This page was last modified June 22, 2010. 

A link to P450 functions in plants an extensive listing with references.
From the Plant Biotechnology Institute, National Research Council, 
Saskatoon, Saskatchewan   CANADA

Plant P450s that have appeared since the 1993 P450 nomenclature update.
Part D of the bibilographic P450 documents.  These files were broken into 
      five parts to reduce the download time for each part. 
      This includes references that were incomplete and duplications
      of sequences that were already in the update.  If a sequence 
      is assigned an accession number that was not in the old update
      it is included in this list.  Some expressed sequence tags (ESTs)
      are also included from Arabidopsis thaliana and Catharanthus roseus.
      This list was last modified March 24, 2008. Added functions for CYP51H10,
      CYP705A5 and CYP708A2 (two new family functions identified).

Plant P450 families are numbered CYP51, CYP71 to CYP99.  The numbers then jump to 
      701-772, because there are 95 plant P450 families.  Many of the 
      sequences included here are PCR fragments or expressed sequence tags
      that are quite short.  These fragments have not been
      assigned to families, unless a clear family resemblance was present.
      CYP51 is the only family conserved enough to be identified as the
      same family across kingdoms, including plants, fungi, animals and 
      In the Arabidopsis expressed sequence tags, some are from the C-
      terminal and some are from the N-terminal or middle region of the
      P450s.Clearly some are from the same sequence, but the relationship
      cannot be known until the whole sequence is complete, or 
      until PCR primers from the fragments can be used to identify
      which fragments are in the same sequence.

Note: at least one plant sequence has been reported that shows a P450 spectrum and 
P450 activity, but the sequence does not appear to be a P450 family member based on 
descent from a common ancestor. (GenEMBL D64052, tobacco, Biochim. Biophys. Acta 
1308, 231-240 1996)  This sequence when blastn searched shows highest similarity to 

BLASTN-outcome:D64052     Tobacco mRNA for cytochrome P450 like seq. 10050  0.0   
   1emb|Z11498|MSRRN26S   M.sativa 26S rRNA                                     1034  4.5e-311

So D64052 is not a P450 but a ribosomal RNA.
Nitric oxide synthases have a heme thiolate spectrum.  A heme thiolate ligand is 
not restricted to P450 family members.  It is ironic that the name cytochrome P450 
derives from a characteristic spectrum, but not all proteins with this spectrum can 
be included in the family of cytochrome P450s.  This family is now defined by 
sequence, and not spectral properties.

Note: First 71D sequences are in GenBank 71D6 and 71D7 (see below)

51 Family

71A Subfamily

71B Subfamily

71C Subfamily

71D Subfamily

71E Subfamily

72A Subfamily

72B Subfamily

73A Subfamily

74A Subfamily

74B Subfamily

75A Subfamily

76A Subfamily

76B Subfamily

76C Subfamily

76D Subfamily

77A Subfamily

78A Subfamily

79A Subfamily

79B Subfamily

79C Subfamily

79D Subfamily

79E Subfamily

80A Subfamily

80B Subfamily

81A Subfamily

81B Subfamily

81C Subfamily

81D Subfamily

81E Subfamily

81F Subfamily

81G Subfamily

81H Subfamily

82A Subfamily

82B Subfamily

82C Subfamily

82D Subfamily

82E Subfamily

82F Subfamily

83A Subfamily

83B Subfamily

83C Subfamily

83D Subfamily

84A Subfamily

85A Subfamily

86A Subfamily

87A Subfamily

88A Subfamily

89A Subfamily

90A Subfamily

90B Subfamily

91A Subfamily

92A Subfamily

92B Subfamily

93A Subfamily

93B Subfamily

93C Subfamily

93D Subfamily

94A Subfamily

95A Subfamily

96A Subfamily

96B Subfamily

97A Subfamily

97B Subfamily

98A Subfamily

99A Subfamily

701A Subfamily

702A Subfamily

703A Subfamily

704A Subfamily

705A Subfamily

706A Subfamily

707A Subfamily

708A Subfamily

709A Subfamily

709B Subfamily

710A Subfamily

711A Subfamily

712A Subfamily

713A Subfamily

714A Subfamily

715A Subfamily

716A Subfamily

718A Subfamily

719A Subfamily

CYP1 warning 
EXPRESSED IN PLANTS.  These are not CYP1 orthologs from plants.
AF147296  Cucurbita moschata cytochrome    387    8e-107
AF147295  Elaeagnus multiflora cytochrom   387    8e-107
AF147291  Solanum lycopersicum cul...   387    8e-107
AF147289  Solanum tuberosum cultivar ...   387    8e-107
AF147294  Perilla frutescens cultivar...   386    2e-106
AF147292  Solanum lycopersicum cul...   386    2e-106
AF147290  Solanum tuberosum cultivar ...   385    3e-106
AF147293  Perilla frutescens cultivar...   374    9e-103
AF147288  Solanum tuberosum cultivar ...   372    3e-102

51 Family

A note on nomenclature.  CYP51s were originally all called CYP51, because only one 
gene was found per species and they all seemed to be in this one conserved family.
However, rice had many CYP51s in at least two sequence groups, so subfamilies
have been designated for CYP51s.  These are not the typical subfamilies, but only 
one subfamily is created for each major taxonomic group.  CYP51A for animals,
CYP51B for bacteria. CYP51C for Chromista, CYP51D for Dictyostelium, CYP51E
for Euglenozoa, CYP51F for fungi.  Those groups with only one CYP51 per species 
are all called by one name: CYP51A1 is for all animal CYP51s since they are 
orthologous.  The same is true for CYP51B, C, D, E and F.  CYP51G (green plants) 
and CYP51Hs (monocots only so far) have individual sequence numbers.
CYP51G1 refers to the typical CYP51 14 alpha-demethylase gene in plants,
usually in one copy per species. A few species have extra CYP51G sequences.
CYP51H is another group of related sequences that probably do not 
have the same function as CYP51G.  There are many of these in rice.

CYP51G1     Arabidopsis thaliana
            GenEMBL AC007296 comp(52507-54167) 
            GenEMBL N65031 (EST fragment)
            GenEMBL AA651059 (EST fragment) opposite end AA720360
            These ESTs are similar but not identical to CYP51G2.
            76% to CYP51A1
            old CYP51A2

CYP51G1     Chlamydomonas reinhardtii (green algae)
            GenEMBL ESTs BI717817 BU649818 BI726293 BM001590 BI718677 AV642299
            From scaffold 58 of the genome project

CYP51G1   Volvox carteri (colonial green algae)
          JGI model estExt_Genewise1.C_30095|Volca1
          84% to Chlamydomonas CYP51G1

CYP51G1   Micromonas sp. RCC299
          EuGene.1200010398|MicpuN3 at JGI
          81% to CYP51G1 Ostreococcus lucimarinus, ortholog
          81% to CYP51G1 Ostreococcus Ostreococcus tauri, ortholog

CYP51G1    Micromonas pusilla CCMP1545
           estExt_fgenesh1_pg.C_100222|MicpuC2 at JGI
           83% to CYP51G1 EuGene.1200010398|MicpuN3

CYP51G1   Ostreococcus tauri (micro algae)
          e_gw1.|Ostta4 at JGI
          56% to CYP51G1 Chlamy.
          May be about 27 aa short at N-term

CYP51G1   Ostreococcus lucimarinus (micro algae)
          e_gwEuk.11.159.1|Ost9901_3 at JGI

CYP51G1     Physcomitrella patens (moss)
            ESTs BJ585158.1 BJ591215.1 BJ592754.1 BJ963427.1 BJ165255.1 BJ157286.1
            BJ188328.1 BJ185333.1

CYP51G1v1   Nicotiana tabacum (tobacco)
            GenEMBL AF116915.1
            Burger,C., Rondet,S., Benveniste,P. and Schaller,H.
            Virus-induced silencing of sterol biosynthetic genes: 
            identification of a Nicotiana tabacum L.
            obtusifoliol-14alpha-demethylase (CYP51) by genetic manipulation 
            of the sterol biosynthetic pathway in Nicotiana benthamiana L.
            J Exp Bot. 2003 Jul;54(388):1675-83.
            obtusifoliol-14-demethylase (CYP51) mRNA,
            clone name NtCYP51-1 97% identical to CYP51G1v2

CYP51G1v2   Nicotiana tabacum (tobacco)
            GenEMBL AY065641.1
            Burger,C., Rondet,S., Benveniste,P. and Schaller,H.
            Virus-induced silencing of sterol biosynthetic genes: 
            identification of a Nicotiana tabacum L.
            obtusifoliol-14alpha-demethylase (CYP51) by genetic manipulation 
            of the sterol biosynthetic pathway in Nicotiana benthamiana L.
            J Exp Bot. 2003 Jul;54(388):1675-83.
            clone name NtCYP51-2 97% identical to CYP51G1v1

CYP51G1   Carica papaya
          82% to Arab. 51G1
          88% to Vitis vinifera 51G1 (best GenBank hit)
          85% to Nicotiana tabacum

CYP51G1    Vitis vinifera 
           AM475390.2, CAAP02000381.1
           81% to 81G1 Arab. 90% to CAAP02000072.1
           Note: there are two CYP51G1 genes in Vitis, (see CYP51G6)
           Both are equally similar to Arab and rice 51G1s.

CYP51G1     Oryza sativa (rice)
            GenEMBL    AB025047
            ESTs BE040549.1 BE230288.1 BE230302.1 BE607441.1
            Aoyama,Y., Horiuchi,T. and Yoshida,Y.
            Cloning and characterization of rice sterol 14-demethylase (CYP51) gene.
            Old name = CYP51A5

CYP51G1     Oryza sativa (rice)
            GenEMBL aaaa01012243.1 Indica rice genome 
            ortholog of AB025047 99%
            Old name = CYP51A5

CYP51G1     Pinus taeda (pine)
            GenEMBL BF517195.1 AW984874.1 AW626637.1 C-term fragments
            BF610290.1 CYP51 N-term
CYP51 C-term
CYP51G1     Sorghum bicolor
            GenEMBL U74319
            Bak,S., Kahn,R.A., Olsen,C.E. and Halkier,B.A. 
            Cloning and expression in Escherichia coli of the obtusifoliol 14
            alpha-demethylase of Sorghum bicolor (L.) Moench, a cytochrome P450 
            orthologous to the sterol 14 alpha-demethylases (CYP51) from fungi and mammals
            Plant J. 11 (2), 191-201 (1997).

CYP51G1     Triticum aestivum (wheat)
            GenEMBL Y09291 (1655bp)
            Cabello-Hurtado F, Taton M, Forthoffer N, Kahn R, Bak S, Rahier A,    
            Werck-Reichhart D
            Optimized expression and catalytic properties of a wheat obtusifoliol
            14alpha-demethylase (CYP51) expressed in yeast Complementation
            of erg11Delta yeast mutants by plant CYP51.
            Eur J Biochem  262,435-446 1999 

CYP51G1     Triticum aestivum (wheat)
            GenEMBL Y09292 (1231bp)
            Cabello-Hurtado F, Taton M, Forthoffer N, Kahn R, Bak S, Rahier A, 
            Werck-Reichhart D
            Optimized expression and catalytic properties of a wheat obtusifoliol
            14alpha-demethylase (CYP51) expressed in yeast Complementation
            of erg11Delta yeast mutants by plant CYP51.
            Eur J Biochem  262,435-446 1999 

CYP51G1     Zea mays
            GenEMBL T12664 (EST fragment)
            BT017790.1, CD437739.1, CO452409.1, EE184969.1

CYP51G1     Avena strigosa (black oats)
            No accession number
            Annie Osbourn
            Submitted to nomenclature committee Dec 10, 2003
            87% to 51G1 rice
            clone name AsCYP51

CYP51G1     Populus trichocarpa (black cottonwood)

CYP51G1     Solanum chacoense (chaco potato)
            O'brien,M., Chantha,S.C., Rahier,A. and Matton,D.P.
            Lipid Signaling in Plants. Cloning and Expression Analysis of the
            Obtusifoliol 14{alpha}-Demethylase from Solanum chacoense Bitt., a
            Pollination- and Fertilization-Induced Gene with Both Obtusifoliol
            and Lanosterol Demethylase Activity
            Plant Physiol. 139 (2), 734-749 (2005)

CYP51G1      Cucumis melo subsp. melo Piel de Sapo Pinyonet (melon, Cucurbitales)
             AM722680 AM721153.2
             AM729933.2 Cucumis melo subsp. agrestis (C-term)

CYP51G1     Sesamum indicum (a sesame plant)
            No accession number
            Eiichiro Ono
            Submitted to nomenclature committee July 11, 2007
            Clone name SiCYP-EST-H10
            80% to 51G1 Arab.

CYP51G1     Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            78% to CYP51G1 sterol 14-demethylase [Arabidopsis thaliana]

CYP51G1     Gossypium hirsutum
           Shi,Y.H., Zhu,S.W., Mao,X.Z., Feng,J.X., Qin,Y.M., Zhang,L.,
            Cheng,J., Wei,L.P., Wang,Z.Y. and Zhu,Y.X.
            Transcriptome Profiling, Molecular Biological, and Physiological
            Studies Reveal a Major Role for Ethylene in Cotton Fiber Cell
            Plant Cell 18 (3), 651-664 (2006)
            obtusifoliol-14-demethylase mRNA, partial cds
            89% to 51G1

CYP51G1      Diospyros kaki (persimmon, Ericales)
             DC586067.1, DC585117.1
(50 aa gap)

CYP51G1      Coffea canephora (Gentianales)

CYP51G1     Liriodendron tulipifera (tulip poplar, magnoliids)
            FD493672.1 FD498629.1

CYP51G1     Aristolochia fimbriata (White Veined Dutchman's Pipe, magnoliids) 
            FD760060.1 ends do not match
            FD753103.1, FD757102.1, FD756980.1, FD759954.1, FD758835.1

CYP51G1     Zamia vazquezii (Cycad)
            FD774927.1 FD769109.1


CYP51G1     Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ335779 also GenPept ABC59074

CYP51G1     Glycine max (soybeans, Fabales)
            Li,L.Y. and Yu,D.Y.
            Comprehensive analysis of putative P450 genes superfamily in
            Glycine max and Medicago truncatula

CYP51G1     Selaginella moellendorffii (Lycopod)
            traces 724390578, 890688186, 719688188
            71% to 51G1 Arabidopsis, N-term seq does not match

CYP51G1      Ceratopteris richardii (fern)
             GenEMBL CV734775.1 CV734906.1 ESTs

CYP51G1     Lactuca perennis (lettuce, Asterales) 
            GenEMBL DW082409 DY973804.1 ESTs


CYP51G1  Ricinus communis (castor bean, Malpighiales)
         GenEMBL AASG01019728 (WGS)
         80% to 51G1 Arab.

