartorya fischeri

95% to CYP52H2 Aspergillus fumigatus = ortholog

NFIA_029600

MLAPAVALFGAVYATFLVLRYFQQLYKHRKQARSLRCQPPAEGEAGIFGISSFLRLRNAVKEKRWIELIAEQYGKYGNTF

TQTIFGQPLVSTIEPENLKALLATQFNDFELGTRHQEFYPLLGDGIFTLDGAGWSHARALLRPQFTRDQVADLDLMDGHV

SRLIDLVPKDGSTFDIQRLFFLLTIDSATHFLFGESVGSLHAGTDTGLLGRSAVGNAEGFAEAFNKAQEYLAARSRAVIF

YWMINPKEFRDANKRVHEVVDHYVELALESRRNSENKQPGGRYIFAEALAAENDNPKVLRDNMLNILLAGRDTTASLLSS

TFFYLARHPNVWTKLRQAIVDAFGGAEHPKEEITQTKLKDIPYLRYVLNEVLRLLPPVPANFRVANKDTTLPVGGGPDQK

SPVYIRKDTVVTYSVYAMHRRTDFYGPDANEFRPERWEENGKRGWEYLPFNGGPRICLGQQYALTEASFTIVKLLQRFDR

IENADPDLIEPVQQTNLTLAHDRGVYIRLYSSKAL*

 

>CYP52H3  Aspergillus oryzae

         GenEMBL BAE64862.1, AP007171.1

         71% to 52H1, 48% to 584G1

         14 P450 genes and 2 pseudogenes on this contig

MLAQIAPLFGALCITFLVLQYLQRLYQQRKRAQSLGCQPAAQGPSGIFGIRSFVRLLNEVRHKRWVEYIA

GQYGRYGNTYTQKALGKWMVS TIEPENIKALLATQFNDFGLGTRHREFYPLLGDGIFTLDGPGWSHARGL

LRPQFTRDQVADLELMDGHISRMIDLIPQDGSSFDIQRLFFLLTIDSATHFLFGESVGALESSNSASLLG

RSSVGSAQGFAEAFGTAQDYLTTRSRAMHFYWMVNPKEFREANQRVHEVVDHYVQLAIQSKNNPDKKSDR

YIFAEALAADNDDPKVLRDNMLNILVAGRDTTASLLSSAFFYLSRNQDVWKKLRQTIIDEFGDSQNPKGE

ITQAKLKDIPYLRYVLNEVLRLLPPVPLNFRVAAKDTSLPVGGGPDGRSPVFIPKGQVVAYSVYAMHRRT

DLYGPDSHSFRPERWEENGRRGWDYLPFNGGPRICLGQQYALTEASYTLVKLVQRFDTLECADPELKQPA

ILSTLTMSHDRGVKVRLSSSVPKCWFNQ

 

>CYP52H3  Aspergillus flavus

100% to CYP52H3  Aspergillus oryzae

AFL2G_05134

MLAQIAPLFGALCITFLVLQYLQRLYQQRKRAQSLGCQPAAQGPSGIFGIRSFVRLLNEVRHKRWVEYIAGQYGRYGNTY

TQKALGKWMVSTIEPENIKALLATQFNDFGLGTRHREFYPLLGDGIFTLDGPGWSHARGLLRPQFTRDQVADLELMDGHI

SRMIDLIPQDGSSFDIQRLFFLLTIDSATHFLFGESVGALESSNSASLLGRSSVGSAQGFAEAFGTAQDYLTTRSRAMHF

YWMVNPKEFREANQRVHEVVDHYVQLAIQSKNNPDKKSDRYIFAEALAADNDDPKVLRDNMLNILVAGRDTTASLLSSAF

FYLSRNQDVWKKLRQTIIDEFGDSQNPKGEITQAKLKDIPYLRYVLNEVLRLLPPVPLNFRVAAKDTSLPVGGGPDGRSP

VFIPKGQVVAYSVYAMHRRTDLYGPDSHSFRPERWEENGRRGWDYLPFNGGPRICLGQQYALTEASYTLVKLVQRFDTLE

CADPELKQPAILSTLTMSHDRGVKVRLSSSVPKC*

 

>CYP52H4 Aspergillus niger

estExt_GeneWisePlus.C_80246|Aspni1

73% to CYP52H2

MLAPAIVFLGAIYLTFRILSSLHQAYHHRKKAKALGCQPPNSVDTGILGITGFYRIAKAAREKRWVEYIAEHYQTSGPTF

RQRALGGLMVTNTVEPENIKALLATQFQDFGLGTRHREFYPLLGNGIFTLDGAGWSHARGMLRPQFTRDQVADLDLMDGH

ITKMMDLIPKDGSTFDIQRLFFLLTIDSATHFLFGESVGSMRTSAESSLLEKSTVGNAQGFAEAFNRAQEYLAARSRAMA

FYWLVNPKEFREANQLVHEVVDHYVRLALEAKRHPEKKEPGRYIFAEALAGDTDDPRVIRDNMLNILLAGRDTTASLLSS

AFFYLARHPNVWTRLRQTIVDEFGDAQHPKGTITHARLKDTPYLRYFLNEVLRLLPPVPLNFRVAAKDTSLPLGGGPDGK

APIYVRKGELVSYSVYAMHRRTDLYGPDAHAFRPERWEENSKRGWEYLPFNGGPRICLGQQYALTEASYTMVKLLQRYNR

IENADPDMVEPIINSSLTLSHDRGVHIRLFSS*

 

>CYP52H5 Aspergillus clavatus

84% to CYP52H2 Aspergillus fumigatus

ACLA_054640

MLAPAVTLLVAVYAAFLILRYFQQLYHHRKQARALRCQPVASGNPGFFGIPAFLRLGQAVKEKRWIEHITEQYGTYGNTF

TQVLLGRRLLSTIEPENLKAMLATQFHDFGLGTRHREFYPLLGDGIFTLDGPGWSHARGLLRPQFTRDQVADLDLMDGHI

SRLIELVPKDGSTFDIQRLFFLLTIDSATHFLFGESVGSLHGGTDTGLLGKSAVGNAQGFAEAFNTAQEYLLTRSRALDF

YWMVNPKEFRDANKRVHEVVDHYVQLALESRRNPEKKKQSGGRYIFAEALAAENDNPKVLRDNMLNILLAGRDTTASLLS

STFFYLARHPNVWTKLRHAIVEEFGDSENPRNEITQTKLKDIPYLRYVLNEVLRLNPPVPANFRVANKDTSLPVGGGPDK

KSPVYVPKGTVVTYSVYAMHRRTDLYGQDADQFRPERWEENGRRGWEYLPFNGGPRICLGQQYALTEASYTVVKLLQRFD

TIENADPGLLVPIQLSNLTMSHDTGVNIRLYSSKGYN*

 

>CYP52H6 Aspergillus terreus

75% to CYP52H5

ATEG_02198.1

MLAPIGLVFGALYLTYFVLQYIQRLYQQRKFAKARQCLPPREGAAGLFGITPFIRLAKAVREKRWVEYIADQYSINGTTF

SQAMLGQRMISTIDPENLKAILATQFNDFSLGTRHREFYPLLGDGIFTLDGAGWSHARGLLRPQFTRDQVADLDLMNGHV

SRLIELVPKDRSTFDIQHLFFLLTIDSATHFLFGESVNSMGSGVLEKSAVGGAQGFAEAFNTAQDYLASRSRAMKFYWMV

NPKEFKDATARVHEVVDHYVRLAIESKNHPERKEAGRYIFAEALAADNDDPKVLRDNMLNILLAGRDTTASLLSSTFFFL

ARSPKVWNRLRETIINEFGDSQNPKSEITHTKLKDIPYLRYVLNEVLRLMPPVPLNFRTATKDTSLPVGGGPDGRSPVFV

PKGTTVTYSVYAMHRRPDFYGPDPNEFRPERWEENGRRGWDYLPFNGGPRICLGQQYALTEASYTLVKLLQHFDTLENAD

PTLLRPVIQSNLTMSHETGVNVRLYRAGTA

 

>CYP52J1P  Aspergillus fumigatus Af293

         GenEMBL XP_746816.1 also EAL84778.1

         alkane hydroxylase predicted

         42% to CYP52F1, in 52 clan

         insertion of 11 C bases causes frameshift

MTNTDIAFGHQHGCELPPELTKNWPLGLDRIKELWTANTEGHLLAFLCSVAEKYEPGNSITQYFLFGPRA

FHILQPESVEAILSTNFKDYGFGARAAIFAPRLGNGIFTQEGPAWRHSRDLLRKQFSRVQNRILEHFHEH

VDNMVARLPLDGVVDLQPLFFNLTLDIATALLFGRSVYSLLAGIDQDADNGLFAEGFNIAQDGLAKRFRI

APWHFLYNPPGFRKACGDVHRFVEQYIDQLDLENSEDLDDKTYGFIKRVAHESASRQHLRDQLLNVLLAG

RDTTACCLSWTFRLLVHHEQAMIRLREEIASVMGDSAHPTKEQIRKMPYLSCVIKE (1)

SLRLYPPP &

PPVPLNNREAIRTTILPTGGGPDADRPILVRKGELVVFFQYVNSRKKNIYGPDADCFRP

ERWETGELDHIGWAYFPFNGGPRQCLGENFALMEVSYTVVRLLQTFSSIILPKGQPIEPVGSERQRLTLV

LSSADGCKVQIHS

 

>CYP52J1 Neosartorya fischeri

95% to CYP52J1 Aspergillus fumigatus = ortholog

NFIA_113870

MQSSQQDNALGHQHGCELPPELTKKWPLGLDRIKELWTSNAEGHLLAFLCSVAEKYEPGNSITQYFLFGPRAFHILQPEN

VEAILSTNFKDYGFGARAAIFAPLLGNGIFTQEGPAWRHSRDLLRKQFSRVQNRNLEHFHEHVDNMVARLPLDGVVDLQP

LFFNLTLDIATALLFGRSVYSLKAGIDQDADNRLFAESFNIAQEGLAKRFRIAPWHFLYNPPGFRKACGDVHRFVEQYID

QLDLENSEDLDDKTYGFIKRVAQESASQQHLRDQLLNVLLAGRDTTACCLSWTFRLLVRHEQVMIRLREEIASVMGDSAH

PTKEQIRKMPYLSCVIKESLRLYPPVPLNNREAIRTTILPTGGGPDADRPILVRKGELVVFSQYVNSRKKNIYGPDADCF

RPERWETGELDHIGWAYFPFNGGPRQCLGEDFALMEVSYTVVRLLQTFSSIILPKGEPIEPVGSERQRLTLVLSSADGCR

VQIHSY*

 

>CYP52J2 Uncinocarpus reesii

71% to 52J1 in overlapping parts

UREG_00942.1

MATFLLIQYVACIVFAYVGYCAIVRFREYCSDTAFGRRLGCQLPPELTKRLPFGIDRIKDLWETDSKGKLLAYLCDVAEQ

YEPGNNLTQYLLVGPRAFHVLHPANLEAVLSTNFSDYGFGARRAIFAPLLGNGISTQEGHAWRHSRELLRKQFIRVQYQN

LDHFREHVDNLIACLPKDGVIDLQPLFFNLTLDVATHLLFGRSVYSLRAGIDQDSKNKVFAESFNVALKGLARRFRSAPF

HFLYNPSKFRKACANVHHFVEQYIDELDIEETEAKDDSSYMFFRQVARESATKEDLRDQLLNVLFAGRDTAACCLSWTLR

LLIRHPYEMERLRAEVASVMRESSHPTRQQIRKMPFLACVIKESLRLYPPVPLNNREAVRTTVLPTGGGSDGQSPILVRK

GELVVFSQYVNSRKKNIWGPDAYEFHPGRWEENKLSDIGWAYFPFSGGPRRCLGEDFALMEVSYTLVRLLQTFPSIVLPD

DEPVEPVGSERQRLTLVLSSANGCRAHVQSA

 

>CYP52K1  Aspergillus oryzae

         GenEMBL BAE66393.1

         44% to 52A5, 44% TO CYP52J1

MLTLSFSALLGIALAWAIHRLAWKYSRLKAICVKRDNKLATQYGCEQPPRLRNWWPLGIDRLIQIWTADS

EQRLMDLFTFPFKDVGYTLEQKFLGTIAFGTIDPENLEAIMTNIN (0)

VFSFGLRRHILFPLLGDGIFTQEGK

SWRHSRELLRPQFTRQHYRDLNIFRPHVDR

LLHYLTGNGAATDLQPLFFRLTLDTTTEYLFGKSVNSLMP

GEATKGQSFANHFDMAQNYVVQRFRLLDLYWLIGGPKFWRSCSAVHRFIDEIIDTRMDSKEKDKDCNSKS

IFFDAVARDSRTRRDLRDQLTNVLLAGRDTTACLLSWTFHCLARHPDVLGRLNVEIASVVGTNTDLTRDD

FKRMPYLDQVLREVLRLYPPVPVNTRTAHKTTILPT

GGGKDGTKPFMVREGENVAFCVYAMHRREDLYGP

DAGQFRPERWDEDLPLFQNERTATWGYLPFNGGPRACLG

QDFGFVEAAYTVVRILQKYPIVKPDMYKGDI

QGRKWLGWSSHQPEGIEMVTEERQKMTIVLSLGDGCRVTLGR

 

>CYP52K1P  Aspergillus flavus

97% to CYP52K1  Aspergillus oryzae

small 6 aa deletion and frameshift = &

AFL2G_11704

MLTLSFSALLGIALAWAIHRLAWKYSRLK (0)

AICVKRDNKLATQYGCEQPPRLRNWWPLGIDRLIQIWTADSEQRLMDLFTFPFKDV

GYTLEQKFLGTIAFGTIDPENLEAIMTNIN (0)

VFSFGLRRHILFPLLGDGIFTQEGK

SWRHSRELLRPQFTRQHYRDLNIFRPHVDR

LLHYLTGNGAATDLQPLFFRLTL

DTTTEYLFGKSVNSLMPGEATKGQSFANHFDMAQNYVVQRFRLLDLYWLIGGPKFWRSCSAVHRFIDEIIDARMDSTEKD

KDCNSKYIFFDAVARDSRTRRDLRDQLTNVLLAGRDTTACLLSWTFHCLARHPDVLGRLNVEIASVVGTNTDLTRDDFKR

MPYLDQVLRE

VLRLYPPVPVNTRTAHKTTILPT

GGAKDGTKPFMVREGENVAFCVYAMHRREDLYGPDAGQFRPERWDEDLPLFQNERTATWGYLPFNGGPRACLG (1)

QDFGFVEAAYT &

KYPNVKPDMYKGDIQGRKWLGWSSHQPEGIEMVTEEGQKMTIVLSLGDGCRVTLGR

 

>CYP52L1   Graphium sp. ATCC 58400 AY438638.1

MMDPFYLLGGCCVFGIVYKSVATLYVNYVHGKTARELGCKPLPK

ERTRFFGLDILRREMKADREMYLPSDIMTRFEEVGATTYEYQMLNEKHIATCDPLVIQ

TVLATQFKEFTFGNRPWGTVLGNGIFSIDNIGDNKEWLHTRAMLKPQFLRNQVSDLEL

EEGHVRNFMSVLKVGDDGWTPKVNLQHMFFNFTLDSATEFLFGKSADCQLLFAPGGDP

KGVSKPLRAFLKALDVAKETVNTKWFLGNNGWIADSPTFRKNCAYVNDFMDALIAKTK

AELEAKPKGSKPSGGREKYHFLHAMLDETDDKVELRGQALNILLAGRETTASLLGWLW

YYLARHPIEFQKLRAAVLKDFGTAENPKPMSFESLKACDQLQYCNNEILRLFPLVSYN

SRMALTDTTLPRGGGPDGNSPIFVKKGQQIVYHPHAMHRRKDIWGQDADEFRPDRWKT

LRPGWEYIPFNGGGRICMGQQFALTEASYLTVRLLQRFDRIENLDPNPVLKQKFRIVN

TPGEGVLVRLHEAAAGA

 

>CYP52M1 Candida bombicola EU552419

alternative name Starmerella bombicola

MLIKDIILTPMSLSAVAGLLPLLFVAFLVLHEPIWLLWYRYAARRHKCSMPRFIEKSFPLGIQRTMDMIKTAKSYTLLEVQYDRVFNKFKARTYLXQAPLQYQIFTIEPENIKTILATKFNDFGLGARFHTVGKVFGQGIFTLSGNGWKQSRSMLRPQFTKDQVCRIDQISSHAAELIKEMNRAMKVDQFIDAQHYFHKLTLDTATEFLFGESCESLNPENQSCIVARDGSEITAEQFVESYNFLLNYAFKRTLSSKVYWLFNSKEFRDHKKRAQSYIDYYVDKALYATSFAAENSIAEKDAAAESSGIYVFSLEMAKVTRDPVTIRDQIFNILIAGRDTTAATLSFAIHFLARNPDVFNKLREEVLDHFGTKEEQRPLSFELLKQAPYLKQVINEVLRLAPVLPLNFRTAVRDTTLPIGGGPEQKDPIFVPKGTAVYYSIYMVHRDIKYWGPDAHEFNPNRWENLKLDNVWAFLPFNGGPRICLGQQFALTELSLTLVRLLQEYSKIEMGPDFPESPRFSTTLTAQHAPPGVVVRFS

 

>CYP52N1 Candida bombicola EU552421

alternative name Starmerella bombicola

MILYAVLGAFAAFLLYMDVLYPFVIYPLRARWHKCGYIPRDLSWPLGIPLTLVVLSKLRKDMLLQFMAAQDLSRPYKTSLRQFLGKWVIATRDPENIKAVLSTKFNDFSLKERGNRMRHVIGDGIFTQDGAPWKHSRDMLRPQFTKDQISRVELLSHHIDVLIREIRKSGGNVELQRLFHLMTMDTATHFLFGESVGSLEVSGESKGIEITDPKTGEIVNTVDFVESYTFANKFALKKIILNDLEFVADLTEPSYKWHLRRVHTVMDHYVQLALKATEKYDPDDDSEKGEYYFSHELAKLTRDPLSLRDQLFNILIAGRDTTAATLSYAFHYLTKNPAIYAKVREDVLTVFPNGDASLATYEDLRKAKYLQMVIKEVLRLAPAVPLNTRAAVRDTYLPRGGGPAGNLPVFVPKGTAVNYPTYILHRDPDIYGADAYEFNPERWRPENKLPNSPXYSWGYIPFNGGPRICIGQQFALTEIALTMIKLVLEFERLEPADDFEPNLQDKSSLTVMVGGSGVRVKLS

 

>CYP52P1 Aspergillus niger

gw1.4.1682.1|Aspni1

46% to CYP52K1

WPLGLDLLVQAFHYDRRQQILKFFLGVVAESGTTFEQNLLFSRGVDTIDPQNIQALLSTQYADFGLGLRPPTFCPLLGSG

IFTQDGAQWRHSRERLRPQFMTNRFTNFEQIRSAVDNLISSISDDNAVNLQPLFFRLTFETTLFLLFGQHLPSLQLEGIK

NQESDFANAFNLGQEYLAKRGRLGGFYWLLDGRDFREACKTCHEFVDRAVQKALDLTTKKTPGTKTEPYIFIDAFIEETR

NPEVLRDQCLNILLAGRDTTACCLTWTLRLLVQHPPVLSKLRAEISDTVGIGPRSPAPTIIQVKSLPYLSLVIKEVLRLY

PSVPVNSRAATKTTTLPTGGGPTGTAPILVRKGEAVGYCVYAMHRRRDIYGADADKFRPERWENDALKDVGWGYLPFNGG

PRVCLGREFALLEVGYTIMRLLQTFEVIEQAE

 

>CYP52P2 Mgr076 Mycosphaerella graminicola

53% to CYP52P1 A. niger, 47% to 52K1 (missing N-term)

yellow from JGI model e_gw1.8.895.1|Mycgr3

LGLGLLLRTFRVAKEQRLLHFFNDLVRSTGNW

TFEQRLLGISGIDTFEPENVEAVLSTQFEADFDLGERRKVFFALLGDGIFTQDGAAWARTRALLRPAFYQQNTDRMLDEIDGLVGKMLRDVPEGEEVDFQPLFFRLTLETTMSLLFGKRMEGEDEQRKKVEMDDFAAAFDEAQDWLARRGRLGGLYWLIDGPGFRKSCRIVHRFIDAAIEEALRVKDVNEGETEGYSVLGALLPETQDRKVLREQCLNVLLAGRDTTACLLSWTCRLLASHPRTLTTLRQEITQICGTDPSPPSRAQLKRMRYLDAILKEVLRLYSSVPINSRTASRTTTLPTGGGPDRTSPILIRKGQAVAYSPYIMHRREDIFGPDAADFRPERWLENDGRLFAEAGWAYLPFNGGRRVCLGQEFALLEAGSVIVGMVRRWREWKVAGDGEAFPEVGTERQKVTLVVSCAEGCRLEVKS*

 

>CYP52Q1 Aspergillus niger

e_gw1.11.186.1|Aspni1

45% to CYP52H3, 41% to CYP52P1

MPWSAASLSLATFFSALVALQLYWIVSRSYRSRKLSKQWNCEPVCRYPSGILGYKVVLRAKTAAQEGQVGSTIQGVHLQY

GNTLKVNLVGHDVVATCEPENIQAVLASQFSSFGLSEWRYPQYRPLLGRGIFTSDGTAWEHSRKLLRPQFTKNQIPSIEW

FDSHSENLMRSLPPDGHAFDIQPLAFRLALDSATGYLFGESINSLVKPDSNQTGVAETSGSGNEGFAAAFDYAQDILFRR

TLALSYYWLINPSDFRKSTRVVHKFVDYYVDKAIEYRSNIGNYKTGHEQKGEEYCFLHALAAETQDREFLRDQLVNVLLA

SRDDVASVLASTFYLLARDTRAWWKLKQEITDAVDRHASNITLKEIQSLPYLRGVLYEVLRLFPPVPVNARVAHHDTTIP

VGGGPDGRSPVFIPKGQMVAYSVWCLHRRRDLWGADAESFRPERWEGYNPPAWEFVPFNGGPRACLGQQFAMILISQQVF

RLVQHLDSIESAQPGPDMGLNPPLRQTLTMCHEHGVHLRVKRMRI*

 

>CYP52R1 Mgr006 Mycosphaerella graminicola

51% to CYP52G2    Aspergillus fumigatus

MHNVALLALLGLAVLGFYKIVASIALKWQHASKARQLGCQDPVVVPGGGVLGLKHLKNMMAADKAQRFPDFMLDRHEMMSKQTGRVCETFRTDLMGQSVFFTSDPENIKAILATQFQDFDLGPVRRAIMGKVLGDGIFIQDGKKWEHSRAMLRPNFVRDQVSDLDMEEIHVKNLLQVMPAKEAGWTDLVNIQTLFFRLTIDASTEFLFGESVLSQVAASKTDGKPNARDETIFSQNFDRSQYHMARQFRFADNYWLYRSSELDQNAKVVNEFVKTYVEAALAAPEKEKSDKYIFSEALAQQTRDPDEIRAQLLNILLAGRDTTASLLSWFFYEMLRNPAVFEKLRGVITETFGTFDEPTDITFATLKSCQYLQYCINETLRVWPVVPGNGRRSNKDTTLPRGGGPDGKSPIFIPAETGIDYSVHVLHRRKDIWGEDAGVFRPERFQGLRPNWTFIPFNAGPRICIGQQFALTEASYVIVRLLQKYDKIEAAPGELDAPALSNLSLTNCPAIPVTLRLHEAE

 

>CYP52R2 Mycosphaerella fijiensis

60% to CYP52R1 Mycosphaerella graminicola

fgenesh1_pm.C_scaffold_45000005

MQNYILIPLLGVALLTLYKILNIIVTRVQNASRSRQLGCQDPPMFPNCGFLGLKHVKLLQAADEKNMFPDFLEERQDIMN

KETGRVCSTFTSYQLGQTIYFTSDPENIKAILATQFADFDLGPIRHAIMGEVLGEGIFVQDGKPWEHSRAMLRPNFAREQ

ISDLDMEERHVQNLFAALPAQEDGWTAFTNIQQLFFRLTMDASTELLFGESVDSQISENPHITKNKSAAKRHDEAAFAIN

FDQAQLHMAKKFRLVNFHWLHNPKEYQVNNKVVNDFVKYYVDLALQQPSNEKQAEEGAHHGKEKFIFLEALAKETRDPDE

LRGQLLNILLAGRDTTASLLSWLFHLLLRNPHVFSTLRSTIITTFGPYHSPTAPITFSTLKSCQYLQSTLSEVLRLRTIV

PGNSRTANKPTTLPRGGGPDGTSPIFIPAGSPIDYSVHVMHRRKDLWGEDALEFKPERFSGRKSGWEFLPFNGGPRICLG

QQFALTEAGYVVVRVLQRFEGIEGIEGEEEEGAVQTDLGLTSCPKREVRLRLRVAREYV*

 

>CYP52S1 Yarrowia lipolytica

42% to 52H3, 44% to 52F1

CAG81974.1

MLLPLLFAGCVFFFLHQRLNYYRRKQRAYEKWLASGKFGAGQKVADIQVQNNFLRNPFGLVQFVEFLNRTKGAFFVDFVN

QNFQKYGYILPTRTLGKVNIITCDPELIKTVLATNFKDWSIGIRRKAMFPVLGNAIFSVEGDQWTHSRAMLRPQFARDSI

ANVADLERHVTRLINVFRGYGVQSFDCQKYFFQFTLDSASDFLFGESTNSLSVQDDKSESEDTGESFNVLTQQGENAESF

AQAFKVAFTFTAIRLRLQQFYWLLRPSNKKYRDSIDTVHRLVDGYVERALENKEDTDRYIISNQLVKVCDDKKYIRDQLL

GILLAGRNTTAAVLAWIMYESARRPEIWNKMRQEVTDTFSDGPVTSDELRKCVYVRSVINEALRVYPSVPMNQRVAVRDT

FLPTGGGPDGSLPLYCPRGTKVAYSVFALHMREDFYGSDSHIFRPERWNEGVGKGWQYLPFNGGPRICLGQQFALMEASY

TLVRLVQEFDTVELDMEVVDPPPKMSSFSMVHRDGVRIRVK

 

>CYP52T1 Aspergillus terreus

48% to CYP52G2

ATEG_03903.1

MNHPTVLAAILALIYVVYKCVDSISDRRKAKALGCQPVPVLKNRLPLGLDHAYRAFQAIKAGQMPDHQVQVYKEVGRRTF

AGSSLGASYIHTVEPKNIQAILATQFHDFELGDLRRKVFFPLLGNGIFTSDGKAWEHSRAMLRPQFTRGQVADLELEERH

VQELFRLMPTDQSGWTQQINLTPMFFRLTIDSATEFLFGVTVHSQRHTSSQQPATDTDAFPWKDLARHFDESTKHLGVRS

LFQELYFLYNPSSFRNNIKEIHRFADFCIQQGLQRLDQQKSSAAQRYIFLDELLKVTRDPVEVKSQLLNILIAGRDTTAG

LLSWTFWLLAQHPAVYSKLRARVLEDFGPDAGRPDRITFAALKACTYLQHVMSEVLRLFPAVPLNARRAARDTTLPLGGG

PDGKAPVFVKKGHEVGYSVYVTHRLEEYWGPDAARFNPDRWVDRKHGWDYLPFNGGPRICLGQQFALTEAGYVIVRLLQR

FDQVELAEPATAPSHNYGITDAPHDYMIYLHEAGSKGG*

 

>CYP53A1 Aspergillus niger X52521

MLALLLSPYGAYLGLALLVLYYLLPYLKRAHLRDIPAPGLAAFT

NFWLLLQTRRGHRFVVVDNAHKKYGKLVRIAPRHTSIADDGAIQAVYGHGNGFLKSDF

YDAFVSIHRGLFNTRDRAEHTRKRKTVSHTFSMKSIGQFEQYIHGNIELFVKQWNRMA

DTQRNPKTGFASLDALNWFNYLAFDIIGDLAFGAPFGMLDKGKDFAEMRKTPDSPPSY

VQAVEVLNRRGEVSATLGCYPALKPFAKYLPDSFFRDGIQAVEDLAGIAVARVNERLR

PEVMANNTRVDLLARLMEGKDSNGEKLGRAELTAEALTQLIAGSDTTSNTSCAILYWC

MRTPGVIEKLHKALDEAIPQDVDVPTHAMVKDIPYLQWVIWETMRIHSTSAMGLPREI

PAGNPPVTISGHTFYPGDVVSVPSYTIHRSKEIWGPDAEQFVPERWDPARLTPRQKAA

FIPFSTGPRACVGRNVAEMELLVICGTVFRLFEFEMQQEGPMETREGFLRKPLGLQVG

MKRRQPGSA

 

>CYP53A2     Aspergillus parasiticus

            GenEMBL AC005991

            Lewis,J., Kupfer,D., Keller,N. and Roe,B.A.

