Batrachochytrium dendrobatidis P450s

 

D. Nelson

 

August 9, 2009

 

9 sequences

 

>CYP51F1 Batrachochytrium dendrobatidis JEL423 (chytrid)

43% to CYP51F1 Rhizopus oryzae

note this species has no obvious CYP61 sequence

BDEG_01891

MGLFFEAYESVRNVSGLPPDQFHTVVAITSLVFVLTVWLLSYALNQPLKSKDTGSEPPRVPVSIPFIGAAIAYGVDPIKF

LIECRQKYGDCFTFVMLGRKMTFCLGPDGNHYVFNVPVADATAEGAYKKLTVPVFGAGVVYDVHNAMFMEQKKFVKDAFN

SNSFNAYMLNIWNETNAFFNDWEDHYDANMIFDEMSELTIRTASHCLLGKEIRQQLHSTVAQLYHDLDSGLAPINVFFRW

LPLPVYFKRDRANKIMSKTFVDIIKKRRATNSTDNADLMQTLMFARYRDGTSMTDDEIAHLLIATLMGGQHTSSTTLCWM

LFELARRQDIVDKLLHEQSMVLTGKPDTPPEDLPEFTHEQIRQLTFLDCVMKETLRLHPPIHTVMRKVEKSMTYRGMTIP

AGHFICGSAAVSHLDPTRFPDPLKFEPSRFLNNDEGSGEWSINTIDIAQKSARSHFLPFGAGRHRCIGEAFAYIQNKTIL

SAFIRRYTHKLYVDPNTGKEHFPSSDYTSLITIPEKPARLSITRRSVKA

 

>CYP5224A1 Batrachochytrium dendrobatidis JEL423 (chytrid)

only 25% to CYP617D6  Aspergillus niger

26% to CYP509A1 Cunninghamella elegans

N-term part only, up to I-helix, added the rest from genomic seq

BDEG_02920

Supercontig 3 1051607 - 1053730 (-) strand

MNAVLGLISTGNGWAKQFESIVTSHSRSRYSLVCAVAIPAIGILILKRWLQPSLLPKGLP

TPPYLPLVGQFFTILP (2)

YANRRQTHEFFEKMRKTVGHIWLMKNMSTDIVVVSDPESVMRLLQNSTEITRGEKLQLSA

QTMFEHSLFVLPGGPVWKKHRKLLQPAFGPLHLRFAAHASEEAIVQLSMLIEDEIRAADS

ECYTIDIYQYMTAISMDIM (2)

GQVTLKHDFKAVRSVYDQEDSK (0)

TPGVFDKLVTFLQR (0)

RLFIPPFLWGLVGLHNSSPEIRSTVGSVVN

MVKAMIKDYKDAHKNDQSNDIKDKKHMDVLERLLHSNSEAQ (0)

LFSEQEIIDELIGFIIAGHE (2)

TTANTMTFIVFALCQNPKVQEKLAAEIHDIYNSLDEELNVDNILRFTYLD

WVIKEAQRCYSVVQQVSRVSTQDIQLLGYTFKKGTRFLLRLADVHQDDRYWKDPKQFNPD

RWAEPCTPGTFLPFGDGQFNCIGQKMALIEIRVIMIHLIRQFAFDLVPNQKLERFSTVTH

GFKNGLKVKMTKRK*

 

Wrong C-term part

TTASTMTFIIFQLCIHPEIQTKLVTDICEIYSKLDKDIDMENIMHFEYLDWVIKEAQ

RLDSVLQNVMRVSTNDIQLMGYEFKAGTQFMLRIADIHRDERYWKDPLRFNPDRWAE

PCVPGTFLPFGDGAFKCIGQKMAMVEIKVVMIHLLREFQFELVPNQKLERFTSITHGFKKGLMVKISKRK*

 

>CYP5224A2 Batrachochytrium dendrobatidis JEL423 (chytrid)

51% to CYP5224A1

added the N-term and C-term part

BDEG_03897 revised (may have a gc boundary at SLDIM)

MFTTIMSVIPFTMPSISLYFGFMEKKYCPSVYLIAP

VLVCFGLACWRHLSKPLNGLPGPYAWPIVGQFPILLM (2)

FLKNHQTHLYLAAMRKKYGPIWILPSLGIDSVVVCDAKAVQSIFQNSTDIIRPDSGFRAAKSL

FQYALFILPGGPLWKKHRKLLQSSFSLPHLRLAVHASKETAAVISTVINNFI

QADSSKSCIIDIHCYMISLSLDIM (2)