CYP51G1    Eucalyptus gunnii (Myrtales)
           GenEMBL CT983870 EST

CYP51G1    Triphysaria versicolor (Lamiales)
           GenEMBL DR174877

CYP51G1     Malus x domestica (Royal Gala apple, Rosales)
            EB130903.1 EST

CYP51G1    Citrus clementina (Sapindales)
           GenEMBL DY300918

CYP51G1    Gossypium hirsutum (cotton, Malvales)
           GenEMBL DT574647

CYP51G1    Mesembryanthemum crystallinum (Ice plant, Caryophyllales)
           GenEMBL CA839975

CYP51G1    Aquilegia formosa x Aquilegia pubescens (Ranunculales)
           GenEMBL DT767027.1  EST 

CYP51G1    Quercus robur (red oak, Fagales)
           GenEMBL DN949857.1 

CYP51G1    Adiantum capillus-veneris (maidenhair fern)
           69% to 51G2

CYP51G2P    Arabidopsis thaliana
            GenEMBL AC002329 Complete sequence
            GenEMBL AC007127 comp(82241-84323) complete seq.
            Contig 1783 of the TIGR Landsberg erecta sequences has 99% match
            Old CYP51A1
            Note: this gene is an expressed pseudogene, even though there
            is no flaw in the protein sequence.

CYP51G3     Oryza sativa (rice)
            GenEMBL AY022669.1
            GenEMBL aaaa01065204.1 aaaa01028263.1 aaaa01014709.1 Indica genome 
            Old name = CYP51A15
            This sequence sometimes sorts with the G or the H subfamily
            It is not reproducible.

CYP51G4P    Oryza sativa (rice)
            GenEMBL AP003866.1b
            GenEMBL aaaa01005681.1b Indica rice genome 
            Old name = CYP51A16P, pseudogene closely related to CYP51G3

CYP51G5     Populus trichocarpa (black cottonwood)

CYP51G6    Vitis vinifera 
           81% to 81G1 Arab., 90% to CAAP02000381.1
           the two Vitis CYP51G sequences are nearly equally
           similar to other CYP51G1 sequences, so it is not 
           possible to tell if one is the dominant gene from seq. data.

CYP51G7P    Vitis vinifera 

CYP51G8     Glycine max (soybeans, Fabales)

CYP51G9P    Glycine max (soybeans, Fabales)

CYP51G10P   Glycine max (soybeans, Fabales)

CYP51G11P   Brachypodium distachyon

CYP51G12P   Solanum lycopersicum (tomato)

CYP51G13P   Solanum lycopersicum (tomato)

CYP51G14P   Solanum lycopersicum (tomato)

CYP51H1     Oryza sativa (rice)
            GenEMBL AP005448.1b AP005188.2c
            GenEMBL aaaa01003099 Indica rice genome
            Old name = CYP51A6

CYP51H2P    Oryza sativa (rice)
            GenEMBL AP005188.2b AP005448.1a
            GenEMBL aaaa01003099.1a Indica rice genome
            Old name = CYP51A7P

CYP51H3     Oryza sativa (rice)
            GenEMBL AP005188.2a
            GenEMBL aaaa01001626.1 Indica rice genome
            Old name = CYP51A8

CYP51H4     Oryza sativa (rice)
            GenEMBL AP004890.1
            GenEMBL aaaa01009323.1 Indica rice genome
            Old name = CYP51A9

CYP51H5     Oryza sativa (rice)
            GenEMBL AP004090.1
            GenEMBL aaaa01023253.1 aaaa01024682.1 Indica rice genome
            Old name = CYP51A10

CYP51H6     Oryza sativa (rice)
            GenEMBL AC108875.1a
            GenEMBL aaaa01008685.1 Indica rice genome
            Old name = CYP51A11

CYP51H7     Oryza sativa (rice)
            GenEMBL AC108875.1b
            GenEMBL aaaa01010435.1 aaaa01067145.1 Indica rice genome
            Old name = CYP51A12

CYP51H8     Oryza sativa (rice)
            GenEMBL AC108875.1c
            GenEMBL aaaa01004091.1 Indica rice genome
            Old name = CYP51A13

CYP51H9     Oryza sativa (rice)
            GenEMBL AP003866.1a
            BAC clones AQ326645 AQ291927 AQ689048.1 AQ396185.2
            GenEMBL aaaa01005681.1a Indica rice genome
            Old name = CYP51A14

CYP51H10    Avena strigosa (black oats)
            GenEMBL DQ680852
            Annie Osbourn
            Submitted to nomenclature committee Dec 10, 2003
   20 March 2008: 11154990v1
            DOI: 10.1126/science.1154990
            55% to CYP51H6 rice, 47% to CYP51G1 rice
            clone name AsCypA1, a CYP51 with a new function not in sterol 
            sad2 (saponin-deficient) second step in avenacin biosynthesis
            avenacin is an antifungal triterpene glycoside or saponin
            expressed in root tips

CYP51H11    Avena strigosa (black oats)
            No accession number
            Annie Osbourn
            Submitted to nomenclature committee Dec 10, 2003
            56% to 551H7 rice, 47% to 51G1 rice
            clone name AsCypA2

CYP51H12    Zea mays
            64% to CYP51H4 

CYP51H13   Triticum aestivum (wheat)
           No accession umber
           Hikaru Seki
           Submitted to the nomenclature committee April 19, 2010
           Seq. 13 
           57% to CYP51H6 rice

CYP51H14   Brachypodium distachyon (temperate grass)

CYP51H15   Brachypodium distachyon (temperate grass)

CYP51H16   Brachypodium distachyon (temperate grass)

CYP51H17P  Brachypodium distachyon (temperate grass)

CYP51H18P  Brachypodium distachyon (temperate grass)

CYP51H19    Sorghum bicolor
            54% to CYP51H8 rice
            56% to CYP51H15 Brachypodium distachyon

CYP55B1     Chlamydomonas reinhardtii
            See Chlamy page

71A Subfamily

CYP71A1     Persea americana (avocado)
            PIR A44973 (40 amino acids)
            GenEMBL M32885
            O'Keefe, D.P. and Leto, K.J.
            Cytochrome P-450 from the mesocarp of avocado (Persea
            Plant Physiol. 89, 1141-1149 (1989)

CYP71A2     Solanum melongena cv. Sinsadoharanasu (eggplant)
            GenEMBL D14990 (1744bp) X71654 (1747bp) 
            Swiss P37118 (505 amino acids) PIR S36806 (505 amino acids)
            Umemoto,N., Kobayashi,O., Ishizaki-Nishizawa,O. and Toguri,T.
            cDNAs sequences encoding cytochrome P450 (CYP71 family) from
            eggplant seedlings.
            FEBS Lett. 330, 169-173 (1993)
            Note: clone name 154 also called CYPEG4

CYP71A3     Solanum melongena cv. Sinsadoharanasu (eggplant)
            GenEMBL X70982 (1096bp) Swiss P37119 (365 amino acids)
            PIR S36807 (365 amino acids)
            Umemoto,N., Kobayashi,O., Ishizaki-Nishizawa,O. and Toguri,T.
            cDNAs sequences encoding cytochrome P450 (CYP71 family) from
            eggplant seedlings.
            FEBS Lett. 330, 169-173 (1993)
            Note: clone name F151 also called CYPEG3

CYP71A4     Solanum melongena cv. Sinsadoharanasu (eggplant)
            GenEMBL X70981 (1724bp) Swiss P37117 (507 amino acids)
            PIR S36805 (507 amino acids)
            Umemoto,N., Kobayashi,O., Ishizaki-Nishizawa,O. and Toguri,T.
            cDNAs sequences encoding cytochrome P450 (CYP71 family) from
            eggplant seedlings.
            FEBS Lett. 330, 169-173 (1993)
            Note: clone name E138 also called CYPEG2
            Incorrectly called CYP71A1 in Genbank entry

CYP71A5v1   Nepeta racemosa (catmint, source of catnip)
            GenEMBL Y09423(1703bp)
            Clark, I.M., Forde, B.G. and Hallahan, D.L.
            Spatially distinct expression of two new cytochrome P450s in leaves
            of Nepeta racemosa: identification of a trichome-specific isoform.
            Plant Mol. Biol. 33, 875-885 (1997)
            note: sequence is revised on 9/10/98 from original submission 
            only 3 aa differ (lower case).  GenBank entry is now correct.

CYP71A5v2   Nepeta racemosa (catmint, source of catnip)
            No accession number
            Clark, I.M., Forde, B.G. and Hallahan, D.L.
            Spatially distinct expression of two new cytochrome P450s in leaves
            of Nepeta racemosa: identification of a trichome-specific isoform.
            Plant Mol. Biol. 33, 875-885 (1997)
            note: a second allele, CYS at heme signature is now a stop codon
            message is made but the protein is not functional.

CYP71A6     Nepeta racemosa (catmint, source of catnip)
            GenEMBL Y09424(1697bp)
            Clark, I.M., Forde, B.G. and Hallahan, D.L.
            Spatially distinct expression of two new cytochrome P450s in leaves
            of Nepeta racemosa: identification of a trichome-specific isoform.
            Plant Mol. Biol. 33, 875-885 (1997)

CYP71A7     Catharanthus roseus (Madagascar periwinkle) PCR fragment
            GenEMBL X69779 (346bp)
            Meijer,A.H., Souer,E., Verpoorte,R. and Hoge,J.H.C.
            Isolation of cytochrome P-450 cDNA clones from the higher plant
            Catharanthus roseus by a PCR strategy.
            Plant Molec. Biol. 22, 379-383 (1993)
            Note: sequence 7 from Fig. 2.

CYP71A8     Mentha piperita
            GenEMBL Z33875 (2141bp)
            Kang,M.H. and Choi,Y.D.
            Molecular cloning of a genomic DNA for cytochrome P-450 oxidase
            from Mentha piperita.
            unpublished (1994)

CYP71A9X    Glycine max (soybean)
            GenEMBL Y10489 (1603bp)
            Schopfer,C.R. and Ebel,J.
            Identification of elicitor-induced cytochrome P450s of soybean
            (Glycine max L.) using differential display of mRNA
            Mol. Gen. Genet. 258, 315-322 (1998)
            clone CP1
            name changed to CYP71AH3

CYP71A10    Glycine max (soybean)
            GenEMBL AF022157 (1838bp)
            Siminszky,B., Dewey,R.E. and Corbin,F.T.
            capable of catalyzing the metabolism of phenylurea herbicides

CYP71A11X   tobacco
            no accession number 
            Takashi Yamada
            tobacco sequence 2
            submitted to nomenclature committee 9/9/97
            renamed CYP71AH1 only 46% to 71B38

CYP71A12    Arabidopsis thaliana
            GenEMBL AC002340

CYP71A13    Arabidopsis thaliana
            GenEMBL AC002340 updated BX820453 and NM_128630
            ESTs H76866, AA605540
            N-terminal has six more amino acids included. (9/27/04)

CYP71A14      Arabidopsis thaliana
            GenEMBL AF069716 10000-14000 region
            GenEMBL AC005964 comp(3688-6807)
            67% identical to CYP71A13
            no ESTs 

CYP71A15      Arabidopsis thaliana
            GenEMBL AF069716 16000-19000 region
            GenEMBL AC005964 comp(1066-1380) partial seq.
            no ESTs

CYP71A16      Arabidopsis thaliana
            GenEMBL AB022210 comp(26631-24211)
            64% identical to 71A14 ESTs AA395422, T43806

CYP71A17P    Arabidopsis thaliana
           GenEMBL AB017065 comp(19000-21000 region)
           64% identical to 71A14 
           clear pseudogene, missing large regions including I-helix

CYP71A18P   Arabidopsis thaliana
            GenEMBL AC007296 83847-85677 
            86% identical to 71A12 
            no ESTs no GSSs

CYP71A19        Arabidopsis thaliana
           GenEMBL AL049608 
          gene T9E8.30 64% identical to 71A16 no ESTs no GSSs

CYP71A20        Arabidopsis thaliana
           GenEMBL AL049608 
          gene T9E8.50 88% identical to CYP71A19 no ESTs no GSSs

CYP71A21        Arabidopsis thaliana
           GenEMBL AL049659 comp(61576..62187,62279..63139) 
           gene T29H11.160
           also U31288 fragment at end of another gene and GSS B25921 no ESTs

CYP71A22        Arabidopsis thaliana
           GenEMBL AL049659 comp (64631..65242,65328..66188) 
           gene T29H11.170 EST N38590

CYP71A23        Arabidopsis thaliana
           GenEMBL AL049659 comp (67262..67861,68005..68856) 
           gene T29H11.180

CYP71A24        Arabidopsis thaliana
           GenEMBL AL049659 comp(70246..71784) 
           gene T29H11.190 
           Genbank translation has a retained intron before the I-helix

CYP71A25        Arabidopsis thaliana
           GenEMBL AL049659 comp (73216..73830,73929..74786) 
           gene T29H11.200
           ESTs T22148, AA395671, AI100632

CYP71A26    Arabidopsis thaliana
            GenEMBL AL049659 comp(76207..76818,76952..77809) 

CYP71A27P   Arabidopsis thaliana
            GenEMBL AL022224
            F1C12.160a  (parts from two genes are represented as one gene) 
            this is the first gene
            61% identical to CYP71A20
            note formerly 713A1
            Note on August 25, 2004: There is a missing t base just after the
            PERF motif in this gene.  This causes a frameshift and truncates the    
            protein, without a heme signature sequence.  The lost t is apparently 
            real and not a sequence error, so this is a pseudogene of very
            recent origin that is still made into mRNA.  It may be interesting to       
            compare Landsberg erecta and Columbia strains. (4 Ts vs 5Ts ?)