            Aspergillus parasiticus Cosmid Clone ap0

            Unpublished

            57% to CYP53A3

27896 MLLDLYLVKCLFCPL

27941 VPIVALGLLVAYYVAGYLKQWHLHDLPGPFIAGFSRIWLILQVRQGYRSLVVNDLHRRCG 28120

28121 KIVRLAPNHISVADESAIQAIYGHGNGFLK 28210 intron

28267 SNFYNAFLNVDWSIFTTRSRAEHTRKRKIVSHAFSARSLAQVEQYAHNTMELLVRQWQ 28440

28441 KMVDSQEGLDDPYAVIDARVWCNYLTFDIIGDLAFGAPFGMLERGNAIVSMRKALEDAAV 28620

28621 TLDAVEVLNHRGDVSAALGICPDLIPYAKWLPDLFFRQGAEAIANVADVAGAAVDRRLKM 28800

28801 NTSMTEKRGDLLAHLIDAEDQAGAKLGYRELTGEAVTLIAAGSDTSSSTLCALLYWVSTT 28980

28981 PRVLWKLQNVLDEVIPVDVEVPYLAMVKKI 29070 intron

29117 PSLQWVIWEALRIHSTFGQGLPREVPPERGPVEICSHTFYPGDVLSVPGYTMHHSVDIWG 29296

29297 IDVEDFVPERWDPCRLTQRQKDSFIPFSEGPRACIGRNLAEMEFFVGCATLFRLFEFRVE 29476

29477 GQGPLEVREGWLRKPVSLQVGIRRRYLDVRSS* 29575

 

>CYP53A3 Aspergillus nidulans AN7589.1 64% to 53A4 53 clan

MITDFLTPE

NITPERIALALLGLLAAYYVVPYLQTWRLSDIPAPGLAAWTNFWLLLQTR

LGHRFISVDNAHKKYGKLVRIAPRHISIADDAAIQAVYGHGNGFLKSDFY

DAFVSIRRGLFNTRDRAEHTRKRKTVSHTFSAKSIGQFEQYIHHNIENLV

KQLTRISNLQRNPKNGYATVDALNWFNFVAFDIIGDLAFGAPFGMLDKGQ

DIAEMRKSPDSPPQYVQAVEVLNRRGEVSATLGCYPALKPFAKYLPDRFF

RDGLEAVENLAGIAIACVNERLKPEVMANNTRVDLLARLMEGKDANGNKL

GRAELTAEALTQLIAGSDTTSNTSCAILYYCLRTPGVIDKLHKVLDEAIP

QDVEVPTHAMVKEIPYLQWVIWETMRIHSTSAMGLPREIPEGNPPVEISG

HIFKPGDILSVPTYTIHHSKEIWGADADEFIPERWAPERLTARQKAAFIP

FSTGPRACVGRNVAEMELLVICSTVFRMFDWELQQKGPMETREGFLRKPL

GLTVGVKRRTIV*

 

>CYP53A4 N. crassa AABX01000266.1 cont3.41 NCU01086.1 (version3)

243627 MAIISLLMSPWAPVVLLAGVAFYYLVPYFVTYSALRK

IPSPFPAQFTDLWLLSVCRRGNRYQRVDELHKKLGPVVRIQPNH

VSICDDAAIPTIYGHGNGFLN (2) 243932

243994 DFYDAFVSIRRGLFNTRDRAEHT

RKRKIVSHTFSAKSVQQFEPYMHSNLELFVKQWDSMIKNSKNPDKAAHLD

CLEWFNYLAFDVIGDLSFGQPFGMLSSGADMAEIRSSPDAAPIYAPAIEI

LNRRGEVSATLGIHPALKPFAKYLPDPFFTKGLAAVENLAGIAIACVKSR

LDNPPPVTRKDLLQRLMEGRDEKGEPLGREELTAEALTQLIAGSDTTSNS

SCALLFHAVRTPGVMQKLQAELDANIPPEVDVPTYDMVKELPYLEAVINE

VLRFHSTSGIGLPRQIPHDASQGVHIQGYYLPPGTVLSVPTYSIHHSKEI

WGPDADEFKPERWERLTARQKNAFIPFSHGPRSCVGRNVAEMEMKLIVAT

WARRYEVKLLQDYMDTREGFLRKPLGLKVGLKLRK* 245220

 

>CYP53A5 Magnaporthe grisea MG07977.4  69% to CYP53A4 (split on two contigs)

AACU01000984.1 cont2.1481 runs off end, changed C-term

AACU01000983 cont2.1480 = N-term

 89 MAIVNLVFTPLGLASLGAFMLVAYYVVPYFTTFGHLRSIQPASPLAGFSNLWLLYTSRVG 268

269 KRSLLVDEAHARLGPVLRVQPNHVSIADDEAINIIYGHGNGFLKSSFYDAFVSIRRGLFN 448

449 TRDRAEHTRKRKLISHTFAPKSVGQFEPYIHGNLELFAKKWDELIERTKKSDGWAPVECL 628

629 QWF 634

XXXXXXXXXXXX

2 FGAPFGMLNAGADIAEVRMSVDSEPIYAPAVEILNRRGEVSATLGTLPELKPYAGY

LPDSFFSKGLAAVQNLAGIAIARVKSRLENPPDVNRKDLLARLQEGRDAK

GEPLGFEELTAEALTQLIAGSDTTSNSSCALLYWTARTPGVLAKLQAELD

AAIPDGVFAPAFDMIRNLPYLEAVINETLRIHSTSGIGLPRQIPADSPGV

TIRGQYYPPGTVLSVPTYTIHHSKEIWGPDADEFRPERWIENGGLTDRQK

NAFIPFSYGPRACVGRNVAEMEMKMIAATWARRYDVEVRQDVME

VREGFLRKPLALEIGLKRRS*

 

>CYP53A6 Fusarium graminearum FG08079.1 AACM01000324 FGcontig1.324_scaffold5

MAMFTVLPLIWLAPLGLISLFFYYIIPYFWNYRHLRSIPGPLFARLSNWW

LVYACREKSRWKYVNDAHTRYGPVVRIQPNHVSIANEEVINAIYGHGNGM

LKSSFYDASVITTYSIFTSRDRAEHSRKRKVVSHSFAPQSMRNFEPFIQQ

HLNVFLQKWDAMAANEAKFDGYADVESRVWLNYLVLDIIGDLAFGAPFGV

LAKGSEVVDFETEKGPSSLPVITSLSTRSEIAATVGALPELKPYLKWSPD

PFFRTGFNGMINLRTLGTSRITDRLNNPPGDEREKDLLERVREGRDHKGQ

PFGKGELIAEALTVLIAGTDTTSSTMAALLYHVVRTPGVLKKLQAELDEA

IPADVSIPSFEMVKNLKYLGFVVNEALRHHSTISLGLPRLVPENGNGVTI

AGYHFAPGTVLSIPIYTVHHLKEVWGPDADEFKPERWEDVTQRQKQAFIP

FSHGPRACLGRNLAEMELKVITATWARRYDLIMRDDTMEILEGLARKPEA

VNVGIRRRM*

 

>CYP53A7 Fusarium graminearum FG08086.1 AACM01000324 FGcontig1.324_scaffold5

MAITELLVSPW

APVALVVAFVAWYILPWVSNKDLRGIPAPFPAQFSNLWLLSTCRRGKRYE

IVDQVHKKLGPLVRIAPNHVSVADADAINTIYGHGNGFLKADFYDTFVSI

RRGLFNTRDRAEHSRKRKIVSHTFAPKSVLEFEPYIRQNLEIFVKQWDRI

SSNKERDGYGRVDCLNWFNFLAFDIIADLAFGKPFGMLASGADIAEVKAS

PTSPTIYAPAVEIMNRRGEVSATLGCLPQLKPYAKYLPDPFFSQGLQAVE

NLAGIAIARVSERLERGGDSTRKDLLARLMQGRDEKGEPLGRDELTAEAL

TQLIAGSDTTSNSSCALLYHIVRTPGVMKKVYEEISAVMPDGVDIPDFES

VKHLPYLGYCINETLRIHSPSGIGLPREVPPNHKGVTIHGRYFGPGTVLS

VPTYTIHHSTEIWGPDADDFKPERWETLTDKQKSAFIPFSYGPRSCVGRN

LAEMQMRMIAATWIKRYDVVLRQDVMETREGFLRKPMGLDVGLARR*

 

>CYP53A8 Fusarium graminearum FG10451.1 AACM01000435 FGcontig1.435_scaffold7

MAIVDLLFTWWSLPIAAGLVAASYLYSYFITYGHLRDIPAPFPAQFSNLW

LLYVCRRGERYRVVDQIHKELGPVVRIQPNHTSIADAEAIATIYGHGNGF

LKSEFYDAFVSIRRGLFNTRDRAEHTRKRKLISHVFSAKSISQFEPYIHA

NLELFVKQLDKLVASGQMAKNGKREALMDCLPWFNYLAFDVIGDLAFGVP

FGMLASGADVAEVRDTPDSPPIYASAIEILNRRGEVSATLGCFPQLKPYA

QYLPDPFFSNGLNAVKNLAGIAIARVKNRLDNPPSIERMDLLARLMEGRD

EKGEPLGREELTAEALTQLIAGSDTTSNSSCALLYHVTRTPGVLEKLQSE

LDNAIPSEVSVPTYDMVRDLPYLANVINETLRYHSTSGIGLPRQIPPNSP

GVTIKDHFFPPGSILSVPTYTLHHSKEIWGADADDFRPERWENPTELQKT

AFNPFSHGPRACVGRNVAEMEMKLIAATWARRYVPELRQGVMETREGFLR

KPLGLDIALMMRE*

 

>CYP53A10 Nectria haematococca fgenesh1_pg.scaffold_37000003

Necha1/scaffold_37:6771-8451

59% to fgenesh1_pg.scaffold_12000228,

83% to Fusarium graminearum  CYP53A7

FG08086.1 AACM01000324 FGcontig1.324_scaffold5

Note: this seq has two more introns than the CYP53A8 ortholog

This gene model seems correct DRN 2/4/06

MALINLLISPWAPVALVVLFVGWYLVPYFGANRGLRGIPAPFPAQFSNLWLMSTCRRGKRFEVVDQVHKR

LGTVVRIAPNHVSIADADAINVIYGHGNGFLKS (2)

DFYDPFVSIRRGLFNTRSRAEHSRKRKIVSHTFAPKSVLEFEPYIHQNLDLFVKQWDRASSNPEADGAGRLDCLSW (1)

FNYLAFDVIADLAFGKPF (1)

GMLATGADIAEVK

ASPTSPAIYAPAVEIMNRRGEVSATLGCMPWLKPYAKWLPDPFFSQGLQAVENLAGIAIARVSERLERGA

DTTRKDLLARLMQGRDEKGEPLGRDELTAEALTQLIAGSDTTSNSSCALLYHVVKTPGVLQKLQQEIDEA

TADEGVIPSYESVKHLPYLGMCINETLRHHSPSGIGLPREIPAKSKGVTLHGRYFGPGTVLSVPTYTVHH

STEIWGPDAEEFKPERWENITDKQKIAFIPFSHGPRSCVGRNLAEMQMRLIAATWIKRYNIFLRQEKMET

REGFLRKPLGVEIGVSRR*

 

>CYP53A11 Nectria haematococca fgenesh1_pg.scaffold_12000228

Necha1/scaffold_12:587439-589032

84% to Fusarium graminearum  CYP53A8

FG10451.1 AACM01000435 FGcontig1.435_scaffold7

64% TO 53A1 Aspergillus niger

This gene model seems correct DRN 2/4/06

MAIVDLLLSWWTLPIGVAVLVGTYLYAYFVTYGYLRGIPAPFPAQFSNLWLLYVCRRGERYDVMDKIHKK

MGPVVRIQPNHVSIADDEAIPIIYGHGNGFLKS (2)

EFYDAFVSIRRGLFNTRDRAEHTRKRKLISHTFSTKS

ISQFEPYIHSNLELFVKQLDKLITSGTTKDNQGHQQALIDCLPWFNYLAFDVIGDLAFGAPFGMLANGAD

VAEVRATPESPPIYASAIEILNRRGEVSATLGCFPQLKPYAKWLPDPFFSNGLNAVQNLAGIAIARVKAR

LDNPPPEERMDLLARLMEGRDEKGEPLGREELTAEALTQLIAGSDTTSNSSCALLYHVTRTPGVLEKLQA

ELDASIPSHVSVPTFDMVRDLPYLNCVINETLRYHSTSGIGLPRQVPEGSPGVTIRGHFFPAGSVLSVPT

YSIHHSKEIWGPDADDFKPERWEDVTPRQKNAFIPFSHGPRACVGRNVAEMEMKLIAATWARRYNVELKQ

EIMETREGFLRKPLGLDIALKIR*

 

>CYP53A12 Aspergillus fumigatus Af293

EAL93820 XP_755858 cytochrome P450 benzoate 4-monooxygenase

join(<2165575..2165876,2165928..2166734,

                     2166796..>2167246)

85% to CYP53A1

MITDLLSLQNAGLILLGLIAVYYVIPYLQKWHLHDIPSPRFAAFSNLWLLLQARRGRRFLKVDEAHKKYG

KLVRIAPKHVSIADDAAIQAIYGHGNGFLKADFYDAFVSIRRGLFNTRDRAEHTRKRKTVSHTFSMKSIG

QFEQYIHQNVELFVQQWTKLAKLNGNPRSGYATIDALNWFNYLAFDIIGDLAFGAPFGMLEKGKDIAEMR

KTPDSEPTYVQAVEVLNRRGEVSATLGCLPRLIPYAKYLPDRFFKDGVQAVENLAGIAVARVNERLKPEV

MEKNTRVDLLSRLMEGKDSNGNKLGREELTAEALTQLIAGSDTTSNTTCAILYWCMSTPGVIPKLQKVLD

EAIPDDVDVPTHAMVKDIPYLQWVIWETMRIHSTSAMGLPREIPPGNPPVTISGHTFYPGDVVSVPSYTI

HRSKEIWGPDAEKFVPERWDPARLTARQKAAFIPFSTGPRACVGRNVAEMELLVMTGTIFRLFEFEMQQD

GPMETREGFLRKPLGLIVGMKRRAVHASV

 

>CYP53A12 Neosartorya fischeri

96% to CYP53A12 Aspergillus fumigatus = ortholog

NFIA_090480

MITDLLTPQNTGFILLGLIAAYYIVPYLQKWHLHDIPSPSFAAFSNLWLLLQARRGRRFLKVDEAHKKYGKLVRIAPRQV

SIADDAAIQAIYGHGNGFLKSDFYDAFVSIRRGLFNTRDREEHTRKRKTVSHTFSMKSIGQFEQYIHQNVELFVQQWTKL

AKLNGNPRSGYATIDALNWFNYLAFDIIGDLAFGAPFGMLEKSKDIAEMRKAPDSDPTYVQAVEVLNRRGEVSATLGCLP

RLIPYAKYLPDRFFKDGIQAVENLAGIAVARVNERLKPEVMEKNTRVDLLSRLMEGKDSNGNKLGREELTAEALTQLIAG

SDTTSNTTCAILYWCMSTPGVIPKLQKVLDEAIPDDVDVPTHAMVKDIPYLQWVIWETMRIHSTSAMGLPREIPPGNPPV

TISGHTFYPGDVVSVPSYTIHRSKEIWGPDAEEFVPERWDPARLTARQKAAFIPFSTGPRACVGRNVAEMELLVMTGTIF

RLFEFEMQQDGPMETREGFLRKPLGLIVGMKRRAVHASV*

 

>CYP53A13  Aspergillus oryzae

          GenEMBL BAE60506.1

          58% TO CYP53A14, 81% to 53A3

MIAELLTPTGAAYVLTAAVIVYYILPYLQLWRLRDIPSPGFAAFSNLWLMLQYRKGNRFVTVDNAHKKYG

KLVRIAPRHVSIADDEAIQAIYGHGNGFLKADFYDAFVSIRRGLFNTRDRAEHTRKRKTVSHTFSMKSIG

QFEQYIHGNAELFVKQWNRIADTQSNPKTGYATIDALNWFNYLAFDIIGDLAFGAPFGMLEKGQDIAEMR

KSPNDKPSYVQAVEVLNRRGEVSATLGACPSLIPWAKYIPDRFFRDGLEAVENLAGIAVARVNERLRPEV

MANNTRVDLLARLMEGKDSNGNKLGREELTAEALTQLIAGSDTTSNTSCAILYWCLRTPGVIEKLHKVLD

ESIPKDVDVPVHAMVKDIPYLQWVIWETMRIHSTSAMGLPREIPAGNPPVTISGHTFYPGDVVSVPTYTI

HRSKEIWGPDAEQFVPERWDPKRLTARQKAAFIPFSTGPRACVGRNVAEMELLVIVGTVFRLFDFEIQQD

GPMETREGFLRKPLGLMVGMKRRSVAV

 

>CYP53A13 Aspergillus flavus

99% to CYP53A13  Aspergillus oryzae, 1 aa diff, N-term extension deleted

AFL2G_03223

MIAELLTPTGAAYVLTAAVFVYY

ILPYLQLWRLRDIPSPGFAAFSNLWLMLQYRKGNRFVTVDNAHKKYGKLVRIAPRHVSIADDEAIQAIYGHGNGFLKADF

YDAFVSIRRGLFNTRDRAEHTRKRKTVSHTFSMKSIGQFEQYIHGNAELFVKQWNRIADTQSNPKTGYATIDALNWFNYL

AFDIIGDLAFGAPFGMLEKGQDIAEMRKSPNDKPSYVQAVEVLNRRGEVSATLGACPSLIPWAKYIPDRFFRDGLEAVEN

LAGIAVARVNERLRPEVMANNTRVDLLARLMEGKDSNGNKLGREELTAEALTQLIAGSDTTSNTSCAILYWCLRTPGVIE

KLHKVLDESIPKDVDVPVHAMVKDIPYLQWVIWETMRIHSTSAMGLPREIPAGNPPVTISGHTFYPGDVVSVPTYTIHRS

KEIWGPDAEQFVPERWDPKRLTARQKAAFIPFSTGPRACVGRNVAEMELLVIVGTVFRLFDFEIQQDGPMETREGFLRKP

LGLMVGMKRRSVAV*

 

>CYP53A14  Aspergillus oryzae

          BAE56637.1

          56% to 53A3

MDGDSCPSCCSTCTSLNVFLCPHIPILTLGLLLVYYVTGYLKRWHLRDIPGPFIAGFSRIWLIVQVRQGY

RSLVVHDLHRRYGKIVRLAPNHISIADESAIQAIYGHGNGFLETDFYNAFLNVDWSIFTTRSRAEHTRKR

KIVSHAFSARSLAQVEQHAHNNMEHLVRQWRKMIDSEEGLDDPYAVIDARVWCNYLTFDIIGDLAFGAPF

GMLERENATVSMRKAPENPEVTLDAVEVLNHRGDVSAAFGICPDLIPYAKWLPDPFFRQGAEAIANLAGV

AGAAVDRRLKMDTSMTEKRGDLLALLIDAEDQAGAKLGHRELTGEAVTLIAAGSDTSSSTLCALLYWVSS

TPRVLWKLQNVLDEVIPVDIEVPYLAMVKKITYLQWVIWEALRIHSTFGQGLPREVPPERGPVEICGHTF

YPGDVLSVPGYTMHHSADIWGIDVEDFVPERWDPRRLTQRQKDSFIPFSEGPRACIGRNLAEMELFVGCA

TLFRLFEFRVEGQGPLKVRERWLRKPVSLQVGIRRRYLDARSS

 

>CYP53A15  Cochliobolus lunatus Nada Krasevec

           EU597483

           65% to CYP53A1

MFLTSLLLTPYTILLLPVLFYLLPYLRNWRIRDIPAPFPAAWTNLWLLYQCRRGRRFLAVHEAHQKLGKLVRIQPNHVSIADADAITQVYGHGNGFLKSEYYDAFVSIRRGLFNTRDRAEHTRKRKTVAHTFSAKSVLQFEQYIHHNLQELQNQWDRRAESVKGGWYEMDALNWFNYLAFDVIGDLAFGEPFGMLKKGRDEAEVARGGKITYAPAIEVLNRRGEVSGTVGIFPAIKPYAKYFPDPFFSQGMKAVENLAGIAIARVNARLEKPSDRVDLLARLMEGRDENGNKLGREELTAEALTQLIAGSDTTSNTSCALLYHCLQHPEVVQKLQNELDAALPNPDAVPSYAQVKDLPYVDAVIKETMRIHSTSSLGLPRVIPPGPGVTILGRHFPQGTVLSVPAYTIHHSTEIWGPDADTFRPERWEKVTEQQKAAFIPFSYGPRACVGRNVAEMELALIVATVFRRYEFELRQGEMETREGFLRKPLALQVGMRKRSFA

 

>CYP53A16 Mgr055 Mycosphaerella graminicola

64% to CYP53A11   Nectria haematococca

MFLSVLFTPWALVVLPVLYFVLPFLRNWSIMDVPGPFLAKFTTLWYMYECRRCRRYLTVHKLHEKYGKFIRVQPNHVSIADPEAIPIVYGHGTGTLKSEYYDAFVSIQRGLFNTRNRAEHTRKRKTVSHTFSAKSVGQFEQYIHHNLELLAKRWDELSEKSSGGYARFDALHWFNYVAFDIIGDLAFGAPFGMLERGADMAEVQLTPDGPPTYAPAIEVLNRRGEVSNAVGCWPQIKPYAKYLPDPFFSKGMAAIANLAGIATARVNARLAAAEKGEINRVDLLARLMEGKDENGEKLGRAELTAEALTQLIAGSDTTSNTSCALLYHCLTKPNVVKKLQAELDEALPSNDVPTFDQVKDLKYLDMVIQETLRIHSTSSQGLPRQIPAGDGLDVAGRHFPQGTVLSVPAYVMHHSKEIWGPDADEFRPERWEKVTERQKSAFIPFSYGPRACVGRNVAEMELALIVSTVFRRYEFELHQDELETREGFLRKPLGLEVGMRKRDH

 

>CYP53A17 Uncinocarpus reesii

74% to CYP53A1   Aspergillus niger

model has some missing seq (added back)

UREG_05168.1

MLLAFLFNPYIIAGFTICYFYIVPYLQRWDLRDIPAPFPASLSHLWLLYQSRKGKRYQAVHNAHGKYGKLVRIQPNHVSV

ADADAIQTIYGHGNGFLKSEYYDAFVSIRRGLFNTRNRAEHTRKRKTVSHTFSAKSIGQFEQYIHANLQLFLQQWTQICD

LQRNPRSGYASIDALNWFNYLAFDIIGDLAFGAPFGMLSKGRDVAEMKKSPNSPASYVPAIQVLNRRGEVSATLGCFPAL

KPFAKYLPDRFFRDGLEAVENLAGIAVARVAERLRPEVMAKNTRVDLLSRLMEGRDETGAKLGREELTAEALTQLIAGSD

TTSNTSCAMLYWVLRTPGVIEKLQEVLDEAIPAHVEVPTFSMVKDIPY (2)

LQWVILETMRIHS

TSSLGLPREIPQGSPPVTIQGHVFHPGTILSV

PAYTIHHSSEIWGPDVEEFVPTRWDPARLTAQQKAAFIPFSHGPRACVGRNVAEMELHCIAATVFKNFEFQLEQNGPMET

SEGFLRKPLGLLVGIKRRQLDPVVN

 

>CYP53A18 Coccidioides immitis

90% to CYP53A17

CIMG_09108.2

MLLSFLFNPYVLAGIFIFVFYIVPYLRLSYLRDIPSPFAAGFSNLWLLYQCRRGKRYQAVHDAHKKYGKLVRIQPDHVSV

ADADAIQTIYGHGNGFLKSEYYDAFVSIRRGLFNTRSRAEHTRKRKTVSHTFSAKSVGQFEQYIHANLQLFFQQWTNISE

VQRNPKSGYASIDALNWFNYLAFDIIGDLAFGAPFGMLSKGRDVAEMRKSPDSPASYVPAIQVLNRRGEVSATLGCFPAL

KPFAKYLPDKFFRDGLEAVEHLAGIAVARVSERLRPEVMAKNTRVDLLSRLMEGRDETGAKLGREELTAEALTQLIAGSD

TTSNTSCAMLYWVLRTPGVIEKLQEALDEAVPAHVNVPSFSMVRDIPYLQWVIWETMRIHSTSSLGLPREIPPNSPPVTI

EGHVFHPGTILSVPAYTIHHSPEIWGPDVEEFVPTRWDPARLTPRQKAAFIPFSYGPRACVGRNVAEMELHCIAATVFKN

FEFRLEQDGPMETSEGFLRKPLGLMVGIRRRQPNLN

 

>CYP53A19 Fusarium oxysporum

90% to CYP53A8

FOXG_04952

MAVVDILFTWWSIPIAACVLIATYLYSYFVTYGHLRDIPAPFPAQFTNLWLLYVCRRGGRYRVVDEIHKRLGPVVRIQPN

HTSIADPDAIATIYGHGNGFLKSDFYDAFVSIRRGLFNTRDRAEHTRKRKLISHVFSAKSISQFEPYIHANLELFVKQLD

KLVASGQTTDKNGKRQALIDCLPWFNYLAFDVIGDLAFGVPFGMLANGADVAEVRETPDSAPIYASAIEILNRRGEVSAT

LGCWPQLKPYAQWLPDPFFSNGLNAVKNLAGIAIARVKARLDNPPSVERKDLLARLMEGRDEKGEPLGREELTAEALTQL

IAGSDTTSNSSCALLYHVTRTPGVLEKLQAELDEAIPADVSVPTYDMVRDLTYLNNVISETLRYHSTSGIGLPRQIPDNS

PGVTIKGHYFPPGSVLSVPTYTLHHSKEIWGSDADDFKPERWDSVNNLQKTAFNPFSHGPRACVGRNVAEMEMKLIAATW

ARRYTPELKQEVMETREGFLRKPLGLDIALKMR*

 

>CYP53A19 Fusarium verticillioides

98% to CYP53A19 Fusarium oxysporum = ortholog

FVEG_03183

MAVVDILFTWWSIPIATGVLIATYLYSYFVTYGHLRDIPAPFPAQFTNLW

LLYVCRRGERYRVVDGIHKRLGPVVRIQPNHTSIADPDAIATIYGHGNGF

LKSDFYDAFVSIRRGLFNTRDRAEHTRKRKLISHVFSAKSISQFEPYIHA

NLELFVKQLDKLVASGQTTDKNGKRQALIDCLPWFNYLAFDVIGDLAFGV

PFGMLANGADVAEVRATPDSAPIYASAIEILNRRGEVSATLGCWPQLKPY

AQWLPDPFFSNGLNAVKNLAGIAIARVKARLDNPPSVERKDLLARLMEGR

DEKGEPLGREELTAEALTQLIAGSDTTSNSSCALLYHVTRTPGVLEKLQA

ELDEAIPADVSVPTYDMVRDLTYLNNVISETLRYHSTSGIGLPRQIPDNS

PGVTIKGHYFPPGSVLSVPTYTLHHSKEIWGPDADDFKPERWDSLNELQK

TAFNPFSHGPRACVGRNVAEMEMKLIAATWARRYTPELKQEVMETREGFL

RKPLGLDIALKMR*

 

>CYP53A20 Fusarium oxysporum

92% to CYP53A7

FOXG_02776

MAITELLISPWAPLALAVALVAWYILPWISNSNLRGIPAPFPAQFTNLWLLSTCRRGKRYEIVDQVHKKLGVLVRIAPNH

VSVADADAINTIYGHGNGFLKA

DFYDTFVSIRRGLFNTRNR

AEHSRKRKLVSHTFAPKSVLEFEPYIRQNLDIFINQWDR

IASNKDADGYGSVDCLNW

FNFLAFDIIADLAFGKPFG

MLSTGADIAEVKASPTSPTIYAPAVEIMNRRGEVSATLGCLPQ

LKPYAKYFPDPFFSQGLQAVENLAGIAIARVSERLERGGDSTRKDLLARLMQGRDEKGEPLGRDELTAEALTQLIAGSDT

TSNSSCALLYHVVRTPGVMQKLYEEISAVVPEDVAIPDYESVKHLPYLGYCINETLRIHSPSGIGLPREIPPNHKGVTLH

GRYFGPGTILSVPTYTIHHSTEIWGPDADEFKPERWENLTDKQKTAFIPFSYGPRSCVGRNLAEMQMRLIATTWIKRYDV

RLRQDIMETREGFLRKPMGLDVGLARR*

 

>CYP53A20 Fusarium verticillioides

97% to CYP53A20 Fusarium oxysporum = ortholog

FVEG_01611

MALTELLISPWAPLALAVALVAWYILPWISNSNLRGIPAPFLAQFSNLWLLSTCR

RGKRYEIVDQVHKKLGVLVRIAPNHVSVADADAINTIYGHGNGFL

KADFYDTFVSIRRGLFNTRDR

AEHSRKRKIVSHTFAPKSVLEFEPYIRQNLDIFINQWDRIASNKEADGYGSVDCLNW(1)

FNFLAFDIIADLAFGKPF (1)

GMLSTGADIAEVKVSPTSPTIYAPAVEIMNRRGEVSATLGC

LPQLKPYAKYLPDPFFSQGLQAVENLAGIAIARVSERLERGGDSTRKDLLARLMQ

GRDEKGEPLGRDELTAEALTQLIAGSDTTSNSSCALLYHVVRTPG

VMQKLYEEISAVVPEDVAIPDYESVKHLPYLGHCINETLRIHSPSGIGLPREIPPNH

KGVTLHGRYFGPGTVLSVPTYTIHHSTEIWGPDADEFKPERWE

SLTDKQKNAFIPFSYGPRSCVGRNLAEMQMRLIAATWIKRYDVRLRQDIMETREGFLRKPMGLDVGLARR*

 

>CYP53A21 Aspergillus clavatus

90% to CYP53A12

ACLA_074210

MITEILTPQNTGYVLLGLLTAYYIIPYLQTWHLHDIPSPGFAAFSNLWLLLQARQGHRFLKVDEAHKKHGKLVRIAPGHI

SIADDGAIQAVYGHGNGFLKADFYDAFVSIRRGLFNTRDRAEHTRKRKTVSHTFSTKSIGQFEQYIHHNIELFVKQWTKL

SKLNGNPRSGYATIDALNWFNFLAFDIIGDLAFGAPFGMLEKGKDFAEMRKTPDSPPTYVEAIEVLNRRGEVSAALGCFP

RLIPYAKWIPDRFFKDGLQAVENLAGIAVARVNERLKPEVMANNTRVDLLSRLMEGKDSNGNKLGREELTAEALTQLIAG

SDTTSNTACAILYWCMQTPGVITKLQKVLDEAIPADVDVPTHSMVKEIPYLQWVIWETMRIHSTSSMGLPREIPPGNPPV

TISGHVFYPGDVVSVPSYTIHRSREIWGPDAEQFVPERWDPARLTPRQKAAFIPFSTGPRACVGRNVAEMELLVMTATVF

RLFEFEMQQDGPMETREGFLRKPLGLIVGMKRRAAHASV*

 

>CYP53A22 Aspergillus terreus

85% to CYP53A12

ATEG_07877.1

MIADLAAINPAYLLLAAVAAYYIVPYLKRWHLRSIPTPSVAGFTNLWLLIQARRGNRFEVVDNLHKKHGKLVRLAPRHVS

IADDAAINAIYGHGNGFLKALSDFYDAFVSIRRGLFNTRDRAEHTRKRKTVSHTFSMKSIGQFEQYIHHNIELFVKQWTR

LSETQGNPRSGYATIDALNWFNFLAFDIIGDLAFGAPFGMLEKGQDIAEMRKSADAAPTYVQAVEVLNRRGEVSATLGTL

PALIPYAKYIPDRFFKDGIQAVENLAGIAIARVNERLRPEVMANNTRVDLLARLMEGKDANGNKLGREELTAEALTQLIA

GSDTTSNTACAILYWCMSTPGVIDKLHKVLDEAIPADVDVPTHSMVKDIPYLQWVIWETMRIHSTSAMGLPREIPAGSPP

INISGHVFYPGDVVSVPSYTIHRSREIWGPDAEKFVPERWDPARLTPRQKAAFIPFSTGPRACVGRNVAEMELLVMAGTV

FRLFDFEMQQKGPMETREGFLRKPLGLIVGMKRRTPA

 

>CYP53A23 Mycosphaerella fijiensis

88% to CYP53A16   Mgr055 Mycosphaerella graminicola

estExt_fgenesh1_pm.C_10348

MFLSFLFTPWALLASPFLFYLLPFLRNWSIRDVPGPFLAKFTTLWYMYECRRCRRYYTVYKLHEKYGKFVRVQPNHVSIA

EPEAIPIIYGHGTGFLKSEYYDAFVSIQRGLFNTRDRAEHTRKRKTVSHTFSAKSVGQFEQYIHHNLELLAKRWDEIAKN

TGAGKYTRFDALHWFNYVAFDIIGDLAFGAPFGMLEKGADIAEVQLNPDGPVTYAPAIEVLNRRGEVSNAVGCWPAIKPY

AKYLPDPFFSKGMEAIANLAGIATARVNQRLAAAERGEIDRVDLLARLMEGKDENGNKLAKAELTAEALTQLIAGSDTTS

NTSCALLFHCLKNPHVVKKLQAELDEALPSDDVPTYEQVKNLQYLDQVISETLRIHSTSSQGLPRVVPPGDGVEVAGRHF

PPGVVLSVPAYVMHHSKEIWGPDADEFRPERWEKVTERQKLAFIPFSYGPRACVGRNVAEMELALIVATVFRRYEFELYQ

DELETREGFLRKPLGLQVGMRKRS*

 

>CYP53B1 Rhodotorula minuta D63703

MGIVQEAAAFVGSLTAVQLAGAFAALVLAFHVVPYILDPHGLRK

YPAAGPFGIAAFTDAWVVWQARRGKRFEALDKAHRKYGKYVRISPRQVSIADPKALDT

IYGHGTGTMKPAFYDAFVGLKNVRGLFNTRDRAEHTRKRKIVSATFAQRNVLEFEPYI

ASVMRQLLNKWDAMCDKAVKDGKGWVTLDTLTWLNFLAFDIIGDLAFGAPFGMVEREA

DICEIEQEDGSIKHLPAVTILNERGEYSNCLGVMPPHWRPFSKYVDPWFSRGHASVIN

LAGMARARVNARLKSGAGDRKDLLARLQEARDESGNPMDIDELTAEALTQLIAGSDTT

SNSSCAIIFYLARNQDAQKKLQAELDKTFKDRGISGVMEYEDIKTLPYLEACINEALR

MHSTSSMGLPRVMPAQGADFQGEHFKEGTEVSVPAYTIHHLESIWGDPFNYRPERWLG

SDAKQLEKSFIPFSIGPRSCVGRNLATMELLVFMSTLFYRYDFKLADENQTKLETSEG

FLRKPLESWIKMRRRSIDA

 