GKVAFKYEFNAVKQTVSGNNEK (0)

GYKLFEKLLVLLQK (0)

RVLLPKIFWSYANIADNSPALRETADYMRLTVKKVIDERDASCESELSKDPLHMDVLERLLNSRTGDL (0)

VLSEEEIISEIIGFIIAGYD ()

TTASTMTFIIFQLCIHPEIQTKLVTDICEIYSKLDKDIDMENIMHFEYLDWVIKEAQRLDSVLQ

NVMRVSTNDIQLMGYEFKAGTQFMLRIADIHRDERYWKDPLRFNPDRWAEPCVPGTFLPFGD

GAFKCIGQKMAMVEIKVVMIHLLREFQFELVPNQKLERFTSITHGFKKGLMVKISKRK

 

>CYP5225A1 Batrachochytrium dendrobatidis JEL423 (chytrid)

frameshift at &, first exon is a guess.

BDEG_08295

MLSNPLLYSKISQIRPCYSIAVVAYSRKATTVSMPITREDTVLSSRWG (0)

DPIGFLNKQREIYGDAFTLNLVNTKMHFFISPAVCTFMIESSI (2)

SLFQMQKFSLDQAFYDRCPPFKIQGMTDKYSKLFLKLTATALNQPKMLHAYHPLMTDVVSATIMEFTQSGTLDVFELTSSIAVK

IAIVWILGKQFYKAHADDMVQLILQIEKDIASPLNSFFPGWPHPPCIRMQKAIETMFKWVSHEIKLRRMVNANAPVQCDL

LQLLLNCHECNVLLEADISRFMLTLFLAAHTNTAANMGWTIYELAKHTHLQQ (1)

HSDSTFTDFYPSS

GTRNLESHMPITTACI &

KETGRLYMKLFTFKEIVVRCSVWWI

GYKILKGELICISPGCVALDSKLFEYPNVYNPDRWLP

NNHKSTTSKPKIIPPMNMPQFGIGKHHCLGERVVLMAIKTIVLPELLRRFECTLDSNEQI

VIPDYFGSISSPFPKHPIRIKVVPI*

 

>CYP5226A1 Batrachochytrium dendrobatidis JEL423

26% to CYP5224A1, heme signature is not correct, no CYS in cyan region

BDEG_02487

MPNVDFRYKNNQQFHKLQTWLTTNYGQITMLYFYSKRIVFVSSPLYAKQILSSSLFVQDEESVKLFEGIVDIPSPEDRKR

HLSTVKQLSMELLHARILDITMERTFRVLISWNEKIRIDSERLVVDLDNVCKAISLDICGLGILSMDFDAVTGLRIKQIT

LSEIVLNKVVRFLHQRANLAPFAWAYNKVGITSSDLVSARTHFKSVLKSLIREQCHPYVDDPLSSVNIIRTLLKDYGTDL

TPENEQAIGADVYRGMLWSNMFLSSALSFVFFELLQNDDVREKATQEIDRVWKATHGKIQLDTLSQLLYVECVVKESLRL

HPVCAYLVKESKESVKVGNYLFPTATQFRISVIDLHQDPLIWNDPSAFLPQRWEKTDANTLPFYPFGDDPDLVVQKLALV

PIKAAVAVFLRHISFEHAKKDTADEVPSATHDIDASGAVCKLYDENSLLECIATQRPLDSLQ

 

>CYP5227A1 Batrachochytrium dendrobatidis JEL423

35% to CYP5224A1   Batrachochytrium dendrobatidis

BDEG_02013

MDTTVASASIVTLAAGLAIVSYLQNYYVRIPGPYAYPIIGSGLEVAKYSKEGNYHLFLAWMRTFGPITRINIFMKNVVVT

TDAALIKRATTSSTEFWRDPAFSKIAHSLLDNGLFTLPTGDVWKRHRKNLQPAFAPSHLRQAAKITRERIETLGDYWQQE

AVNNGGSIIVDIFHEFTALTLDIIGSAIFSYDFHASDDLHKKRDQVSQGMVEELVRLVQERFSVPPLLWAFNNLSSYSSR

VKKVNGCIHAVIQDVIDKRKEQMKLGNIPSNDQMDVLDRLLKVHQVAAENFTNEEVVGEVIGFFVAGHETTANTLVLTAL

EICRHPEIEQRLAKEVAQVEKSQGCPINIESVPSLKYLDMVVKESQRFHPVVSNMGRNTLCTIQHNGYTIPANTTLILNT

GGAQKDPAYWDKPEKFDPERWADGFVPIPGSYVPFGDGPMACIGQKMALIEIKIVLSHVLSKFDMELIPDQDLTLVTSVT

TGLKHGLKLRLTPKTVQ

 