CYP71A28    Arabidopsis thaliana
            GenEMBL AL022224
            F1C12.160b  (parts from two genes are represented as one gene)
            this is the second gene 
            60% identical to CYP71A20
            note formerly 713A2

CYP71A29    Medicago truncatula (barrel medic, Fabales)
            GenPept ABE93594, ABE93593, ABE93591

CYP71A30    Medicago truncatula (barrel medic, Fabales)
            GenEMBL CG924302, AQ917284

CYP71A31    Medicago truncatula (barrel medic, Fabales)
            GenEMBL CG951015, CA920740.1 BI262798.1 AW692831.2

CYP71A32    Mentha x piperita e
            GenEMBL AF346833
            menthofuran synthase
            56% to 71A5

CYP71A33    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C20
            79% to 71A10, same as EST AI496547

CYP71A34    Glycine max (soybeans, Fabales)

CYP71A34-de1b  Glycine max (soybeans, Fabales)

CYP71A35P   Glycine max (soybeans, Fabales)

CYP71A36P   Glycine max (soybeans, Fabales)

CYP71A37   Glycine max (soybeans, Fabales)

CYP71A38P   Glycine max (soybeans, Fabales)

CYP71A39P   Glycine max (soybeans, Fabales)

CYP71A40P   Glycine max (soybeans, Fabales)

CYP71A41P   Glycine max (soybeans, Fabales)

CYP71A42P   Glycine max (soybeans, Fabales)

CYP71A43   Glycine max (soybeans, Fabales)

CYP71A44   Glycine max (soybeans, Fabales)

CYP71A45P   Glycine max (soybeans, Fabales)

CYP71      Juglans regia (walnut, Fagales)
           65% to 71A10

71B Subfamily

CYP71B1     Thlaspi arvense
            GenEMBL L24438 (1648bp)
            Udvardi,M.K., Metzger,J.D., Krishnapillai,V., Peacock,W.J. and
            Cloning and nucleotide sequence of a full length cDNA from Thlaspi arvense
            that encodes a cytochrome P-450.
            Plant Physiol. 104, 755-756 (1994)

CYP71B2     Arabidopsis thaliana
            D78605 (502 amino acids) also AC007357 31915-33510
            Mizutani,M., Ward,E. and Ohta,D.
            Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
            cDNAs, differential expression, and RFLP mapping of multiple
            cytochromes P450
            Plant Mol. Biol. 37, 39-52 (1998)
            P450-48 nearly identical to Z18072 and Z35218 ESTs

CYP71B3     Arabidopsis thaliana
            D78602 (501 amino acids) also AB024038 COMP(43851-45465)
            Mizutani,M., Ward,E. and Ohta,D.
            Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
            cDNAs, differential expression, and RFLP mapping of multiple
            cytochromes P450
            Plant Mol. Biol. 37, 39-52 (1998)
            Contig 885 of the TIGR Landsberg erecta sequences has 100% match

CYP71B4     Arabidopsis thaliana
            D78603 (504 amino acids) also AB024038 comp(78016-79595)
            Mizutani,M., Ward,E. and Ohta,D.
            Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
            cDNAs, differential expression, and RFLP mapping of multiple
            cytochromes P450
            Plant Mol. Biol. 37, 39-52 (1998)
            same as EST T21833, AI100749 GSSs B12539, B10642

CYP71B5     Arabidopsis thaliana
            D78601 (498 amino acids) also AL132958
            Mizutani,M., Ward,E. and Ohta,D.
            Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
            cDNAs, differential expression, and RFLP mapping of multiple
            cytochromes P450
            Plant Mol. Biol. 37, 39-52 (1998)

CYP71B6     Arabidopsis thaliana
            D78604 (503 amino acids)
            Mizutani,M., Ward,E. and Ohta,D.
            Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
            cDNAs, differential expression, and RFLP mapping of multiple
            cytochromes P450
            Plant Mol. Biol. 37, 39-52 (1998)
            ESTs F15479, F14179
            identical to AC005967

CYP71B7      Arabidopsis thaliana
            GenEMBL X97864 (1684bp) also AC007357 33975-41560
            Maughan.J.A., Nugent, J.H.A. and Hallahan, D.L.
            expression of CYP71B7 a cytochrome P450 expressed sequence tag
            from Arabidopsis thaliana.
            unpublished (1996)
            full length sequence of 5 ESTs R65111, T44310, T04541, T04814, T44875
            Contig 610 of the TIGR Landsberg erecta sequences has 100% match

CYP71B8       Arabidopsis thaliana
            GenEMBL AB011485 27121-28820

CYP71B9      Arabidopsis thaliana
            GenEMBL AC004136
            47% identical to 71B7
            no ESTs

CYP71B10       Arabidopsis thaliana
            GenEMBL AB019233 comp(24311 - 22750)
            71% identical to AC004136
            no ESTs no GSS (1/13/99)

CYP71B11 Arabidopsis thaliana
            GenEMBL AC006259 (94-702) partial seq.
            GenEMBL AC005964 (66557-68105) whole seq.
            BAC F21J6 from chromosome V mapping near 60.5 cM
            69% identical to 71B1
            ESTs Z33963, Z33677 GSSs B28673, B78204 and AQ011301

CYP71B12 Arabidopsis thaliana
            GenEMBL AC006259 (4286-6376)
            GenEMBL AC005964 (72227-73777)
            BAC F21J6 from chromosome V mapping near 60.5 cM
            92% identical to 71B11

CYP71B13 Arabidopsis thaliana
            GenEMBL AC006259 (9294-10829)
            GenEMBL AC005964 (76695-78230)
            BAC F21J6 from chromosome V mapping near 60.5 cM
            70% identical to 71B1

CYP71B14 Arabidopsis thaliana
            GenEMBL AC006259 comp(30932-32475)
            BAC F21J6 from chromosome V mapping near 60.5 cM
            68% identical to 71B1

CYP71B15       Arabidopsis thaliana
           GenEMBL AB016889 (54457-56024)
           62% identical to 71B7

CYP71B16         Arabidopsis thaliana
            GenEMBL AB024038 comp(13279-14849)
            84% identical to CYP71B17
            no ESTs no GSSs

CYP71B17         Arabidopsis thaliana
            GenEMBL AB024038 comp(15932-17496)
            84% identical to CYP71B17
            no ESTs no GSSs

CYP71B18         Arabidopsis thaliana
            GenEMBL AB024038 comp(18098-19609)
            80% identical to CYP71B17 
            ESTs AA650762, T44224, AI099821 (2 diffs)
            T44855 (3 diffs) GSS B25335
            missing an internal 21 amino acid fragment and frame shift after 
            first 6 N-terminal  amino acids. may be a pseudogene

CYP71B19         Arabidopsis thaliana
            GenEMBL AB024038 comp(21194-22760)
            ESTs H76241
            60% identical to 71B2

CYP71B20         Arabidopsis thaliana
            GenEMBL AB024038 comp(26044-27630)
            94% identical to CYP71B19
            ESTs T04186, T45449, T21193, AA585920 (1 diff)
            T20987 (3 diffs) no GSSs

CYP71B21         Arabidopsis thaliana
            GenEMBL AB024038 comp(31112-32720)
            88% identical to 71B22 
            no ESTs no GSSs

CYP71B22         Arabidopsis thaliana
            GenEMBL AB024038 36984-38609
            88% identical to CYP71B21
            no ESTS no GSSs

CYP71B23         Arabidopsis thaliana
            GenEMBL AB024038 comp(40969-42839)
            71% ident to 71B7 
            no ESTs no GSSs

CYP71B24         Arabidopsis thaliana
            GenEMBL AB024038 comp(45837-47529)
            80% identical to 71B3 no ESTs 
            GSS AQ011201 (5 diffs/178 = 97%) B96063 4 diffs/126 = 97% these
            may be a related gene.

CYP71B25         Arabidopsis thaliana
            GenEMBL AB024038 comp(75254-76832)
            74% identical to 71B4 
            no ESTs no GSSs

CYP71B26         Arabidopsis thaliana
            GenEMBL AB024038 comp(80407-82076)
            68% identical to 71B9 
            very similar to Z33952, Z34037 (91% identical) but different gene

CYP71B27         Arabidopsis thaliana
             GenEMBL AB007357 28180-29804 
             GSSs B11396, B21019 no ESTs

CYP71B28         Arabidopsis thaliana
             GenEMBL AB007357 34549-36103 
             ESTs T20906, T76255, T14112, N65665, AI100027

CYP71B29         Arabidopsis thaliana
             GenEMBL AB007357 36686-38241 
             similar to GSS B21027

CYP71B30P    Arabidopsis thaliana
             GenEMBL AL132958
             Clone T04D02 from the EU Chr 3 project contains 71B5 and 3 new 71Bs 
             (71B30P, 71B31, 71B32) and 97C1 (formerly a confidential sequence)
             82204-83671 missing N-term 80 AA not found between end of 71B5 and start 
             of this sequence probably a pseudogene
             clone F4P12  from the EU Chr 3 project overlaps T04D02 and contains 
             two of the three new 71Bs and part of the third

CYP71B31     Arabidopsis thaliana
             GenEMBL AL132958
             Clone T04D02 from the EU Chr 3 project contains 71B5 and 3 new 71Bs 
             (71B30P, 71B31, 71B32) and 97C1 (formerly a confidential sequence)
             84593-86302 GSSs AL092788 (clone T10J6) AL081333 (clone F2M19) No ESTs
             clone F4P12  from the EU Chr 3 project overlaps T04D02 and contains 
             two of the three new 71Bs and part of the third

CYP71B32     Arabidopsis thaliana
             GenEMBL AL132958
             Clone T04D02 from the EU Chr 3 project contains 71B5 and 3 new 71Bs 
             (71B30P, 71B31, 71B32) and 97C1 (formerly a confidential sequence)
             87497-89156 two in frame stop codons may be a pseudogene
             clone F4P12  from the EU Chr 3 project overlaps T04D02 and contains 
             two of the three new 71Bs and part of the third

CYP71B33     Arabidopsis thaliana
             GenEMBL AP001298 comp(479-2126)

CYP71B34     Arabidopsis thaliana
             GenEMBL AP001298 comp(2977-4644)

CYP71B35     Arabidopsis thaliana 
             GenEMBL AP001298 comp(4867-6557)

CYP71B36     Arabidopsis thaliana
             GenEMBL AP001298 comp(8161-9842)

CYP71B37     Arabidopsis thaliana
             GenEMBL AP001298 comp(10654-12314)
             EST Z27299

CYP71B38     Arabidopsis thaliana
             Locus tag AT3G44250 GenPept CAB88993.1
             Genomic AL353865 28103-29822 (-) strand

CYP71B38X    Populus trichocarpa (black cottonwood)\
             The CYP71B38 given to an Arabidopsis sequence
             That is was accidentally not listed on the 
             Nomenclature pages
             This cottonwood gene is renamed as CYP71B63
             To give the old name back to Arabidopsis

CYP71B39P    Populus trichocarpa (black cottonwood)
71B40v1      Populus trichocarpa (black cottonwood)
71B40v2      Populus trichocarpa (black cottonwood)
71B41        Populus trichocarpa (black cottonwood)
71B41-de1b   Populus trichocarpa (black cottonwood)
71B42P       Populus trichocarpa (black cottonwood)
71B43P       Populus trichocarpa (black cottonwood)
71B44P       Populus trichocarpa (black cottonwood)
71B45P       Populus trichocarpa (black cottonwood)

CYP71B46   Carica papaya
           supercontig_33:452619..454410 (+ strand)
           FGPP_ORF_70_from_ supercontig_33 
           61% TO CYP71B35, three frameshifts in mid region

CYP71B47   Carica papaya
           supercontig_33:457127..458929 (+ strand)
           56% to 71B35
           Frameshift in first exon after RPKL

CYP71B48   Carica papaya
           supercontig_33:464744..466583 (+ strand)
           57% to 71B34

CYP71B49   Carica papaya
           supercontig_33:481289..493164 (+ strand)
           partial seq. exon 1 only
           Exon 2 in a seq. Gap

CYP71B50P  Carica papaya
           supercontig_33:481289..493164 (+ strand)
           Pseudogene fragment after GS_ORF_53 sequence gap
           41% to 71B24

CYP71B51P  Carica papaya
           supercontig_33:493368..515729 (+ strand)
           Located inside GS_ORF_54_from_supercontig_33
           Pseudogene 38% to CYP71B36

CYP71B52P  Carica papaya
           supercontig_33:565711..567427 (+ strand)
           One stop codon, one frameshift, mid region not well conserved
           May be a pseudogene
           46% to 71B2 

CYP71B53P  Carica papaya
           supercontig_33:568355..570927 (+ strand)
           Frameshift after NIAF, missing C-term 
           44% to 71B36

CYP71B54P  Carica papaya
           pseudogene fragment (-) strand runs off contig upstream
           flanked by a reverse transcriptase 
           52% to 71B36 between I-helix and PKG
           47% to 71B2

CYP71B55   Carica papaya
           57% to 71B37 

CYP71B56P  Carica papaya
           supercontig_144: 640976,642532
           73% to CYP71Ba

CYP71B57   Carica papaya
           supercontig_144:634198..635833 (- strand)
           78% to 71B48 

CYP71B58P  Carica papaya
           pseudogene 48% to 71B34, 47% to 71AS1
           75% to 71B55

CYP71B59   Carica papaya
           exon one only, exon 2 in a seq gap
           one stop codon present, 
           47% to 71B35, 83% to 71B55

CYP71B60P  Carica papaya
           Pseudogene 50% to 71B34, 51% to 71AS1 

CYP71B61P  Carica papaya
           73% to CYP71B55

CYP71B62P  Carica papaya
           44% to 71B37

CYP71B63   Populus trichocarpa (black cottonwood)\
           Formerly CYP71B38 (name conflict with Arabidopsis

71C Subfamily

CYP71C1     Zea mays (maize)
            GenEMBL X81827 (1890bp) X81828 (4352bp)
            Swissprot Q43250
            Frey,M., Kliem,R., Saedler,H. and Gierl,A.
            Expression of a cytochrome P450 gene family in maize
            Mol. Gen. Genet. 246, 100-109 (1995)
            Probable ortholog to 71C6 (wheat), 71C26 (Hordeum),
            71C28 and 71C29
            chr4: 2637246-2638912 (-) strand (Phytozome browser)

CYP71C1     Zea mays
            GenEMBL AF004210 (1185bp)
            agr(c94) random cDNA clone from Zea mays etiolated coleoptiles

CYP71C1v1   Zea mays (maize)
            1 aa diff to 71C1
            50% to 71C4

CYP71C1v2   Zea mays (maize)
            99% to 71C1 (2 aa diffs)
            1 aa diff to EU974830

CYP71C2     Zea mays (maize)
            GenEMBL X81829 (1786bp)
            Swissprot Q43255 
            Frey,M., Kliem,R., Saedler,H. and Gierl,A.
            Expression of a cytochrome P450 gene family in maize
            Mol. Gen. Genet. 246, 100-109 (1995)
            Probable ortholog of CYP71C7 in wheat and 71C25 in Hordeum

CYP71C2v1   Zea mays (maize)
            GenEMBL Y11404 (3130bp)
            Gierl, A.
            unpublished (1997)
            chr4: 2589837-2591145 (-) strand (Phytozome browser)

CYP71C2v2   Zea mays
            Sharon Potter
            sequence b
            submitted to nomenclature committee

CYP71C2v2   Zea mays 
            BZ828285.1, CG202669.1
            96% identical to v1, CG230859.1
            This seq does not match genomic DNA or ESTs at 8 aa 
            This may be poor quality sequence in exon 2, 
            or an allele not in Genbank
RQEE (gc boundary here)