>CYP53B2 Sporobolomyces roseus

57% to CYP53B1   Rhodotorula minuta, estExt_fgenesh1_pg.C_30339

MTQSHVFTDFFEPTTLAVYFLAAPLGAVFLYLFVPHFTSLAPLRRFPGPFWAGYTRLWLARTARVGKRSELVHREHLKHG

KFVRIGPNEVSIADPAALPIVYAHGSGSIKADFYDAFVASPVRGLFNTRNRAEHTRKRKIVSHTFAPKSVREFEPYIAST

VNLLLKKWDQLAAKAQKSPPSGTGGERMKGYAVIDSLDWFNALAFDVIGELAFGTPFGMVERDAADIVTITKEDGTVIHA

GGVQILNMRGEYSATLGCLPPWSRKYMKYIDPWFARGLESVKNLTGIARTRVNDRLEKGALDRKDILSHLQAGRDENGQP

MSKDELTMEALTQLIAGSDTTSNSSCAILFQIVSTPHAHKKLQQELDEAFSGKGMSGVLEYEDVKALPYLGACINEALRR

HSTSGIGLPRIMMDDTEVLGEVFPKGTVLSVPSYTIHWSTEFWGPDAAEFKPERWLESEEKTRQLEKQLNVFSFGPRSCV

GRNVAMIELFCFMATLVYRYDFKLVDPNQKELEVVEGFLRKPTGCQIGFKLRDATQ

 

>CYP53B3 Puccinia graminis f. sp. Tritici

54% to CYP53B2 from LNRYP

PGTG_08085 +  PGTG_08086 revised

MLVIGLIAAFLEYSILLGLVGISCYYLTGYLRNKHQLNRYPGPFLAKFSRLWLGYATRFGNRYQIIHQLHQKHGRFVRIA

PNELSIADPDAVHIVLGHGTGTTKSKF (1)

YDAFVAIHRGLF (0)

NTRDRADHTRKRKIISSTFSQKSILEFEPYIADTLACFLRKIDQVASEP

NLVQLPSHSWDSKHLNERWRIIDILPWFNYLAFDIIGDLAFGERFGMIERGADIAAVEKEGKVIYLPAIQILNERGEFSA

TQGQFDHIKFSKKKKEKKK (0)

YIDPWFSRGAASVQNLTG (0)

IATNQV

NLRISQTGQSRRDLLARLQTGQDADGNPMGKDELIAEALTQLIAGSDTTSNSSCAILWWVVKHPEVHKRLMEELDE

HLGTEEGVISYADCKELKYLNACINETLRIHSTSSIGLPRILPQTVSFKGHILPKGLVCSVPTFEIHHDPDVWGDP (2)

FTFRPERWLEPNAKDREKAFMPFS (2)

CGPRSCIGRNLAMMELY (0)

MITSTIFKRYEFALVDPDLAELETREGFLRKVGFSLQQKT*

 

>CYP53C1     Ustilago maydis

            GenEMBL XM_397620.1

MVETDLVPRIGAAIQWSVESPAHVVITLLGAVVLFHVVPYITNT

ACIKYPGPFFAKFTDFWLLRTALIGHRFEEVHKQHQKYGKFVRIAPNHVSIADHEALQ

PIYGHGTGTLKPAYYDAFVPPRPFPRGLFNTRDRAEHTRKRKIVSHTFAPKTIVAFEP

FIRREVQLLLERWDEFCDKATKDNTEGPRGIKGRAWLDSLMWLNYFAFDTIGALAFGK

TFGMLENGVDQAKVEYEDANGNKQVDYCSAVQIINERGEFSGTMGLAPVWMRPYLIKL

PWFSSRLKSVKKLTGIALARVNDRLQNGSEREDLLAKLQAAKDDRGEPMGKMELTAEA

LTQLIAGSDTTSNTSCAIVYHLATHPDKMRKLQAELDRELEHAEEVPLHADVQELPYL

QAVLSESLRYHSTSAIGLPRVIPAGGATVCGQQFPSGTILSVPAYTLHRDKSVFGADA

EEYNPDRWLAPNAKRDFEKAFIPFSVGPRACVGRNVAMMELSILIAAIFRRYDIVLAE

PDKPLDTFEGFLRKPVKLEVGLKRRN

 

>CYP53C2 Phanerochaete chrysosporium

         AY321584

         55% to CYP53C1

         my Scaffold_164a

MAVIEALTQLDLKSWLLLIPALAIVAHILVWLLDPHGIRSYPGP

LLAKFSDAWLGYVAAQGHRSEVVHDLHKQYGTFVRIAPNHLSIADPDALQVVYGHGTG

TLKSNFYDAFVSIQRGLFNTRSRSEHARKRKIVSHIFSQKSVLEFEPHVRLYVKQLIQ

QWDRLYEAGAKGLSGDDGEGGWRGRNGRVWLDCLPWYNYLAFDIIGDLAFGAPFGMLL

AARDAAPVAVDHEQAMASYGKEKSEVQYIPAVQVINDRGTYSASLGVLPPWMRPIVKL

FPWFRRGQKAVKQLAGIAVAAVAQRLTTPTDRVDLLGKLQEGRDDDGNLMGKEELTAE

ALTQLIAGSDTTSNSSCAITYYLAKYPDAQRKLQQELDEALGSDDEPVSTFDQVKRLP

YLQAVIDEALRIHSTSGIGLPRLVPKGGMTVCGRFFPEGTVLSVPTYTIHRDEEVWGK

DPEVFRPERWFEQDKNAVQKTYNPFSFGPRSCIGRNLANMELLIIVSSILRRYDFVLE

DPDKPFDTMEGFLRKPVECVVGIRRRTL

 

>CYP53D1 Fusarium oxysporum

48% to CYP53A10

FOXG_14732

MSLDSLLLSPWAPLAVLLCVLLFYILPYFYTYRHLRGIPGPLLARFSDLWLLYICRQSKRSYT

VYDLHERLGPVVRIQPNHVSIVDERAINLVYGHGNGLEKS (2)

SWYDSSISLTRSIFTARKRAEHARKRRYIAHSFAPKSSRAAEGPIADKVELLVRKWDEIIDKGPQFD

GFTQLECRRWFTYLSFDITGDLLFSEPFGMLENGSDLVKIDNKPRSYVSMMNSLAQRSAAVATLGVLPWLKPHAHHLPDP

FFHRGMDGLQNLLGVTSAHVKERMAAGQDNHDDWLSLLLRARDDQGELLKFEEIASESLTLFMAAIETVSNTLSAMMYYL

ATSPSSLQKLQAEVDSIDIPGTVPPFTNVRALPYLDAVLNETMCLHSVLGIGLPREVLPGSKGVHLDSFYFPPGTVLSVP

IYAIHRSRDIWGQDANNFRPERWEKLSDRQKTSFIPFGHGPAACVGRNLAEVEMKIIAATLIKRYNFCMMDSEIESTEGT

TRKLIKVNIGIKRRQ*

 

>CYP54A1 N. crassa AABX01000809.1 cont3.282

4170 MALTQLAHSASALLPLVLPSIAAILAFAIFQRYFAPNPLSNLPIV

     GEEYHGYEKKRQAYLTKAKDLYLEGYTK (0)3952

3824 FKHGLFRIVTPNRNSVIVVSPRFLDELKKLPDDVVSFDAANDD (0) 3696

3565 SMHTKYTLIPTHEPILPHTIKTSLTPSLPRLNPQLSEEVQIAFSQ

EIAPLMSSSPSDWAPININSKLLRIVAKVSGRVFIGPELCHDERYLEAAV

GYTVSVMEAQRAVERMNPWVRPIAAWRLKEVRKLAQMERDATAFLRPVVE

ARREKQRKGEEKDNDMLQWLMDSADQGQGKQHGKWGEDTTTTRKLARLQL

AISFAAIHTTTLVTTHAVYSLAADPKLQATLREEIQSVLQEHKGVFNTSA

LQAMKKTDSFLKETMRFHPLGQTSFNRKVLRTFALSNGQVIPKGSTIEVP

NYAVSRDPEAYPNPDVFDPLRFYNLRNEAREKGEAEQAASGQFVSVNKEF

LTFGYGRHACPGRFFAANEIKMILANLVMTYEMGLVEGETERYRDWDIAA

GTIPDPTKDVMFRKL* 2333

 

>CYP54B1 Magnaporthe grisea MG01391.4  45% to CYP54A1 AACU01000043 cont2.256

AI068604 revised to fill in gap

MSTTQLADVVADRLPLIASAAVILGVTFVVQYFFFKDPLANVPFVGTEFG

GEEARREQFLKDAKPFYLEGFRMNKVHKVTSPRTDTTVSIPAEFLEELKR

LPDDTISFGGAVNEVMAGKYTGIDGIEPTAPHLVKSHLTPALAKINPVLTEE

VARTVREELGSLEDW

TEVNIHSKLLRIVAIVSGRIFLGPELCHNEKYIESAIYYTMELNQGRQAI

FRLPAWQRPFRAWFLPEIKNLHKREREFYALIEPIVKARREARRSDPNYQ

APDDMLTWLEESQDKTTRKSIREIAKLQLGLSFAAIHTTTMTTTNIIYDL

AAHPEMIAELRQEASAALAAHDGAFTAPALHTMKKMDSVMKESMRMNPAG

YSAFMRKVLKPFTLSNGQEIPAGVTIEVPGYGVSRDPETFPNADSWDGLR

FFRLRESGETVGSSKQGGGRASAVEVSAQNQFVSVSKSSLGFGYGRHACP

GRFFASNEVKMILARLVLNYDVKLAGGATERYKNIEAAGSCVPDPTKMLL

FKERA*

 

>CYP54C1 Fusarium graminearum FG11536.1 AACM01000473 FGcontig1.473_scaffold10

MGDTQSAFDIEANRWPVLLTALLVCLVAAIAPKVGSVLRFWTIPVVGEEL

GSTEKRRKAYLGGARKLYSDGYQKLTIEQFKNGIFMITTSKSSPTIVISP

DFLPELKKLPDSILSMEAAVDESMETTYTKIETSVPIIPHTIKGHLTPAL

SRLSAIIADEVRQSLELSIPSCDDWTEVNIHHSLLRIVGMVSGRVFIGPE

LCRSEQYLDAAINYTMEVMGAQRAVQNMRPWLRPFLAQSQPEVKRLYQRI

AEAEAFLQPVVESRIEAMADLSYEKPDDFLQWLIDGKDKFPDKNSQNLAK

VQLGLTFAAVHTTTLTATNAFYDLAAMPDLQVELRDEVQEALLQSEGVFT

SNALQGMKKMDSFLKETLRVHPATMASFQRKVLKPFTLSNGQVIPAGLMI

EIPAVAVNSDPYIFPHADEFDPLRFYRIRTQAKDESSVENAAKEQFVSVN

QSSLTFGYGRHACPGRFFAANEIKMILAHALLRYDVKLVGSETRRYPNIE

FAHMSIPDPSRKLLFKAIGF*

 

>CYP54C2 Nectria haematococca fgenesh1_pg.scaffold_20000135

Necha1/scaffold_20:362069-363960

75% to 54C1 small gap after GYQK? (5 aa), this seq looks right,

maybe the 54C seq is too long here. Note LTIEQ can be removed from 54C and

the intron boundary is preserved.

This gene model seems correct

MGNIQSFVDLAVNRWPTLLAIVVVCLTAAFGPTINRTILLRSLPVVGDGNAEKRRMAYLAGARKLYSDGYQK (0)

FKDGVFTITTSR (1)

TSPIVVISPKFLPELHKLPDSVVSMDAAVDE (0)

TMETKYTKIETSVPIIPHTIKGDLTPSL (1)

NRLNPTIAQEVREALQLSIPSCDDWTEVNIHHSLLRIVGMVSGRVFIGPELCKSEKYLDAAINYTME

VMGAQRAVQQMRPWLRPFLASRLPAVKRLDQRIAEAEEFLNPIVKQRAEAIADPSAEKPDDMLEWLMNRK

DKFPDKNSQNLAKVQLGLTFAAIHTTTLTATNA (2)

FYDLAAMPDVQKELRVEIREALSQTSGVFTSQALQNMKKMDSFLKEVLRLHPATM (1)

ASFQRKVLKPFTLSNGQKIPEGVTIEIPAVAISADSSVFPKADKFDPWRFYRLRQQAKDDGSAEKAALHQ

FVSVNQSSLTFGFGRHACPGRFFAANEIKMILANTILQYDIKLVDATERYPNIEFAHM (0)

SIPDPSRKLLFKAIDV*

 

>CYP54C3 Cryphonectria parasitica

CB690595.1 60% to CYP54C2 N-term only, 55% TO 54C1

MATSTTSSLSETLSERFLVIVAAVLACALAYLGPKIISIIRLAALPVIGTE

LGNEEKRRQAYLQGARKLYYAAYDNFKNGLFKGAARLTTSRNANVIVVSPKFLPELNKLP

DSVVSMEAAVDDAMETKYTKIESHVPIIPHTVTGKLTPSLTRLNPTIARETAEALEL

EMPLREFTNWQEVNIHEKLLRIVGMXSGR

 

>CYP54C4 Cryphonectria parasitica

CB686707.1 CB688482.1

55% TO CYP54C1

TRPMPTCEDWTAVKINSVLLRIVAKASGRIFVGPELCHSEEYLEAAIRYTVEVIGAANAV

SNVPPWLRSFKASKLPEVQRLHERRKHAIKFMQPVVESRKDLDQKPDDLLQWLIDNEGNL

GDMSTWKLARTQLALSFAAIHTSTVVSTNVFYTLAVMPNEVILELRDEIRSVLGENNGNFT

SSALQSMKKVDSFIKETMRYYPFANHSFERKVMRTFTLSNGQVIPAGVILECSTAHNQDD

EVFPDASRFDPWRFSKLQEQEKEDGMDGAARHQMVSVTPNHLTFGYGRHACPGRFFAINX

IKMIIGTFLLNYDIKNIDGVK*

 

>CYP54C5 Fusarium oxysporum

82% to CYP54C1

FOXG_01238

MGNAQSPLDFVSNRWPIIVTALFACLVAAIGPRVVNALRLWTIPTIGEELGSTEKRRQAYLAGARKLYSAGYQKLTTFQF

KDGVFLITTSRTSPTIVISPDFLPELKKLPDATLSMEAAVDESMETKYTKIETSVPIIPHTIKGELTPSLSRLSLTIASE

VRDSLNLTMPPCDDWTEVNIHHALLRIVGMVSGRMFIGPELCRSEQYLDAAINYTMEVMGAQRAVQNMRPWLRPFRAQSL

PEVKKLYQRIAEAEAFLEPVVKTRTDAMNDPTYEKPDDFLQWLIDGKDKFPDKNSQNLAKVQLGLTFAAVHTTTLTATNA

FYDLAALPDLQIELRDEVREALAQSGGKFTSNVLQSMKKMDSFLKETLRVHPATMASFQRKVLKPFTLSSGQVIPAGVTI

EIPAVAVSSDSNVFPQADKFDPLRFYKLRTEAKDGGSVEKAANNQFVSVNQSSLTFGYGRHACPGRFFAANEIKMILAHA

LLQYDVKNAGDATERYPNMEFAHMSIPDPSKKLRFKSVEV*

 

>CYP54C5 Fusarium verticillioides

90% to CYP54C5 Fusarium oxysporum = ortholog

FVEG_00258 revised

MGNTQSLLDLVANRWPLPVTALLACVLAAIGPRVANVLRLWSIPTIGEEL

GNTEKRRQAYLGGARKLYSAGYQKLTDDQFKDGVFLITTSRTSLTIVISPDFLPE

LKKLPDATLSMEAAVDESMETKYTKIETSVPIIPHTIKGKLTPSLSRLSL

TIATEVRDSMNLTIPPCDDWTEINIHRALLRIVGMVSGRLFIGPELCRSE

QYLDAAINYTMEVMGAQRAVQNMRPWLRTFRAQSLPEVKKLYQRISEAEA

FLDPVVRRRTDAMNDPSYEKPDDFMQWLIDGKDKFPDKNSQILAKVQLGL

TFAAVHTTTLTATNAFYDLAALPDLQIELREEVREALSQSGGQFTSNALQ

SMKKMDSFLKETLRVHPATMASFQRKVLKPFTLSNGQVIPAGVTIEIPAV

AVSSDSNVFPHAEKFDPLRFYRLRTEAKDGASVEKAANNQFVSVNHSSLT

FGYGRHACPGRFFAANEIKMILAHALLQYDVKNLGDATERYPNMEFAHMVS*

 

>CYP55A1v1 F.oxysporum M63340

MASGAPSFPFSRASGPEPPAEFAKLRATNPVSQVKLFDGSLAWL

VTKHKDVCFVATSEKLSKVRTRQGFPELSASGKQAAKAKPTFVDMDPPEHMHQRSMVE

PTFTPEAVKNLQPYIQRTVDDLLEQMKQKGCANGPVDLVKEFALPVPSYIIYTLLGVP

FNDLEYLTQQNAIRTNGSSTAREASAANQELLDYLAILVEQRLVEPKDDIISKLCTEQ

VKPGNIDKSDAVQIAFLLLVAGNATMVNMIALGVATLAQHPDQLAQLKANPSLAPQ

FVEELCRYHTASALAIKRTAKEDVMIGDK

LVRANEGIIASNQSANRDEEVFENPDEFNMN

RKWPPQDPLGFGFGDHRCIAEHLAKAELTTVFSTLYQKFPDLKVAVPLGKINYTPLNR

DVGIVDLPVIF

 

>CYP55A1v2 Fusarium oxysporum

96% to CYP55A1v1

FOXG_12350

MASDAPSFPFSRASGPEPPAEFAKLRATNPISQVKLFDGSLAWLVTKHKDVCF

VATSDKLSKVRTRQGFPELNAGGKQAAKAKPTFVDMDPPEHMQQRSMVEPTFTPEAVKNLQPYIQKTVDDLLEQMKQKGC

ANGPVDLVKEFALPVPSYIIYTLLGVPFKDLEYLTQQNAIRTNGSSTAREASAANQELLDYLATLVEQRLVEPKDDIISK

LCTEQVKPGNIDKSDAVQIAFLLLVAGNATMVNMIALGVATLAQHPDQLAQLKANPSLAPQVEELCRYHTASALAIKRTAKEDVMIGDK

LVRANEGIIASNQSANRDEEVFENPDEFDMNRKWPTQDPLGFGFGDHRCIAEH

LAKAELTTVFSTLYQKFPDLKVAVPLEKINYTPLDRDVGIVDLPVTF*

 

>CYP55A1 Fusarium verticillioides

96% to CYP55A1v2 Fusarium oxysporum

FVEG_10773

MASDAPSFPFSRAFGPEPPAEFAKLRATNPVSQVKLFDGSLAWLVTKHK

DVCFVATSDKLSKVRTRQGFPELSAGGKQAAKAKPTFVDMDPPEHMHQRSM

VEPTFTSEAVKNLQPYIQKTVDDLLEQMKQKGCANGPVDLVKEFALPVPSY

IIYTLLGVPFKDLEYLTQQNAIRTNGSSTAREASAANQELLDYLATLVE

ERLVEPKDDIISKLCTEQVKPGTIDKSDAVQIAFLLLVAGNATMVNMIAL

GVATLAQHPDQLAQLKADPSLSPQFVEELCRYHTASALAIKRTAKEDVMI

GDKLVRANEGIIASNQSANRDEEVFENPDGFNMNRKWPAQDPLGFGFGDH

RCIAEHLAKAELTTVFSTLYQKFPDLKVAVPLEKINYTPLNRDVGIVDLPVTF*

 

>CYP55A2 Cylindrocarpon tonkinense D78511

 

MASEPPSFPFQRASGMEPPAEFARLRATDPVSKVKLFDGSLAWL

VTKYKDVTFVATDERLSKVRTRPGFPELNAGGKQAAKAKPTFVDMDAPDHMNQRGMVE

SLFTLEHVKKLQPYIQKTVDDLLAAMKKKGCANGPVDLVKEFALPVPSYIIYTILGVP

FNDLDHLTNQNAIRTNGSSTAREASAANQELLDYLASLVEKRLEEPKDDLISKLCTEQ

VKPGNIEKADAVQIAFLLLVAGNATMVNMIALGVVTLFQHPEQLAQLKANPSLAPQFV

EELCRYHTASALAIKRTAKVDLEIGGKHIKANEGIIASNQSANRDADIFENPDEFNMN

RKWPAEDPLGYGFGPHRCIAEHLAKAELTTVFATLFKEFPDLNIAVPFEKINFTPLGG

DVGVVDLPVTF

 

>CYP55A3 Cylindrocarpon tonkinense D78512

 

MHATEDETTTIPRFPFQRASAFEPPAEFARLRANEPISQVELFD

GSLAWLVVKHEDVCRVATDERLSKERTRLGFPELSAGGKAAAKNKPTFVDMDAPAHMN

QRSMVEPFFTEDHVENLRPYIKETVQGLLNDMVANGCEEPVDLIEKFALPVPSYIIYT

ILGVPFEDLEYLTEQNAIRSNGSGTAQEAAAANQQLLKYLAKLVDQRLQEPKDDLIGR

LVDQQLVPGHIEKSDAVQIAFLLLVAGNATMVNMIALGVVTLMQNPSQLEELKADPTL

VPGFVEELCRYHTGSSMAMKRVAKEDMELGGKLIRAGEGIIASNQSANRDEDVFPNPD

VFDMHRDFDSRDGLGFGFGPHRCIAELLAKAELEIVFETLFATLPDLRVSIPLDEIEC

TPRHKDVGIVRLPVKW

 

>CYP55A4      Trichosporon cutaneum (a basidiomycete fungus)

             GenEMBL AB052733

MMLTRLGLRPLNSFTRALSTRAAPKFPFARASGMEPPAEFATLR

                     ATNPVSQVQLYDGSLAWLVTKYEDVIKVATDERLSKVRTRPGFPELSAGGKAAAQAQP

                     TFVDMDAPDHMKQRGLVEAFFTPEYVEGLKPYIQSVIDEALDKMAAKTQPADLVSEFA

                     LIVPSYVIYTILGVPLKDLEFLTLQNAIRTNGSSTAREASAASAGLLEYLGKLVDARM

                     DEPKDDLVSTLCKAVAAGKLDRTSAVQVAFLLLVAGNATMVNMIALGVATLAKYPSQL

                     ELLKADPSLAANMVQELCRYHTASAMALKRVALEDIVLGGQTIKAGEGIIASNYSGNR

                     DADAFKDPDVFDIRRTFDKDPLAFGWGPHRCIAETLAKVELTAVFETLYKRLPNLKPA

                     VPLEDIAYSPLDKDVGIVELPVTW

 

>CYP55A5v1    Aspergillus oryzae

             GenEMBL AB055659

MNSEPVYPRFPFARPSGDEPPAEFHRLLRECPVSRVELWDGSHP

WLVVKHKDVCEVLTDPRLSKVRQRDGFPEMSPGGKAAARNRPTFVDMDAPDHMHQRSM

VSAFFNDEYVESRLPFIRDTVQHYLDRLIRAGKDGKEVDLVKHFALPIPSHIIYDILG

IPIEDFEYLSGCDATRTNGSSTAAAAQAANKEILEYLERLVDKKTTNPSHDVISTLVI

QQLKPGHIEKLDVVQIAFLLLVAGNATVVSMIALGVVTLLEHPDQLSRLLEDPSLSNL

FVEELCRFHTASALATRRVATVDIELRGQKIRAGEGIIASNQAANRDPEVFPDPDTFD

MFRKRGPEEALGFGYGDHRCIAEMLARAELETVFSTLFQTLPSLKLAIPKSEIQWTPP

TRDVGIVGLPVTWDRD

 

>CYP55A5v1  Aspergillus oryzae

           GenEMBL BAC01275.1

           cytochrome P450nor

MNSEPVYPRFPFARPSGDEPPAEFHRLLRECPVSRVELWDGSHPWLVVKHKDVCEVLTDPRLSKVRQRDG

FPEMSPGGKAAARNRPTFVDMDAPDHMHQRSMVSAFFNDEYVESRLPFIRDTVQHYLDRLIRAGKDGKEV

DLVKHFALPIPSHIIYDILGIPIEDFEYLSGCDATRTNGSSTAAAAQAANKEILEYLERLVDKKTTNPSH

DVISTLVIQQLKPGHIEKLDVVQIAFLLLVAGNATVVSMIALGVVTLLEHPDQLSRLLEDPSLSNLFVEE

LCRFHTASALATRRVATVDIELRGQKIRAGEGIIASNQAANRDPEVFPDPDTFDMFRKRGPEEALGFGYG

DHRCIAEMLARAELETVFSTLFQTLPSLKLAIPKSEIQWTPPTRDVGIVGLPVTWDRD

 

>CYP55A5v2  Aspergillus oryzae

           GenEMBL BAE61721.1

           6 aa diffs to CYP55A5v1

MQLEPVYPRFPFARPSGDEPPAEFHRLLRECPVSRVELWDGSHPWLVVKHKDVCEVLTDPRLSKVRQRDG

FPEMSPGGKAAARNRPTFVDMDAPDHMHQRSMVSAFFNDAYVESRLPFIRDTVQYYLDRLIRAGEDGKEV

DLVKHFALPIPSHIIYDILGIPIEDFEYLSGCDATRTNGSSTAAAAQAANKEILEYLERLVDKKTTNPSH

DVISTLVIQQLKPGHIEKLDVVQIAFLLLVAGNATVVSMIALGVVTLLEHPDQLSRLLEDPSLSNLFVEE

LCRFHTASALATRRVATVDIELRGQKIRAGEGIIASNQAANRDPEVFPDPDTFDMFRKRGPEEALGFGYG

DHRCIAEMLARAELETVFSTLFQTLPSLKLAVPKSEIQWTPPTRDVGIVGLPVTWDRD

 

>CYP55A5 Aspergillus flavus

99% to CYP55A5v2 Aspergillus oryzae, 2 aa diffs

Supercontig 11: 146268-147914 (-) strand

AFL2G_09432

MQLEPVYPRFPFARPSGDEPPAEFHRLLRECPVSRVELWDGSHPWLVVKHKDVCEVLTDPRLSK (0)

VRQRDGFPEMSPGGKAAARNRPTFVDMDAPDHMHQR (2)

SMVSAFFNDAYVESRLPFIRDTVQYYLGRLIRAGEDGKEVDLVKHFALPIPSH (0)

IIYDILGIPIEDFEYLSGCDATRTNGSSTAAAAQAANK (2)

EILEYLERLVDKKTTNPSHDVISTLVIQQLKPGHIEKLDVVQIAFLLLVAGNATVVSMIAL (0)

GVVTLLEHPDQLSRLLEDPSLSNLFVEELCRFHTASALATRRVATVDIELRGQ (0)

KIRAGEGIIASNQAANRDPGVFPDPDTFDMFRK

RGPEEALGFGYGDHRCIAEMLARAELETVF (1)

STLFQTLPSLKLAVPKSEIQWTPPTRDVGIVGLPVTWDRD*

 

>CYP55A6 N. crassa AABX01000354.1 cont3.356 NCU06137.1 (version3)

153215 MGALTENLEFPFRRASGLDPPPEYAWLRKTDPVTQVRLFDGSL

       AWLVTKYHDVCQVATDERLSKERTRPGFPELAAGGKEAAKNRA

       TFVDMDPPKHMQYRGMVQPIFEMEHVKELEPYIQKTVDDLLER

       MKNMGCEGGPVDLVQNFALPVPSY (0) 152757

152692 IIYTILGVPVEDLDFLTQQNSIRTNGSSTAREASAANQ (2) 152579

152519 ELLNYLRRLAEQRLQEPKDDLISKLMTEQVKAGKLDTADAVQM

       AFLLLVAGNATMVNMIAL (0) 152337

152273 GIVTLFLNPSQLEELKRDPSVVPAFVEELSRFHTASAMAIRRV

       AKEDLEIRGKTIKKGEGVIASNLSANRDEEVFKDADKFDMHRE

       WPVKELGFGWGEHRCIAEFLAKAELKAVF (1) 151893

151771 ETIFKKLPDLKIAVPFDEIEYTPLDRDVGIVKLPVTW* 151658

 

>CYP55A7      Trichosporon domesticus SBUG 752 (a basidiomycete fungus)

             GenEMBL AY044231 and AY044232

AEFAKLRATDPVSKIKLFDGSEAWLVTKYRDVCKVATDDRLSKV

RTRPGFPELNAGGKEAAKAKPTFVDMDKPDHMKQRG

 

>CYP55A8 Fusarium graminearum FG11585.1 AACM01000475.1 FGcontig1.475_scaffold11

MSSDPPSFPFQRASGSEPPAEFARLRATEPVSQVELFDGSLAWLMTKYKD

VTFVATSDKLSKVRTRTGFPELTARGKQAAEAKSTFVDMDPPDHMRQRGM

VESLFTPEAVKKLQPYIKKTVDDLLENLKQKGSANKQVDLVKEFALPVPS

IIYTILGVPFDDLQYLTQ

QNAIRTNGSSTAREASAANKELLLYLASLVEKRLEEPKDDLISKLCTEQ

VKPGNIEKPDAVQIAFLLLVAGNATMVNMIALGVVTLAQHPEQLAQLKSN

PSLAPQFIEELCRFHTASALAMKRTAKEDVEIGGKLIKVNEGIIASNQSA

NRDEDIFENANQFNINRKWPAEDPLGFGFGDHRCIAEHLAKAELITVFAS

LYQKFPDLNVVIPLEEVNYTPLSGDVGIVDLPVTL*

 

>CYP55A9 Nectria haematococca

fgenesh1_pg.scaffold_30000098

Necha1/scaffold_30:272059-273639

92% to CYP55A2 Cylindrocarpon  tonkinense D78511

79% to CYP55A8 Fusarium graminearum 

This gene model seems correct DRN 2/5/06

MASEPPSFPFKRASGMEPPAEFARLRASDPVSKVKLFDGSLAWLVTKYKDVTFVATDERLSK (0)

VRTRKGFPELSAGGKQAAKAKPTFVDMDAPDHMKQR (2)

GMVEPLFTRKHVEKLQPYIQKTVDDLLAAMKKKGCATGPVDLVKEFALPVPSY (0)

IIYTILGVPFNDLEYLTNQNAIRTNGSSTAREASAANK (2)

ELLDYLASLVDKRLEAPEDDIISKLCREQVKPGNIEKADAVQIAFLLLVAGNATMVNMIAL (0)

GVVTLFQHPEQLAKLKENPSLAPQFVEELCRYHTASALAIKRTAKVDLEIGGK (0)

HIKANEGIIASNQSANRDADIFENPDEFNMNRRWPAEDALGYGFGAHRCIAEHLAKTELTTVF (1)

ATLFKELPDLKIAVPFEKINFTPLDRDVGVIDLPVTF*

 

>CYP55A10 Nectria haematococca

fgenesh1_pg.scaffold_28000090 [Necha1:94366]

Necha1/scaffold_28:245547-247185

96% to CYP55A3 Cylindrocarpon  tonkinense D78512

Note: the very high similarity suggests a very close relationship  between the

Two species.  This is higher than the ortholog pair matches between

F. graminearum and N. haematococca

This seq is originally of bacterial origin (P450 B type not E type) similar to CYP105s

This gene model seems correct DRN 2/4/06

MHATEDETIIIPRFPFQRASAFEPPAEFARLRANEPISQVELFDGSLAWLVVKHEDVCRVATDERLSK (0)