>CYP5227A2 Batrachochytrium dendrobatidis JEL423

59% to CYP5227A1   Batrachochytrium dendrobatidis

35% to CYP5224A1   Batrachochytrium

BDEG_02014

MSNNSVIAGTLVAAIAAMTYLQNNYLGFPGPFAYPIVGNGLDFVHQTNKGKYQDYICSLQSYGRVVRINVFGANYICTTD

AALIKRVLTSGTEFWRDPTFANISHSLLDLSLFTIPSGDVWKRHRKNLQPAFAPTHLRQAGNITQNQADKLVRYYNSESL

KNDGSITVDIYHEFTALSLDIIGQVIFSYDFHACNDLHAHKVQVGQGYIEELVMFIHQRFTLPSILWGMAGLSSNSTRVK

LASTYMKKLIQNVIDKKKSELKQNDEKDPKCMDVLDRLLKVGPSESENFTDEEVVGEVVGFFIAGHETTANTLVNTTLEL

CRNPEITRKILAEIHQVESTLGHPINTESLSSLKYLEMVIKESLRMYAVVASTYRTTLCRIEHEGNVIPSNTKFIVNIGG

VHHEPVYWDKPEKFDPDRWADGFVPIPGSYLPFGDGPMACIGQKMAMIEIKLALCALLSSFDMELVPNQDIVFVTSITTG

LKHGLKVKLTPRSAASV

 

>CYP5228A1 Batrachochytrium dendrobatidis JEL423

32% to CYP534D1   Mgr039 Mycosphaerella graminicola

BDEG_02899

MSASLTKWLRISLVSLPALYTIYTVIRWRLLAAKERRILERLCPTLPVITINFNRTMFGIIDVTHFSIIPTWWMPKILPK

GWQWMGGHDVYQQLGEDTIAIVSPGDRQFWVVDADLVKDIVSRKSDFVKPVHIYTILNIFGSNVVTTEHAEWRRHRRIVS

PQFSERINLSVLQYAAETVRDMLKCWQSTEHTAHGEVRVNVSNDMMKLALHVISGAGFGMRLDWVTSESDQTLDHGHTMS

YKTAVHSMMAGLLLKSILPKFAYLLPIERVQNVKRSFDEFGLYLSEVIRGADKQDESNLLVSLAKAARAEDGGLTEQELV

GNVFVFLFAGHETTASTFMFALAMLASHQDVQQRLYEEIQLILDGNDPQLKDIQNLGYTLAVMNETLRMFPPVVAIPKHT

TSQQTLGKYIIPEDTRVTLHTVGIHYNPKYWGPDPSVFRPARWFTLPECASSAVKTRDFIRSTTQLKSQTSPSEPEHDKT

RSDVPDTASDKPHQSLFSYNRYAFLPYSEGMRSCLGKRFAQVEFITGLAMMMQKYSVHLPDGAQIEEVIESQNRVTLQPK

RDMYLVFKPRTST

 

>CYP5229A1 Batrachochytrium dendrobatidis JEL423 (chytrid)

23% to CYP5225A1 no heme signature. Check

BDEG_08292

MDSPEFNEAIRRAPKGMFKEDENGIHVGFEDLFRKEPKQAGPGEMIGMLYDLGKSDDINAQILFWVVLVIFVIPIVIGMV

FVLFGSHRQKRKLVPAISSWIPFGVTLWFSRAKKYSKGFSIPLGFSEFTVFAGVKGQKLISAFEDDKMSFAQGFKLQFEK

TLVSGRLKIVQDQYLQSGYYLPEMLRARLDHIKNEESVDLFKFSSDIALRLLTRLAIGQKLLDENDDDIIPLMQTTEKTL

MSPGTLFFRSFSFGTSASKTLFQDLRIIIQEEIEFRKENPSDESYYDIISILTKAAPQLSVDGIVSHINLFIFANHSDIS

GTIAWTLYHLIQDRTLQTRVLTEYAQAVSVSDTVKDNVSTQPCLTSIIKEVGRLYAPLFLIRGSFKKQPIGNYDIYFCDI

VATSPAMIALNEKIYESPKTFDASRFLDQQKIQVLTQQQKLLQFNNAQHAWFDHVIAETMIKRTIIPTILETYHIELVDK

KFTPRPSYLESFSTPFSDLPLCVKFSSKACMMDNVSKQSNAKKSK