CYP71C2v2   Zea mays
            98% to 71C2v1, 98% to 71C2v2,
            note this seq matches 71C2v2 except in the middle region where
            it matches CYP71C2v1.  Those sequences may be hybrids 

CYP71C3v1   Zea mays (maize)
            GenEMBL X81830 (1800bp)
            Swissprot P93703
            Frey,M., Kliem,R., Saedler,H. and Gierl,A.
            Expression of a cytochrome P450 gene family in maize
            Mol. Gen. Genet. 246, 100-109 (1995)
            Probable ortholog of CYP71C8 in wheat and 71C27 in Hordeum

CYP71C3v1   Zea mays (maize)
            GenEMBL Y11403 (5057bp)
            Gierl, A.
            unpublished (1997)
            chr4: 2699282-2701101 (+) strand (Phytozome browser)

CYP71C3v2   Zea mays (maize)
            AY072298 (mRNA)
            Persans,M.W., Wang,J. and Schuler,M.A.
            Characterization of maize cytochrome p450 monooxygenases induced in
            response to safeners and bacterial pathogens
            Plant Physiol. 125 (2), 1126-1138 (2001)

CYP71C3v2   Zea mays (maize)
            AY072299 (gene)
            Wang,J. and Schuler,M.A.
            Molecular characterization of the maize CYP71C3 and CYP72A
            subfamily genes
            note:  Maize strain used in Schuler's lab = B73, Frey's lab used CI31A

CYP71C3v2   Zea mays (maize)
            100% to CYP71C3v2
            2 aa diffs to CYP71C3v3 EU960395
            98% to CYP71C3v1 7 aa diffs

CYP71C3v3   Zea mays (maize)
            2 aa diffs to CYP71C3v2 EU967421

CYP71C4     Zea mays (maize)
            GenEMBL X81831 (1878bp)
            Frey,M., Kliem,R., Saedler,H. and Gierl,A.
            Expression of a cytochrome P450 gene family in maize
            Mol. Gen. Genet. 246, 100-109 (1995)
            Probable ortholog of CYP71C9 in wheat and 71C24 in Hordeum
            Called ZmBX2 by Gregersen
            chr4: 2851225-2852950 (+) strand (Phytozome browser)

CYP71C4     Zea mays (maize)
            GenEMBL Y11368 (7466bp)
            Gierl, A.
            unpublished (1997)

CYP71C5     Zea mays (maize)
            Sharon Potter
            sequence a
            submitted to nomenclature committee
            55% to 71C4
            also called BX2like_MAIZE_ESTcontig by Gregersen

CYP71C5     Zea mays (maize)
            CG332493.1, CG280655.1, CG040547.1, CG359491.1
            chr6:7645971-7647690 (-) strand (Phytozome browser)
            This sequence is 2 aa different from the genomic sequence
            Consider the genomic sequence to be the reference sequence

CYP71C5X  Zea mays (maize)
          chr6:7645971-7647690 (-) strand 
          clone name n4884_P01_Z_mays 
          97% to CYP71C5 CG332493.1, CG280655.1, CG040547.1, CG359491.1 
          This sequence is a different gene from CYP71C5
          It has been renamed CYP71C62

CYP71C6v1   Triticum aestivum (wheat)
            GenEMBL AF123601
            Daniele Werck
            submitted to nomenclature committee 1/20/99
            probable orthologue to CYP71C1 Zea (79% identical)
            also related to 71C26 Hordeum and 71C28 and 71C29

CYP71C6v1   Triticum aestivum (wheat)
            GenEMBL AB042627
            Hiromasa Imaishi
            submitted to nomenclature committee 4/30/2000
            clone name N-2
            probable orthologue to CYP71C1 (79% identical)
            100% identical to 71C6v1 AF123601

CYP71C6v2   Triticum aestivum 
            Nomura,T., Ishihara,A., Yanagita,R.C., Endo,T.R. and Iwamura,H.
            Three genomes differentially contribute to the biosynthesis of
            benzoxazinones in hexaploid wheat
            Proc. Natl. Acad. Sci. U.S.A. 102 (45), 16490-16495 (2005)
            submitted to nomenclature committee 10/20/2003
            clone name C6-18
            98% to 71C6v1 9 aa diffs

CYP71C6v2   Triticum aestivum 
            Yang,G., Li,B., Zheng,Q., Liu,J., Tong,Y. and Li,Z.
            1 aa diff to 71C6v2 AB124854

CYP71C6v3   Triticum aestivum L. cv Chinese Spring (wheat)
            Nomura,T., Ishihara,A., Yanagita,R.C., Endo,T.R. and Iwamura,H.
            Three genomes differentially contribute to the biosynthesis of
            benzoxazinones in hexaploid wheat
            Proc. Natl. Acad. Sci. U.S.A. 102 (45), 16490-16495 (2005)
            submitted to nomenclature committee 10/20/2003
            clone name C6-5
            98% to 71C6v1 6 aa diffs

CYP71C6v4   Triticum aestivum 
            Yang,G., Li,B., Zheng,Q., Liu,J., Tong,Y. and Li,Z.
            Genomic sequence of P450 from blue-grained wheat
            2 aa diffs to CYP71C6v2 AB124854

CYP71C6v5   Triticum aestivum 
            Yang,G., Li,B., Zheng,Q., Liu,J., Tong,Y. and Li,Z.
            96% to 71C6v1, 97% to 71C6v2, 97% to 71C6v3

CYP71C6v6   Triticum aestivum 
            Yang,G., Li,B., Zheng,Q., Liu,J., Tong,Y. and Li,Z.
            7aa diffs to 71C6v2 AY485940, 8 aa diffs to 71C6v2 AB124854

CYP71C6v7   Triticum aestivum 
            Yang,G., Li,B., Zheng,Q., Liu,J., Tong,Y. and Li,Z.
            8 aa diffs to 71C6v2 AB124854

CYP71C7v1   Triticum aestivum (wheat)
            GenEMBL AF123602
            Daniele Werck
            submitted to nomenclature committee 1/20/99
            probable orthologue to CYP71C2 Zea (76% identical)
            also related to CYP71C25 Hordeum

CYP71C7v1   Triticum aestivum L. cv Chinese Spring (wheat)
            Nomura,T., Ishihara,A., Yanagita,R.C., Endo,T.R. and Iwamura,H.
            Three genomes differentially contribute to the biosynthesis of
            benzoxazinones in hexaploid wheat
            Proc. Natl. Acad. Sci. U.S.A. 102 (45), 16490-16495 (2005)
            submitted to nomenclature committee 10/20/2003
            clone name C7-20
            >99% to 71C7v1 AF123602 only 1 aa diff

CYP71C7v2   Triticum aestivum (wheat)
            GenEMBL AB042628
            Hiromasa Imaishi
            submitted to nomenclature committee 4/30/2000
            clone name N-3
            probable orthologue to CYP71C2 (76% identical)
            96% identical to 71C7v1 of Werck

CYP71C2v2 ortholog   Triticum monococcum subsp. aegilopoides
            Entrez protein BAF44080.1
            98% to CYP71C7v2 wheat

CYP71C7v3   Triticum aestivum L. cv Chinese Spring (wheat)
            Nomura,T., Ishihara,A., Yanagita,R.C., Endo,T.R. and Iwamura,H.
            Three genomes differentially contribute to the biosynthesis of
            benzoxazinones in hexaploid wheat
            Proc. Natl. Acad. Sci. U.S.A. 102 (45), 16490-16495 (2005)
            submitted to nomenclature committee 10/20/2003
            clone name C7-2
            95% to 71C7v1 22 aa diffs 96% to 71C7v2 17 aa diffs

CYP71C8v1   Triticum aestivum (wheat)
            GenEMBL AF123603
            Daniele Werck
            submitted to nomenclature committee 1/20/99
            probable orthologue to CYP71C3 (78% identical)
            Note: N-terminal 7 amino acids are probably not
            correct since Met codon is ttg not atg.
            Probable ortholog of CYP71C3 in Zea and 71C27 in Hordeum

CYP71C8v1   Triticum aestivum L. cv Chinese Spring (wheat)
            Nomura,T., Ishihara,A., Yanagita,R.C., Endo,T.R. and Iwamura,H.
            Three genomes differentially contribute to the biosynthesis of
            benzoxazinones in hexaploid wheat
            Proc. Natl. Acad. Sci. U.S.A. 102 (45), 16490-16495 (2005)
            submitted to nomenclature committee 10/20/2003
            clone name C8-9
            100% to 71C8v1 AF123603

CYP71C8v2   Triticum aestivum (wheat)
            GenEMBL AB042629
            Hiromasa Imaishi
            submitted to nomenclature committee 4/30/2000
            clone name N-4
            probable orthologue to CYP71C3 (78% identical)
            95% identical to 71C8v1 of Werck

CYP71C8v3   Triticum aestivum L. cv Chinese Spring (wheat)
            Nomura,T., Ishihara,A., Yanagita,R.C., Endo,T.R. and Iwamura,H.
            Three genomes differentially contribute to the biosynthesis of
            benzoxazinones in hexaploid wheat
            Proc. Natl. Acad. Sci. U.S.A. 102 (45), 16490-16495 (2005)
            submitted to nomenclature committee 10/20/2003
            clone name C8-3
            95% to 71C8v1 24 aa diffs 97% to 71C8v2 13 aa diffs 

CYP71C8v4   Triticum monococcum subsp. aegilopoides
            Entrez protein BAF44081.1
            TbBx5-4, paralog to CYP71C8v1, v2 and v3
            96% to CYP71C8v3 wheat

CYP71C9v1   Triticum aestivum (wheat)
            GenEMBL AB042630
            Hiromasa Imaishi
            submitted to nomenclature committee 4/30/2000
            clone name N-5
            probable orthologue to CYP71C4 Zea (78% identical)
            also related to 71C24 Hordeum
            97% identical to 71C9v2

CYP71C9v1 ortholog   Triticum monococcum subsp. aegilopoides
            Entrez protein BAF44079.1

CYP71C9v2   Triticum aestivum (wheat)
            GenEMBL AB042631
            Hiromasa Imaishi
            submitted to nomenclature committee 4/30/2000
            clone name N-6
            probable orthologue to CYP71C4 (78% identical)
            97% identical to 71C9v1

CYP71C9v2   Triticum aestivum (wheat)
            No accession number
            Daniele Werck-Reichhart
            submitted to nomenclature committee July 23, 2001
            76% identical to 71C4
            clone C4-38
            100% identical to Dr. Imaishis sequence

CYP71C9v3   Triticum aestivum L. cv Chinese Spring (wheat)
            Nomura,T., Ishihara,A., Yanagita,R.C., Endo,T.R. and Iwamura,H.
            Three genomes differentially contribute to the biosynthesis of
            benzoxazinones in hexaploid wheat
            Proc. Natl. Acad. Sci. U.S.A. 102 (45), 16490-16495 (2005)
            submitted to nomenclature committee 10/20/2003
            clone name C9-24
            98% to 71C9v2 8 aa diffs 97% to 71C9v1 9 aa diffs 

CYP71C10    Triticum aestivum (wheat) formerly CYP71H1
            ESTs: CJ699033.1, CJ596758.1, CJ702528.1, CD884412.1, 
            CJ593092.1, CJ564668.1, CJ671762.1, CD882978.1,
            EB514761.1, EB515119.1, EB515327.1, 
            Daniele Werck-Reichhart 
            55% to 71C4 but only 50% to 71C8, 56% to 71C11
            clone name 71F8I2
            submitted to nomenclature committee July 18, 2000
            This sequence has been reassigned to the 71C subfamily
            It is on the outskirts of the subfamily, but new sequences 
            force it to belong there rather than in a new subfamily.
            Also similar to CYP71AE1 and CYP71AE2 that have been renamed
            CYP71C33 and CYP71C32 respectively
            Hordeum CYP71C34 is most similar (83%)

CYP71C10    Triticum aestivum (wheat)
            No accession number
            Per Langkjaer Gregersen
            Submitted to nomenclatue committee Nov. 15, 2007
            100% to 71C10 of Werck-Reichhart

CYP71C11    Triticum aestivum (wheat)
            CD454940.1 EST
            Daniele Werck-Reichhart
            submitted to nomenclature committee Jan 6, 2001
            65% to 71C14
            58% identical to 71C7, 57% to 71C6 and 56% identical to 71C10
            whole seq known but confidential 
CV777383.1 from aa 74-218, 6 lower case letters differ from 
submitted aa sequence
(112 aa gap) 
CD454940.1 aa 331-537

CYP71C12    Oryza sativa (rice)
CYP71C13P   Oryza sativa (rice)
CYP71C14P   Oryza sativa (rice)
CYP71C15    Oryza sativa (rice)
CYP71C16    Oryza sativa (rice)
CYP71C17    Oryza sativa (rice)
CYP71C18P   Oryza sativa (rice)
            88% to CYP71C21
CYP71C19    Oryza sativa (rice)
            89% to CYP71C21
CYP71C20    Oryza sativa (rice)
CYP71C21    Oryza sativa (rice)
CYP71C22P   Oryza sativa (rice)
CYP71C23P   Oryza sativa (rice)

CYP71C24    Hordeum lechleri 
            Grun,S., Frey,M. and Gierl,A.
            Evolution of the indole alkaloid biosynthesis in the genus Hordeum:
            Distribution of gramine and DIBOA and isolation of the
            benzoxazinoid biosynthesis genes from Hordeum lechleri
            Phytochemistry 66 (11), 1264-1272 (2005)
            97% to 71C9v3, 54% to 71C7
            Probable ortholog to CYP71C9 wheat and CYP71C4 Zea

CYP71C25    Hordeum lechleri 
            Grun,S., Frey,M. and Gierl,A.
            Evolution of the indole alkaloid biosynthesis in the genus Hordeum:
            Distribution of gramine and DIBOA and isolation of the
            benzoxazinoid biosynthesis genes from Hordeum lechleri
            Phytochemistry 66 (11), 1264-1272 (2005)
            94% to 71C7
            Probable ortholog to CYP71C7 wheat and CYP71C2 Zea

CYP71C26    Hordeum lechleri 
            Grun,S., Frey,M. and Gierl,A.
            Evolution of the indole alkaloid biosynthesis in the genus Hordeum:
            Distribution of gramine and DIBOA and isolation of the
            benzoxazinoid biosynthesis genes from Hordeum lechleri
            Phytochemistry 66 (11), 1264-1272 (2005)
            96% to 71C6v3
            Probable ortholog to CYP71C6 wheat and CYP71C1 Zea
            Also related to CYP71C28 and 71C29

CYP71C27    Hordeum lechleri 
            Grun,S., Frey,M. and Gierl,A.
            Evolution of the indole alkaloid biosynthesis in the genus Hordeum:
            Distribution of gramine and DIBOA and isolation of the
            benzoxazinoid biosynthesis genes from Hordeum lechleri
            Phytochemistry 66 (11), 1264-1272 (2005)
            94% to 71C8
            Probable ortholog to CYP71C8 wheat and CYP71C3 Zea

CYP71C28    Thinopyrum ponticum 
            Yang,G., Li,B., Zheng,Q., Liu,J., Tong,Y. and Li,Z.
            98% (8 aa diffs) to 71C6v2 AB124854
            Probable ortholog to CYP71C6 wheat and CYP71C1 Zea

CYP71C29    Thinopyrum ponticum 
            Yang,G., Li,B., Zheng,Q., Liu,J., Tong,Y. and Li,Z.
            6 aa diffs to 71C6v1
            Probable ortholog to CYP71C6 wheat and CYP71C1 Zea

CYP71C29    Triticum aestivum 
            Yang,G., Li,B., Zheng,Q., Liu,J., Tong,Y. and Li,Z.
            Molecular cloning of P450 gene from Chinese Spring
            99% (5 aa diffs) to CYP71C29, 7 aa diffs to 71C6v1
            possible allele of 71C6, probable ortholog of AY485937
            Probable ortholog to CYP71C6 wheat and CYP71C1 Zea

CYP71C30    Lolium rigidum (ryegrass)
            Fischer,T.C., Klattig,J.T. and Gierl,A.
            A general cloning strategy for divergent plant cytochrome P450
            genes and its application in Lolium rigidum and Ocimum basilicum
            Theor. Appl. Genet. 103, 1014-1021 (2001)
            clone BXH putative cytochrome P450 mRNA, complete
            54% to 71C14 (rice), 39% to 71B26 (Arab.)