ERTRLGFPELSAGGKAAAKNKPTFVDMDAPAHMNQR (2)

SMVEPFFTEDHVESLRPYIKETVQGLLNDMVAKGCEDPVDLVEKFALPVPSY (0)

IIYTILGVPFEDLEYLTEQNAIRSNGSGTAQEAAAANQ (2)

QLLKYLAKLVDQRLQEPKDDLIGRLVAQQLVPGHIEKSDAVQIAFLLLVAGNATMVNMIAL (0)

GVVTLMQNPSQLDELKADSTLVPGFVEELCRYHTGSSMAMKRVAKEDMELGGQ (0)

LIRAGEGIIASNQSANRDEDVFPNPDVFDMHRDFDSRDGLGFGFGPHRCIAELLAKAELETVF (1)

ETLFTTLPDLRVSIPLDEIECTPRHKDVGIVRLPVVW*

 

>CYP55A11 Nectria haematococca

estExt_fgenesh1_pg.C_880004 (better model)

Necha1/scaffold_88:11555-13495

69% to AB226066.1  Aspergillus oryzae cDNA

58% to fgenesh1_pg.scaffold_28000090

54% to CYP55A8 Fusarium graminearum

58% to CYP55A3 Cylindrocarpon  tonkinense

same as fgenesh1_pg.scaffold_88000004 which is too long at

SNAQAHPAP between MHQ and RQM

Note: This gene has one extra intron at the N-terminal

that only codes for 3 amino acids

This gene model seems correct DRN 2/5/06

MAS (1)

DPHFPFARQNGAEPAPEFQQRLTSCPVARVELWDKSHPWLVVKHKDVREVLTDPRLSK (0)

NRQKEGFPEMSAGGKAAAKNCPTFVDMDPPDHMHQ R (2)

QMVAAFFTPEYVEQRKPWIKGVVQHYLNEFINARKGQNSIDLVEHFALRVPSH (0)

IIYDILGVPLRDVDYLTKCNATRTNGSATASAAQDANT (2)

ELLDYFAKLIDKKIESPEPSNDVISSLVANQLANGQLDKKDVVQISFLLLVAGNLTMINMIAL (0)

GVITLLDHPDQLDALIRDPSLSKPFVEELCRFHTASSFATRRVAKVDVKIRGQ (0)

EVKAGEGIIASNQAANRDPDVFSDPNVFDMFRKRGSEEALGFGWGDHRCIAESLARAELEAVF (1)

STLFQTLPTLKLAIPNSEIKWTPPIKDIGVSELPVTWSSSHVGGRRSQL*

 

>CYP55A12P Aspergillus niger

gw1.11.1089.1|Aspni1

48% to CYP55A5v1 aa 53-257, this is a pseudogene

LKSIPVSRKNLFDGSCP*MVIKLKETYNILVDPRLLK (0)

VRQRDRYPEISAGAKKRAENSPTFINMDPSVHGHQRFIARLNS* (2)

SFKPEYIKSCEGFNKHTVRRYLERLIKTKADQQSVDRVENFTLSIPSH ()

IIYNLLGIPDKDFIYLTNCNAT*TNSGNTAGAAQSANE (2)

KYLKYFDHLLDERIANPGDNIISSLAKEQLQQGNLER*DII

 

>CYP55A13 Uncinocarpus reesii

71% to CYP55A5v1  Aspergillus oryzae

UREG_06342.1

MATEATPPKFPFARPRGAEPPAEFAKLRATNPVSRVELWDGSHPWLVVKYNDVCSVLTDERLSKQRQRDGFPEMSAGGKA

AAKNRPTFVDMDPPDHMRQRGMVTSFFTPEYTESIKPQIQKTVDRYLEEMIKGGCEKPVDLVEKFALPIPSCIIYDILGI

PFEDSDSLTQWNAIRTNGSSTAAAAATANTELLGYLDKLVDKKIANPQNDLISTLVTEQLQPGNIDKLDVVQISFLLLVA

GNATMVNMINLGVVTLLEHPDQLEDLKRDPSLAKPFVEELCRYHTASALATRRVAKVDITLNGQLIKAGEGIIASNQAAN

RDEDIFPDPDKFDIHRKRGSESALGYGYGDHRCIAEGLSRAELEAVFSTLFQRLPNLRLGIPHSEIKYSEPTMDVGIAEL

PVVW

 

>CYP55A14 Histoplasma capsulatum

73% to CYP55A13

HCB04560.1

MCVCLSARSKSAIPARSAIVARNQRCNMSTEAAPPKFPFSRPSGAVPPLEYAKLRATNPVSRVTLWDNSQPWLVVKHKDI

CSVLTDSRLSKERTRAGFPEMNPGGKEAAKNRPTFVDMDPPDHGRQRNMVASLFTRESSETMRPHIQATADALLDEMIKQ

GCEKPVDLVEKFALPLPSYIIYGILGVPKEDLAYLTECNAVRSNGSSTAAAASNANKELLDYIGNLADKRLEKPGNDMIS

KLVVEQLKPGHIDRLDVIQIAFLMLVAGNATLVNMISLGIVTLLQHPKQLADLKANPSLAPKFVEELCRYHTASAMATRR

VAKEDIMLGGHLIKAGEGIIAATQSGNRDEDIFPNPDVFDMHRTRGSEVALGYGYGEHVCVAEGLARTELEVVFSTLFRR

LPNLKLGIPLSEVKYSPPDADVGITELPVVW

 

>CYP55A15P  Fusarium oxysporum

74% to CYP55A2 Cylindrocarpon tonkinense

FOXG_14888

SNPRSFPFERASVLEPPAEFAKLRATDPVSQVKLFHGSLPWLVTKHKDVVFVATPDKLSK (0)

VCTRPGFPELDAGGKEAAKAKPT (?)

LDMDSPDHMHQR (?)

RRMVEQIFTQEAVEKLQPYIQKTVDDLLEDLKQKGCADGPVHLVKIFALPAPSY (0)

VIYTILGAPFHDLEYLT*QNAIRSNGSSTAREPSAANN (2)

REFLDYVANLADK*LEEPQDDLISKLCTEQVKPGNIEKADAVQISFLLLVAGNATMVNMIAL (0)

GVITLPQHPDQLSELKP*SIPGPQFVEELCRYHTASALAIK

RTAKEDLEISGK (0)

SKGIIASNQSANRHEDAFKNPD*FDMDCKWLVEDALGFGFDGHRCIDEHLAKTEPTTVFGT (?)

LYRKFPDLKNAVPLEEVHYTPLCQDVGVVDLPVTF*

 

>CYP55A16P Fusarium oxysporum

83% to CYP55A11

FOXG_17502

INYDILGVALKDVDYLTQCNATRTNGSATASAAQDANM (2)

ELLNYFAKRVDKKIESPEPSNDVIGSLVSNELAN &

VDKKHVVELSFLLLVAGNLTMINMIALV (1)

CVLTLLEQPDQLDALIQDPSLLKPFVEELCRYHTASSFATRRVAKVDIKVRGH ()

EVKAGEGIIA*NQAANRDPDVVPDPNVFDLF*KRGSEEALGFGWGDHRCIAASLARAEPEAVF (1)

STLFQTLPTLKLAIPSSEINGSAPNKDIGVSELPVTWSSPQVS*

 

>CYP55A17 Aspergillus terreus

73% to CYP55A13 Uncinocarpus reesii

ATEG_06140.1

MTTTRAVSRPSLWAKYRPVPRPRFSYVSFNSLAGFTSRSGPLREAAAGTQ

TDAPEFPFARPRAAEPPAEFAKLRSSCPVS

RVKLWDGSLPWLVVKHEDVCNVLTDTRLSKERSRAGFPEMNPGGKAAAKNRPTFVDMDPPNHMRQR (2)

RSMVSAFFTPEYIDSMKPFIQSTVDNVLNDMIAKGCDEPVDLVERFSLPIPSI (0)

IIYHIIGVPTEDMDYLTQKNAVRSSGSSTAAAAQNANEELLAYLGSLVDKRIADPKKDLISTLITEQ

LNPGHLDRLDVVQLAFLLLVAGNATMVNMINLGVVTLLEHPSQLEELRRDPLLARKFVEELCRFHVASSFATRRVAKVDI

TLRDKHIKAGEGIIASNQSANRDEDVFPDPDTFNMHRETDSEQNLAYGYGDHRCIAEGLARAELEAVF (1)

SCLFRLPNLKLGVPHDQVRYSEAHKDVGIDELPVTW*

 

>CYP55A18 Trichophyton rubrum

ESTs DW700172.1, DW689200.1, DW681558.1

72% to CYP55A14 Histoplasma capsulatum

MFISRPVITSIGSRVSVQLTTTGLRAMATAV

PKFPFSRPRGAEPPAEYARLRATDPVSKVELWDGSQAWLVVKHKDICSVLTDQRLSKQRN

RPGFPELDAGGKEAAKRKPTFVDMDPPEHMQQRSMVEPLFTREHIDGMRPHIQQTVNTLI

DEMIIGGGKPAVDIVEKLALPTASYIIYGILGVPFKDLEYLTQQAAIRSNGSATAAAASA

ANQQLLEYIGGLVDQRIAEPRNDLISKLVVEQLKPGHLQRDDVIQMAFLMLVAGNATMVN

MINLGIVTLFENPSQLADLKKDLSLVPQFVEELCHFHTASAMATRRVAKVDI

ELGGKTIKAGEGIIAATQSGNRDADVFPDPDTFNMHRKRGAESAFGFGYGEHRCVAEWLA

RAELEIVFTTLFRRLPDLRLAVPLDEVKYSDPSKDVGITELPITW*

 

>CYP55C1 Aspergillus niger

fgenesh1_pm.C_scaffold_5000072|Aspni1

40% to CYP55A1, 40% to CYP55B1

MYPFARPPKSYDPPAELAELRHQGPTERVQLFDGRPAWIVTRDKEVREMLSSDKFSNDRYNRDGYPEIHSGTKKDGVRPT

FVHMDDPKHARHRAMTESFFTPEATEAVKPQVQEVVDSLIDSIKERGCNNGPIDLVKELATVVNPKVILLSILKVSEKEA

NELIQSSSALGGTSGSASESGHTDLHEYISQLIDARIEKPRRPQDDLLSKLVVDEYRQANLDRDDLINLVYMIFVAGNSA

IQSSIVLGVITLLQHQDQLEELKENPGLAGRVVEEILRYHTPSALNSRRVTTTDITLGGKKIKSGSGVIGSVRSANRDER

VYPDADKFSIHRQVDPHQNLAFGHGPHNCQGQWLSRMELQAIFSSLFRKLPNLRLAIEPSELEYTSPTQNVGVLRLPVVF*

 

>CYP56A1 S. cerevisiae DIT2 X55713

MELLKLLCLILFLTLSYVAFAIIVPPLNFPKNIPTIPFYVVFLP

VIFPIDQTELYDLYIRESMEKYGAVKFFFGSRWNILVSRSEYLAQIFKDEDTFAKSGN

QKKIPYSALAAYTGDNVISAYGAVWRNYRNAVTNGLQHFDDAPIFKNAKILCTLIKNR

LLEGQTSIPMGPLSQRMALDNISQVALGFDFGALTHEKNAFHEHLIRIKKQIFHPFFL

TFPFLDVLPIPSRKKAFKDVVSFRELLVKRVQDELVNNYKFEQTTFAASDLIRAHNNE

IIDYKQLTDNIVIILVAGHENPQLLFNSSLYLLAKYSNEWQEKLRKEVNGITDPKGLA

DLPLLNAFLFEVVRMYPPLSTIINRCTTKTCKLGAEIVIPKGVYVGYNNFGTSHDPKT

WGTTADDFKPERWGSDIETIRKNWRMAKNRCAVTGFHGGRRACLGEKLALTEIRISLA

EMLKQFRWSLDPEWEEKLTPAGPLCPLNLKLKFNENIME

 

>CYP56A2 Saccharomyces paradoxus NRRL Y-17217

AABY01000059.1

91% to CYP56A1

46799  MELFKLLGLTLFLTISYIAFAIIVPPLNFPKNIPTIPFYVVFLPVfVFPIDQTELYDLYIR  46620

46619  ESMEKYGAVKFFFGSRWNILVSRSEYLAQIFKDEDTFAKSGNQKKIPYSALAAYTGDNVI  46440

46439  SAHGAVWRDYRNAVTNGLQHFDDTPIFKNAKLLCTLIKRRLQEGQLSIQMGPLSQRLALD  46260

46259  NISQVALGFDFGTLKHEKNAFHEHLIRIKKQIFHPFFLTFPFLDLLPIPSRKKAFKDVAS  46080

46079  FRELLVKRVQDELVNTYKFEQTTFAASDLIRAHNNEIIDYRQLTDNIVIILVAGHENPQL  45900

45899  LFSTSLYLLAKYSNVWQERLRQEVNGVTDPKILADLPLLNAFLLEAVRLYPPLSTIINRC  45720

45719  TTRTCKLGPEIVIPKGVYVGYNNFGTSHDPRTWGATADDFKPERWGSDIETIRKNWRMAK  45540

45539  NRCSVTGFHGGRRACLGEKLALTEMRITLAEMLKQFRWGLDPEWEEKLTPAGPLCPLNLK  45360

45359  LKFTENITE*  45330

 

>CYP56A3 Saccharomyces bayanus MCYC 623

AACA01000139.1  Sbay_5318

83% to CYP56A1

23165  MSILQLIGFILLIIISYIAFVVVVPPLNFPRNIPTIPFYVVFLPVIFPIDQTELYDLYIR  22986

22985  EPMEKYGAVKIFFGSRWNILVSRSEYLAQIFKDEDTFAKSGNQKKIPYSALAAYTGDNVI  22806

22805  SAHGKVWRDYRNAVTNGLQHFDDAPISKNAKTFCNLIKKRAQNGESSIQMGPLSQRLALD  22626

22625  NISQVALGFDFATLTQDKNALHELLVHIKKQIFHPFFLAFPFLDLLPIPSRRKAFRDVAS  22446

22445  FRELLVKRVQDQLINNYKFEQTTFAASDLIRAHNNEVIDYKQLSDNIVIILVAGHENPQL  22266

22265  LFNTSLYLLAKYSTEWQNSLRQEVESVTNSKALADLPLLNAFLFEAVRLYPPLSTIINRC  22086

22085  TTKLCKLGADIVIPKDVYVGYNNFGTSHDPKNWGPTANDFRPERWGSDIETIRKNWRIAK  21906

21905  NRCTVTGFHGGRRACLGEKLALTEMRITLAEMLRQLEWTLDPEWEEKLTPAGPLCPFNLK  21726

21725  LNFKERLPS*  21696

 

>CYP56A4 Saccharomyces castellii NRRL Y-12630

AACF01000075.1 Scas_Contig632.25

63% to CYP56A1

43945  MPALRVILSLLIVLVGYVIFKVVWPPLNFPRNIPTIPCYVVFLPIIFDIDQVDIYNTYIK  43766

43765  VQMEKYGAVKIFFGSRWNILVSKPEYLAQIFKEEDVFAKSGNQKKIPYSAIAAYTGDNII  43586

43585  SAHGDVWRKYRSIMTNGLQHFKEEPFICNAKKFCGLLRKNRGPTGNVLMGPLIQRLTL  43412

43411  DNISQVVLGFNFGTLSEETNELHQHLIKIKKQIFHPFFLTFPFFDMLPIPSRKKAFQDIS  43232

43231  KFREVLVSRVKNDLINNYKFEQTSYVSSDLIKAYNNNIIDYKQLTDNIVILLVAGHENPQ  43052

43051  LLLSNCLYLLAKYPSWQKLIWKETQNISNYKDLNELPLFNSFLFEVVRLYPPLNIIINR  42875

42874  KTNKKCRMGQDIIVPKNTYVGYHNFGVTHNRNVWGNTAEEFDPRRWGTNIADIMIAWRSS  42695

42694  KNSCKLTSFHGGRRACLGEKLGFVEMRISIFEIIQQFELTLPKEWKEKMTPAGPLCPYNL  42515

42514  QLNIKSREKDVGVCE*42467

 

>CYP56A5 Candida glabrata strain CBS138

CR380952.1, CAG59007.1

57% to CYP56A1

MLNILVFGFICLVLCWILTICFPPISFPNNIPTIPFYSVFIPQY

YNIDQVQFYNLYIREKLEKYGAVKFYFGSRWNILVSRPEFLNNIFKNEDTFAKSGNQQ

KIPYSVLAAYTGDNVISAHGVNWQKYRKPIKDGLQHFDIGILLKNAMKFCELIKEDMR

PFKYHCNFKIIPYIQRLTLDNICRVGLGFEFGAIDEDNNSLHRQLIQIKKQIFDPFYL

NFPMFDRLPIPSRLLAFQNVENFRSSLVDKVQKQLIKTYKFEQANTSGSALVRAYNNG

ELTYKQLTDNIVILLVAGHENPQLFISNLIYLLGKYHDTWQVDIRNEILNNEENNLSE

LPLLNSFLYECLRYYPPLSVIINRKTTKRCMLGPGIVVPKDTYVGYHNYSTCHDSNFW

GHTSDIFDPTRWGKDIETINKAWKTTKNNCILNTFHGGKRACLGEKLVFVSTRIIIAE

FLSSFEWKLSPLWVEQMTHAGPLCPKDLALDIRVRDTSMQIQKLNKYL

 

>CYP56A6 Ashbya gossypii (= Eremothecium gossypii)

AE016819, NP_985947.1, 54% to CYP56A1

MTANIVLVLLGGLVLNYIRSIVLPPWGFPRNIPTIPFYVTFLTT

LFDIDQKELFELYIRKPMEKYGAVKIYFGNRWNILVSKPEFLAQMFKDEDTFAKSGNH

IKIPYSILALYTGDNVISSHGLAWKKFRGALTQGLQFFDPSPLSANAEKFIGFIERDM

KKNNGEVLMPALIQRLALANIAQIALGFDIGTLDPERPSKLQQQLEEVKKHIFHPLYM

NFSFLDRLPIPSRIRARQQVERFRSDLLQEVRRNLIINYKYEQTSYAASDLIRVYEHG

EITEKQLTDNIVILMVAGHENPQLLLTTCLYMLAKYPEWQARLRQQAVTLQDDLLNDS

VEFNQFLFETVRVLPPLGQIINRKTSHKCKLGPEIVLPKDTYVGYQVYGTGTSTQVWG

PDAAEFKPERWGSTNATVHETWRRSKNTGAMGAFHGGRRACLGEKMGLMETRVALAHM

LRKLEWTLSPNWKDRVTPAGPLCPFMLKLQFTRIQEPLAAELTA

 

>CYP56A7 Kluyveromyces lactis NRRL Y-1140

XM_452498, KLLA0C06743g

49% to CYP56A1, 53% to 56A6

MLSLVLGIISSGILLSFLCLVCFPIGLPWSLPTIPIYVSFLPIL

TDMDQLEIFERYIRHPMEKYGAVKIFFANRWNILTSKPEFLNIMFRDEDTFAKSGNQK

KIPYSLLAKYTGDNVISAHGKVWMKYRSCIQNQLNVFDSKPLIDNAQLFVKLLKKSIE

DNTEGTVLLPPLIQRLTLANIAKIALGFDIGTLKFDEHDNICRSRLHEKLNQVKQQIF

KPVFLSFPFLDLLPIKSRQRAKIDIIQFRDMLLDTVYKNLIHNYKFEQTNNAAAGLIR

EWKLQGITDEQLKDNLVIILVAGHENPQLLLSTLFYLLAKHQNWQYAIREELLSVDRN

EDILNSFKLTAFIYEALRMFPPLGQIINRRTTRKCQLGPGIIIDKDVYCGYNVYGTGT

ATSVWGETAKQFIPERWGENSNELANNWKKHKYDASMSAFHGGRRSCLGEKLALMEMK

YVLYYVLMNFHIELHPQWKEKMTPAGPICPKMLKVKLTILKDPQDQRSDSLYSSAGET

LSENI

 

>CYP56A8 Saccharomyces mikatae

90% to CYP56A2 Saccharomyces paradoxus Smik_4197 partial seq

MGPLSQRLALDNISQVALGFDFGALKQEKNAFHEHLICIKRQIFHPFFLTFPFLDLLPIPSRKKAFKDVASFRELLVKRV

QDELINNYKFEQTTFAASDLIRAHNNEIIDYNQLTDNIVIILVAGHENPQLLFSTSLYLLAKYSNKWQERLRREISGITD

PKVLADLPLLNAFLFEAVRLYPPLSTIINRCTTRTCKLGAEIIIPKNVYVGYNNFGTSHDPKNWGSTAYDFEPERWGSDI

ETIRKNWRTAKNRCTVTGFHGGRRACLGEKLALTEMRITLAEMLRQFRWELDPEWKEKLTPAGPLCPFNLKLKFKKNVAE

 

>CYP56A9 Saccharomyces kudriavzevii

AACI02001147.1, AACI02000561.1

85% to CYP56A3

MGIFKILGLILFLIISYIAFVVVVPPLNLPKNIPTIPFYVIFLPVIFPID

QTELYDLYIRESMEKYGAVKIFFGSRWNILVSRSEYLSQIFKDEDTFAKSGNQKKIPYSA

IAAYTGDNVISAHGKVWRDYRNAITKGLQHFDDAPISKNAKLFCNKIKERVQNGQVSVHM

GPLSQRLALDNISQVALGFDFATLKHEKNALHELLIHIKKQIFH

PFFLTFPFLDLLPIPS

(67 aa gap)

PQLLFYTSLYLLAKYSSKWQERLRQEVKNVTDPKALADLPLLNAFLFETVR

MYPPLNTIINRCTTKVCKLGMDIVIPKNVYVGYNNFGTSHDAKNWGPTANDFEPDRWGSD

IETIRKNWRLAKNRCVVTAFHGGRRACLGEKLALTEMRITLAEMLNQLKWSLDPEWEEKF

TPAGPLCPLNLMLRFKENVAK*

 

>CYP56A10 Saccharomyces kluyveri

AACE03000001.1 Sklu_Contig1634.3 Cyan region is an insertion

60% to CYP56A3   Saccharomyces bayanus w/o the insert

MITTIALSFLTLIVIFSLKIIVPPWNFPNNIPTIPFYVTFLTTFFDLDQEDIFRLYLAEPLEKYGAVKIYFGSRWNILVS

RPTYLSQMFKEEDTFAKSGNQKKIPYSVMAEYTGDNVISAHGKIWKLYRNSVTNGLQFFDHKPMVENARLFCSLLKEQLNKE

CGQNLNYNKLSDKSKKEPCSNKAISLPECDDTNISILSQ

SASLEMADYIQRLTLANISQVALGFDFGTLTEDKAPLHQ

QLKYVKKQVFKPLFLNFPFLDKLPLPSRQSAREEVSKFRKNLVDQVRENLMDNYLYEQTSFASSELIRNYNREKLNEKQL

TDNIVIIMVAGHENPQLLLTTLLYMLAKHHSTWQVRLREELRSCSMTEIHELPLLNAFFFECIRMYPPLGQIINRCTSKT

CVLGRDIVIPKGSYVGYNVYATGRSRTVWGNDSNEFRPERWGLSYNEVMDTWRHSKNSCAMSAFHGGRRACLGEKLALTE

LRITVAEMLTQFQWRLAPDWKDKMTPAGPLCPLNLKLKIEPLNQ

 

>CYP56A11 Kluyveromyces waltii

59% to CYP56A10 Saccharomyces kluyveri kwal_162-g20.1

similar insertion as in 56A10

MNSILWGLIGVIFFLILRIVVPPFNFPRNIPTIPFYVTFLATIWDLDQEDIFNLYLREPLEKYGAVKLYFGSRWNIVVSR

PEFLAQMFKDEDTFAKSGNHKKIPYGVIAAYTGENVISAHGAIWKTFRRAITPGLQLFDHTPLVKNADLFCSLISKRLTK

SGSSSIGGSTSSLDEKESWQFPTA

ASGTLLMSELIQRLSLANISEVALGLDIGTLTEESPELHLKLKNVKSHIFKSLYLN

FPLLDKLPIPSRQRARGYVEDFRRCLMKAVEMNLLNNYTFEQTSFSSSDLIRSYNREEISKKQLIDNIVIIMVAGHENPQ

LLLTTCFYMFGKNRKWQDLVREEVQGCGIENLNDLPLLNSFIFECIRMYPPLSQIINRCTTKKCVLGTDIVLPENVYLGY

NVYSTGRYKSAWGDNADCFIPERWGNNIEEITKEWRHRKNTCAMAAFHGGRRACLGEKLALMEVRIAMAAVLKNFEWTLA

ASWVDKVTPAGPLCPAGLEIEISELSKH

 

>CYP56A12 Kluyveromyces polysporus

Kpol_364p9

62% to CYP56A3   Saccharomyces bayanus

MEFFIKFIIFCFVIFGVFIFKVVSPPLNFPRNIPTIPFYVSFLPIFYSIDQTELFELYLRKPLERYGAVKYFFGSRWNIL

VSKRLFVKQMFKNEDVFAKSGNQKKIPYSLLALYTGDNVISAHGEIWKTYRSVVTNGLQHFDYEPLYKNSKLFCDLIEKS

LETEENSESTVTVGPLIQRLALANISQVVLGFDFGTLTEEKCALQDHLIRIKKQIFHPFFLTFPFFDMLPLPQRRKGFKD

VSAFRNELVSKVRNDLINNYKFEQTTFTSSDLIRAYNNKLINYQQLTDNIVVLLVAGHENPQLAITTILYLLGKYHDSWQ

IAIRNEIGKLSKHDDLLQLPILNSFIFEALRVYPPLSIIINRCTTKTCRLGNDIVIPKGAYVGYHNYSTTHNFESWGDDS

DEFNPNRWGKTIEAIFHNWKVAKMECTLPTFHGGKRACLGEKLALAELRLCIAEILKRFEWKLSKSWNNKMTPAGPLCPL

NLKLDFKKIESE

 

>CYP56B1 Aspergillus nidulans AN2706.1 43% to CYP56A1 547 clan

revised 7/18/07

MLVTLTVLFLGLVGILASFLTYLFTPPQFFPKGLPTIPFYYTLIPLLNQT

LKRAPTDQVTLYHRYLSTPLRTHGAVKLFFGGRWNILITKPSYIAEVLKN

EDLYAKSGNQKKIPHSVLAQYTGDNIISSHGENWKLYSSIFKPGLQRDYD

PSGIWRNASLLVQMISQDIKRKSPVDINPLMQRYALANLSEVLLGTTFDT

LQKPAASLHAFQLLIKPKIFDPIFLNFPVLDYLPLQTREEARKLVTRFTD

ELIETVRKGHTTCDHEKEHTRNLGCRLLYACESGLFTEMQLRHNMISAFL

AGHENPQLLLVSSLFLLAEHPEMQESLRAEISALNDLEPAYNALSALPLL

TSTIYEVLRLYPPISQLINRRTTAPTLLGGEIPIPAGTYVGYNAYATNRD

IGFWGPDANEFKPSRWGNTMEEINALFRRANAKGAFISFHGGRRTCLGQR

FALLEGRVTLAKLLMCVRWEIDPSWQRGMTPAGPLYARNLQLRFSNISGAGKAGAS

 

>CYP56B2 Uncinocarpus reesii

59% to CYP56B1   Aspergillus nidulans

UREG_00550.1

MLTAYSLFSTGLLAVAIITILLLFVAAYLFSPPGSFPRNIPTIPFYYALLPLVKDNDQEVLYRRYLEPLFEKHGAAKIFF

GGRWNILVQRPSYIAEVFKFEDIYAKSGNHVKIPHSVLAEYTGDNIISAHGENWKLYRSVLQPPLQQDQDPEPIWRNARL

LIDLLFEEQKSSAGGSVLLPQLLQRYTLANLAEGLLGTSFETLQRKDAALHEFQMQIKPLIFSPVFMNFPFLDHLNLPSR

KKARQLARQFASKLCAVVQQGHQHAHNDKSTSNVGCSVIGAFEEGILTEKQFRNNMVSVFLAGHENPQLLLVSMIFLLGE

HQAVQEKVRRELFSLGDDELAYPVLQSAPYLTSVIYETLRMYPPISQLINRCTTRPVLLGGKIPLPAGTYVGYNAYATNR

DQEFWGADADEFKPERWGQTAEDINTMFRKANAKGAFISFHGGRRVCLGQKFAMFEARITMAAVLRSVEWKIDPAWPRMM

TPVSNKIQSHDATDINSVGIDRLGHCIREICESDSSGSARNIPNGTMLIYPNSTGTDRQYHARSERAIPKSNRPAPAGRE

EALNLENAPCLDSSAMFIDHSSALATCASKCCVPVSLNTAAQPLP

 

>CYP56B3 Coccidioides immitis

80% to CYP56B2   Uncinocarpus reesii

CIMG_00523.2

MAGLLSSLSSVTLVAVAAITVILFLALVYFFIPPASFPRNIPAIPFYYALLPLVKDGDQEALYHTYLEPLFEQHGAAKIF

FGGRWNILVQRPSYIAEVFKYEDTYAKSGNQKKIPYSVLAEYTGDNIISSHGENWKLYRSILQPPLQQDQDPGPIWRNSR

LLISLLLEEQKTSPHGSVLLPQLLQRFTLANLSEGLLGTSFQTLQQKDAALHKFQMMLKPLIFDPVFLNFPFLDHFNFPS

RQRARRLARQFANELCQTVQRGHQHAHTDKSTSNVGCSVIGAFEQGILSEKQFRNNMVSVFLAGHENPQLLLVSMMFLLG

EHQEIQERVREEVLSLGEDELPYSVLQSAPFLTSVIYETLRMYPPISQLINRRTTKPVLLGGKIPLPAGTYIGYNAYATN

RDKQSWGADADEFKPERWGRTVDEINVTFRKANAKGAFISFHGGRRACLGQKFAMFEARIAMAEILRSLRWKIDPTWPRR

MTPVSGLNQNHDAMDEN

 

>CYP56C1 Aspergillus oryzae

AP007164.1c

third P450 of six on this accession

CDS join(1160825..1161472,1161531..1162415,1162505..1162558)

47% to CYP56B1 AN2706.1 Aspergillus nidulans

41% to CYP56A1

MVMHGLCIIIGKALAVGILFLSICIFSRIVPPRYPRNIPAVPFW

VTLLSLVRDIDQEDIYRRHIQKPLQTHGAIKIFFAGQWNLLIQRSSYLNEIFRNEDVY

QKSGNQKKIPHSVLAEFL (1?)

GDNVISSRGTTWRLYRDIITPG

LQGHFDAGLIAANAEELCSSLLAFQNTVGNCGVPVQDLLQQFTIANVSQVLLQANHKP

TKGDESSLHQLQLAVKREIFKPIFMNFPVLDRLGKLIPCRVRARNVVEQFSAALQYGV

RHGQGTPNASNLGARLMAARDGGVLTGKQFRDNLNVLFVAGQENPQLLLISMLYLLAKHP (0)

DVQSRLRREIDACSTLDPSNVAFSELPYVTCVIYESLRLLP

PISQLINRRTSQDVILGNQIYIPKGTYVGYNCYSTNRDPAVWGPTADEFRPERWGQSN

TEISQCYRQRRARAEFVSFHGGSRACLGEKFALLEARVALFVLVSRLSWSLDPEWPDR

KTPAGPLYPRALRLIFTERK

 

>CYP56C1 Aspergillus flavus

98% to CYP56C1 Aspergillus oryzae

AFL2G_06061

MTLLRITPAKSKRLRVLVGPMRSSVNPASILWHPRGHKRSVFFPKSEQPTSRKMVMHGLCIIIGKALAVGILFLSICIFS

RIVPPRFPRNIPAVPFWVTLLSLVRDIDQEDIYRRHIQKPLQTHGAIKIFFAGQWNLLIQRSSYLNEIFRNEDVYQKSGN

QKKIPHSVLAEFL (1)

GDNVISSRGTTWRLYRDIITPGLQGHFDAGLIAANAEELCSSLLAFQNT

VGNCGVPVQNLLQQFTIANVSQVLLQANHKPTKGDESSLHQLQLAVKREIFKPIFMNFPVLDRLGKLIPCRVRARNVVEQ

FSAALQYGVRHGQGTPNASNLGARLMAARDGGVLTGKQFRDNLNVLFVAGQENPQLLLISMLYLLAKHPDVQSRLRREID

ACSTLDPSNVAFSELPYLTCVIYESLRLLSPISQLINRRTSQDVILGNQIYIPKGTYVGYNCYSTNRDPAVWGPTADEFR

PERWGQSNTEISQCYRQRRARAEFVSFHGGSRACLGEKFALLEARVALFVLVSRLSWSLDPEWPDRKTPVGPLYPRALRL

IFTERK*

 

>CYP56C2 Uncinocarpus reesii

60% to CYP56C1   Aspergillus oryzae

UREG_04911.1

MFSGALIAMLSKVLLAGVVVLTLSLYWVLVPPRHPRNIPAVPFWVTLLPLFFDVDQENTYRRYIRKPLQQYGVIKIFFGG

QWNLVIQRPTYVAEMFKHEEVYQKSGNQKKIPHSVLAEFLGDNIISSRGDDWKLYRNIIKPGLQKTFETQPIVANARKLC

SLLKKSQQALGSQGILIQNHIQCYTTANISKCVLQAEIESLSTENDTLMKLQLAVKREIFKPIFMNFPLLDRFGSFIPSR

AHARELVRRFSSELESRLVRDHTEMPDSEASDNVGSRLIAARDRGELTQQQFRDNLNVTFVAGQENPQLLLISTMYLLGK

YPEVQCRLRSEIEGCGADEPSHLILRDMPYLTSVTYESLRLFPPISQLINRRVAKPVVLGGEIYIPQNTYVGYNCYATNR

DPTVWGKTADEFRPERWGSTTKEISMRYRVARARAEFTSFHGGSRACLGETFALLEMKLSLFILLKNLSWRLDPKWEDRK

TPVRNLPRPLF

 

>CYP56C3 Aspergillus clavatus

53% to CYP56C2

ACLA_064250

MDVFFSEWSKTATGWSLLLFLGALPCLFGLYLCFVAPPRHPQQIPSVPFWVTLLPFFFDVDQQETFQQYIAKPLQTHGAI

KMFFAGRWNVIVQRPAMLAEIFRNEHIYHKSGNQEKIPHSVLAEYL (1)

GSNIISARGDEW

RRYRAVIQPGLQTSFDSSAVFRHAQRLSAVLLGLQERNRRQGVPVQGVLQRYSSANLLRCVLGLSDLSMIKMDQDAPLHS

IQTSLKRYLFQPIFLNFPVLDWLGWAIPSRRQARNLIQDFSTELQMQIVQAHPPGSSTTSVGGRLATAWRDGTLTTQQFR

DNLNVLYVAGHENPQLLLTSALYLLGKFPKVQERLRAEIEQYGTIDEGDTPTVSWERLPYLSATILECARLFPPISQLIN

RRVATPTWLAGNLHLTPGMYVGYHSYATNRDPTTWGPDADEFRPERWGHTHEQIFAAYRRAKARAEFITFHGGPRACLGE

KFALLQMRVSLLVLVRSLSWTLDPEWTDQMMPAGPLHPRGLRLMFITHDKDAAT*

 

>CYP56D1 Clavispora lusitaniae ATCC 42720 = Candida lusitaniae

AAFT01000066.1, CLUG_02306.1

46% to CYP56A1

MLIDIIISNISVSFWCLCFFFLSWKIFRIIYPPFDFPKNIPTIPFYAAFVSSFLGWDQNK

VYAHYYRENLEKYGAAKIYFASRWNILVTKPEYLAQIFKQNEIFEKSGNQHKIPYSLLAE

YTGDNIISTGNKYWKLYRKAVTNSIQFPNLEPLQTNATVLIENLSAASDNGYFPIADILQ

AYTLNNVGDCVIGTNFHKSDNFDISTSLKKVKQEIFRPLFLNFPLLDLLPFPSRIRARKL

VRSFKRNYCNKILNELNEENKGRLGHNLATFWKQGDITEKQFQDNAMIAMIAGHENPQLL

LTSLIYVIAKYPEIQRQLRSEMNSSNYDVKEQIPLLKAVVYETIRLFPPLGLIVNRKTRK

NVILGNGIFIPKGTYVGYNNFGTQRDRNYWGDDADAFRPERWGNDGKKIEEKYAEAKSKC

TLPAFHGRSRACLGEKFALAEVRKAVIEILQNFEISLDPSWKEQLTPAGPICPLKLSVML

KKVCSEHEHNI*

 

>CYP56E1 Candida tropicalis MYA-3404

AAFN01000070.1

45% to CYP56A1

MIMFDIVKYTLIGLFSYLLYVILDIVLPPFNFPKNIPTIPFYVSFLGAYTNLDQRDI

YNLYLREKLEKYGAVKIYFASRWNILITRPEYLLEMFRNEDVYSKRGNHLKIPGSVMATY

TGDNIISAHGELWKLYREVIAKSIQFPDFEPITKNTKSLLEIIDGMIDSDKNHAIIPITD

LFQKYSLANVTESILGVNFKVLEGDQSIMHQKIKYVKLQIFKPFFLNFPYFDSFPIPSRL

QARKEVINFRNWYGQSIIDKHDPQLPNSAATKLVDGLMQEKLTEKQFLDNAIIVMIAGHE

NPLLLMLSLMFVAAKYPKVQEAIRSEIDPTKPYLHSVIYETLRMYPPLGLIINRYTTRPT

KLGNIVIPKGVYCGYNNFGTGRDRNVWGPDSDEFKPERWGRDNIEEINRNYANAKRSAEL

PAFHGRKRACLGEKYALYEVKELLTSILGHYKVTLDASWKEKITPAGPISPFGLKVKFEK

LIVA*

 

>CYP56E2 Candida albicans SC5314

AACQ01000054.1 chromosome R Ctg19-20053, whole genome

45% to CYP56A1 missing N-term runs off the end of the contig

whole seq on orf19_554

MFQLLKYIFIGGFTYLLYLILEIVFPPFNFPRNIPTIPFYVSFLGACTNLDQE

DIYKLYLREKLEKYGAVKMYFASRWNILITKP

151305  DFLLEMFKNEDVFAKSGNHVKIPNSVLATYTGDNIISAHGELWKLYRDVVAQSIQFPDLK  151126

151125  PISKNTQKLLRFLDNEMGSANQATISVTDILQKYSLANVCESVLGVNFNVLDDKQSLMHE  150946

150945  KIKYVKSQIFNPIFLNFPYFDNFPIPSRLKARREVIGFRKWYGQSLIEKYNLQLPN  150778

150777  SAATKLVDSLIKEKLTEKQFLDNAIILMIAGHENPLLLMLSLLYVVSKYPQVQELIRNE  150601

150600  TETTKPYLHSVIYETLRMYPPLGLIINRCTTRITKLGNIVIPKNVYCGYNN  150448

150447  FGTGRDRNVWGSDADIFKPERWGLEIDEINKKFTLAKRSAELPAFHGRKRACLGEKYALF  150268

150267  EVKQFLLAILGEYKVSLDPNWKEQLTPAGPISPLRLKLNFEKLTVS*  150127

 

>CYP56E3 Candida dublinensis

96% CYP56E2   Candida albicans (ortholog)

cdub_14-g334.1

MLQLLKYIFIGGFTYLLYLILEIVFPPFNFPRNIPTIPFYVSFLGACTSLDQEDIYKLYLREKLEKYGAVKMYFASRWNI

LITKPDFLLEMFKNEDVFAKSGNHVKIPNSVLATYTGDNIISAHGELWKLYRDVVAQSIQFPDLKPIFKNTHKLLRFINN

EMGSANQTTISVTDILQKYSLANVCESVLGVNFNVLDDKQSLMHEKIKYVKLQIFNPIFLNFPYFDNFPIPSRLKARREV

IGFRKWYGQSLVEKYNLQLPNSAATKLVDSLIKEKLTEKQFLDNAIILMIAGHENPLLLMLSLLYVVSKYPQVQELIRNE

TEPTKPYFHSVIYETLRMYPPLGLIINRCTTRITKLGNIVIPKNVYCGYNNFGTGRDRNVWGSDADTFKPERWGVEIDEI

NKKFTLAKRSAELPAFHGRKRACLGEKYALFEVKQFLLAILGDYKVSLDPTWKEQLTAAGPISPLQLKIKFEKLTVS

 

>CYP56E4 Candida parapsilosis

65% to CYP56E1   Candida tropicalis

CPAG_05515

MINSLKGILWFRFVHNGTMVMFEFIKVVAASLLGFGLYLLLEIVFPPLCFPRSIPTIPFYVSFLSSWTNLDQRDIYNTYL

REKLEKYGAVKIYFASRWNILVTRPEYLIQVFKHEDIYAKSGNHLKIPGSVLASYTGDNVISAHGPLWKLYREVVSSSIQ

FPDLSTIHQNTNKFLDLLEQDLSTKSSILVNDLLQRYTLANVGDSILGVDFKALDGKESIMHQKIKYIKQQIFKPFFMNF

PYIENFPIPSRIKAKREVEGFRNWFGQNLSSNYNPERGNSAATKLAQALCNEKLTQKQFLDNAIIIMVAGHENPLLLMLS

LLFVVAKYQDVQELVRSETNPEQPFLCSVIYETLRLFPPLGQIINRCTTSSVCLGDIRIPRGVYVGYNNMATGRDRSVWG

ADADQFKPSRWGTTISEINTNYSSSKRLAKLPAFHGRKRACLGEKFALHESKLLLTSVLEKYKVSLDENWQEKITSAGPV

GPLGMKLKFEKV

 

>CYP56E5  Lodderomyces elongisporus

runs of EE probably in an intron seq

59% to CYP56E2   Candida albicans

LELG_03266

MIVLFITILLVLSALIVFPPLNFPRNIPTIPFYVSFLGGMDQLEKFEKYLRTKLEKHGAVKIYFASRWNILVTKPEYLVH

IFKNEDVFAKSGNHIKIPGSVLATYTGDNIISAHGQLWRLYRDVMAQSIQFPNLDPIAENTNNLMKDLENALKFDSSVAI

TDFLQQYSLANVGDCIVGSNLRPMHQKIKYIKLQIFKPFYMNFPSVEMLPIPSRIRAKQEVENFRQWFGDKLMDADHGAA

VKLATAYNEGKLTQKQYLDNCIILMVAGHENPLLLMLSLLYVLAKNPYMQDKIRCNKE

IEEHGKEEGGRVVEEEGEEGEEEEGEEEEEEEEEEEEEEEEK

SPELYLSAVIYETLRMYPPLNQIINRCTTKDTMLGNIRIPKGTYVGYYNMGTGRDKTVWE

SPDTFWPERWGNTIEEVHANYTRAKRLGHLPAFHGRKRACLGEKFALYQCKAMVQAILGKYKISLDEDWEERITPAGPVC

PMNMKLRFSKI

 

>CYP56E6 Pichia stipitis

57% to CYP56E4   Candida parapsilosis

JGI model e_gwh1.2.1.1913.1

MISALIVGVLLIVKSIILPPSNFPKSIPTIPFYVSFLGAYTSMDQEEIYNYYMREKLEKYGAAKLYFASRWNIVIIEPEL

LLQLFKNENIYAKSGNQEKIPYSVLAQYTGENIISAHGEKWRLYRRVVASSVQFPNMEPIVENSKRFLDVLHQELINNSP

IEIIDLLQRYTLANIGDSVLGVKFNTMEEKDTEIHKRIKHVKRQIFQPLYMNFPFLDKLPIASRMEARKEVAQFRSYFSN

ILKTCQNFGRETGASRLRQALDNNTLTEKEFTDNGIILMVAGHENPLLLLLSLFYIVAKYPEVQHKIRQENGDNEAPYLN

SVICECLRMLPPLGQIINRRTTENVILGSNIRIPKGTYVGYNNFGTGRHRKIWGESADEFKPERWGKTPQEISRKYLEAK

IKANLPAFHGRKRACLGEKFALEEVRVLIQTLLQMYQLLLDPNWVEKITPAGPICPLGLKIKFKKIEF

 

>CYP57A1v1 Nectria haematococca L20976

MLVDTGLGLISELQAKLGWAVLLQIVPITIVAYNLLWFIYASFF

SSLRKIPGPFLARISRVWEMKKTATGNIHEIMMDLHRRHGAIVRIGPRRYDFDTMEAL

KIIYRIGNALPKADYYKPFGLPSFPNLFDEQNPARHSAIKKQVASLYTMTALLSYEEG

VDGQTAILKEQLQRFCDQKQVIDLPRFLQYYAFDVIGVITVGKSMGMMESNSDTNGAC

SALDGMWHYASMMAYIPNMHAWWLRLSSLLPIEVPIKGLTEYVERRIIQYRLKAAEFG

DDAALKGENNFLAKLLLMEKKGTVTPVETQQAVGLNIGAGSDTTANALSTILYYLYTN

PRTLHTLREELERYVKDGPISFQQSQSMPYLQAVIKEALRLHPGVGTQLTRVVPKGGL

VIEGQFFPEGTEVGVNGWALYHNKAIFGNDASIFRPERWLEANENINIGGSFAFGAGS

RSCIGKNISILEMSKAIPQIVRNFDIEINHGDMTWKNECWWFVKPEYKAMIKPRRCCL

SRDESLV

 

>CYP57A2 Nectria haematococca X73145

MLVDTGLGLISELRARLGWAALLQIVPVTVVAYNLLWFIYTSFF

SSLRKIPGPFLARISRVWEIKKAATGNIHEIVMDLHRCHGPIVRIGPNRYDFDTMEAL

KIIYRIGNALPKADYYIPFGLPSSPNLFDVQNPARHSAMKKQVASLYTMTALLSYEAG

VDGQTIILKEQLQRFCDQKQVIDLPQFLQYYAFDVIGVITVGKSMGMMETNSDTNGAC

GALDAMWHYSSMMAFIPHMHAWWLRLSSLLPIDVPIKGLTEYVEQRIIQYRLKAAEFG

DDDALKGENNFLAKLILMERQGTVTSTETQQAVGLNIGAGSDTTANALSSILYFLYTN

PRTLRRLREELDTHVKEDPIRFQQSQSMPYLQAVIKEALRLHPGVGTQLTRVVPKGGL

VIEGQFFPEGAEVGVNGWALYHNKAIFGNDASVFRPERWLETKGNLNIGGSFAFGAGS

RSCIGKNISILEMSKAIPQIVRNFDIEINHGDMTWKNECWWFVKPEYKAMIKPRAA

 

>CYP57A3 Nectria haematococca

fgenesh1_pg.scaffold_15000311

Necha1/scaffold_15:835216-837380

61% to fgenesh1_pg.scaffold_36000065  CYP57A1,

MLIDAIRLKMWELYSSRSLSDLNNLLLLGQ

ICYTIVWLFHAFFLSSLRKLPGPFLARLTRLWEVRKVTTGDIHDIMIDLHETH (1)

GPIVRIAPNRYDFNTPEAVKIIYRIGNAFHKSHFYDPFGSPQFKNLL

NELDNSRHAAMRRQLASLYTMSTLMSYESAVDGQTLILREKLLKFCDQGEVIDVPQFLQFYAFDVIGVIT (0)

VGESMGMMESNTDMHGACRDLDAIWRYAAVVGLLPSLHPWVVRISSFLRLRGVSDGLDSFVDAQIRQYKE

KQGSPDANTNEDTTFLSAMLKLERQGKATEAETRLCLSMNIGAGSDTTAISLSSIIYYVYTNPRTLRHLR

EELERATREGRLSDPIKFQEAQELPYLQAVIKEALRLHPGVGTQLTRIVPKGGVVIEGQYFPEG (0)

VEVGVNAYALYHNQDVFGKNASSFQPERWLESESEGIRIAGSFA (0)

FGAGPRSCIGKNISILEMSKAIPQIVQHFDIELEPRDKPWDNECWWFVKPQYKARIRRRTS*

 

>CYP57A4 Nectria haematococca

fgenesh1_pg.scaffold_30000136

Necha1/scaffold_30:357529-359333

63% to fgenesh1_pg.scaffold_15000311, 57% to 57A1 

This gene model seems correct DRN 2/5/06

MLVNSGFGITLAELHGSQALAILVKIFVAGYAFYIILWLVYILFLSNLRKVPGPFLAKLTRLWEVKKVIT

GNIHGIMIDLHKIH (1)

GPIVQIAPNRYDFNTPEAVKTIYRIGNAFTKSRYYEPFGDPSFHNLMNALDNKDHAALR

KQIASLYTMSALLSYEPLVDAQTTILKEKMEGFANRGDVVDLPLFLQFYAFDVVATIT (0)

IGKSMGMMESNTDMYDTCQVLDGMWHYIAVSGLIPGIHLRYIQLAKLLGLTPPTKALDFFIDTQIQHYTE

AMERKGGVGDDEDTFLARMLKLQEQGKATKKDTRHCVTINIGAGSGTTAIGLSSVIYHLYSNPHALNRLR

EELDEFVKAGELSDPVGFQQTQKMPYLQAVTKEALRLHPGVGTQLTRVVPKGGVVIEGQFFPEG (0)

AEVGVNGWALYYNQDVFGDDAAKFRPERWLQPGEDVRIAASFA (0)

FGAGPRSCLGKNVSILEMSKAIPQIVKNFDIEIQYESWKHESWFFVKPEFKAQIKLRVR*

 

>CYP57B1 Nectria haematococca

gw1.57.27.1

43% to fgenesh1_pg.scaffold_15000311, in  CYP57 family, model short at N-TERM

Necha1/scaffold_57:81298-82977

MALLRNLESSPIAQYVLSRLQHAGLKDLAAAFLLTSATLITVLYLVPLVYSLFFSPLRKIPGPLLTRVTH*

WEYRVVIKGDSNREYIRLHKKY (1)

GPVVRVGPNRYSVSQPKDIKTIYELGGKFTKSDYYKPLLNPNPEEQNIFPIQDNERHKERRRRISPLYTISSMVSY

EPAVDDITAVCMRKLYQFAEEGRLLDIPHWMQYYAFNIIGEIT (0)

FNKSFNMIENEGDTTGMIPGIREANDF

LAYLGVIPSLVPWVIGLSAVLGRKSNTSVLVSYTFAQINKNQEANAHSTTKDSKKYNTFLKKVLDMKSQG

RLKLPNVLDACGSNIGAGSDTTAVTLSSTLFFLYSNPNKLAKLRREIDTKAADGSISDPVTFQEAQNMTY

LQAVIKETLRLHPAVGTILPRVVPRGGIELSGHYFPEG (0)

TEVGVNAWVLHYSKDIYGPDPEVFRPERWIGDEKTSIMDSMMFA (0)

FGAGSRTYIGRNISLLELTKVVPQIVRKFDLEFELPGKPMDTTCAWFVYPHYNGRFKIRETKA*

 

>CYP57B2 Nectria haematococca

complete joined model 45% to 57A2, 83% to gw1.57.27.1

MALLQDLQSSLIAQRILSSLQHVSPKDVAIGFLLTAAVLYIFFYLIPLIYSLFFSPLRKIPGPLLARVTR

WWEYRLVSKGDSNLEYIRLHQKY (1)

GPVVRVGPNRYSISQPKDVKTIYELGGKFTKADYYKPLLNPDPEKQN

IFVVLDNDRHKEKRRKISPLYTMSSMVSYEPAVDEMTTVCIRKLYQFAKEGRLIDIPHWM QYYAFDVIGEIT  (0)

FNKSFGMMENEGDTTGMIPGIRAANDFLAYLGIIPNLVPWVLGLSAVLGRKSNTSVLVSYAFAQIDRNREANVHST

TKDTKKYDTFLKKLLDMEAQGRLKLPNVLDACGSNIGAGSDTTAVTLSSTLYFLFRNPDKLDKLRQEIDT

KTAEGSISDPVTFREAQDMSYLQAVIKETLRLHPAVGTMLPRVVPRGGMELSGYYFPEG (0)

TEVGANAWVLHYSKDIYGPDPEVFRPERWIGKEKTSIMDSMMFA (0)

FGAGSRTCIGRNISLLELTKVVPQIVRKFDLELEHPDKPMDTTCAWFVYPHYNGRFKVRGAKASD*

 

>CYP57B3   Aspergillus oryzae

          GenEMBL BAE55311.1

          56% to 57B2, 55% to 57B1

MIGTVLDTVLGNPQGAVGGLFVGSFVIFWVVPFLYNLFFSPLRNVPGPFWARFTILWEFSQLMKGRSHEE

YIKLHKKYGPVVRVSPKRYSVIDPQDVKKIYGFGADFPKSEFYDSLGDPKNIFTVRDNEDHKDRRRKVAS

LYTMSSMVAYEDAVDRMTTLCIKKMTDLAASRKLISIPKFMQFYAFDVIGEITFDQNFGMMENMGDTQGI

IKEIHAMNNTIGIMGLLPELQSTWRAAQKVLFSGTAMGKLTEYIWSQYWKHRNTNSGAKQKSQYDTFLRK

VLELEAAHKVGRMNVLDSCGSNIGAGSDTTGITLSAALWYIYRNPDKLAKLRHEIDTMTAEGRISDPVTY

KQAQEMPYLNAVIKETLRVHPGVGTILARVVPKGGITLTGGYYVPEGTHIGTNAWPLHYSETVYGPDADQ

YRPERWLEDKPQPDYRDSMMFAFGSGSRTCIGRNISLLEITKVLPQIVRKFDLKFEEKKDPWDAW

CAWFVYPKYKCWIEPRKPVENVA

 

>CYP57B3   Aspergillus flavus

100% to CYP57B3   Aspergillus oryzae

AFL2G_00227 revised

MIGTVLDTVLGNPQGAVGGLFVGSFVIFWVVP FLYNLFFSPLRNVPGPFWARFTILWEFSQLMKGRSHEEYIKLHKKYGP

VVRVSPKRYSVIDPQDVKKIYGFGADFPKSEFYDSLGDPKNIFTVRDNEDHKDRRRKVASLYTMSSMVAYEDAVDRMTTL

CIKKMTDLAASRKLISIPKFMQFYAFDVIGEITFDQNFGMMENMGDTQGIIKEIHAMNNTIGIMGLLPELQSTWRAAQKV

LFSGTAMGKLTEYIWSQYWKHRNTNSGAKQKSQYDTFLRKVLELEAAHKVGRMNVLDSCGSNIGAGSDTTGITLSAALWY

IYRNPDKLAKLRHEIDTMTAEGRISDPVTYKQAQEMPYLNAVIKETLRVHPGVGTILARVVPKGGITLTGGYYVPEGTHI

GTNAWPLHYSETVYGPDADQYRPERWLEDKPQPDYRDSMMFAFGSGSRTCIGRNISLLEITKVLPQIVRKFDLKFEEKKD

PWDAWCAWFVYPKYKCWIEPRKPVENVA

 

>CYP57B4 Fusarium oxysporum

81% to CYP57B2

FOXG_01386

MAFLRDAESNPTVQAIFSRLKHVDATAVAAGLPLNTFRSCLFILLHRITL

(sequence gap)

KLNQFAKEGRLVDIPHW MQYYAFDVIGAITFNKSFNMMENEGDTTGMIKGIREANDFLAFWGIVPNLVPWLIGIATALGMTSNTSTLVSYALKQIDN

TRKENAKSTVKGTTKYDTFLKKLLEGESEGRLKTPNLLDACGSNIGAGSDTTAVTLSSALYYLFQNPDKLKKLREEIDQK

AAHGGLSDPVTFQEAQDMPYLQAVIKETLRIHPAVGTILPRVVPRDGMELSGIYFPEGTEVGVNAWVLHYDKGIYGPDPE

VFRPERWLGDEKTSIMDSMMFAFGAGARTCIGRNISLLELTKMVPQIVRKFDLVIEDADKPLDTFCAWFVYPHYNGRFKV

RE*

 

>CYP57C1 Mycosphaerella fijiensis

51% to CYP57B3 Aspergillus oryzae

fgenesh1_pg.C_scaffold_2000556 revised N-term

MPSFEIQHSVLANLSAKQILALTSILLGITIAYQFVYALLLSPVKDV

PGPFLARFTRLWELRQMLRGEFHETIVKLHKQHGPIVRISPNLYSLNSPADQKKIYNLRADLSKTPYY

DAGGHPQRPNLFSTQDASLHADRKKPVANLYSMSSMVHYEDAVDRMIKICLRKFAGFAEKRKKVFVPKFMQAYAFDVIGE

ITINQNFGMMETEADVDGMMELVHASIRYLGTVGIFPEFHSWIFRIVSFLRLRHAGGLIEKIASDTIRKFRHPDRMIEKE

DPNSDPFISKLLRLEAAGKADSSHLMDAIASNIAAGSDTTAITLSAALYYLYRTPRALAALRKEIDEMQKAGKISDPVSF

KEAQDMPYLQAVILETLRLHPAVGYVLPRKVPAGGMELAGRHLPGGTCVGVSAWALHRNPEAYGDDASEFRPERFLVSED

SSSKNRTASLASSFAFGGGTRSCIGKNISLLEMTKAVPQIVRKFDLVFESDEPWELFSTWFVWQKYHCYIEPRKG

 

>CYP58A1 Fusarium sporotrichioides U22462, ALSO U10456 mini chromosome

ESTs BI191705 BI191704 BI191231 BI200306 BI201084

Formerly CYP579A1

MVDQDWIKALVNIPISHAVGVVAASTVIYFLSSCFYNLYLHPLR

KIPGPKLAAIGPYLEFYHEVIRDGQYLWEIAKMHDKYGPIVRVNDKEVHIRDPSYYST

IYTAGARKTNKDPATVGAFDVPTATAATVDHDHHRARRGYLNPYFSKRSITNLEPFIH

ERVTKLLSRFQEHLDNDQVLSLDGAFCALTADVITSRFYGKHYNYLDLPDFHFVVRDG

FLGLTKVYHLARFIPVLVTVLKRLPYSCLRLIAPSVSDLLQMRNEIHERGGDEFLSSK

TSEAKSSILFGALADTHIPPVERTVERMLDEGTVILFAGTETTSRTLAITFFYLLTHP

ECLRKLREELNSLPKVEGDRFPLATLENLPYLNGVVHEGFRLACGPISRSGRVATQEN

LKYKEHVIPAGTPVSQSTYFMHTDPKIFPEPEKFKPERWIEAAEKKIPLKKYITNFSQ

GSRQCIGYTMAFAEMYLAMSRIARAYDVELYDTTKADIDMTHARIVAYPKAIPGKTEH

VGEIRVKVLKAL

 

>CYP58A2 Myrothecium roridum AF009417 65% identical to 58A1 Fusarium sporotrichioides

MAVLNFETVSNAIPLGAVAGGIAGLYFLYLAWNCFYNIYLHPLS

HIPGDKLAVMGPYLEFYHEVIRGGQYLWEVEKMHERYGPIVRVNAREVHVKDSSFYHT

IYTAGSRKTNKDPSAVGAFDVPSSTAATIDHDTHRARRGYLNPYFSKRSLASLEPTIN

ERIGKLAERMNGHMNGKEILTLDGIFSALTADIICSRFYGKNFDYLSVPDYHFVVRDG

FQGLTKLYHLARFLPTMVNGLKVLPEWFVRMFLPPLADLMVMRQEIHTNGAEMFTNSH

TADSKASALVGALADTNIPVHERTISRLLDEGTVFLFAGTETTSRTMAITMFYLLSNP

DCLRKMREELDTLPASEGFAHSLQTLEALPYLSGVVNEGLRLAFGPITRSARVPMNVD

LQYQDYTIPAGTPLSMSTYFVHTDEELYPDPMAFKPERWIKAAEDGVPLKKFLTNFSQ

GSRQCIGINMSFAEMYLTLSRVAREFDFELYDTTMADLDLTYARIVGYPKAIPGKTEG

TGEIRVKVLNRHSPNFEKQELISTA

 

>CYP58A3 Fusarium graminearum old name = CYP579A2 FG03535.1 AACM01000159 FGcontig1.159_scaffold2

MIDQDWIKSLLNIPVSHVAGIFAASTVIYFLSSCFYNLYLHPLRKIPGPK

LAAIGPYLEFYHEVIRDGQYLWEISKMHDKYGPIVRVNAREVHIRDSSYY

TTIYTAGSRKTNKDPATVGAFDVPSATAATVDHDHHRSRRGYLNPYFSKR

TITNLEPFIHERVTKLLTRFQQHLDDDQVLSLDGAFCALTADVITNRFYG

KHNDYLSLPDFHFVVRDGFLGLTKIYHLARFLPGLVTILKRLPYSCIRMI

APSVCDLLQMRDEIQDRGGEEFLSNKSHEAKSSILFGALADSHIPSHERT

VERMLDEGTVILFAGTETTSRTLAITVLYLLTHPECLKKLREELNSLPPV

KDGQYSLATLENLPYLNGVIHEGFRLAFGPISRSGRVATQENLKYKEHVI

PKGTPISQSTYFMHTDPKNFPEPEKFKPERWIEAQQKGIPLKKYITNFSQ

GSRQCIGYTMAFAEMYLALSRIARAYDIELYDTTKADIDMTHARIVGYPK

AIPGKKEHLGEVRVKVLKAL*

 

>CYP58B1 Aspergillus parasiticus

AY371490.1 aflatoxin pathway gene

93% to CYP58B2P Aspergillus flavus NRRL3357

MASNTVYTSLIGLLVALTVRSIYRVYFHPLRKIPG

PKIAAITHLYQHYYDAVKGGKYIWKLDELHRKY (1)

GPIVRFNPNEVHIQDSHYYHHIYAGGAKKQDKDPGFPAVPLFPGVTVTTIKH

NHHRLRRGIIKSFFSKQYVTGLEHVIQSKVNLLASRFTEAYRHGTVLDLKYVFAALTSDL

TTHYVYGTNLNHLAEPDFKNDFLAGMDSVGPWIPVLLVFGRLLKLARYLPACLVPAGEFL

HLWTLSERRVGEILDSQDNGTMGDQKTLLQAMATADVSEEEKTATRLQMETLNIIAGGTE

TTARALAVGVFHLAHKPSLLLQLRDELRTVMPFPDSLASCTQLEQLPYL (0)

AGVVNESLRLSFGFIIRSARVYPNDPLVYEDLVIPPG (0)

TPISQSAYFVCMDPSIFPQPEDFNPDRWVQAAREGNNLHRYLIVFSKGSRHCLGIN (2)

FALAEIYLAIATIARRFDLVPYQTTVEQLQMKRDLGFAAPEKGPFTVRAKVTGLAD*

 

>CYP58B2P Aspergillus oryzae

Supercontig 10: 19609-20001 +

95% to CYP58B2P Aspergillus flavus

even pseudogenes are well conserved

TVTTIKHNHHRLRRGIIKSFFLKKYVTGLEHVVQNEVNLLASRFTEAYHHGTVLDLKY

VFAALTSDLTTHYVYGTNLNHLAEPDF &

KNDFLAGMDSVDPWIPVLLVFGRLLKLAGYFPACLVSAGEFLHLWT &

LSERRVGEILDSQDNGTMGDQKTLLQAMATADIPEEEKTATRLQVETLNIIAGGTET

TARALAVGVFHLAHKPSLLLQLRDELRTVMPFPDSLASCTQLEQLPYSYL (0)

AGVVNESLRLAFGFIIRSARVYPNDPLVYEDLVIQFP (?)