CYP71C31    Echinochloa phyllopogon (late watergrass)
            No accession number
            Akira Uchino
            Submitted to nomenclature committee Oct. 31, 2007
            Clone name Ep17
            64% to AF321858 Lolium rigidum CYP71C30

CYP71C32    Oryza sativa (rice) 
            Formerly CYP71AE2 renamed based on CYP71C trees
            Most similar to CYP71C33, CYP71C10 and CYP71C34

CYP71C33    Oryza sativa (rice) 
            aaaa01019060.1 (indica cultivar-group) one stop in exon 2
            EE590601.1 (japonica EST) 5 aa diffs to indica
            Formerly CYP71AE1 renamed based on CYP71C trees
            Most similar to CYP71C32 65%, CYP71C10 and CYP71C34

CYP71C34    Hordeum vulgare (barley)
            No accession number 
            Per Langkjaer Gregersen
            Submitted to nomenclatue committee Nov. 15, 2007
            Probable ortholog of CYP71C10 wheat (83%)
            ESTcontig PUT-157a-Hordeum_vulgare-1108111101_5 PlantGDB-assembled 
            Unique Transcript-fragment derived from Hordeum_vulgare mRNAs

CYP71C35    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami and Akira Uchino
            Submitted to nomenclatue committee Dec. 4, 2008
            Clone name BP17
            99% to 71C31 except the first 13 amino acids and 3 other amino acids.
            This sequence maps to a different location than the CYP71C31 sequence.

CYP71C36    Zea mays
            54% to CYP71C24, 53% to CYP71C5, 51% to 71C14

CYP71C36   Zea mays
           chr2:32495136-32496884 (-) strand (Phytozome browser)
           clone name n4036_P01_Z_mays 
           98% to CYP71C36 EU974117 

CYP71C37    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Jan. 10, 2010
            Clone name EEF1
            66% to CYP71C14, 73% to CYP71C39, 72% to CYP71C38

CYP71C38    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Jan. 10, 2010
            Clone name EEF2
            66% to CYP71C14, 94% to CYPEEF3

CYP71C39    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Jan. 10, 2010
            Clone name EEF3
            68% to CYP71C14, retained intron, 94% to CYP71C38

CYP71C40    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Jan. 10, 2010
            Clone name EEF4
            54% to CYP71C17, 88% to CYP71C41

CYP71C41    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Jan. 10, 2010
            Clone name EEF5
            55% to CYP71C17, 88% to CYP71C40

CYP71C42v1  Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Jan. 10, 2010
            Clone name EEF12-1
            58% to CYP71C14, 100% to CYP71C42v2 except for 6 aa deletion, 
            68% to CYP71C40

CYP71C42v2  Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Jan. 10, 2010
            Clone name EEF12-2
            58% to CYP71C14, Frameshift at & (16 nucleotides missing), 
            100% to CYP71C42v1 except for deletion of 6 amino acids

CYP71C43-71C55 Brachypodium distachyon (temperate grass)

CYP71C56    Zea mays (maize)
            chr2 :32399262-32401041 (-) strand (Phytozome browser)
            clone name n9342_P01_Z_mays

CYP71C57   Zea mays (maize)
           chr2:32378480-32380331 (-) strand (Phytozome browser)
           clone name n1264_P01_Z_mays 

CYP71C58   Zea mays (maize)
           chr2:99835719-99837386 (+) strand (Phytozome browser)
           clone name n3796_P01_Z-mays

CYP71C59   Zea mays (maize)
           chr10:107886897-107888717 (+) strand (Phytozome browser)
           clone name n8732_P01_Z_mays 

CYP71C60   Zea mays (maize)
           chr10: 107945353-107947211 (+) strand (Phytozome browser)
           clone name n9530_Z_mays

CYP71C61    Saccharum hybrid cultivar
            ESTs CA274311.1 DV635365.1
            78% to CYP71C60 Zea mays

CYP71C62  Zea mays (maize)
          chr6:7645971-7647690 (-) strand on phytozome
          clone name n4884_P01_Z_mays 
          97% to CYP71C5 CG332493.1, CG280655.1, CG040547.1, CG359491.1 
          This sequence is a different gene from CYP71C5
          It has been renamed CYP71C62

CYP71C63    Sorghum bicolor
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen
CYP71C64    Sorghum bicolor
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C65    Sorghum bicolor
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C66    Sorghum bicolor
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C67    Sorghum bicolor
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C68    Sorghum bicolor
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C69    Sorghum bicolor
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C70    Sorghum bicolor
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C71    Sorghum bicolor
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C72    Sorghum bicolor
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C73    Sorghum bicolor
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C74    Sorghum bicolor
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C75    Sorghum bicolor
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C76    Sorghum bicolor
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C77    Sorghum bicolor
            SORBIDRAFT_07g003000, XM_002444979
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C78    Sorghum bicolor
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C79    Setaria italica
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C80    Setaria italica
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C81    Setaria italica
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C82    Setaria italica
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C83    Setaria italica
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C84    Setaria italica
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C85    Setaria italica
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C86    Setaria italica
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C87    Setaria italica
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C88    Setaria italica
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C89    Setaria italica
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C90    Setaria italica
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C91    Setaria italica
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C92    Setaria italica
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C93    Setaria italica
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C94    Setaria italica
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C95    Setaria italica
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71C96    Phyllostachys praecox (bamboo)
            GenPept ACM69386
            71% to CYP71C14P rice

CYP71C97    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Feb. 25, 2011
            Clone name Ep6
            90% to CYP71C42v1 Echinochloa phyllopogon
            75% to CYP71C43 Brachypodium distachyon, 70% to CYP71C17 rice

CYP71C98    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Feb. 25, 2011
            Clone name Ep11
            93% to CYP71C41 Echinochloa phyllopogon
            75% to CYP71C51P Brachypodium distachyon, 71% to CYP71C16 rice

CYP71C99    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Feb. 25, 2011
            Clone name DG1
            81% to CYP71C39 Echinochloa phyllopogon
            63% to CYP71C50 Brachypodium distachyon, 65% to CYP71C14 rice
            58% to CYP71C97 Echinochloa phyllopogon

CYP71C100v1 Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee May 9, 2012
            Clone name Bx4A
            97% to CYP71C100v2 Echinochloa phyllopogon
            81% to CYP71C6v3 AB124855.1 Triticum aestivum

CYP71C100v2 Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee May 9, 2012
            Clone name Bx4B
            97% to CYP71C100v1 Echinochloa phyllopogon

CYP71C-like Hordeum vulgare (barley)
            GenEMBL AJ000231
            Analysis of randomly selected cDNAs from white leaves of the
            albostrians mutant of barley
            68% identical to C-terminal of 71C4

71D Subfamily

CYP71D1     Catharanthus roseus
            GenEMBL AY192573
            submitted to nomenclature committee

CYP71D2     Catharanthus roseus
            GenEMBL AY192574
            submitted to nomenclature committee

CYP71D2     Catharanthus roseus
            No accesion number
            Daniele Werck-Reichhart
            Submitted to nomenclature committee Oct. 10, 2011
            Full sequence

CYP71D3X    Arabidopsis thaliana
            GenEMBL Z27299
            62% amino acid identity to CYP71D1
            this short EST fragment belongs to 71B37

CYP71D4     Solanum tuberosum cv. Datura (potato)
            GenEMBL AJ296346
            Michel Schneider 
            56.1% identical to CYP71D1
            induced rapidly by Phytophthora infestans infection or wounding
            (pesonal communication from Michel Schneider)

CYP71D5v1  Nicotiana tabacum (tobacco)
           no accession number
           Simon Warner
           submitted to nomenclature committee

CYP71D5v2  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D267-AF10
           2 aa diffs to 71D5

CYP71D5v3  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D96-AB6
           3 aa diffs to 71D5

CYP71D6    Solanum chacoense (Chaco potato)
           GenEMBL U48434 (1641bp)
           Hutvagner, G., Barta, E. and Banfalvi, Z.
           Isolation and sequence analysis of a cDNA and related gene for 
           cytochrome P450 from Solanum chacoense.
           Gene 188 (2), 247-252 (1997)

CYP71D7    Solanum chacoense (Chaco potato)
           GenEMBL U48435 (3107bp)
           Hutvagner, G., Barta, E. and Banfalvi, Z.
           Isolation and sequence analysis of a cDNA and related gene for 
           cytochrome P450 from Solanum chacoense.
           Gene 188 (2), 247-252 (1997)

CYP71D8     Glycine max (soybean)
            GenEMBL Y10493 (1800bp)
            Schopfer,C.R. and Ebel,J.
            Identification of elicitor-induced cytochrome P450s of soybean
            (Glycine max L.) using differential display of mRNA
            Mol. Gen. Genet. 258, 315-322 (1998)
            clone CP7

CYP71D9     Glycine max (soybean)
            GenEMBL Y10490 (1754bp)
            Schopfer,C.R. and Ebel,J.
            Identification of elicitor-induced cytochrome P450s of soybean
            (Glycine max L.) using differential display of mRNA
            Mol. Gen. Genet. 258, 315-322 (1998)
            clone CP3

CYP71D10    Glycine max (soybean)
            GenEMBL AF022459 (1691bp)
            Siminszky,B., Dewey,R.E. and Corbin,F.T.
            clone name 5/16

CYP71D11    Lotus japonicus
            GenEMBL AF000403 (1641bp)
            Szczyglowski,K., Hamburger,D., Kapranov,P. and de Bruijn,F.J.
            Construction of a Lotus japonicus late nodulin expressed sequence
            tag library and identification of novel nodule-specific genes
            Plant Physiol. 114 (4), 1335-1346 (1997)

CYP71D12    Catharanthus roseus (Madagascar periwinkle)
            GenEMBL AJ238612 (1682 bp)
            Schroeder,G., Unterbusch,E., Kaltenbach,M., 
            Schmidt,J., Strack,D., De Luca,V., and Schroeder,J.:
            Light-induced cytochrome P450-dependent enzyme in 
            indole alkaloid biosynthesis: tabersonine 
            FEBS Lett. 458, 97-102 (1999)
            Note: due to a mistake on my part the name 71D12 was assigned
            to two sequences.  The sequence of Schroeder has priority
            Since it was submited and named earlier than Lupiens sequence.

CYP71D12X   Mentha spicata (spearmint) Renamed as CYP71D18
            GenEMBL AF124815
            Shari Lupien, Rodney Croteau
            Regio-Specific Cytochrome p450 Limonene Hydroxylases From Mint
            (mentha) Species
            submitted to nomenclature committee 1/24/99
            50% identical to 71D7, 69% identical to 71D13
            Note: due to a mistake on my part the name 71D12 was assigned
            to two sequences.  The sequence of Schroeder has priority
            Since it was submitted and named earlier than Lupiens sequence.

CYP71D13    Mentha X piperita (peppermint)
            GenEMBL AF124816
            Shari Lupien, Rodney Croteau
            Regio-Specific Cytochrome p450 Limonene Hydroxylases From Mint
            (mentha) Species
            submitted to nomenclature committee 1/24/99
            69% identical to 71D12
            clone name PM17

CYP71D14    Petunia hybrida (petunia)
            GenEMBL AB028462
            Hiromasa Imaishi
            submitted to nomenclature committee June 4, 1999
            58% to 71D6 

CYP71D15    Mentha X piperita (peppermint)
            GenEMBL AF124817
            Shari Lupien, Rodney Croteau
            Regio-Specific Cytochrome p450 Limonene Hydroxylases From Mint
            (mentha) Species
            submitted to nomenclature committee 1/24/99
            69% identical to 71D12, 92% identical to 71D13
            clone name PM2

CYP71D16   Nicotiana tabacum
           GenEMBL AF166332
           Wang,E., Wang,R., Deparasis,J., Gan,S. and Wagner,G.J.
           Isolation of a cytochrome P450 gene from tobacco
           54% to 71D5 also a tobacco sequence

CYP71D17    Prunus dulcis chloroplast  (almond)
            GenEMBL AF107765
            Ma,R. and Oliveira,M.M.
            A putative Prunus dulcis cytochrome P450 gene sequence
            chloroplast gene encoding chloroplast protein, partial cds.
            70% identical to 71D sequences these sequences may be chloroplast P450s

CYP71D18    Mentha spicata (spearmint) Formerly CYP71D12
            GenEMBL AF124815
            Shari Lupien, Rodney Croteau
            Regio-Specific Cytochrome p450 Limonene Hydroxylases From Mint
            (mentha) Species
            submitted to nomenclature committee 1/24/99
            50% identical to 71D7, 69% identical to 71D13
            Note: due to a mistake on my part the name 71D12 was assigned
            to two sequences.  The sequence of Schroeder has priority
            Since it was submitted and named earlier than Lupiens sequence.