TPISQSAYFVCMDPSIFPQPDDFNPDRWVQAARDGNKLHRYLIVFNKGSR

HCLGIN (2)

FALAEIYLAIATVARRFDLVPYQTTVEQLQM

KRDLGFTAPEKGPFTVRAKVTGLAD*

 

>CYP58B2P Aspergillus flavus NRRL3357 pseudogene

AAIH01000612.1

missing first 29 aa, two frameshifts and one stop codon, bad boundary at 1273

AFL2G_07229

  76  LRKIAGPKIAPITHLY*HYYDAVKGGKYIWKLDELHRKY  (1) 192

 255  GPIVRFNPNEVHIQDSHYYHHIYAGGAKKQDKDPEFPAVPLFPGV TVTTIKHNHHRLRRG  434

 435  IIKSFFSKKYVTGLEYVIQSEVNLLASRFTEAYHHGTVLDLKYVFAALTSDLTTHYVYGTNLKX  623

 626  LAEPDFKNDFLAGMDSVDPWIPVLLVFGRLLKLAGYLPACLVSAGEFLHLWT  781

 783  LSERRVGEILDPQDNGTMGDQKTLLQAMATADVPEEEKTATRLQMETLNIIAGGTETTARALAV  974

 975  GVFHLAHKPSLLLQLRDELRTVMPFPDSLASCTQLEQLPYSYL (0)  1103

1163  AGVVNESLRLAFGFIIRPARVYPNDPLVNEDLVIPFP (?)  1273

1362  TPISQSAYFVCMDPSIFSQPDDFNPDRWVQAARDGNKLHRYLIVLSKGSRHCLGIN (2)  1529

1599  FALAEIYLAIATVARRFDLVPYQTTVEQLQMKRDLGFTAPEKGPFTVRAKVTGLAD*  1769

 

>CYP58B3 Aspergillus nomius isolate AN13137

AY510454.1

8295-10054

92% to CYP58B1 Aspergillus parasiticus

gene CypA of aflatoxin biosynthesis

gene model revised

MVSKTVSTALIGLLVALILRSVYRVFFHPLRKIPGPKIAAITHL

YQHYYDAVQGGKYIWKLDELHRKYGPVIRFNPNEVHIQDSHYYHQIYAGGAKKQDKDP

GFPAVPLFPEVTVTTIKHHHHRLRRGIIKSFFSKQYVMGLEHVIQSKVNLLASRLTEA

YRHDTVLDLKYVFAALTSDLTTHYVYGTNLSHLTEPDFKNDFLAGMDSVGRWIPVLLV

FGRLLKLARYLPACLVPAGEFLHLWTLSERRVGEILGSKNNGTMGDRKTLLQAMATAD

VPEQEKTATRLQMETLNIIAGGTETTARALAVGVFHLANKPSLLLQLRDELRTVMPFP

DSTASWTQLEQLPFL (0)

AGVVNESLRLSFGFIIRSARVYPNDPLVYEDLVIPPG (0)

TPISQSAYFVCMDPSIFPHPEDFNPDRWVQA

ACEGHNLHRYMIVFSKGSRHCLGINFALAEIYLAIATVARRFDLVPYQTTVEQLQMKR

DLGFAAPEKGPFTVQAKVTGLAD*

 

>CYP58C1 Aspergillus nidulans revised

MTVAQWMRWEVPLLLIISFYLTRTVYRLFFHPLTRFPGPKITAATGLYEF

YHDVVRGGKFLWEIEQMHQVY

GPIVRITPWEIH

VKDPHFYDEIYTSARKCNKDPNFVGMFGSPTSMIATVDHGHHRFRRGILS

SFFSKRSIRDISPLIRRKVQRLMERLAEFYQTDTEVDLSAAFAALTADII

STYSYGESFDFLEDGSFHSEVRDAIMETEKLDHISRLFPVVLTVIRHVPV

WAFAIVKPATAVIAGIQKRVAEKSAKALKMTGSSKEEWTMFDALTDPKLP

ACERTMSRIHDEGMILLSGGTEPTANALTVAAFHMINQKDILTTIREEVR

ASGRDVKKASLAELEQLPYLTAVVNEALRLSHGLSIRSPRISPTEALTYK

SYVIPAGTPVGMSNYFVHMDPSIFPHPASFNPNRWIEASKRGEKLDRFIT

AFGKGSRQCIGINLGYAELYFALASFATFFDYQLHDTTEENVRVARDRGV

PFPEAGHLTCLWRMWPSEGMILKAQISPEFRQCLLIVATRKAYARNGSML*

 

>CYP58D1 Aspergillus nidulans AACD01000172.1 Aspergillus nidulans FGSC A4 revised

MNRILAVTVSALASASERLTVSIPVLLILGLVVRTIYRLYFDPLHHIPGPKLAAI

THLYEFYHDVIRGGLFIWEIEKMHREY (1)

GPIVRINPREVHIKDSQFYEEIYAPASGGRRDKDRQAVEIFSSPTA

MVATVDHDTHRIRRKLLTFFFSRRSIERLEPVVHESLSKFLDSLVAAYKE

DTVVDLIDRLQGLTGDVITQYAYGNSYGLQEPQNIGRGITKVVQEGTTQI

HLHRFFPFFERLLRVVPKWFMAQMLPARAAIYDLLNGVREQSIEALKQRD

MSAPPPKKTTMFHALTAPEVPPEERTLQRLQDEGLVLFAAGTETTATILG

VALFHILNNKEVHRKLRNELDQELPTPQAGTTWRQLEKLPYLNATIHEAL

RCSGLTMRQQRIAPTEVVKYKNYVIPPGTPVSMISHFVNMDPDIFDDPQT

FKPERWILAAEKKQNLSRFLVTFGKGNRNCIGMNLAYAELYNTLAAVVRR

FDLELYQTTEENVRFVRDMLLPRSTNGPWKVRVKVIGIREE*

 

>CYP58D2 Aspergillus oryzae RIB40

AP007157.1b genomic DNA, SC023

73% to 58D1

complement(join(191351..191525,191581..191747,

191803..191910,191973..192829,192878..193118))

MGVISVVTFLASAKEHFIISILLLFPIALILRTIYRLYIDPLHH

IPGPKLAAISHLYEFYHDVVRGGLFIWEIEK MHQEY (1)

GPIVRINPREVHIKDPYFYDELYAPAHGWRDKDAKSVEIFSSPNA

LVSTVDHHTHRMRRKLLTSFFSRRSIERIEPVIHE

SLSKFLDSLITAYEEDSVVELIDRLQALTGHVITQYAYGEDYGLHEPQNIGKGIVKVV

QEGTEQIHLHRFFPLIQRFLRLIPSFFMTQLFPARAAMYDLLHGVRKKSIEVLQQKDV

CTPTERTTMFHALTAPEVPPEERTLQRLEDEGLVLFAAGTETTATTLGVAIFHILSDP

MVLTKLRKELEQVMPTPEGLATWRELEKLPYL NGVIHEALRFSGLAMRQQ

RVSPTEVI

KYKDYAIPPGTPVSMLQYFLHTDPALFSDPEKFYPERWMLAAERKESLSRFLVTFGKG

TRSCIGMNLAYAELHTALAAIVRRFDLELYETTAEDIRFVRDKLLPRAKNGPWRVRVK

VVGIRKD

 

>CYP58D2 Aspergillus flavus

99% to CYP58D2 Aspergillus oryzae

AFL2G_03972

MGVISVVTFLASAKEHFIISILLLFPIALILRTIYRLYIDPLHH

IPGPKLAAISHLYEFYHDVVRGGLFIWEIEKMHQEY (1)

GPIVRINPREVHIKDPYFYDELYAPAHGWRDKDAKSVEIFSSPTALVSTVDHHTHRMRRKLLTSFFSRRSIERIE

PVIHESISRFLDSLITAYEEDSVVELIDRLQALTGHVITQYAYGEDYGLHEPQNIGKGIVKVVQEGTEQIHLHRFFPLIQ

RFLRLIPSFFMTQLFPARAAMYDLLHGVRKKSIEVLKQKDVCTPTERTTMFHALTAPEVPPEERTLQRLEDEGLVLFAAG

TETTATTLGVAIFHILSDPMVLTKLRKELEQVMPTPEGLATWRELEKLPYL

NGVIHEALRFSGLAMRQQ

RVSPTEVIKYKDYAIPPGTPVSMLQYFLH

TDPALFSDPEKFYPERWMLAAERKESLSRFLVTFGKGTRSCIGMNLAYAELHTALAAIVRRFDLELYETTAEDIRFVRDK

LLPRAKNGPWRVRVKVVGIRKD

 

>CYP58D3  Aspergillus fumigatus Af293

         GenEMBL XP_753152.1 also AAHF01000003.1

         trichodiene oxygenase predicted

         71% to 58D1

         N-term and C-term parts of broken gene

MRRKLLNNFFSRRSIENIEPVIHNSLSRFLDGLTTAYKEGSVVELIDRLQGLTGDVITEYAYGENYGLQD

PENYGKGIVKVVQEGTDQIHFFRFFPLVSQLLRIIPSWFMGQVFPARAAIYQLLDGVRKQSILALQQKNV

STAPQRMTIFQALTAPEVPPEERNLQRLQDEGLVLFAAGTETTATTLAVALFYN

YILNDKRVLSKLRRELEQI

MPTPQHPTTWRELEKLPYLTAVIREALRFSGIVMRQQRISPTEALKYKDIVVPPGTPVSMIARFVHMDPT

IFPDPTRFHPERWMLAAGREEGLSKFLVTFSRGNRGCIGMNLAYAELYNTLAAVVRRFDLELNQTTPENI

RFVRDKLLPRSKDGSWTVRVKVVGIREQ

 

>CYP58E1 Nectria haematococca

fgenesh1_pg.scaffold_14000019

Necha1/scaffold_14:58063-59829

46% to 58A2 also 48% to 579A2, check 579A2 vs 58A2 = 65%

Note 58A2 and 579A2 are same family and same subfamily,

already revised names 579A2 = 58A3, not yet changed on blast server

This gene model seems correct DRN 2/5/06

Note this gene is near scaffold_14000017

MTENVFWIDKPAIAAAGAAGLFWISYLVCEVIYNLFFHPLSKFPGPKIAAIGTYYEFYHDVIRDGTYLWR

IEEMHRKY (1)

GPVVRINADELHIHDPDFYSKVYAGSKRVNKYGPAVAAFTVPRATLATIDHDVHRLRRSILN

PYFSKRAVTMLEPLINDKVDRLCGRLEEWIGQGTPVDLDAAMAALTADIVSIYFYGKDFDYLGGKDFKFV

VRDAILGLIRFYHFSRFVPAVANFINSLPIPIVRMIQPGAAALLESQQEILVEIQQSLNDKDNVKSKSVI

VGALGDPDIPAEEKTLDRLVDEGVTVIFAGTETTARSISVAIFHLLRDKSLLQKLRDELSTVEKGPDGQW

AYNQLEALPYL (0)

TGCVQEGLRLAHGPVIRLPRVSPNEALQYGDWLIPAG (0)

TPVSESTLLVHLDPSIFPNPNTFDPDRWVRAAAEGVHLSKYICSFTKGTRQCLGIN (2)

LAYAELYIAIAKIATSFEMELYNTSLEDVQVHHIRLTGYPKRGTGEIKATITSKA*

 

>CYP58E2  Aspergillus oryzae

         GenEMBL BAE59845.1

         61% TO 58E1, 47% TO 58A2, 41% to 58C1, 46% TO 58A3

MLDTISESRPNGLATLGVVVATFATYLALKALYNLYLHPLRKFPGPKLAAIGPYYEFYYDVMKDGMFLWE

MERMHQVYGPIVRVNANEIHIRDPHYYSTVYAGNHRSTDKYHDAVAAFSVPQASLATIHHKVHRLRRSIL

NPYFSKAAVTRLESAINERIERMCSRLEETMHYGQVVDLDAGFAALTADIVTTYFYGQNFDYLGNEGFKF

QVRDAILGLIQFYHFTRFFPWIANTIKKLPIPIMRLIHPGAAYLVSSQEEIKDSIRASLDKGNKADAKSV

IVQALEDPTIPPQERTLDRLGDEGTTIIFAGTETTARALSVGMFHILNNKTILKKLREELDTLPGVSSGV

YSHVQLECLPYLTGAVQESLRLSHGPAIRLPRVANDKALKYGDYIIPPGTPVSLCTVLVHQDPCIFPDPH

RFDPERWVKASKEGVNLDKFIAAFTKGTRQCLGINLAYAEIYLTFAKLIRTFNMEIYDTTVDDLTVHHIR

LTGAPKQGTGEVKVKVTEKIL

 

>CYP58E2  Aspergillus flavus

100% to CYP58E2  Aspergillus oryzae

AFL2G_06877 revised

MLDTISESRPNGLATLGVVVATFATYLALKALYNLYLHPLRKFPGPKLAAIGPYYEFYYDVMKDGMFLWEMERMHQVYGP

IVRVNANEIHIRDPHYYSTVYAGNHRSTDKYHDAVAAFSVPQASLATIHHKVHRLRRSILNPYFSKAAVTRLESAINERI

ERMCSRLEETMHYGQVVDLDAGFAALTADIVTTYFYGQNFDYLGNEGFKFQVRDAILGLIQFYHFTRFFPWIANTIKKLP

IPIMRLIHPGAAYLVSSQEEIKDSIRASLDKGNKADAKSVIVQALEDPTIPPQERTLDRLGDEGTTIIFAGTETTAR

ALSVGMFHILNNKTILK

KLREELDTLPGVSSGVYSHVQLECLPYL (0)

TGAVQESLRLSHGPAIRLPRVANDKALKYGDYIIPPG (0)

TPVSLCTVLVHQDPCIFPDPHRFDPERWVKASKEGVNLDKFIAAF

TKGTRQCLGINLAYAEIYLTFAKLIRTFNMEIYDTTVDDLTVHHIRLTGAPKQGTGEVKVKVTEKIL*

 

>CYP58E3 Neosartorya fischeri

53% to CYP58E1

NFIA_042080

Note: this seq does not have an ortholog in A. fumigatus

MLFQDLSFPAVIGAAFGVFAISVVAGCIYDLFFHPLRNFPGPKRAAIWSFYEFYYDVIRDGTYLWEIEKMHHKYGPIVRI

NSRSLHIHDPEYFSTIYAGSGRKVNKELSAVSGYTFPHSTISTLDHDLHRKRRAIVNPYFSKRAIADIEPVIHERLDALI

SRLAEAKGSTVDLTCAFSAFTADVVTYHFYGSHANYIGSKDFKYGLKDALTVLLNLYNLTRFLPVPATTLKNLPLPILGL

INPNFPE VVSAREANKKMVLNYLNKPDEEKNAMKDARSKSVIVSALTDPNVPDAEKTLDRLLDEGETIIFAGIDTTARTL

AVALFHLLNNKDVLMKLRKELQAIAKSDGQQWTTTELEAVPYMRGVVQEAIRLAYGLVVRIPRISPHEALQYNGFVIPPG

TPVSQSTYLVNNDASIFPNPQAFDPERWVKAAQDGVSLDKYMVSFSKGSRGCLGINLAYAKLYLGIARVATSLDMELFET

TEKDIAVYHTRGFAFPKEGDGAVKAQVTGLCK*

 

>CYP58E3 Aspergillus flavus NRRL3357

AAIH02002155.1

Identical to CYP58E3 Neosartorya fischeri (partial seq, upstream part in a seq gap)

VVSAREANKKMVLNYLNKPDEEKNAMKDARSKSVIVSALTDPNVPDAEKTLDRLLDEGETIIFAGIDTTARTL

AVALFHLLNNKDVLMKLRKELQAIAKSDGQQWTTTELEAVPYM ()

RGVVQEAIRLAYGLVVRIPRISPHEALQYNGFVIPPG

TPVSQSTYLVNNDASIFPNPQAFDPERWVKAAQDGVSLDKYMVSFSKGSRGCLGI (2?)

NLAYAKLYLGIARVATSLDMELFETTEKDIAVYHTRGFAFPKEGDGAVKAQVTGLCK*

 

>CYP58E3 Aspergillus terreus NIH2624

AAJN01000124.1

93% to CYP58E3 = ortholog

ATEG_04417.1

36715  MLFQDLSFPAAIGAVFGAVAISVAARCIYDLFFHPLRNFPGPKRAAIWSFYEFYYDVIRD  36894

36895  GTYLWEIEKMHQKY (1)

36993  GPIVRINSRSLHIHDPEYFNTIYAGSGRKVNKELSAVSGYTFPHSTISTLDHDLHRKRRA  37172

37173  IVSPYFSKRAIAEIEPVIHERLNVLISRLAEAKGSIVDLTSAFSAYTADVVTYHFYGTHA  37352

37353  NYIGSKDFKYGLKDALTVLLNLYNLTRFLPVPANTLKNLPLPILGLINPNFPLVVSAREA  37532

37533  NKKMVLGYLNKPDEDKKAMKDARSKSVIVSALTDPNVPDAEKTLDRLLDEGETIIFAGID  37712

37713  TTARTLGVALFHLLNNKDVLMKLRKELQAVAKPDGQQWTTTELEAVPYM  37859 ()

37910  RGVVQEAIRLAYGLVVRIPRISPHEALRYNGFVIPPG (0) 38020

38074  TPVSQSTYLVNNDPSVFPNPQVFDPERWVKAAQDGVSLDKYMVSFSKGSRGCLGI (2?) 38238

38301  NLAYAKLYLGIARVATSLDMELFETTAKAISVYHTRGFAFPKEGDGAVKARVMGLCK*  38474

 

>CYP58F1  Aspergillus oryzae

         GenEMBL BAE64028.1

         46% TO 58E2, 40% to 58C1, 45% to 58D1, 44% to 58B1

         46% to 58A3

MALLVILGIGFVTYLVFLSIYRLYFHPLSHIPGPKLAAITHGYEFYHNIIRGGLFIWELERLHEVYGPII

RINPREVHIKDPDYYDDIYASSARKREKDPVLVAQFGLEGSGFSAIDQETHHQRRAPVAKFFSKRAIENQ

EHLIRDSLNKLVGHFQEACRAHTVVSLDAAFAALTSDVIHQYAYGFNPNNLDKEGFNAKVRDGINGLFQL

AHLLYFFPILQTLMNVMPLPLLQVLNPPAFALASQKKELYEQGAAALEKANSKAGSGTLIDTLAAPSMPE

HMRSAHRLMNEGFALVIGGTETTARSLALGAWHLFTREDIRNKLREELKQVMPTPDSQPTWNDLEKLPYM

SGVISESLRLSTGIANRSSRVAPTEALVYKDYTIPPGTPVSETNYFTLMDPEIFSDPHAFDPERWIRAAA

KGQRLDRYLVNFSKGSRMCVGLNLAYAELFLVIATIVRRFDIELYETPKSNIDFARDFGTPYPDKGNFSV

RALVTGVISE

 

>CYP58F1  Aspergillus flavus

99% to CYP58F1  Aspergillus oryzae

AFL2G_09007

MALLVILGIGLVTYLVFLSIYRLYFHPLSHIPGPKLAAITHGYEFYHNIIRGGLFIWELERLHEVYGPIIRINPREVHIK

DPDYYDDIYASSARKREKDPVLVAQFGLEGSGFSAIDQETHHQRRAPVAKFFSKRAIENQEHLIRDSLNKLVGHFQEACR

AHTVVSLDAAFAALTSDVIHQYAYGFNPNNLDKEGFNAKVRDGINGLFQLAHLLYFFPILQTLMNVMPLPLLQVLNPPAF

ALASQKKELYEQGAAALEKANSKAGSGTLIDTLAAPSMPEHMRSAHRLMNEGFALVIGGTETTARSLALGAWHLFTREDI

RNKLREELKQVMPTPDSQPTWNDLEKLPYMSGVISESLRLSTGIANRSSRVAPTEALVYKDYTIPPGTPVSETNYFTLMD

PEIFPDPHAFDPERWIRAAAKGQRLDRYLVNFSKGSRMCVGLNLAYAELFLVIATIVRRFDIELYETPKSNIDFARDFGT

PYPDKGNFSVRALVTGVISE*

 

>CYP58F2 Aspergillus niger

fgenesh1_pm.C_scaffold_7000005|Aspni1

60% to CYP58F1

MFVYAWLGIGLLAYYVFRSVYLLYFHPLHKIPGPKLAAITYGYEFYYNVIKGGKFVWEIERLHKIYGTVIRINPDEVHIN

DPDYYEEIYTSRARRREKDPVQIAQFDLDGAVFSSITPETHRQRRSHLDKFFSKQAISNIEYLIHDSLDKIIKTYKEAYQ

SNNVVNLDAGFAGLTADVIYQYAFGFNPGNLDAERFNESVRDASNAFFRGIHILNFFPFIKVIMGLMPLGLLRLKNQTSV

QQDEXXXXXXXXX

KVSNSRGAILDAIAGPHMPAHMRTPVRLMNEGLALAIAGTETTARSLSVGTYHLLTRDDIRLKLREELKTVMPTPD

TRVGRTELEKLPYLSGVINESMRLSTGVSSRMPRVAPTEALVYKEHIIPPGNDPSSHVFILMDPNIFPDPHDFDPERWIR

AAEKGERLDRYLVNFSKGSRICLGMQLAYAELFIVIATLMRMFDMELADTPRETIEFARDFGTPYPEKGNLCVKARITIL

VQQ*

 

>CYP58F3 Aspergillus terreus

68% to CYP58F1

ATEG_04068.1

MASLILWGLASIIVWFALRSIYRLYFHPLSKFPGPKLAAITSGYEFYYNVVRRGMFIWEIERMHQQYGPIIRVSPREIHI

KDPDYYDEIYASSARKREKDPVVVAQFGLDGSAFSSVSPEDHRQRRAPLDKFFSKQAVTNMEHIIHECLDKLSRHLQDAC

ESHRAVSLDAGFAGLASDVIHQYAWGFNSGNLDAEDFNEHVRDGISGLFRMAHVMFFFPILQTITNAMPLWLLEKVNPFA

FAMASQKHDLYQRAVAALHNSGTKSGRGSIIDAIAGPSMPANMRTPERLMNEGFSLIIGGTETTARSLSLCFYNLITNEP

VRTKLREELRQVMPAPDSQPTWNQLEKLPYLSGVVLETLRLSTGIASRSPRIAPTEALEYKGYVIPPGTLVSETNYFILM

DPNIFPEPHVFDPERWMRAAAKGERLDRYLVNFSKGSRICLGMNLAYAELFLVIATMIRRFDFELYQTSKKDIDFVRDFG

TPYPDEGNFGIKAIVTRVLND*

 

>CYP58G1  Aspergillus oryzae

         GenEMBL BAE64022.1

         40% to 58C1, 41% to 58D1, 39% to 58B1, 35% to 58A3

         39% to 52E2, 41% to 58F1

         revised 3/18/2009

MNLPLIWIGLFTAVSYLVIRSIYRLYFHPLSNFPGPKLAAVTHLYEFYYDVVKGGKFIWEMQRMHDQY

GPIVRINPREIHIKDPYYFDPIYTSKGQAKDPYIVRTFATPLSTAATVEHDRHRYRRDLVNPFFSKRSVMGVDYIV

QDKVDKVCKRLTQVHERGTVVSLDDLFAALTADVISHYAYGESLGFLDTENLKNEFRDAVASAGLLCHFA

RFFFVVSMVAETMPALVEWMQPSSKGLWEAKRMIEQMARSSLEKDHEKNANSRKTIFDALCAESVRPEER

TVARVRDEAMVVFGAGTETTARVLATGSYYLYRDKPRLEKLRAEIETVMPDSTDHVSLTQLESLPYLTAV

INESLRMAHSVTMRLPRISPTPLAYKDYIIPPG

TPVSQSVYFMHMDPTLFPNPDSFNPERWLEASSKGERL

TKFLVPFSKGSRICLGMNLAYSELYQMFATLVRCFDLEIQTPPESVRITRDFIIGLPDDADYLKVHSLVT

NAL

 

>CYP58G1  Aspergillus flavus

99% to CYP58G1  Aspergillus oryzae

AFL2G_09004

MNLPLIWIGLFTAVSYLVIRSIYRLYFHPLSNFPGPKLAAVTHLYEFYYDVVKGGKFIWEMQRMHDQY

GPIVRINPRE

IHIKDPYYFDPIYTSKGQAKDPYIVRTFATPLSTAATVEHDRHRY

RRDLVNPFFSKRSVMGVDYIVQDKVDK

VCKRLTQVHEKGTVVSLDDLFAALTADVISHYAYGESLGFLDTE

NLKNEFRDAV

ASAGLLCHFARFFFVVSMVAETMPALVEWMQPSSKGLWEAKRMIEQMARSSLEKDREKNANSRKTIFDALCAESVRPEER

TVARVRDEAMVVFGAGTETTARVLATGSYYLYRDKPRLEKLRAEIETVMPDSTDHVSLTQLESLPYLTAVINESLRMAHS

VTMRLPRISPTPLAYKDYIIPPG

TPVSQSVYFMHMDPTLFPNPDY

FNPERWLEASSKGERLTKFLVPFSKGSRICLGMNL

AYSELYQMFATLVRRFDLEIQTPPESVRITRDFIIGLPDDADYLKVHSLVTNAL

 

>CYP58H1  Aspergillus oryzae

         GenEMBL BAE56719.1

         43% to 58B1, 44% to 58C1, 42% to 58D1, 38% to 58A3

         42% to 58G1, 40% to 58E2, 42% to 58F1

MDEFTISAGSLCLLSLVVGFIIQSVYRLFFHPLRKFPGPKLGAISHLYEFYYDVIYNGSYLFKIEQLHQKY (1)

GPVVRINPRELH

INDPYYYEQIYAGSSRIREKDPRFIGVFTTPLPMVATVGHEHHRIRRGLLSSYFSRRALKKAELIIDQKV

DRLLVRFHSAFKCHAVLPLQRVFAALAADIVSEYCYGASQGYLEQKVFQNQMIDAVNYVMSMCHINKSIP

IIPKLLRCVPVGLMEKLGLQMADVIGVRNLIRRQAAKSLDKEWLSHDTNMLSKNVFDAIAAADVAPQEKT

LRRLEEEGAALFGAGIETTARALTVAMFHLISDETMIRKLRDELKQVMLSPASRPTWAELEQLPYLTGVV

NESLRLSFGLVARSPRVSPIESLAYGEYVIPPG (0)

TPVSQSAYFVHMNPQV

FPEPESFNPERWIKAAEKGQYLSRFLVAFSKGSRQCLGMNLAYAELYLTLARIVRLVDMKLVGTTIDNIR

VGRDLGHPAPKAGNFKVKVEVMGIASKS

 

>CYP58H1  Aspergillus flavus

98% to CYP58H1  Aspergillus oryzae

AFL2G_07403

MDEFTISAGSLCLLLLVVGFSIQSIYRLLFHPLRKFPGPKLAAISHL

YEFYYDVICNGSYLFKIEQLHQKY (1)

GPVVRINPREL

HINDPYYYEQIYAGSSRIREKDPRFIGVFTTPLPMVATVGHEHHRVRRGLLSSYFSRRALKKAELIIDQKVDRLLVRFHS

AFKCHAVLPLQRVFAALAADIVSEYCYGASQGYLEQKVFQNQMIDAVNYVMSMCHINKSIPIIPKLLRCVPVGLMEKLGL

QMADVIGVRNLIRREAAKSLDKEWLSHDTNVLSKNVFDAIAAADVAPQEKTLRRLEEEGAALFGAGIETTARALTVAMFH

LISDETMIRKLRDELKQVMLSPASRPTWAELEQLPYLTGVVNESLRLSFGLVARSPRVSPIESLAYGEYVIPPGTPVSQS

AYFVHMNPQVFPEPESFNPERWIKAAEKGQYLSRFLVAFSKGSRQCLGMNLAYAELYLTLARIVRLVDMKLVGTTIDNIR

VGRDLGHPAPKAGNFEVKVEVMGIASKS*

 

>CYP58J1  Aspergillus oryzae

         GenEMBL BAE62179.1

         41% to 58C1 46% to 58C1, 44% to 58D1, 41% to 58B1,

         40% to 58A3, 43% to 58E2, 42% to 58F1, 41% to 58G1,

         41% to 58H1

MDSPRLWTGLAGLITYLIVISVYRLFSHPLRNIPGPKLAAVTHLYEWYYDLFLGGKYLFEIERMHERYGP

IV RINPPEIHINDPKYYDEIYASGTHRRNKDAEFVSFTGLLLSSASTTDHDLHRYRRGLMNNFFSKKSVR

GISYFVEEKVHNLMQRFEAFYRCNKVVRLDDAFAAMTSDVITHYCYGKSWDYLDYANLRTDVRKAVRDLT

CSVHFNRIFPIFLAVLKKLPLRWLYAIHPGRSVVLDIQKTIYEQSAEAIHGDKYKIGHNDAVDKHKTIYD

QLTDPSIPAEERSLQRLQDEGLLLISVGTETTARALTTACFHIASDDQLRTRLREELRTVLPTPTSSVTW

SELEKLPYL (0)

TGTVNESLRLGGFLTTRSPRIAPDEPLTYKEYTIPPS (0)

TPVSSSSYFGHKNPNIFPEPEKFSPERWISAGRNNDHLFKYITSFSRGSRICAGMNLAF

LELYMTLAYFVRRFDVELVDTTVEDM KIVRDMRVGFTHRGEPTVYGRIVRVYED

 

>CYP58J1 Aspergillus flavus

98% to CYP58J1 Aspergillus oryzae

AFL2G_06095

MDSPRLWTGLAGLITYLIVISVYRLFSHPLRNIPGPKLAAVTHLYEWYYDLFLGGKYLFEIERMHERY (1)

GPIMRINPPEIHINDPKYYDEIYASGTHRRNKDAEFVSFTGLLLSSASTTDHDLHRYRRGLMNNFFSKKSVRGISYFVEEKVH

NLMQRFEAFYRCNKVVRLDDAFAAMTSDVITHYCYGKSWDYLDYANLRTDVRKAVHDLTCSVHFNRIFPIFLAVLKKLPL

RWLYAIHPGRSVVLDIQKTIYEQSAEAIHGDKYKIGHNDAVDKHKTIYDQLTDPSIPAEERSLQRLQDEGLLLISVGTET

TARALTTACFHIASDDQLRTRLREELRTVLPTPTSSVTWSELEKLPYLTGTVNESLRLGGFLTTRSPRIAPDEPLTYKEY

TIPPGTPVSSSSYFGHKNPNIFPEPERFSPERWISAGRSNDHLFKYITSFSRGSRICAGMNLAFLELYMTLAYFVRRFDV

ELVDTTVEDM RIVRDMGVGFTHRGEPTVYGRIVRVCED*

 

>CYP58K1  Aspergillus oryzae

         GenEMBL BAE63021.1

         41% to 58J1, 38% to 58A1, 40% to 58D2, 39% to 58C1,

         38% to 58B1, 42% to 58J1, 37% to 58H1, 37% to 58G1,

         39% to 58F1, 39% to 58E2

MVMDQAWTWMALVAIAGLFWITRIFYRLYFHPLAKIPGPKLAAASHLLEFYYDVILGGKFLFQVEKMHQK

YGPIVRINPKEVHIIDPTFYNEIYASGMRKRDKYEGFVRSLAADESTVSTVGSEKHRFRRSILQNFFSKR

SVMEFSSAIGERVEKLMRRLEVFEKTQTPVALDVVFSALTSDMITYICYGKDWKFLDHKDFNCDIHQAGV

DFANFFHFNRFFPWVFMTLRALSPRMLALLIPGRAATFKFQESLLKHAIEMAANEQSDAPSKETEKSRPN

VISNLINPSIPYMERSRRRLEDEVITILVAGTEAPVKVLSMAMYYLGSEPAIGEKLRAELKTILPARTST

ATYAELEKLPYLHGVVYESLRISDSVIARFPRIAPTETLRYKDHILPPGTPMSCSSYFISRNHDLFPNPE

KFDPERWIHAAEKGENLKQHLTAFTKGSRICLGINLTIAELFLTIAHMCRRYHILLHNTEPEDVCTTSDL

LAGYTRRGVLKVHAKLKAVRE

 