CYP71D18    Mentha x gracilis
            GenEMBL AY281025.1 
            Bertea,C., Schalk,M., Mau,C.J., Karp,F., Wildung,M.R. and
            Molecular evaluation of a spearmint mutant altered in the
            expression of limonene hydroxylases that direct essential oil
            monoterpene biosynthesis
            Phytochemistry 64 (7), 1203-1211 (2003)
            100% to Mentha spicata 71D18

CYP71D19    Capsicum annuum (pepper)
            GenEMBL AF122821
            Oh,B.J., Ko,M.K., Kim,Y.S., Kim,K.S., Kostenyuk,I. and Kee,H.K.
            A cytochrome P450 gene is differentially expressed in compatible
            and incompatible interactions between pepper (Capsicum annuum) and
            the anthracnose fungus, Colletotrichum gloeosporioides
            Mol. Plant Microbe Interact. 12 (12), 1044-1052 (1999)
            58% to 71D6

CYP71D20v1  Nicotiana tabacum (tobacco)
            GenEMBL AF368376
            Ralston L, Kwon ST, Schoenbeck M, Ralston J, Schenk DJ, Coates RM, 
            Chappell J.
            Cloning, heterologous expression, and functional characterization of
            5-epi-aristolochene-1,3-dihydroxylase from tobacco 
            (Nicotiana tabacum).
            Arch Biochem Biophys. 2001 Sep 15;393(2):222-35.
            Submitted to nomenclature committee Sept. 22, 2000
            81% to 71D4
            gene 1

CYP71D20v2 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D112-aa5
           99% to 71D20 except for 32 aa insertion between SNGAL and DMFAAG 

CYP71D21    Nicotiana tabacum (tobacco)
            GenEMBL AF368377
            Ralston L, Kwon ST, Schoenbeck M, Ralston J, Schenk DJ, Coates RM, 
            Chappell J.
            Cloning, heterologous expression, and functional characterization of
            5-epi-aristolochene-1,3-dihydroxylase from tobacco 
            (Nicotiana tabacum).
            Arch Biochem Biophys. 2001 Sep 15;393(2):222-35.
            Submitted to nomenclature committee Sept. 22, 2000
            82% to 71D4
            gene 2

CYP71D22          Populus trichocarpa (black cottonwood)
CYP71D22P         Populus trichocarpa (black cottonwood)
CYP71D23P         Populus trichocarpa (black cottonwood)
CYP71D24P         Populus trichocarpa (black cottonwood)
CYP71D25Pv1       Populus trichocarpa (black cottonwood)
CYP71D25Pv2       Populus trichocarpa (black cottonwood)
CYP71D26          Populus trichocarpa (black cottonwood)
CYP71D27          Populus trichocarpa (black cottonwood)
CYP71D28v1        Populus trichocarpa (black cottonwood)
CYP71D28v2        Populus trichocarpa (black cottonwood)
CYP71D29v1        Populus trichocarpa (black cottonwood)
CYP71D29v2        Populus trichocarpa (black cottonwood)
CYP71D29-se1[1]   Populus trichocarpa (black cottonwood)
CYP71D29-se2[1]   Populus trichocarpa (black cottonwood)
CYP71D29-se3[1]   Populus trichocarpa (black cottonwood)
CYP71D30P         Populus trichocarpa (black cottonwood)
CYP71D31P         Populus trichocarpa (black cottonwood)
CYP71D32P         Populus trichocarpa (black cottonwood)
CYP71D33P         Populus trichocarpa (black cottonwood)
CYP71D34          Populus trichocarpa (black cottonwood)
CYP71D35P         Populus trichocarpa (black cottonwood)
CYP71D36Pv1       Populus trichocarpa (black cottonwood)
CYP71D36Pv2       Populus trichocarpa (black cottonwood)
CYP71D36Pv3       Populus trichocarpa (black cottonwood)
CYP71D37P         Populus trichocarpa (black cottonwood)
CYP71D38v1        Populus trichocarpa (black cottonwood)
CYP71D38v2        Populus trichocarpa (black cottonwood)
CYP71D38-de2b     Populus trichocarpa (black cottonwood)
CYP71D38-de2c     Populus trichocarpa (black cottonwood)
CYP71D39          Populus trichocarpa (black cottonwood)
CYP71D40Pv1       Populus trichocarpa (black cottonwood)
CYP71D40Pv2       Populus trichocarpa (black cottonwood)
CYP71D41          Populus trichocarpa (black cottonwood)
CYP71D42          Populus trichocarpa (black cottonwood)
CYP71D43          Populus trichocarpa (black cottonwood)
CYP71D44          Populus trichocarpa (black cottonwood)
CYP71D45P         Populus trichocarpa (black cottonwood)
CYP71D46P         Populus trichocarpa (black cottonwood)

CYP71D47v1 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D89-ad2
           92% to 71D19 

CYP71D47v2 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D89-ab1
           92% to 71D19, 1 aa diff to CYP71D22v1

CYP71D48v1 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D163-AF12
           91% to 71D19, 96% to CYP71D22v1

CYP71D48v2 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D163-AG11
           90% to 71D19, 95% to CYP71D22v1, 7 aa diffs to CYP71D23v1
           complete seq.

CYP71D48v2    Nicotiana tabacum 
              59% to 71AB2 rice

CYP71D49v1 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D207-AC4
           93% to CYP71D5v2

CYP71D49v2 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D207-AA5
           1 aa diff to CYP71D24v1

CYP71D49v3 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D207-AB4
           2 aa diffs to CYP71D24v1

CYP71D50v1 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D98-aa1
           58% to 71D19 60% to CYP71D23v1

CYP71D50v2 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D98-AG1
           Identical to CYP71D25v1 except at 7 aa seq that may be frameshifted

CYP71D51v1 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D209-AH10
           81% to 71D20 

CYP71D51v2 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D209-AA12
           2 aa diffs to CYP71D26v1 

CYP71D51v3 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D209-AA10
           3 aa diffs to CYP71D51v1 

CYP71D52   Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D90a-BB3
           96% to CYP71D26v3 

CYP71D53P  Populus trichocarpa (black cottonwood)

CYP71D54   Medicago truncatula (barrel medic)
           GenEMBL DQ335785
           63% to 71D10 Glycine max, 52% to 71D9 Glycine max

CYP71D55   Hyoscyamus muticus (Egyptian henbane, poisonous herb, leaves are a source of hyoscyamine)
           No accession number
           Joe Chappell
           Submitted to nomenclature committee 8/27/2006
           92% to 71D4 of Solanum tuberosum (potato)

CYP71D56P   Medicago truncatula (barrel medic, Fabales)
            GenPept ABE81455 pseudogene

CYP71D57P   Medicago truncatula (barrel medic, Fabales)
            GenPept ABE81449 pseudogene

CYP71D58P   Medicago truncatula (barrel medic, Fabales)
            GenPept ABE81448, GenEMBL CR954196.1q pseudogene

CYP71D58P-de2b  Medicago truncatula (barrel medic, Fabales)
            GenEMBL CR954196.1r pseudogene

CYP71D59    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC137079.9d, CR954196.1p  GenPept ABE81447

CYP71D60P   Medicago truncatula (barrel medic, Fabales)
            GenEMBL CR954196.1n, GenPept ABE81445 pseudogene

CYP71D61    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC137079.9b, CR954196.1m  GenPept ABE81444

CYP71D62    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC137079.9a, CR954196.1i GenPept ABE81443

CYP71D62-de2b  Medicago truncatula (barrel medic, Fabales)
            GenEMBL CR954196.1j pseudogene fragment after 71D62

CYP71D63    Medicago truncatula (barrel medic, Fabales)
            GenEMBL CR954196.1g

CYP71D63-de2b  Medicago truncatula (barrel medic, Fabales)
            GenEMBL CR954196.1h pseudogene fragment after 71D63

CYP71D64    Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ335785, CR954196.1e GenPept ABC59080

CYP71D64-de2b  Medicago truncatula (barrel medic, Fabales)
            GenEMBL CR954196.1f pseudogene

CYP71D65P   Medicago truncatula (barrel medic, Fabales)
            GenEMBL CR954196.1d pseudogene

CYP71D66    Medicago truncatula (barrel medic, Fabales)
            GenEMBL CR954196.1c

CYP71D67P   Medicago truncatula (barrel medic, Fabales)
            GenEMBL CR954196.1b pseudogene

CYP71D68P   Medicago truncatula (barrel medic, Fabales)
            GenEMBL CR954196.1a pseudogene

CYP71D69v1  Medicago truncatula (barrel medic, Fabales)
            GenPept ABE87835

CYP71D69v2  Medicago truncatula (barrel medic, Fabales)
            GenEMBL CG964663.1

CYP71D70    Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ335805 GenPept ABC59100, ABE87844

CYP71D71P   Medicago truncatula (barrel medic, Fabales)
            GenPept ABE87845 pseudogene

CYP71D72    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC145061.27d GenPept ABE87847

CYP71D73    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC145061.27e GenPept ABE87848

CYP71D74    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC145061.27f GenPept ABE87853

CYP71D75    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC145061.27g GenPept ABE87854

CYP71D76P   Medicago truncatula (barrel medic, Fabales)
            GenPept ABE87855 pseudogene

CYP71D77    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC145061.27i GenPept ABE87857

CYP71D78    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC145061.27j GenPept ABE87866

CYP71D79    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC145061.27k GenPept ABE87872

CYP71D80P   Medicago truncatula (barrel medic, Fabales)
            GenPept ABE87877 pseudogene

CYP71D81    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC140774.7, CR932040.2d GenPept ABE79660

CYP71D82    Medicago truncatula (barrel medic, Fabales)
            GenEMBL CR932040.2c

CYP71D83P   Medicago truncatula (barrel medic, Fabales)
            GenEMBL CR932040.2b pseudogene

CYP71D84P   Medicago truncatula (barrel medic, Fabales)
            GenEMBL CR932040.2a pseudogene

CYP71D85    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC126779.19c

CYP71D86    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC126779.19b

CYP71D87    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC126779.19a

CYP71D88P   Medicago truncatula (barrel medic, Fabales)
            GenEMBL CR955010.2a pseudogene

CYP71D89    Medicago truncatula (barrel medic, Fabales)
            GenEMBL CR955010.2c,  CR931743.1b

CYP71D90    Medicago truncatula (barrel medic, Fabales)
            GenEMBL CR955010.2d,  CR931743.1a

CYP71D91P   Medicago truncatula (barrel medic, Fabales)
            GenEMBL CG942476.1  pseudogene

CYP71D92    Medicago truncatula (barrel medic, Fabales)
            GenEMBL CG955915.1

CYP71D93    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC142507.13 correct translation, GenPept ABE90841

CYP71D93    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC142096.25 frameshift error in translation GenPept ABE91764

CYP71D94    Mentha x gracilis
            GenEMBL AY281026.1
            Bertea,C., Schalk,M., Mau,C.J., Karp,F., Wildung,M.R. and
            Molecular evaluation of a spearmint mutant altered in the
            expression of limonene hydroxylases that direct essential oil
            monoterpene biosynthesis
            Phytochemistry 64 (7), 1203-1211 (2003)
            86% to 71D18

CYP71D95    Mentha x gracilis
            GenEMBL AY281027.1
            Bertea,C., Schalk,M., Mau,C.J., Karp,F., Wildung,M.R. and
            Molecular evaluation of a spearmint mutant altered in the
            expression of limonene hydroxylases that direct essential oil
            monoterpene biosynthesis
            Phytochemistry 64 (7), 1203-1211 (2003)
            92% to 71D13

CYP71D95    Mentha spicata
            GenMBL AY622319.1
            Lucker,J., Schwab,W., Franssen,M.C.R., van der Plas,L.H.W.,
            Bouwmeester,H.J. and Verhoeven,H.A.
            Metabolic engineering of monoterpene biosynthesis: two-step
            production of (+)-trans-isopiperitenol by tobacco
            Plant J. 39 (1), 135-145 (2004)
            limonene-3-hydroxylase (lim3h)
            ortholog only 3 aa diffs to CYP71D95v1

CYP71D96    Glycine max (soybeans, Fabales)
            ESTs BM892131, BI892766, BM094727,
            BE805102, BF595208, BM892923, BF324498,
            CA953308, BE347664
            Li,L.Y. and Yu,D.Y.
            Comprehensive analysis of putative P450 genes superfamily in
            Glycine max and Medicago truncatula
            74% to 71D87, 71% to 71D86, Called CYP71D54
            cannot be certain about the ortholog
            JGI Glyma0 assembly scaffold _13 no introns

CYP71D97    Ammi majus (Bishops weed)
            No accession number
            Sandra Kellner
            Submitted to nomenclature committee Nov. 10 2006
            Clone name C54
            54% to 71D51v2 tobacco, 53% to 71D4
            59% to EC600682.1 Hevea brasiliensis (rubbertree plant) C-term EST
            70% to 71D98

CYP71D98    Ammi majus (Bishops weed)
            No accession number
            Sandra Kellner
            Submitted to nomenclature committee Nov. 10 2006
            Clone name CYP
            54% to 71D7, 53% to 71D51v2 tobacco
            70% to 71D97

CYP71D99    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C1
            83% to 71D100, 66% to 71D105, 58% to 71D101, 60% to 71D102, 
            58% to 71D11, 54% to 71D104, 64% to 71D81 Medicago

CYP71D100   Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C16
            83% to 71D99, 65% to 71D105, 58% to 71D9, 63% to 71D81 Medicago

CYP71D101   Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C2
            92% to 71D102, 75% TO 71D9, 61% TO C19, 60% TO 71D100, 58% TO 71D99,
            56% TO 71D104, 60% to 71D81 medicago

CYP71D102   Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C18
            92% to 71D101, 74% to 71D9, 63% to 71D81 Medicago

CYP71D103P  Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C3
            61% TO 71D105, C-HELIX TO I-HELIX, 49% TO 71D11
            54% TO 71D93 MEDICAGO middle region
            no ESTs
            JGI Glyma0 assembly scaffold_49 pseudogene, 64% to 71D105
            Frameshift = &

CYP71D104   Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C17
            56% to 71D105, 56% to 71D101, 55% to 71D10, 55% to 71D81 Medicago

CYP71D105   Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C19
            63% to 71D11, 65% to 71D100, 70% to 71D81 Medicago

CYP71D106   Glycine max (soybean, Fabales)

CYP71D107P  Glycine max (soybean, Fabales)

CYP71D108   Glycine max (soybean, Fabales)

CYP71D109   Glycine max (soybean, Fabales)

CYP71D110   Glycine max (soybean, Fabales)

CYP71D111   Glycine max (soybean, Fabales)

CYP71D112   Glycine max (soybean, Fabales)

CYP71D113   Glycine max (soybean, Fabales)

CYP71D114   Glycine max (soybean, Fabales)

CYP71D115P  Glycine max (soybean, Fabales)

CYP71D116   Glycine max (soybean, Fabales)

CYP71D117P  Glycine max (soybean, Fabales)

CYP71D118P  Glycine max (soybean, Fabales)

CYP71D119P  Glycine max (soybean, Fabales)

CYP71D120P  Glycine max (soybean, Fabales)

CYP71D121P  Glycine max (soybean, Fabales)

CYP71D122   Glycine max (soybean, Fabales)

CYP71D123P  Glycine max (soybean, Fabales)

CYP71D124   Glycine max (soybean, Fabales)

CYP71D125   Glycine max (soybean, Fabales)

CYP71D126P  Glycine max (soybean, Fabales)

CYP71D127   Glycine max (soybean, Fabales)

CYP71D128P  Glycine max (soybean, Fabales)

CYP71D129   Glycine max (soybean, Fabales)

CYP71D130P  Glycine max (soybean, Fabales)

CYP71D131P  Glycine max (soybean, Fabales)

CYP71D132P  Glycine max (soybean, Fabales)

CYP71D133  Glycine max (soybean, Fabales)

CYP71D134  Glycine max (soybean, Fabales)

CYP71D135  Glycine max (soybean, Fabales)

CYP71D136P Glycine max (soybean, Fabales)

CYP71D137  Glycine max (soybean, Fabales)

CYP71D138  Glycine max (soybean, Fabales)

CYP71D139P Glycine max (soybean, Fabales)

CYP71D140P Glycine max (soybean, Fabales)

CYP71D141  Glycine max (soybean, Fabales)

CYP71D142   Glycine max (soybean, Fabales)

CYP71D143   Glycine max (soybean, Fabales)

CYP71D144   Glycine max (soybean, Fabales)

CYP71D145   Glycine max (soybean, Fabales)

CYP71D146P  Glycine max (soybean, Fabales)

CYP71D147P  Glycine max (soybean, Fabales)

CYP71D148P Glycine max (soybean, Fabales)

CYP71D149P Glycine max (soybean, Fabales)

CYP71D150  Glycine max (soybean, Fabales)

CYP71D151P Glycine max (soybean, Fabales)

CYP71D152P Glycine max (soybean, Fabales)

CYP71D153P Glycine max (soybean, Fabales)

CYP71D154P Glycine max (soybean, Fabales)

CYP71D155  Glycine max (soybean, Fabales)

CYP71D156P Glycine max (soybean, Fabales)

CYP71D157P  Glycine max (soybean, Fabales)

CYP71D158   Glycine max (soybean, Fabales)

CYP71D159P Glycine max (soybean, Fabales)

CYP71D160  Glycine max (soybean, Fabales)

CYP71D161P Glycine max (soybean, Fabales)

CYP71D162P Glycine max (soybean, Fabales)

CYP71D163P Glycine max (soybean, Fabales)

CYP71D164P Glycine max (soybean, Fabales)

CYP71D165P Glycine max (soybean, Fabales)

CYP71D166P Glycine max (soybean, Fabales)

CYP71D167P Glycine max (soybean, Fabales)

CYP71D168P Glycine max (soybean, Fabales)

CYP71D169  Glycine max (soybean, Fabales)

CYP71D170  Glycine max (soybean, Fabales)

CYP71D171P Glycine max (soybean, Fabales)

CYP71D172P Glycine max (soybean, Fabales)

CYP71D173P Glycine max (soybean, Fabales)

CYP71D174  Perilla frutescens (Lamiaceae), a mint
           Accession number assigned, but not public yet
           Christopher Mau, Rodney Croteau
           Submitted to nomeclature committee Oct. 22, 2009
           70% to CYP71D95

CYP71D175  Scoparia dulcis (licorice weed, sweet broom, escobilla, Lamiales)
           No accession number
           Yoshimi Yamamura
           Submitted to nomenclature committee Nov. 11, 2009
           Clone name SdCYP4
           54% to CYP71D4 potato, 50% to CYP71BE7 Vitis

CYP71D176  Scoparia dulcis (licorice weed, sweet broom, escobilla, Lamiales)
           No accession number
           Yoshimi Yamamura
           Submitted to nomenclature committee Nov. 11, 2009
           Clone name SdCYP5
           54% to CYP71D4 potato

CYP71D177  Scoparia dulcis (licorice weed, sweet broom, escobilla, Lamiales)
           No accession number
           Yoshimi Yamamura
           Submitted to nomenclature committee Nov. 11, 2009
           Clone name SdCYP6
           55% to CYP71D4 potato, 
           56% to CYP71D18 Mentha x gracilis limonene-6-hydroxylase

CYP71D178  Origanum vulgare (oregano) cultivar f0204
           No accession number
           Christoph Crocoll
           Submitted to nomenclature committee March 18, 2010
           Clone name 
           75% to CYP71D18 Mentha spicata, 
           100% to CYP71D178 culivar d0601
           93% to

CYP71D178  Origanum vulgare (oregano) cultivar d0601
           No accession number
           Christoph Crocoll
           Submitted to nomenclature committee March 18, 2010
           Clone name
           75% to CYP71D18 Mentha spicata, 
           100% to CYP71D178 culivar f0204
           93% to

CYP71D179  Origanum vulgare (oregano) cultivar f0204
           No accession number
           Christoph Crocoll
           Submitted to nomenclature committee March 18, 2010
           Clone name
           73% to CYP71D18 Mentha spicata, 98% to

CYP71D179v1  Thymus vulgaris (thyme)
           No accession number
           Christoph Crocoll
           Submitted to nomenclature committee March 18, 2010
           Clone name
           75% to CYP71D18 Mentha spicata, 
           98% to CYP71D179
           presumed to be the ortholog of the oregano gene

CYP71D179v2  Thymus vulgaris (thyme)
           No accession number
           Christoph Crocoll
           Submitted to nomenclature committee June 15, 2010
           Clone name
           3 aa diffs to CYP71D179v1
           97% to CYP71D179 (ortholog)

CYP71D180v1  Thymus vulgaris (thyme)
           No accession number
           Christoph Crocoll
           Submitted to nomenclature committee March 18, 2010
           Clone name
           76% to CYP71D18 Mentha spicata, 82% to CYP71D178
           81% to CYP71D179

CYP71D180v2  Thymus vulgaris (thyme)
           No accession number
           Christoph Crocoll
           Submitted to nomenclature committee June 15, 2010
           Clone name
           1 aa diff to CYP71D180 Origanum vulgare
           4 aa diffs to CYP71D180v1

CYP71D180  Origanum vulgare (oregano)
           No accession number
           Christoph Crocoll
           Submitted to nomenclature committee June 15, 2010
           Clone name
           3 aa diffs to CYP71D180v1
           1 aa diff to CYP71D180v2 Thymus vulgaris

CYP71D181  Origanum vulgare (oregano)
           No accession number
           Christoph Crocoll
           Submitted to nomenclature committee June 15, 2010
           Clone name
           3 aa diffs to Thymus vulgaris
           92% to CYP71D180v1
           82% to CYP71D178, 81% to CYP71D179

CYP71D181  Thymus vulgaris (thyme)
           No accession number
           Christoph Crocoll
           Submitted to nomenclature committee June 15, 2010
           Clone name
           3 aa diffs to CYP71D181 Origanum vulgare
           91% to CYP71D180v1

CYP71D182  Thymus vulgaris (thyme)
           No accession number
           Christoph Crocoll
           Submitted to nomenclature committee June 15, 2010
           Clone name
           4 aa diffs 97% to CYP71D179v2 Thymus vulgaris (thyme)
           note: alleles in CYP179-CYP181 seem to have 1-4 aa diffs.  
           This looks like it is a different gene.

CYP71D183   Thapsia garganica L., Apiaceae (deadly carrot)
            No accession number
            Damian Paul Drew, Henrik Toft Simonsen
            Submitted to nomenclature committee 7/5/2010
            87% to CYP71D97 Ammi majus, 69% to CYP71D98 Ammi majus
            51% to CYP71D16 Nicotiana tabacum, 49% to CYP71BE1 Vitis vinifera, 
            51% to CYP71AV1 Artemisia  annua

CYP71D183   Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            97% to CYP71D183 Thapsia garganica, probable ortholog
            87% to CYP71D97 Ammi majus
            62% to CYP71D311 Thapsia garganica

CYP71D184   Solanum lycopersicum (tomato)
CYP71D184   Solanum tuberosum (potato)
CYP71D185   Solanum lycopersicum (tomato)
CYP71D185a  Solanum tuberosum (potato)
CYP71D185bP Solanum tuberosum (potato)
CYP71D186   Solanum lycopersicum (tomato)
CYP71D186-de1b2b   Solanum lycopersicum (tomato)
CYP71D186P  Solanum tuberosum (potato)
CYP71D187   Solanum lycopersicum (tomato)
CYP71D187   Solanum tuberosum (potato)
CYP71D188P  Solanum lycopersicum (tomato)
CYP71D189P  Solanum lycopersicum (tomato)
CYP71D189a  Solanum tuberosum (potato)
CYP71D189b  Solanum tuberosum (potato)
CYP71D190   Solanum lycopersicum (tomato)
CYP71D191P  Solanum lycopersicum (tomato)
CYP71D192P  Solanum lycopersicum (tomato)
CYP71D193P  Solanum lycopersicum (tomato)
CYP71D194P  Solanum lycopersicum (tomato)
CYP71D195P  Solanum lycopersicum (tomato)
CYP71D196P  Solanum lycopersicum (tomato)
CYP71D197P  Solanum lycopersicum (tomato)
CYP71D198P  Solanum lycopersicum (tomato)
CYP71D198   Solanum tuberosum (potato)
CYP71D199P  Solanum lycopersicum (tomato)
CYP71D200P  Solanum lycopersicum (tomato)
CYP71D200   Solanum tuberosum (potato)
CYP71D201P  Solanum lycopersicum (tomato)
CYP71D201   Solanum tuberosum (potato)
CYP71D202   Solanum lycopersicum (tomato)
CYP71D203P  Solanum lycopersicum (tomato)
CYP71D204   Solanum lycopersicum (tomato)
CYP71D204a  Solanum tuberosum (potato)
CYP71D204b  Solanum tuberosum (potato)
CYP71D205   Solanum lycopersicum (tomato)
CYP71D205   Solanum tuberosum (potato)
CYP71D206   Solanum lycopersicum (tomato)
CYP71D206   Solanum tuberosum (potato)
CYP71D207   Solanum lycopersicum (tomato)
CYP71D207-de1b2b   Solanum lycopersicum (tomato)
CYP71D207   Solanum tuberosum (potato)
CYP71D208   Solanum lycopersicum (tomato)
CYP71D208   Solanum tuberosum (potato)
CYP71D209   Solanum lycopersicum (tomato)
CYP71D209   Solanum tuberosum (potato)
CYP71D210P  Solanum lycopersicum (tomato)
CYP71D210   Solanum tuberosum (potato)
CYP71D211   Solanum lycopersicum (tomato)
CYP71D211   Solanum tuberosum (potato)
CYP71D212P  Solanum lycopersicum (tomato)
CYP71D212   Solanum tuberosum (potato)
CYP71D212-de1b   Solanum tuberosum (potato)
CYP71D213P  Solanum lycopersicum (tomato)
CYP71D213   Solanum tuberosum (potato)
CYP71D214P  Solanum lycopersicum (tomato)
CYP71D215P  Solanum lycopersicum (tomato)
CYP71D216   Solanum lycopersicum (tomato)
CYP71D216   Solanum tuberosum (potato)
CYP71D217   Solanum lycopersicum (tomato)
CYP71D217P  Solanum tuberosum (potato)
CYP71D218P  Solanum lycopersicum (tomato)
CYP71D218   Solanum tuberosum (potato)
CYP71D219   Solanum lycopersicum (tomato)
CYP71D219   Solanum tuberosum (potato)
CYP71D220   Solanum lycopersicum (tomato)
CYP71D220P  Solanum tuberosum (potato)
CYP71D221   Solanum lycopersicum (tomato)
CYP71D221   Solanum tuberosum (potato)
CYP71D222P  Solanum lycopersicum (tomato)
CYP71D223P  Solanum lycopersicum (tomato)
CYP71D224   Solanum tuberosum (potato)
CYP71D224-de1b   Solanum tuberosum (potato)
CYP71D225   Solanum tuberosum (potato)
CYP71D225   Solanum tuberosum (potato)
CYP71D227P  Solanum tuberosum (potato)
CYP71D228P  Solanum tuberosum (potato)
CYP71D229P  Solanum tuberosum (potato)
CYP71D230P  Solanum tuberosum (potato)
CYP71D231   Solanum tuberosum (potato)
CYP71D232   Solanum tuberosum (potato)
CYP71D233P  Solanum tuberosum (potato)
CYP71D234P  Solanum tuberosum (potato)
CYP71D235P  Solanum tuberosum (potato)
CYP71D236P  Solanum tuberosum (potato)
CYP71D237P  Solanum tuberosum (potato)
CYP71D238P  Solanum tuberosum (potato)
CYP71D239P  Solanum tuberosum (potato)
CYP71D240P  Solanum tuberosum (potato)
CYP71D241   Solanum tuberosum (potato)
CYP71D242   Solanum tuberosum (potato)
CYP71D243P  Solanum tuberosum (potato)
CYP71D244P  Solanum tuberosum (potato)
CYP71D245P  Solanum tuberosum (potato)
CYP71D246P  Solanum tuberosum (potato)
CYP71D247   Solanum tuberosum (potato)
CYP71D248P  Solanum tuberosum (potato)
CYP71D249   Solanum tuberosum (potato)
CYP71D250   Solanum tuberosum (potato)
CYP71D251P  Solanum tuberosum (potato)
CYP71D252P  Solanum tuberosum (potato)
CYP71D252-de2b  Solanum tuberosum (potato)
CYP71D253   Solanum tuberosum (potato)
CYP71D254P  Solanum tuberosum (potato)
CYP71D255P  Solanum tuberosum (potato)
CYP71D256P  Solanum tuberosum (potato)
CYP71D257P  Solanum tuberosum (potato)
CYP71D258   Solanum tuberosum (potato)
CYP71D259P  Solanum tuberosum (potato)
CYP71D260P  Solanum tuberosum (potato)
CYP71D261P  Solanum tuberosum (potato)
CYP71D262P  Solanum tuberosum (potato)
CYP71D263P  Solanum tuberosum (potato)
CYP71D264   Solanum tuberosum (potato)
CYP71D265P  Solanum tuberosum (potato)
CYP71D266   Solanum tuberosum (potato)
CYP71D266-de2b   Solanum tuberosum (potato)
CYP71D267P  Solanum tuberosum (potato)
CYP71D268P  Solanum tuberosum (potato)
CYP71D269P  Solanum tuberosum (potato)
CYP71D270P  Solanum tuberosum (potato)
CYP71D271P  Solanum tuberosum (potato)
CYP71D272P  Solanum tuberosum (potato)
CYP71D273P  Solanum tuberosum (potato)
CYP71D274   Solanum tuberosum (potato)
CYP71D275P  Solanum tuberosum (potato)
CYP71D276   Solanum tuberosum (potato)
CYP71D277P  Solanum tuberosum (potato)
CYP71D278P  Solanum tuberosum (potato)
CYP71D279P  Solanum tuberosum (potato)
CYP71D280P  Solanum tuberosum (potato)
CYP71D281P  Solanum tuberosum (potato)
CYP71D282P  Solanum tuberosum (potato)
CYP71D283P  Solanum tuberosum (potato)
CYP71D284   Solanum tuberosum (potato)
CYP71D285P  Solanum tuberosum (potato)
CYP71D286P  Solanum tuberosum (potato)
CYP71D287   Solanum tuberosum (potato)
CYP71D288P  Solanum tuberosum (potato)
CYP71D289P  Solanum tuberosum (potato)
CYP71D290P  Solanum tuberosum (potato)
CYP71D291P  Solanum tuberosum (potato)
CYP71D292P  Solanum tuberosum (potato)
CYP71D293P  Solanum tuberosum (potato)
CYP71D294P  Solanum tuberosum (potato)
CYP71D295P  Solanum tuberosum (potato)
CYP71D296P  Solanum tuberosum (potato)
CYP71D297P  Solanum tuberosum (potato)
CYP71D298P  Solanum tuberosum (potato)
CYP71D299P  Solanum tuberosum (potato)
CYP71D300P  Solanum tuberosum (potato)
CYP71D301P  Solanum tuberosum (potato)
CYP71D302P  Solanum tuberosum (potato)
CYP71D303P  Solanum tuberosum (potato)
CYP71D304P  Solanum tuberosum (potato)
CYP71D305P  Solanum tuberosum (potato)
CYP71D306P  Solanum tuberosum (potato)
CYP71D307P  Solanum tuberosum (potato)
CYP71D308P  Solanum tuberosum (potato)
CYP71D309P  Solanum tuberosum (potato)
CYP71D310P  Solanum tuberosum (potato)