>CYP58L1 Aspergillus niger

e_gw1.12.119.1|Aspni1

49% to CYP58D1, 49% to e_gw1.8.187.1

MYTILLPLLVVICVSVRAIYRIYFHPLSKIPGSKLAAATHLHEFYHDVIRGGKFIWEVEKMHRIYGPIVRINPREVHIAD

PSMYDEIYAGCGRKREKDPCMVSAYASSYAALATVDHDLHRARRAPLNRFFSKKAVIELSGVVQQKVSFLAWHLERVNAE

QAVLVLSTAFTALTGDIITHYLYGKDNGYLRERDLVKRNIVWDILAEGTSACHLFRFFPFIPTLTKALPIQLMRLVRPEL

SNVYAMQEQIARQSDKALASERGAKRRTIYLALSDPSVPARERSVARLRDESFIVLLGGTESTAATLTFATYHLLRNKDM

YFKLRQELQQVMPEPTSEADWAQLERLPYLTAVINEALRLGAAALRPARVAPTETLYYKGYEIPPGTPVSTISYFVHRNP

AIFPDPESFNPERWIQAANRGDNLTRYLVPFTRGSRICIGMNLAYAELYMTLAAIVRRFDLELCETHPKDMEFTREMVVQ

RPEKGVWTLKVRVVGINET*

 

>CYP58M1 Aspergillus niger

e_gw1.8.187.1|Aspni1

51% to CYP58K1

MALDTSHIWLALVGIASFYVLRSIYRLYFHPLSGIPGPKLAAVTHLYEFYYDVVIHGRFLFQIEKMHQQYGPIVRINPRE

VHISDPSFYDEIYASSTRKRERDPLAYGAFALPYS MIGTMGHEHHRFRRNILNDFFSKRSVLAISPFIEERVEKLRGRFE

GFYRDQSVVNLSDAFAALTSDVITYYCYGKRWGFIEDKDFRSDVHGGNEENTGLAHFNRFFPIVPETMRKIPLHLMALCL

PGKAGMLQFQGSILSTISENTHDKASEKEDRTIFKRLTDPNLPVAERSQRRIEDEVFTLLGAGTETTASTLMIMTYYVSR

DRSIRDKLRSELKQVLPTPTSTATWPELEKLPYLTAVVNESLRLSYGLIMRLPRVAPTETLKYKDYVLPPGTPMSTSTWF

VHRDPSLFPEPDRFDPERWIKAAEEGVNLTRYIVSFMRGSRACIGMNLAYIELYLTIAHVVRRFNFDVEITSPESMRITR

DRIVPGTEKGLMRVYAKVTDMMED*

 

>CYP58M2 Neosartorya fischeri

55% to CYP58M1

NFIA_057570

Note: this seq has no ortholog in A. fumigatus

MMLSSSWLLPALAYIFLCFLVQSIYRLFFHPLSRYPGPKLTAATFLYEFYYDVIKGGQFLFQIERMHERYGPVVRINPRE

LHIKDPSFYDTVYAGGTHQRDKDPGWVHISGAPLSTFSTVSHDHHRFRRSILSDFFSKKSVTALSPIIEERVLKLMQRFQ

EAYDSRSAIRVDAAFAGLTADVITHYAYGKSWGFLEDPQFRSNIRAAVNETTNAVHWFRFFPFLVTIFRTIPAQIMCFVQ

PSKTALFEFQKSIFDHAAQPKSKRNDSARTIFHRLTDPSIPAEERSLARIQDEAFIILAAGTETTARTLTIATFYMANEP

RIWKKLRDELQSSVLPTLSSTATWAELEKLPYLNAVINEALRLSYGAVIRLPRITPTETLKYKDYVIPPGTPVSMSTYFV

HQDPSIFPDPQTFRPERWIKASDQPEHLTKYIVSFTRGSRICLGMNLAYIELFMTIAYMVRRFDMVLHETTFEDIRIVRD

YVLGLSKHGDLRVFTKVTNMLQE*

 

>CYP58M3 Aspergillus terreus

55% to CYP58M1

ATEG_02828.1

MSLHSSMASFSLLGLAYLVLRSIYRLYFHPLRHIPGPRLAAISSLYEFYYDVVCQGRYLWEIERLHAIY (1)

GPIVRINPREVHIIDPSFYDEIYAPSSRRRDKDAKWVPTFGLSQS

MLSTVGHQQHRFRRSLLSSFFSKKSVLQIGPLIDQQREKLFQHLVNFHRTQEVVRLDSAFVALTSDIISAYCYGESGNFL

DDPSFRSDIRASVVDAASICHLARFLPFLQPLIQSVPEGILRALMPGKTALLDFEHSLASKASKALHEGKPSAAAEETIY

DRLTDKSVPPEERSLCRIQDESSLVLAAGTETTARILTIAIYYLSRDQSMLDKLRAELKQALPTPTSLTTWVQLEKLPYL

TAVVRESLRLGFGITCRLPRVAPEEVLRYKGYEIPPGTAMSTCTMFVHRNPEIFPDPDRFDPERWIEGGQLNNKLTKYIV

SFTRGSRICLGINLAYSELYLLIAHLARRFTFEIYDTSEDDVRVTRDLMVGYTRRGDLQVYAKVAEVVQE*

 

>CYP58M4 Aspergillus terreus

57% to CYP58M1

ATEG_03531.1

METQTLWGILLAFSVYQFFKTIYRLYFHPLSKIPGPRLTAATHLYEFYYDVILGGKFLFQIEKMHQTYGPIVRINPREVH

ISDPTFYDEIYASSTVKRDKDPHLVRIFGAPFSMVGTVGHEHHRFRRSLLNNFFSKRSVLELSPLVTERVQKLMERFEGL

HRSNAVVSLDDAFSALTADVITAYCYGKCWMFLEDESFRNDIRKTVSDMTSYMHINRFFPLVLSAMRAIPLWLLAVLQPG

KSSLLKFQEDIFKETVDSVRDRGKSLSGEKSNPARSTIYDKLSDPSVPPEERTLQRIQDEGVILLSAGTETTGRALCMAA

FHLAYDKSITNRLRDELRQVMPRPTDTVSWTELEKLPYLNGVVYEALRLSYGLIIRLPRISPTDALQYKDHIIPPGTPMS

SSSYIVHRDESIFPNADKFDPERWIRAKNEGKNLSRYLVSFTRGSRTCIGMNLAYMELYLTLASFVRRFDIELHDTTPED

LRFTHDLGIGFTRRGDMQVYAKVTGVVEN*

 

>CYP58N1 Aspergillus niger

e_gw1.9.613.1|Aspni1

42% to CYP58C1, 39% to e_gw1.8.187.1

MDYYKALIVLIVYLCLRTIYRLALHPLRGIPGPKLAASTSLYEFYYDAIKGGKYIWEVERMHRQYGKSFTEAILSSLNLT

RGKGPIVRISPREVHIKDPYFYDEIYTSSSIRKRDKDSKLVASFCAPTASFSTVDHNLHRSRRAVISHLFTRKAVVSHEF

LIQDNVGKLASRLESIHKKGSVFSLKIAAAALISDVLAQYMYGTSTHYLDDPTFRSESVASATELASKIHILRHIPVIAT

IFQLLPLALLRPFRLLSDFCDFRLWLRKQSQDALQGKGGSTVRRGPVFDALLRANVPAEEKTLQRLEDESFTLFSAGSET

VSQALSVIFFHLLKNAEFIKTLRKELKQVMPMPTDLATWSELEKLPFLTAVITEALRLSGTSGRLPRVSPTEPLIYGKYI

IPAGTPVGQSNYFAHRDPAMYPNPNAFDPYRWIHAEDENTNPKPFYAPFSKGSRQCIGINLAYATLYLTVATLIRRFDME

ISDSTEDELRTARDFLIPFPEKG

 

>CYP58P1 Aspergillus clavatus

49% to CYP58H1

ACLA_013370

MASFAMDKDQILVGVLLYISGVIVYRLFLHPLSRFPGPKLAAISSLPEFYHDVLRGGRYIWEIERMHEKYGPIVRINPRQ

LHIKDPCFYDEIYAGGSRRRDKYAEYVNALAADNSSAT TVDHTHHRIRRGFISPYFSKRSVLQFEATISEKLAMLTARLE

EASHAGSVLNLQHVFAALTADIIMQYAYGETHGYLAHESFRNDLVDAVATQLDLLHVNRFFPGLVRLFKDAPPWLLRAVG

LKIADVVEVKLWIRELAAKALARKGRAGGRARETIFDALTAETVPPEEKTLDRLEVESTVIFAAGTDTTARALAVASFHL

MQNQDVLRTLREELKRVMPTPTTSVSWLQLEQLPYLSGV VNESLRLSYALVTRLPRVAPDETLKYGDYMIPPGTPISQSA

YFVHQDPTIFPEPQRFHPERWIRAAEKGENLKRFLVSFNKGSRQCLGINLAYAELYRTIAAVARRFDMELYETTLEDILV

NRDLGFGQPETGRFQVQARVTGIVKE*

 

>CYP58Q1 Aspergillus terreus

49% to CYP58M1, 48% to CYP58P1

ATEG_02820.1

MAVTLPLIVALAFLWFGSKAIYRLYWHPLSHIPGPKRAAISHLYEFYYDVIRGGTYLF

EVEKMHQKY (1)

GPIVRINPREVHISDPDFYDEIYAPAARVRWKDPKQVPMIGAPFSMGA

MGATWHHGHHRFRRSLIKNHFSRQSIEKITTTIRKKAEILCGRLEEASAIARPLNVSDAFAALTSDIIAGYAFDIDLGFL

EDPLFRNDVYRSALELDMLCHVLKFFPFLLKPVRWLPSSVTEVLGLQNKSLGSLQEVIDQRIISSLRTTGQSGHAQEKER

DSIFTSLCHQEVPPEERTLERLRDESLVLLIAGAEATARALAVFVYYMATGSINVQKLRQELRQVMPTCTSQASWAELEHLPYL (0)

SGVVNESLRLSFGAIGRLSRIAPTEDLRYKAHPIPRMTPMSSSAYLIHRNADVFPE

PDCFRPERWIGAAASGVNLHRYLVAFSRGTRQCIGINL

AQCQLYFTIAAVARRFDFELFETTEEDIRVARDYITAFPKDGLFDVKVTVRSRLGD*

 

>CYP58-un1 Aspergillus niger

gw1.19.191.1|Aspni1

43% to CYP58J1 pseudogene fragment C-term, 52% to CYP58M1

TPMGSSSDFIRRDPDNFPSLNNFTSTRWLMENGITIHSTRYLVSFSKGSRGRIEM ()

NLPYFELYLTVAYLVR

 

>CYP59A1 Aspergillus nidulans AACD01000132.1 Aspergillus nidulans revised

stcS Aspergillus nidulans L27825

MYTTIITAVCVLFALHLLDSFYQARQEP

MPSFSLLTGHFGALKQTIDGMPPNATLHSIMLKLSQKFRSGMFY

INMWPFSGTWLVVATPSGAAQIQSLNLSKPNILRRPLETITGGPSLMSMHGETWKRWR

ALFNPGFNPNYLIGLAPLIADEVVVFCEQLRQKARTGTVFQLEPLTLRLTVDTICSVT

LYVVTPVGRWPFLTPDLEIHSSTTKLRTTPLPQRCNGRSNGPRLELPSTPLRRYLTVR

PLVMWYNNRLMNRFIDQEVDRAYREQSGRQSKSVISLALRDYMKEKDGSLEDFKRRVA

PQLRVFLFAGRDTTSSTLLYAFYLLSRHPEALAKVRLEHDQVFGPYHQQVHEKIHQDA

KLLNQLPYTTAVLKETLRLFPPSASMREGGPGVEITDDNGQVYPTAGCNVWTLTVALH

HNSAHWAEAESFIPERWLVGSDHPLYPAKGAWRAFEFGPRSCIGQTLAMLELRVALAM

TLREFDIAPAYDKWDHIYPNDAVKEFNGHRAYQAEKGGGGAHPADGMPCLVTFRV

 

>CYP59A3     Aspergillus parasiticus aflatoxin pathway gene cluster

            GenEMBL AY371490

MPEFSLLAGHFGTLKKTIQGMPSDATLHSIMLKISQQFSSGIFY

INMWPFSGTWMVVSTPSAASQIQKLNLTKPVILRRPLETVTGGPSMMSMHGETWKKWR

ALFNPGFNPGYIIGLAPNITDEVATFWLSCAKGQQGEVFPLESLTTRLTVDSICSVVL

DTQLHHQIKDHPLATALQRQIDWTTFGTTFNPLKRYLTIRPLVLWYNNKVMDRIIGGE

VDRACRTPPDHPSKSVISLALREYLQEQASTNSTRSLAEFKRLVAPQLRVFLFAGRNT

TSSTLIYSYYLLAQHPEVLAKIRAEHEDVLGADPAEAQGRIKEDVQLLNKLPYTTAVI

KETLRLFPPSASMREGRPDAEIIGEDGQRYPTVGCNVWTLTVALHHNSDYWDQVENFI

PERWLVGPEDPLYPVKGAWRAFEFGPRSCIGQTLAMLELRIALAMTIRQFDITPAYDE

WDSIHPATTAKEVNGHRAYQAERGAGGAHTADGFPCRVKERC

 

>CYP59A4  Aspergillus oryzae

         GenEMBL BAE59520.1 also BAE71324.1

         72% to 59A1

MPEFQLLAGHFGTLKKTIQGMPSDATLHSIMLKISQQFPSGIFYINMWPFSGTWMIVSTPSAASQIQKLN

LSKPAILRRPLEMVTGGPSMMSMHGETWKKWRALFNPGFNPAYIIGLAPNISDEVAIFCAQLRKIAQQGE

VFPLESLTTRLTVDSICSVVLDTQLHHQIKDHPLATALQRQIDWTSFGTTFNPFKRYLTIRPLVLWYNNK

FMDRIIDGEVDRAYCTPPGHPSKSVISLALREYLQEQASNNSTRSLAEFKRLVAPQLRVFLFAGRNTTSS

TLIYTYYLLAQHPEALAKIRAEHGDVLGADPAEAQGRIKEDVQLLNKLPYTTAVIKETLRLFPPSASMRE

GRPDAEIIGEDGQRYPTVGCNVWTLTVALHHNSDYWDQVENFIPERWLVGPEDPLYPVKGAWRAFEFGPR

SCIGQTLAMLELRIALAMTIRQFDITPAYDEWDSIHPATTAREVNGHRAYQAERGAGGAHPADGFPCRVK

ERC

 

>CYP59A5  Aspergillus oryzae

         GenEMBL BAE48804.1

         92% to 59A4, 71% to 59A1

MPEFKLLAGHFGTLKKTIQGMPSDATLHSIMLKISKQFQSGIFYINMWPFSGTWMIVSTPSAATQIQKLN

LTKPAILRQPPETVTGGPSMMTMHGETWKKWRALFNPGFNPAYIIGLAPNITDEVATFCAQLRKKAQQGE

VFPLESLTTRLTVNSICSVVLDTQLHHQIKDYPLATALQRQINWTSFGTTFNPLKRYFTIRPLVLWYNNK

VMDRIIGGEVDRAYRTPPDHPSKSVISLALREYLQEQASSNSTRSLAEFKRLVAPQLRVFLFAGRNTTSS

TLIYTYYLLAQHPDILAKIRAEHEDVLGVNPEEVQGRIKEDAQLLNKLPYTTAVIKETLRLFPPSASMRE

GRPDAEIIGENGQRYPTVGCNVWTLTVALHHNSDHWNQVESFTPERWLVGPEDPLYPVKGAWRAFEFGPR

SCIGQTLAMLELRIALAMTIRQFDITPAYDEWDSIHPATTSKEVNGHRAYQAERGAGGAHPADGFPCRVK

ERF

 

>CYP59A5  Aspergillus flavus

96% to CYP59A5  Aspergillus oryzae

AFL2G_07219

MYLSLLIALGVVSFIRFLTAFYQARQEPMPEFKLLAGHFGTLKKTIQGMPSDATLHSIMLKISKQFQSGIFYINMWPFSG

TWMIVSTPSAATQIQKLNLTKPAILRQPLETVTGGPSMMTMHGETWKKWRALFNPGFNPAYIIGLAPNITDEVATFCAQL

RKKAQQGEVFPLESLTTRLTVDSICSVVLDTQLHHQIKDHPLATALQRQINWTSFGTTFNPLKRYFTIRPLVLWYNNKVM

DRIIGGEVDRAYRTPPDHPSKSVISLALREYLQEQASSNSTRSLAEFKRLVAPQLRVFLFAGRNTTSSTLIYTYYLLAQH

PEVLAKIRAEHEDVLGADPAEAQGRIKEDVQLLNKLPYTTAVIKETLRLFPPSASMREGRPDAEIIGADGQRYPTMGCNV

WTLTVALHHNSDHWNQVESFIPERWLVGPEDPLYPVKGAWRAFEFGPRSCIGQTLAMLELRIALAMTIRQFDITPAYDEW

DSIHPAPTAKEVNGHRAYQAERGAGGAHPADGFPCRVKERF

 

>CYP59A6 Aspergillus nomius isolate AN13137

AY510454.1

join(49221..49702,49768..50767)

94% to CYP59A5 Aspergillus flavus

gene VerA of aflatoxin biosynthesis

MPEFKLLAGHFGTLKKTIQGMPSDATLHSIMLKISQQFPSGIFY

INMWPFSGTWMIVSAPSAASQIQKLNLTKPAILRRPLETVTGGPSMMSMHGETWKKWR

ALFNPGFNPAYIIGLAPNIADEVATFCTQLRKKAQQAEVFPLESLTTRLTVDTICSVV

LDTQLHHQIKDHPLATALQRQIDWTSFGTTFNPVKRYLTIRPLVLWYNNKVMDRIIDS

EVDRAYRTPPDRPSKSVISLALREYLKEQSSSSSTRSLAEFKRLVAPQLRVFLFAGRN

TTSSTLIYTYYLLAQHPEVLARIRAEHEDVLGGDPADAQGRIKEDVQLLNKLTYTTAV

IKETLRLFPPSASMREGRPDAEIIGEDGQRYPTVGCNVWTLTVALHHNSDHWQQVESF

IPERWLVGPEDPLYPVKGAWRAFEFGPRSCIGQTLAMLELRIALAMTIRQFDITPAYD

EWDSIHPATTAREVNGHRAYQAERGAGGAHPADGFPCRVKERC*

 

>CYP59A7 Aspergillus ochraceoroseus strain SRRC 1432

AY092402.3

join(9134..9615,9669..10671)

gene StcS/AflN in aflatoxin/sterigmatocystin biosynthesis

76% to CYP59A5 Aspergillus flavus

MPEFKLLAGHFAALKQTIQGMPPNATLHSIMLKLSQQFPSGIFY

INLWPFSGTWMIVATMTAASQIQSLNLTKPAILRRPLETITGGPSLISMHGETWKRWR

ALFNPGFNPAYLIGLAPNIADEVAVFRNQLRKKAQQGDIFSLEPLTLRLTVDTICSVA

LDARLFHQQKDHPLAVALQRQIEWASFGTTFNPVKRYLTIRPLVLWYNSRLMNRLIGK

EVDRVHNARPGYSSKSVISLALKQYLKEQSNGDTRQSLEAFKRQVAPQLRVFLFAGRD

TTSSTLLYTFYLLAKHPEILERVRREHDEVFGTDIKKAQSCIAEDPQLLNKLPYTLAV

IKETLRLFPPSASMREGRPDVEIVGDDGRRYPTAGCNVWTLTVALHHNSNHWPEVESF

IPERWLVGHEDPLYPAKGAWRAFEFGPHSCIGQTLALLELRIALAMTLREFNITPAYD

EWDRLHPRDTIKEVNGHRAYQMEKGGGGAHPADGLPCRVTLRTT*

 

>CYP59B1X  # Fusarium graminearum (Gibberella zeae PH-1)

          GenEMBL AACM01000117.1

          52362-54017 (+) strand, one intron

          renamed CYP5071A1

 

>CYP59C1 Aspergillus nidulans AN5766.1 44% to 59A1 586clan?

Revised 7/18/07

MAVTNLVLTLSIPLLTVIGYGLYCGFQHRRKINELRKRGIPMPKDWSWLT

GHLLSLKKYTDRLPADAHVLLPTHELAVEFADTEMFLMDTWPVFPALVMV

YDPDAALQISTKYNLPKSAIFPSLMHPITGGPSMISMNDAEWKKWRSIFN

PGFSAGNMVDQVSTVVDSVQVFCDILREKAGTGLVHLDDLTTRLTMEVIL

KVTLDMDSNYQRSDNEMVHALNTITKWHSFWDPRVRANPLRPLVQKYYGR

VMDRCIRKELDKRFAEMQQGQRSASTSKRVKSVIALALEAYLADYHQKDG

KASKLDDNFAQYATHQIRLFLFAGNDTTSSSIVYVYHMLSKHPKALARVR

QEHDRIFGTLPSAAPQLLKSNPALLNQCPYTLAVIKETLRLFPPASTTRE

GRDGVTLTDRLGNSYPLGHTIGAEIIHPTIHKNPRLWPQAEEFIPERWLV

DPGHELYPSPAAWRPFEHGPRNCIGQTLVYNEMRIVIVMTARTFNIRPAY

DEWDAMHAAKEGLL (0)

TVHGERAYQTEKAGTHPADGYPCHVALCSGSPIS*

 

>CYP59C2 Aspergillus niger

e_gw1.2.1390.1|Aspni1

63% to CYP59C1

MAFINLLLTICLPVVVSVVAYGLHALYQHRSKINRLRKQGIAMPPGWNWLTGHMFVLSEYLNRLPPDANVVLATQELAWE

YTDTEIFLLDVWPMSPAQYIVFYPEAASQATTKFNLPKTVIHDRFMRPITGGPSMISVGNAEWKPWRSIFNPGFSAGSMQ

DLLPEVIKSVSVFCDKLREKADSGEMFALDDLTTRLTMDVILKVTLDADVDHQNSDNIIATALGQITKWHSFWDPRVRAN

PLRPLVQGYYGRVADKWIRKALADRFSEMKQVKRDASIRSKRAKSILTLALEAYLENKNEEISEATELDDDFAKHVTYQI

RLFLFAGNDTTSSSIAYVYHLLSKHPEALTQVREEHDRIFGPDPSAAVQLLCEQPSLLNKCPYTMAVIKETLRLYTPAST

MRQGIDGLSLTDRHGNRYPLADDLSVSVLHQAVHLNPRVWPRAREFLPERWLVDADHELYPDPAAYRPFEQGPRNCIGQT

LVYNEMRTVLVMTARTFEIKPAYDEWDATKAKQKGWFDQIAESVGFQNKKPKLLHGERAYQSEKAGTHPVDGYPCRVSLV

A*

 

>CYP59D1  Aspergillus oryzae

         GenEMBL BAE66084.1

         AP007175.1

         55% TO 59D2, 41% to 59A1, 41% to 59C1

470087 MVIAVSDLVGSYGARVALVLALVIVLRFLQEMLKVRLLFYRLRKQ

GLPMPKWNFAAGNLQMLPDLMKRHP

KGSQQSEAFTLLSYEFASSDNCFYIDVWPFTKPLLVVNSP DLAVQACQTYALPKPPVLAKFFNPFAGGPS

IFTTNGPEWKRNRG LFNPAFSTSNILQHTPHI 470671

VEEAEEYVEILREHARKGDTFTLDKMTCDYVLDIIGRVAM (2)

KARLHSQRGRNPVAAALRSQVEWHCQDEQMNPFIRWNPMRPIMQWCNGRTM

NQYIGAELDKRYEAWTQNKPSTRANSIIDIVLAEYMSTRPVRAALDPEFKSWAT

IQLRTFLFAGHDSTAATIVYSIYLLSKHPEILSKVRTEHDEVFGSDISAAAGILKQHPEL

INRLPYTLAVIKETLRLFPAASALREGQPGVYLQDKNGTKYPTEGLCIWIIHGGIQRNPN

YWPDPHAFKPERWLVGPDHPLYPPKGAWRPFEQGLRDCIGQALALLDVKITLVLTLREFD

FQDQYAHWDRLHPRSGPKTVFGERAYQIPQ GGSHPVDGLPCRVSLRNQITK*

 

>CYP59D1  Aspergillus flavus

99% to CYP59D1  Aspergillus oryzae

AFL2G_11439

MVIAVSDLVGSYGARVALVLALVIVLRFLQEMLKVRLLFYRLRKQGLPMPKWNFAAGNLQMLPDLMKRHPKGSQQSEAFT

LLSYEFASSDNCFYIDVWPFTKPLLVVNSP

(seq gap)

LFNPAFSASNILQ

HTPHIVEEAEEYVEILREHARKGDTFTLDKMTCDYVLDIIGRVAMKARLHSQRG

RNPVAAALRSQVEWHCQDEQMNPFIRWNPMRPIMQWCNGRTMNQYIGAELDKRYEAWTQNKPSTRANSIIDIVLAEYMST

RPVRAALDPEFKSWATIQLRTFLFAGHDSTAATIVYSIYLLSKHPEILSKVRTEHDEVFGSDISAAAGILKQHPELINRL

PYTLAVIKETLRLFPAASALREGQPGVYLQDKNGTKYPTEGLCIWIIHGGIQRNPNYWPDPHAFKPERWLVGPDHPLYPP

KGAWRPFEQGLRDCIGQALALLDVKITLVLTLREFDFQDQYAHWDRLHPRSGPKTVFGERAYQIPQGGSHPVDGLPCRVSLRNQITK*

 

>CYP59D2  Aspergillus oryzae

         GenEMBL BAE58153.1, AP007155.1

         37% to 59A1, 37% to 59C1

2825205 MGANTLGWDGLTSRIAVAVATVCLTSFVYKLIKMRLMFYRLRKKGL (0) 2825068

2825008 PTPPWNPILGNLAVMAQLQKKWPSDSREAESFALLSTEAPGCEAGFYVDVWPFSIP

MLVVTSPALAVQACQTYDLPKPDVLQPFINPMAGGSDNLFVSNGAHWKQARELFNHGFSMAAAMSHMTYI

LEEAQVFVQMLKDHARKGDTFSLDALTCRYVMDIIGNVA LNTRFRFQEQHNPIAAAMRDTIELECGIETS

NFLSRWNPRRLYRQWQNGRTMDYLIGVELDKRYKEWRETAKSSSHPRTQSIMDMVIAEYMKTRPQAQQQQ

ELDPEFKRWATIQIRLFLFVGHDSEATTIIYSLYLLSKNPGVLIKVRAEHDRVFGAGVSSAYDVLTDHPE

KINQLSYTHAVIKETLRLFPPANGLRGGLPGVSLRDEQGRIFPTEGCAIWIVHTAVHRNPSSWPQPHAFI

PDRWLVEPGHPLYPPAGGWRPFEQGPRNCIGQNISLLGIKASLAMLVRQFDFHDAYAEYDRLHPSTGLKT

MFGERAYMIQKGAGHPAQGFPCKVTLR

 

>CYP59D2  Aspergillus flavus

99% to CYP59D2  Aspergillus oryzae

MGANTLGWDGLTSRIAVAVATVCLTSFVYKLIKMRLMFYRLRKKGL (0)

PTPPWNPILGNLAVMAQLQKKGPS

DSREAESFALLSTEAPGCEAGFYVDVWPFSIPMLVVTSPALAVQACQTYDLPKPDVLQPFINPMAGGSDNLFVSNGAHWK

QARELFNHGFSMAAAMSHMTYILEEAQVFVQMLKDHARKGDTFSLDALTCRYVMDIIGNVALNTRFRFQEQHNPIAAAMR

DTIELECGIETSNFLSRWNPRRLYRQWQNGRTMDYLIGVELDKRYKEWRETAKSSSHPRTQSIMDMVIAEYMKTRPQAQQ

QQELDPEFKRWATIQIRLFLFVGHDSEATTIIYSLYLLSKNPEVLIKVRAEHDRVFGAGVSSAYDVLTDHPEKINQLSYT

HAVIKETLRLFPPANGLRGGLPGVSLRDEQGRIFPTEGCAIWIVHTAVHRNPSSWPQPHAFIPDRWLVEPGHPLYPPAGG

WRPFEQGPRNCIGQNISLLGIKASLAMLVRQFDFHDAYAEYDRLHPSTGLKTMFGERAYMIQKGAGHPAQGFPCKVTLR*

 

>CYP59D3 Aspergillus niger

e_gw1.12.714.1|Aspni1

63% to CYP59D2

MPPWDPIFGHLRIMPGLAKKCPSDALQSQTFAVLSMEYPGLQNGFYIDVWPFMCPMFVCTTPPLAVQACQTYSLAKPTEL

LAPFINPMAGGDNFFTTNGAAWKRDRDLFNHAFSMAAVLGHVDYILEEAEIYVEILREHAKKGDTFSMDDLACNYMMDVV

GNVALNTRFNYQTGHNPIAAAMRSTIDLECGREGENNPLRRWNIHRLYRQWRNSQIMDHHIGLELEKRYQEYLQQNQSTK

PRGKSIMDIVIAEYMKHRPASQTHTATLDPEFKAWAIIQIRLFLFVGHDSTAVTIIYCLYLLSKYPDALVKIRAEHEQIF

GPKTTSVATQIKEHPEKTNQMPYTTAVIKEALRLFPPANGLRFGRPGVSLTDTHSSDGRTFPVDDCAVWIVHTAIQRNPG

YWPHAHKFVPDRWLVEPGHELYPPTGGWRPFERGARDCVGQNMALLAIKISLAMVVREFDFDSQYEEWDRMNPASGAVRT

MFGERVYMVAKGAAHPAQGYPCKVRLAA*

 

>CYP59E1 Mgr034 Mycosphaerella graminicola

39% to 59C1, 9/10 top hits are CYP59, but only 34% to 59D3

N-term is short

MAISNLKLYQEFVIKHSIPKHPLVAEFMENFGGQSNLVSSEGATWKRWRSVFNPGFSNSHIMSQVSSIVDVAQTFCEIMN

DHAKNNTIFRMETATTKLTVDVIGKIVLDLDLNSQKGDNILADTFTSQVRWQSMGAQYQPSELWDIRRPIVQRYNNWVMS

RYLKEKVQERFATREGRGKSKHVVDLALEVYLKEVKGTNSDGGNIKSLDAEFMEAVIANMKTFVFAGHDTTSTVIGCAYY

YLSRNPEALTKLRNELDEVFGPDPSTVAQQLKDDPLLLNKMDYAVAVCKETLRLMPPASTVRAAAPGYRLIDPDTGEHIP

TEHMLVWPSATGIHRHPKYFPDPHTFKPSRFLPGDDTGSNTAAWIPFSKGPRNCIGQELAMIEAKIVLAMTVRTWDFVPA

YDELEKLEGDGTGYPNLKTGILEQYGERMYQIQLGTAKPAEGLPCRLRFTGQ

 

>CYP59E2 Mycosphaerella fijiensis

61% to CYP59E1 Mycosphaerella graminicola

e_gw1.7.674.1

MQLQPLTGTHLIWAVGLVLAAYILRFLQRLHFHRTLVNGLPGPPHSYAFGSLISMGKVAAKQPPNAAPQALMQCLKDAYD

LPDAFYFDSWPLGPPIMVITNPDMANQITIKYNPPKHPLVAEFMVNFGGKYDLVSEEGAVWKKWRSAFNPGFAPGHLITQ

VSTIVDECQVFCDIMEKRARNNELFRMEPAATKLTVNIIGKIVLDLDLNAQHGKNVLVDSFMSQIRWQKIGLQYQPSELW

DIRRPIIQRYNNWRMHRWLSARLDERFAGLEARGKSKHVIDLALEAYLKEIKGQKGSVDASKIKGLDPDFKEAAISNMKT

FTFAGHDTTSSAICYSFYYLSKYPETLAKIRKEHEEIFGPDPDVVAQKLKSDPHLLSKMEYTLAVTKEVLRMQPPASTIR

LGQANLTLHNPDTGENMPTNHFMLWPVNVGMHRNPRNWPNPDIFDPERFIPGSAVYAENNKDAWVPFSKGVRNCIGQELA

IMEAKVILAMIVRKFDFISAYNELEKLVGDGSSYPNYLSGVREQFGERAYQVQLGTAKPAEGMPCRMKLAKR*

 

>CYP60A1 Aspergillus parasiticus L40839

MHLPPFHNGTPGILAADHAHHRRYRRLLAFSFSDKGLRHERSLI

ERSIDLLITQLHENCGQGSGLALWFNWATFDIIGDLAFGDSFGCLENVQTHPWIASIQ

GNVKLIPILNAFRRYRLDGLLRLLGSRKLLEQRRRNAQFTTDQVDRRLKNSSTPRGDI

WDAVLAQKPDGEPPMTRDEMISNASAIVLAGSETSATLLSICTWLLLKNPSHLHQLTS

RIRSQFTHASEIDSQSVSRVEGLQAVLEESLRLYPPVPMQSNRIVPQAGAYIAGGWVP

GGTSVGLQQFVACRSSSNFHRPDEFLPERWQGQGEFAHDRREVSQPFSIGPRNCIGRQ

LAYVEMRLILVKLLWHFDLRLDTTRMKDTDWLAEQGIWILWDKNRCGLRWNLAMSSSS

NYSL

 

>CYP60A2 stcF Aspergillus nidulans U34740 AN7818.1 53 clan

revised 7/19/07

MILPLILVLYLLSTAAYRLWLHPVRNYPGPCWWAVWRVPYLKGT

IRGTIVRDIQRLHNQYGPVVRIAPDELSYITPEAAKPIYTSSPEFPKDPMLLPPFHNG

APGILAADYAHHRRYRRLLASAFSEKGLRAQQGMIQSHIDRLMTRLQGNCSSGSLDMT

VWFNWATFDIIGDLAFGEPFGCLERMETNPWIASIQGNVKSIPILNALRRYRLDRLIE

FLAPPRLLEMRRRNAQFTAEKVDRRLKHATTTRGDLWDSVLADPPDGEPPMSRAEMVS

NASAIVLAGSETSATTLSGCLWLLLTNPEYLQQLTERIRARFSTATVIDAQTVTQIQG

LQAVLDESLRLYPAVPMQSNRIVPPPGARLAGSWVPGGTSVAVQQFAACRSPTNFHRP

DEFIPERWEKEGEFINDRREASQPFSIGPRNCIGRQLALAEMRLILVHLLWHFDIELD

RRRMENMDWMAVQGI

WILWDKKPLWVVLKNRST*

 

>CYP60A3 Aspergillus parasiticus avnA U62774

MGGDGWPSDGHILLLIVLTVLTPPSLALYRLWIHPLRSYPGPRW

WAIWRGPYILSNIRGNLVRDLQRLHQQFGPVVRIAPNELSFIVPEAASPIYTSNPEFP

KDPMHLPPFHNGTPGILAADHAHHRRYRRLLAFSFSDKGLRHERSLIERSIDLLITQL

HENCGQGPLDLALWFNWATFDIIGDLAFGDSFGCLENVQTHPWIASIQGNVKLIPILN

AFRRYRLDGLLRLLGSRKLLEQRRRNAQFTTDQVDRRLKNSSTPRGDIWDAVLAQKPD

GEPPMTRDEMISNASAIVLAGSETSATLLSGCTWLLLKNPSHLHQLTSRIRSQFTHAS

EIDSQSVSRVEGLQAVLEESLRLYPPVPMQSNRIVPQAGAYIAGGWVPGGTSVGLQQF

VACRSSSNFHRPDEFLPERWQGQGEFAHDRREVSQPFSIGPRNCIGRQLAYVEMRLIL

VKLLWHFDLRLDTTRMKDTDWLAEQGIWILWDKKPLWVTLEPRNE

 

>CYP60A5  Aspergillus oryzae

         GenEMBL BAE71325.1, BAC45242.1, BAE59521.1

         95% to CYP60A3

MGGDGWPSDGHILLLIVLTVLTPPSLALYRLWIHPLRSYPGPRWWAIWRGPYILSNIRGNLVRDLQRLHQ

QFGHVVRIAPNELSFIVPEAASPIYTSNPEFPKDPMHLPPFHNGTPGILAADHAHHRRYRRLLAFSFSDK

GLRQQRSLIERSVNLLITRLHENCGQGPLDLTLWFNWATFDIIGDLAFGNSFGCLDNVQTHPWISSIQGN

VKLIPILNAFRRYRLDGLLQLLGSRKLLEQRRRNAQFTTDQVDRRLKNSSTPRGDIWDAVLAQKPDGEPP

MSREEMISNTSAIVLAGSETSATLLSGCTWLLLKNPGHLHQLTSRIRSQFTHASEIDSQSVSRVEGLQAI

LEESLRLYPPVPMQSNRIVPQSGAYIAGGWVPGGTSVGLQQFVACRSSSNFHRPEEFLPERWQGQGEFAH

DRREVSQPFSIGPRNCIGRQLAYVETRLILVKLLWHFDLRLDTTRMKDTDWLAEQGIWILWDKNPLWVNL

EPRNE

 

>CYP60A5  Aspergillus flavus

98% to CYP60A5  Aspergillus oryzae

AFL2G_07217 revised

Bottom HALF (two adjacent P450s in this gene model CYP60B3 and CYP60A5)

MGGDGWPSDGHILLLIVLT

VLTPPSLALYRLWIHPLRSYPGPRWWAIWRGPYILSNIRG

NLVRDLQRLHQQFGSVVRIAPNELSFIVPEAASPIYTSNPEFPKDPMHLPPFHNGTPGILAADHAHHRRYRRLLAFSFSD

KGLRQQRSLIERSVNLLITRLHENCGQGPLDLTLWFNWATFDIIGDLAFGDSFGCLDNVQTHPWISSIQGNVKLIPILNA

FRRYRLDGLLQLLGSRKLLEQRRRNAQFTTDQVDRRLKNSSTPRGDIWDAVLAQKPDGEPPMSREEMISNASAIVLAGSE

TSATLLSGCTWLLLKNPGHLHQLTSRIRSQFTHASEIDSQSVSRVEGLQAILEESLRLYPPVPMQSNRIVPQSGAYIAGG

WVPGGTSVGLQQFVACRSSSNFHRPEEFLPERWQGQGEFAHDRREVSQPFSIGPRNCIGRQLAYVEMRLILVKLLWHFNL

RLDTTQMKDTDWLAEQGIWILWDKKPLWVTLEPRNE

 

>CYP60A6 Aspergillus nomius isolate AN13137

AY510454.1

complement(join(51845..52180,52258..53352,53400..53456))

92% to CYP60A3

gene AvnA of aflatoxin biosynthesis

MGVDGWLSDGHFRLLILLIVLTPPSLAVYRLWIHPLRSYPGPRW

WAIWRGPYILSNTRGSLVRDLQRLHQQFGPVVRIAPNELSFIAPEAAAPIYTSNPEFS

KDPMHLPPFHNGTPGILAADHAHHRRYRRLLAFSFSDKGLRQQRGLIERSVNLLITQF

HENCGQGPLDLTLWFNWATFDIIGDLAFGDSFGCLDNVQTHPWIASIQGNVKLIPILN

GLRRYRLDGLLRLLGSRKLLEQRRRNAQFTTDQVDRRLQNSSTPRGDIWDAVLAQKLD

GEPPMSRAEMISNASAIVLAGSETSATLLSGCTWLLLKNPEHLHQLTSRIRSEFSHAS

EIDSQSVSRVEGLQAVLEESLRLYPPVPMQSNRIVPSTGAHIAGGWVPGGTSVGLQQF

VACRSPSNFHRPDEFLPERWQGQGEFAHDRREVSQPFSIGPRNCIGRQLAYVEMRLIL

VKLLWHFDLRLDTTRMKGTDWLAEQGIWILWDKKPLWVTLEPRDK

 

>CYP60A7 Aspergillus ochraceoroseus strain SRRC 1432

AY092402.3

complement(join(29656..30030,30172..31266,31338..31385))

gene AflG in aflatoxin/sterigmatocystin biosynthesis

79% to CYP60A3 Aspergillus parasiticus avnA

gene model revised at one intron boundary

MDVLRSFPLQLLGLRDFLILGSLGAYRLWLHPLRSYPGPRWWAL

WRVPYLQSTIRGTIVRDLQRLHEQYGPVVRIAPDELSFINPEAAKPIYTSNPEFSKDP

MHLPPFHNGVPGILAADHAHHRRYRRLLAFSFSDKGLKAQQGMIQQYIDQLIVRLHEN

CSTGPVDMTLWYNWATFDIIGDLAFGESFGCLEKVETHPWIASIQGNVKAIPILNALR

RYRLSGVLGLLAPRNLLEMRRRNAQFTADKVDRRLQHPGTARGDLWDSVLADNPNGES

PMSRDEMVSNASAIVLAGSETSATLLSGCTWLLLKNPEYLNTLTERVRSQFARAADID

AQTVTQVEGLQAVLEESLRLYPPVPMQSNRIVPPQGAQIAGMWVPGG (0)

TSVAVQQFVACRSADNFHRPNEFLPQRWQGQGEFANDRREASQPFSIGPRNCIGRQLAYAEMRL

ILVHVLWHFNLRLDQGRMKDADWLAEQGIWILWDKNHCGLCWNRGREKVEEDDAT*

 

>CYP60B1 stcL Aspergillus nidulans U34740, AN7813.1, revised 7/18/07

MAFLSLPILTALGA

VVYVLFQLVYNLYFHPLRDYPGPLLW

RASSLPWKLTLLRGTMHHDLMRHHQTYGDTVRIKPDEISYANGQAWRDIHAHVPGRPE

FLKDPVRLPLAPNGVMSILVSDTRNHARFRSLFGHAFSDKGLRAQEPTIARYADLLVE

VLREVADTGKSVEMVRYFNMAIFDSIGALSFGESFDSLRNRELHPWVDTIHKNLKSVA

ISHVLRSMGVEFLAPYLMPAELRGKRQENYTYAIEKLKKRMQKTGDQGDFWDRVIVKS

ADGNQSGDGMSYGEMINNAAVMVVAGSETTSSALCGCTYLLCKFDKMDKAVAEVRGAF

AAADQIDLVSVSRLPYLTAVIDETLRMYPSVPGQPPRVVPEGGAIVCGRFVPAETRVG

VSHLGAYYAPYNFSHADKFIPERHLAGAKLEEPFRHDNYAAYQPWSVGVRNCIGRNLA

YAEVRLTLAKLLWHFDISLDEERTGNFLDQKIWSIWAKRELYLEIRTREF

 

>CYP60B2     Aspergillus ochraceoroseus strain SRRC 1432

            GenEMBL AY092402.3

            complement(join(46781..47113,47181..48332))

            Cary,J.W., Beltz,S.B., Bennett,C.A. and Klich,M.A.

            Molecular Characterization of the Aflatoxin Biosynthetic Cluster

            from Aspergillus ochraceoroseus.

            Unpublished

            function="desaturation of aflatoxin precursor VER B to VER A

            84% to CYP60B1 Aspergillus nidulans StcL

            probable ortholog of CYP60B1

            gene AflL/StcL

MALPTLPVLAVLIGASYILVQLVYNLYFHPLRDYPGPLLWRASS

LPWKFTLLRGTMHHDLMRFHQKYGDTVRIKPDEISFANAQAWRDIHAHVPGRPEFLKD

PVRLPLAPIGVMSILVSVTRFLARFRSVFGLAFSVKGLRAQEPTIVQYADLLVEVLRE

VADTGKSVEMVHYFNMAIFDSIGALSFGESFDSLKNRQLHPWVDAIHKNLKSVAISHV

LRSMGIEFLTPYVLPKELRGKRQENYTYAIEKLKRRMQMTGDQGDFWDRVIVKSADGN

QSGDGMSPGEMLNNAAVMVVAGSETTSSALCGTTYLLCQSGKMEKAVAEIRNAFPTPD

KIDLVTVSHLPYLTAVIDETLRMYPAVPGQPPRVVPAGGATVCGKFLPAETRVGVSHL

GAYYADYNFTRPEKFIPERHLQKMEEPFKHDNYGAYQPWSVGVRNCIGRNLAYAEVRL

TLAKLLWHFDITLDEAKTGNFLDQKIWSIWANGELYMSFKARKV

 

>CYP60B3  Aspergillus oryzae

         GenEMBL BAE71326.1, BAC45243.1, BAE59522.1

         81% TO 60B1

         probable ortholog of CYP60B1

MYFLSLPALAIIVPVGYVLLHLGYNLFFHPLRGYPGPLLWRASSLPWKIALLRGTMHHDLMRFHQKYGDT

VRVKPDEISYANAQAWRDIHAHVPGRPEFLKDPVRLPLAPNGVMSILVSDTKNHARFRSLFGHAFSDKGL

RTQESTIVQYADLLVEVLREMANTGRSAEMVYYFNMAIFDSIGALSFGESFDSLKSRQLHPWVDAIHKNL

KSVAISHVLRSMGIEFLTPYVLPKELRGKRQENYSYAVEKLNKRMKMEGDLGDFWDKVLVKSADDNQRGD

GMSAGEMLNNAAVMVVAGSETTASALSGAMYLLCLSGKIEKATAEIRKSFASPEDIDLISVSHLPYLAAV

IDETLRMYPAVPGQPPRVVPAGGATVCGRFVPEETRVGVSHLGAYFADYNFTHADKFIPERHLQKTEEPY

KYDNYGAYQPWSVGLRNCIGRNLAYAEVRLTLAKLLWHFDFTLDVGKTGNFLDQKIWSIWAKRELYMFIK

TRGTSSSSPQ

 

>CYP60B3v1  Aspergillus flavus

97% to CYP60B3  Aspergillus oryzae

AFL2G_07217 revised

TOP HALF (two P450s in this gene model CYP60B3 and CYP60A5

MYFLSLPALAIIVPVGYVLLHLGYNLFFHPLRGYPGPLLWRASSL

PWKIALLRGTMHHDLMRYHQKYGDTVRIKPDEISYANAQAWRDIHAHVPGRPEFLKDPVRLPLAPNGVMSILVSDTKNHA

RFRSLFGHAFSDKGLRTQESTIVQYADLLVEVLREVADTGRSAEMVYYFNMAIFDSIGALSFGESFDSLKSRQLHPWVDA

IHKNLKSVAISHVLRSMGIEFLTPYVLPKELRGKRQENYSYAVEKLNKRMKMEGDQGDFWDKVLVKSADDNQRGDGMSAG

EMLNNAAVMVVAGSETTASALSGAMYLLCLSGKIEKSTAEIRKNFASPEDIDLISVSHLPYLTAVIDETLRMYPAVPGQP

PRVVPAGGATVCGRFVPEETRVGVSHLGTYFADYNFTHADKFIPERHLQKTEEPFKYDNYGAYQPWSVGLRNCIGRNLAY

AEVRLTLAKLLWHFDFTLDVDKTGNFLDQKIWSIWAKRELYMFIKTRGTSSSTPQ*

 

>CYP60B3v2  Aspergillus flavus strain SRRC 141

            GenEMBL AF106960

            Bhatnagar,D., Cary,J.W., Ehrlich,K.C., Cleveland,T.E. and

            Payne,G.A.

            Molecular characterization of an aflatoxin B2 producing mutant

            strain of Aspergillus flavus

            Unpublished

            verB gene 85% identical to 60B2

            97% to 60B3v1 ortholog

            99% to CYP60B3v3  Aspergillus flavus strain SRRC 1007

            formerly CYP60B4v1

MYFLSLPALAIVIPVGYVLFQLGYNLFFHPLRGYPGPLLWRASS

LPWKIALLRGTMHHDLMRYHQKYGDTVRIKPDEISYANAQAWRDIHAHVPGRPEFLKD

PVRLPLAPNGVMSILVSDTKNHARFRSLFGHAFSDKGLRTQESTIVQYADLLVEVLRE

VANTGRSAEMVYYFNMAIFDSIGALSFGESFDSLKSRQLHPWVDAIHKNLKSVAISHV

LRSMGIEFLTPYVLPKELRGKRQENYSYAVEKLNKRMKMEGDQGDFWDKVLVKSADDN

QRGDGMSAGEMLNNAAVMVVAGSETTASALSGAMYLLCLSGKIKKATAEIRKSFASPE

DIDLISVSHLPYLTAVIDETLRMYPAVPGQPPRVVPAGGATVCGRFVPEETRVGVSHL

GAYFADYNFTHADKFIPERHLQKTEEPYKYDNYGAYQPWSVGLRNCIGRNLAYAEVRL

TLAKLLWHFDFTLDVGKTGNFLDQKIWSIWAKRELYMFMKTRGTSSSSPQ

 

>CYP60B3v3  Aspergillus flavus strain SRRC 1007

            GenEMBL AF106959

            formerly CYP60B4v2

MYFLSLPALAIVIPVGYVLFQLGYNLFFHPLRGYPGPLLWRASS

LPWKIALLRGTMHHDLMRYHQKYGDTVRIKPDEISYANAQAWRDIHAHVPGRPEFLKD

PVRLPLAPNGVMSILVSDTKNHARFRSLFGHAFSDKGLRTQESTIVQYADLLVEVLRE

VANTGCSAEMVYYFNMAIFDSIGALSFGESFDSLKSRQLHPWVDAIHKNLKSVAISHV

LRSMGIEFLTPYVLPKELRGKRQENYSYAVEKLNKRMKMEGDQGDFWDKVLVKSADDN

QRGDGMSAGEMLNNAAVMVVAGSETTASALSGAMYLLCLSGKVEKATGEIRKSFASPE

DIDLISVSHLPYLTAVIDETLRMYPAVPGQPPRVVPAGGATVCGRFVPEETRVGVSHL

GAYFADYNFTHADKFIPERHLQKTEEPYKYDNYGAYQPWSVGLRNCIGRNLAYAEVRL

TLAKLLWHFDFTLDVGKTGNFLDQKIWSIWAKRELYMFIKTRGTSSSSPQ

 

>CYP60B3    Aspergillus parasiticus strain RH1

            GenEMBL AF106958

            formerly CYP60B4v3

MYFLSLPSLVIVIPVGYLLFHLGYNLFFHPLRGYPGPLLWRASS

LPWKIALLRGTMHHDLMRFHQKYGDTVRIKPDEISYANAQAWRDIHAHVPGRPEFLKD

PVRLPLAPNGVMSILVSDTKNHARFRSLFGHAFSDKGLRTQESTIVQYADLLVEVLRE

VADTGRSAEMVYYFNMAIFDSIGALSFGESFDSLKSRQLHPWVDAIHKNLKSVAISHV

LRSMGIEFLTPYVLPKELRGKRQENYSYAVEKLNKRMKMEGDQGDFWDKVLVKSADDN

QRGDGMSAGEMLNNAAVMVVAGSETTASALSGAMYLLCLSGKIEKATAEIRKSFASPE

DIDLISVSHLPYLTAVIDETLRMYPAVPGQPPRVVPASGATVCGRFVPEETRVGVSHL

ATYFADYNFTHADKFIPERHLQKTEEPFKYDNYGAYQPWSVGLRNCIGRNLAYAEVRL

TLAKLLWHFDFTLDVDKTGNFLDQKIWSIWAKRELYMFIKTRGTSSSSPQ

 

>CYP60B3    Aspergillus parasiticus aflatoxin pathway gene cluster

            GenEMBL AY371490

            formerly CYP60B4v3

MYFLSLPSLVIVIPVGYLLFHLGYNLFFHPLRGYPGPLLWRASS

LPWKIALLRGTMHHDLMRFHQKYGDTVRIKPDEISYANAQAWRDIHAHVPGRPEFLKD

PVRLPLAPNGVMSILVSDTKNHARFRSLFGHAFSDKGLRTQESTIVQYADLLVEVLRE

VADTGRSAEMVYYFNMAIFDSIGALSFGESFDSLKSRQLHPWVDAIHKNLKSVAISHV

LRSMGIEFLTPYVLPKELRGKRQENYSYAVEKLNKRMKMEGDQGDFWDKVLVKSADDN

QRGDGMSAGEMLNNAAVMVVAGSETTASALSGAMYLLCLSGKIEKATAEIRKSFASPE

DIDLISVSHLPYLTAVIDETLRMYPAVPGQPPRVVPASGATVCGRFVPEETRVGVSHL

ATYFADYNFTHADKFIPERHLQKTEEPFKYDNYGAYQPWSVGLRNCIGRNLAYAEVRL

TLAKLLWHFDFTLDVDKTGNFLDQKIWSIWAKRELYMFIKTRGTSSSSPQ

 

>CYP60B3 Aspergillus nomius

AY510454

complement(join(53898..54266,54322..55473))

gene VerB of aflatoxin biosynthesis

94% to CYP60B3 Aspergillus flavus
MYFLSLSVLALVTLVSYVLFHLGYNLFLHPLRGYPGPLLWRASS

LPWKIALLRGTMHHDLMRYHQKYGDTVRIKPDEISYANAEAWRDIHAHVPGRPEFLKD

PVRLPLAPNGVMSILVSDTRNHARFRSLFGHAFSDKGLRTQESTILQYADLLVEVLRE

VADTGRSAEMVYYFNMAIFDSIGALSFGESFDSLKSRQLHPWVDAIHKNLKSVAISHV

LRSMGIEFLTPYVLPKELRGKRQENYSYAVEKLNKRMRMEGDQGDFWDKVLVKSADDN

QRGDGMSAGEMLNNAAVMVVAGSETTASALSGSMYLLCLSGKIEKATAEIRKSFASPE

EIDLISVSHLPYLTAVIDETLRMYPAVPGQPPRVVPAGGATVCGKFVPEETRVGVSHL

GAYFADYNFTHADKFIPERHLQKTEEPFKYDNYGAYQPWSVGIRNCIGRNLAYAEVRL

TLAKILWHFDFTLDVDKTGNFLDQKIWSIWAKRELYMTLKSRDTSCSWPSTSSSPQ*

 

>CYP61A1 Yarrowia lipolytica

64% to CYP61A1   Saccharomyces paradoxus

CAG84120.1

MNATQPESHIVQWLTWTQDTIGFGTLAATVLLIALLYDQFSYVKSKGSIAGPPLKMWPIIGPFLDSINPDFEKYKAQWAS

GALSCVSVFHKFVVLASDRDLTRKIFNSSAYVKPCVVDVAIKILRPTNWVFLDGKAHVDYRRGLNGLFTNRALSMYLPIQ

EGIYDTYFDKFVEMSKDGHVPYMPIFREINCALSLRTFCGNYITEEQIKEIAHDYYLVTAALELVNFPIILPFTKAWYGK

KAADKVMDIFAKCAQMAKDHIKAGGDVTCTMDAWIAIMNGRDFDSDHGTVPNKKIRKFTNKEISETIFTFLFASQDASSS

ATTWLFQIVADRPDVYAKIREEQLAVRGGDPNVPLSLELTEKMTYTNMVVKECLRLRPPVIMVPYVAKKDFPISDTYTVP

KGSMIIPTVYPSLHDPEVYERPDEFVPERWLPDGDGTKNAKNWLVFGTGPHYCLGQKYALMNFTNMIGKACMNLDFTHKV

TPLSEKVRVFATIFPDDDCLLQFKKRE

 

>CYP61A1 S. cerevisiae bakers yeast Z49211 Z71257

MSSVAENIIQHATHNSTLHQLAKDQPSVGVTTAFSILDTLKSMS

YLKIFATLICILLVWDQVAYQIKKGSIAGPKFKFWPIIGPFLESLDPKFEEYKAKWAS

GPLSCVSIFHKFVVIASTRDLARKILQSSKFVKPCVVDVAVKILRPCNWVFLDGKAHT

DYRKSLNGLFTKQALAQYLPSLEQIMDKYMDKFVRLSKENNYEPQVFFHEMREILCAL

SLNSFCGNYITEDQVRKIADDYYLVTAALELVNFPIIIPYTKTWYGKKTADMAMKIFE

NCAQMAKDHIAAGGKPVCVMDAWCKLMHDAKNSNDDDSRIYHREFTNKEISEAVFTFL

FASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELNLDLIEKMKYTNMV

IKETLRYRPPVLMVPYVVKKNFPVSPNYTAPKGAMLIPTLYPALHDPEVYENPDEFIP

ERWVEGSKASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFALYTDFHHTVTPLSE

KIKVFATIFPKDDLLLTFKKRDPITGEVFE

 

>CYP61A1 Saccharomyces paradoxus

98% to CYP61A1 S. cerevisiae Spar_17277

MSSVAENIIQQATHNSTLHQLAKDHSPVGATTAFRILNTLKSMSYLKIFATLICILLVWDQVAYQIKKGSIAGPKFKFWP

IIGPFLESLDPKFEEYKAKWASGPLSCVSIFHKFVVIASTRDLARKILQSSKFVKPCVVDVAVKILRPCNWVFLDGKAHT

DYRKSLNGLFTKQALAQYLPSLEQIMDKYMDKFVRLSKENNYEPQVFFHEMREILCALSLNSFCGNYITEDQVRKIADDY

YLVTAALELVNFPIIIPYTKTWYGKKTADMAMKIFENCAQMAKDHIAAGGKPVCVMDAWCKLMHDAKNSNDDDSRIYHRE

FTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELNLDLIEKMKYTNMVIKETLRYR

PPVLMVPYVVKKNFPVSPNYTAPKGAMLIPTLYPALHDPEVYENPDEFIPERWVEGSKASEAKKNWLVFGCGPHVCLGQT

YVMITFAALLGKFALYTDFHHKVTPLSEKIKVFATIFPKDDLLLTFKKRDPITGEVFE

 

>CYP61A1 Saccharomyces mikatae

97% to CYP61A1 S. cerevisiae Smik_16456

MSSVAENIIQQASHNSTLQQLAKDQSSVGITTAFSILDTLKSMSYLKIFATLICILLVWDQVAYQIKKGSIAGPKFKFWP

IIGPFLESLDPKFEEYKAKWASGPLSCVSIFHKFVVIASTRDLARKILQSSKFVKPCVVDVAVKILRPCNWVFLDGKAHT

DYRKSLNGLFTKQALAQYLPSLELIMDKYMEKFVRLSKENNYEPQVFFHEMREILCALSLNSFCGNYITEDQVRKIADDY

YLVTAALELVNFPIIIPYTKTWYGKKTADMAMKIFENCAQMAKDHIAAGGKPVCVMDAWCKLMHDAKNSNDDESRIYHRE

FTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELNLDLIEKMKYTNMVIKETLRYR

PPVLMVPYVVKKNFPVSPNYTAPKGAMLIPTLYPALHDPEVYENPDEFIPERWVEGSKASEAKKNWLVFGCGSHVCLGQT

YVMITFAALLGKFALNTDFHHKVTPLSEKIKVFATIFPKDDLLLTFKKRDPITGEVFE

 

>CYP61A1 Saccharomyces kudriavzevii

97% to CYP61A1 S. cerevisiae Skud_Contig2054.8

MSSIAENIIQQATHNSTLHQLAKDESSLGVTTAFSILETIKSMSYLKIFATLICILLVWDQVAYQIKKGSIAGPKFKFWP

IIGPFLESLDPKFEEYKAKWASGPLSCVSIFHKFVVIASTRDLARKILQSSKFVKPCVVDVAVKILRPCNWVFLDGKAHT

DYRKSLNGLFTKQALAQYLPSLEQIMDKYMDKFVRLSKENNYEPQVFFHEMREILCALSLNSFCGNYITEDQVRKIADDY

YLVTAALELVNFPIIIPYSKTWYGKKTADMAMKIFENCAQMAKDHIAAGGKPVCVMDAWCKLMHDAKNSNDDESRIYHRE

FTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELNLDLIEKMKYTNMVIKETLRYR

PPVLMVPYVVKKNFPVSPSYTAPKGAMLIPTLYPALHDPEVYENPDDFIPERWVEGSKATEAKKNWLVFGCGPHVCLGQT

YVMITFAALLGKFALYTDFHHKVTPLSEKIKVFATIFPKDDLLLTFKKRDPITGEVFE

 

>CYP61A1 Saccharomyces castellii

83% to CYP61A1 S. cerevisiae Scas_Contig709.53

METIMDNSTMEFVQQQTPSTLISTIQQLSYWKIFVTFICIVLVWDQISYQIKKGSIAGPRFKIWPIIGPFLESLDPKFEE

YKAKWDSGALSCVSIFHKFVIISSTRDISRKIFQSSKFVKPCVVDVAIKILRPTNWVFLDGKAHIDYRKSLNGLFTKTAL

AQYLPSQEQVMDKYLQKFIEISKENNYEPQVFFHEMREILCALSLRAFCGEYITEDQIRKIADDYYLVTAALELVNFPII

IPFTKTWYGKRTADAAMKIFEQCAQMSKDYIAKGGKPICVMDAWCKLMHDAKTKNDEDSRILHREFSNKEISEAIFTFLF

ASQDASSSLACWLFQIVADRPDILEKIRKEQMEVRNNDMSTELNIELIDKMKYTNMVIKETLRYRPPVLMVPYVVKEKFP

VTPNYTAPKGSMLIPTLYPSLHDPEVYENPDEFIPERWEEGSPASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFAL

YTDFEHKITPLSEKIKVFATIFPKDDLLMTFKKRDPITGKVFE

 

>CYP61A1 Saccharomyces bayanus

93% to CYP61A1 S. cerevisiae Sbay_17696

MSSVAENIIQQAANNSTLHQLAKGGSSLGFTKAFNVLDALKSMSYLKMFATLICILLVWDQLAYQIKKGSIAGPKFKFWP

IIGPFLESLDPKFEEYKAKWASGPLSCVSIFHKFVVIASTRDLARKILQSSKFVKPCVVDVAVKILRPCNWVFLDGKAHT

DYRKSLNGLFTKHALAQYLPSLELIMDKYMEKFVRLSKDNNYEPQVFFHEMREILCALSLNSFCGNYITEDQVRKIADDY

YLVTAALELVNFPIIIPYSKTWYGKKTADMAMKIFENCAQMAKDHIAAGGEPVCVMDAWCKLMHDAKNSNDDDARIFHRE

FTNKEMSEAVFTFLFASQDASSSLACWLFQIVADRPDVLEKIREEQLAVRNNDMSTELTLDVIEKMKYTNMVIKETLRYR

PPVLMVPYVVKKNFPVSSNYTAPKGAMLIPTLYPALHDPEVYENPDDFIPERWEEGSKASMAKKNWLVFGCGSHVCLGQT

YVMITFAALLGKFALSTDFHHKVTPLSEKIKVFATIFPKDDLLLTFKKRDPITGEVFE

 

>CYP61A1 Saccharomyces kluyveri

79% to CYP61A1 S. cerevisiae Sklu_Contig2168.4

MSTVVKYAQNAASNSILNSGNNATTTATNAVATTVQNVIDSVQSISYWKLFVTIICVGLVWDQVSYQIKKGSIAGPKWKV