CYP71D311   Thapsia garganica L., Apiaceae (deadly carrot)
            No accession number
            Corinna Weitzel
            Submitted to nomenclature committee March 17, 2011
            65% to CYP71D98 Ammi majus, 62% to CYP71D183 Thapsia garganica

CYP71D312  Panax ginseng (Apiales)
           No accession number
           Yong Eui Choi
           Submitted to nomenclature committee August 12, 2011
           58% to CYP71D97 Ammi majus, 63% to CYP71D313 Panax

CYP71D313  Panax ginseng (Apiales)
           No accession number
           Yong Eui Choi
           Submitted to nomenclature committee August 12, 2011
           58% to CYP71D97 Ammi majus, 63% to CYP71D312 Panax

CYP71D314  Panax ginseng (Apiales)
           No accession number
           Yong Eui Choi
           Submitted to nomenclature committee August 14, 2011
           84% to CYP71D313 Panax

CYP71D315v1  Panax ginseng (Apiales)
           No accession number
           Yong Eui Choi
           Submitted to nomenclature committee August 14, 2011
           83% to CYP71D313 Panax, 99% to CYP71D315v2  Panax

CYP71D315v2  Panax ginseng (Apiales)
           No accession number
           Yong Eui Choi
           Submitted to nomenclature committee August 14, 2011
           99% to CYP71D315v1  Panax

CYP71D316  Panax ginseng (Apiales)
           No accession number
           Yong Eui Choi
           Submitted to nomenclature committee August 14, 2011
           79% to CYP71D313 Panax

CYP71D317  Panax ginseng (Apiales)
           No accession number
           Yong Eui Choi
           Submitted to nomenclature committee August 14, 2011
           63% to CYP71D97 Ammi majus, 86% to CYP71D318v2 Panax

CYP71D318v1  Panax ginseng (Apiales)
           No accession number
           Yong Eui Choi
           Submitted to nomenclature committee August 14, 2011
           57% to CYP71D97 Ammi majus, 80% to CYP71D317 Panax
           97% to CYP71D318v2 (5 aa diffs)

CYP71D318v2  Panax ginseng (Apiales)
           No accession number
           Yong Eui Choi
           Submitted to nomenclature committee August 14, 2011
           61% to CYP71D97 Ammi majus, 86% to CYP71D317 Panax
           97% to CYP71D318v1 (5 aa diffs)

CYP71D319   Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            60% to CYP71D97 Ammi majus
            63% to CYP71D311 Thapsia garganica
            60% to CYP71D183 Thapsia garganica

CYP71D320P  Solanum tuberosum (potato)
            Name revised from CYP71D284P 
            (name conflict with another potato gene)

CYP71D321   Ricinus communis (castor bean, Malpighiales, Euphorbia)
CYP71D322   Ricinus communis (castor bean, Malpighiales, Euphorbia)
CYP71D323P  Ricinus communis (castor bean, Malpighiales, Euphorbia)
CYP71D324   Ricinus communis (castor bean, Malpighiales, Euphorbia)
CYP71D325   Ricinus communis (castor bean, Malpighiales, Euphorbia)
CYP71D326   Ricinus communis (castor bean, Malpighiales, Euphorbia)
CYP71D327P  Ricinus communis (castor bean, Malpighiales, Euphorbia)
CYP71D328   Ricinus communis (castor bean, Malpighiales, Euphorbia)
CYP71D329   Ricinus communis (castor bean, Malpighiales, Euphorbia)
CYP71D330   Ricinus communis (castor bean, Malpighiales, Euphorbia)
CYP71D331   Ricinus communis (castor bean, Malpighiales, Euphorbia)
CYP71D332   Ricinus communis (castor bean, Malpighiales, Euphorbia)
CYP71D333   Ricinus communis (castor bean, Malpighiales, Euphorbia)
CYP71D334   Ricinus communis (castor bean, Malpighiales, Euphorbia)
CYP71D335   Ricinus communis (castor bean, Malpighiales, Euphorbia)
CYP71D336   Ricinus communis (castor bean, Malpighiales, Euphorbia)
CYP71D337   Ricinus communis (castor bean, Malpighiales, Euphorbia)
CYP71D338   Ricinus communis (castor bean, Malpighiales, Euphorbia)
CYP71D339   Ricinus communis (castor bean, Malpighiales, Euphorbia)
CYP71D340   Ricinus communis (castor bean, Malpighiales, Euphorbia)
CYP71D341   Ricinus communis (castor bean, Malpighiales, Euphorbia)
CYP71D342   Ricinus communis (castor bean, Malpighiales, Euphorbia)
CYP71D343   Ricinus communis (castor bean, Malpighiales, Euphorbia)

CYP71D344   Mimulus guttatus (Lamiales, monkeyflower)
            on scaffold 69 432062-434507 (+) strand
            56% to CYP71D190 tomato

CYP71D345   Mimulus guttatus (Lamiales, monkeyflower)
            on scaffold 69 555973-558321 (+) strand
            55% to CYP71D190 tomato

CYP71D346   Catharanthus roseus
CYP71D347   Catharanthus roseus
CYP71D348   Catharanthus roseus
CYP71D349   Catharanthus roseus
CYP71D350   Catharanthus roseus

CYP71D351   Catharanthus roseus
            No accession number
            Vincent Courdavault
            Submitted to nomenclature committee August 20, 2012
            85% to CYP71D12v2 Catharanthus roseus

CYP71D352   Mimulus guttatus (Lamiales, monkeyflower)
CYP71D353   Lotus japonica
CYP71D354   Mimulus guttatus (Lamiales, monkeyflower)
CYP71D355P  Mimulus guttatus (Lamiales, monkeyflower)
CYP71D356   Medicago truncatula

CYP71D357   Euphorbia peplus
CYP71D358   Euphorbia peplus
CYP71D359   Euphorbia peplus
CYP71D360   Euphorbia peplus
CYP71D361   Euphorbia peplus
CYP71D362   Euphorbia peplus
CYP71D363   Euphorbia peplus
CYP71D364   Euphorbia peplus
CYP71D365   Euphorbia peplus
CYP71D366   Euphorbia peplus
CYP71D367   Euphorbia peplus
CYP71D368   Euphorbia peplus
CYP71D369   Euphorbia peplus
CYP71D370   Euphorbia peplus
CYP71D371   Euphorbia peplus
CYP71D372   Euphorbia peplus

CYP71D373   Salvia miltiorrhiza (Lamiaceae)
            No accession number
            Juan Guo
            Submitted to nomenclature committee Jan. 3, 2013
            Clone pESCp2
            70% to CYP71D375 Salvia miltiorrhiza

CYP71D374   Salvia miltiorrhiza (Lamiaceae)
            No accession number
            Juan Guo
            Submitted to nomenclature committee Jan. 3, 2013
            Clone p10
            71% to CYP71D344 Mimulus guttatus

CYP71D375   Salvia miltiorrhiza (Lamiaceae)
            No accession number
            Juan Guo
            Submitted to nomenclature committee Jan. 3, 2013
            Clone p11
            56% to CYP71D176 Scoparia dulcis

CYP71D376   Salvia miltiorrhiza (Lamiaceae)
            No accession number
            Juan Guo
            Submitted to nomenclature committee Jan. 3, 2013
            Clone p20
            64% to CYP71D354 Mimulus guttatus

CYP71D frag.  Artemisia vulgaris (Asterales)
            Barthelson,R.A., Galbraith,D.W. and Woosley,R.
            Development of a Comprehensive Assay for Medicinal Plant Species
            68% to 71D4

CYP71D      Casuarina glauca (swamp oak, Fagales)
            71% to 71D4, 46% to 71A25 N-term

71D Subfamily

CYP71E1     Sorghum bicolor
            GenEMBL AF029858
            Soren Bak, Rachel Alice Kahn, Hanne Linde Nielsen, Birger
            Lindberg Moller, Barbara Ann Halkier
            Cloning of three A-type cytochromes P450, CYP71E1,
            CYP98, and CYP99 from Sorghum bicolor (L.) Moench by
            a PCR approach and identification by expression in
            Escherichia coli of CYP71E1 as a multifunctional
            cytochrome P450 in the biosynthesis of the cyanogenic
            glucoside dhurrin.
            Plant Molecular Biology 36 (3):393-405, 1998.

CYP71E2     Triticum aestivum (wheat)
            No accession number
            Daniele Werck-Reichhart
            Submitted to nomenclature committee 3/29/2000
            clone name 71g
            58% identical to 71E1 37% to 71F1, 41% to 71G1 and G2

CYP71E3X    Triticum aestivum (wheat) name changed to CYP71M3
            No accession number
            Daniele Werck-Reichhart
            Submitted to nomenclature committee 6/4/2001
            clone name 71-2
            52% identical to 71E1 51% to 71E2, 43% to 71A11
            46% to 71B10, 37% to 71C8, 40% to 71D2, 37% to 71F1
            42% to 71G1v1, 40% to 71J, 38% to 71K

CYP71E4     Oryza sativa (rice)
CYP71E5     Oryza sativa (rice)
CYP71E6     Oryza sativa (rice)

CYP71E7     Manihot esculenta 
            Zhang,P., Bohl-Zenger,S., Puonti-Kaerlas,J., Potrykus,I. and
            Two cassava promoters related to vascular expression and storage
            root formation
            Planta 218 (2), 192-203 (2003)
            Jorgenson K, Morant AV, Morant M, Jensen NB, Olsen CE, Kannangara R, 
            Motawia MS, Moller BL, Bak S (2011) Biosynthesis of the cyanogenic 
            glucosides linamarin and lotaustralin in cassava: Isolation, 
            biochemical characterization and expression pattern of CYP71E7, 
            the oxime-metabolizing cytochrome P450 enzyme. 
            Plant Phylsiology 155, 282-292. 
            52% to 71E1, see CYP71E11 below for paralog

CYP71E8     Zea mays
            Halkier,B.A., Bak,S., Kahn,R.A. and Moller,B.L.
            Cytochrome P450 Monooxygenases
            59% to 71E4

CYP71E9     Brachypodium distachyon (temperate grass)

CYP71E10    Brachypodium distachyon (temperate grass)

CYP71E11    Manihot esculenta (cassava)
            No accession
            Rubini Kannangara
            Submitted to nomenclature committee Feb. 2, 2011
            90% to CYP71E7, see publication on CYP71E7

CYP71E12    Triticum aestivum
            GenPept ACN41355.1 
            Beat Keller
            Submitted to nomenclature committee Nov. 9, 2012
            82% to rice CYP71E5 rice (possible ortholog)

CYP71F1     Triticum aestivum  
            Imaishi,H., Nomura,T. and Ohkawa,H.
            P450 in Wheat
            Published Only in Database (2001)
            40-42% identical to 71D sequences 43% identical to 71A1
            clone name N-1
            submitted to nomenclature committee 1/8/2000

CYP71F2P    Brachypodium distachyon
CYP71F3     Brachypodium distachyon
CYP71F4     Brachypodium distachyon
CYP71F5     Brachypodium distachyon
CYP71F6     Brachypodium distachyon
CYP71F7P    Brachypodium distachyon
CYP71F8     Brachypodium distachyon
CYP71F9     Brachypodium distachyon
CYP71F10    Brachypodium distachyon

CYP71F11    Setaria italica 
            Scaffold 7 2283422-2285853 (-) strand
            82% to CYP71F12 BT063622.1 Zea mays
            78% to CYP71F3 XM_003572113.1 Brachypodium distachyon

CYP71F12    Zea mays
            82% to CYP71F11 Setaria italica
            74% to CYP71F3 XM_003572113.1 Brachypodium distachyon

CYP71G1v1   Asparagus
            GenEMBL AB037244
            Hiromasa Imaishi
            submitted to nomenclature committee 3/2/2000
            clone name ASPI-1
            49% to CYP71A1, 40% to 71A14, 45% to 71E1, 43% to 71B9, 
            37% to 71D13, 37% to 71C1, 39% to 71F1

CYP71G1v2   Asparagus
            GenEMBL AB037245
            Hiromasa Imaishi
            submitted to nomenclature committee 3/2/2000
            clone name ASPI-2
            99% to CYP71G1v1 (4 amino acids differences)

CYP71H1X    Triticum aestivum (wheat)
            No accession number
            Daniele Werck-Reichhart 
            55% to 71C4 but only 50% to 71C8, 58% to 71C7
            clone name 71F8I2
            submitted to nomenclature committee July 18, 2000
            This sequence has been reassigned to the 71C subfamily
            It is on the outskirts of the subfamily, but new sequences 
            force it to belong there rather than in a new subfamily.

CYP71J1     Asparagus officinalis 
            GenEMBL AB052131
            Imaishi,H., Iwai,C., Iwamura,H. and Ohkawa,H.
            P450 in Asparagus
            Asp-3 mRNA for cytochrome P450, complete cds.
            submitted to nomenclature committee 12/5/2000
            clone name ASPI-3
            47% to CYP71A1, less to other 71 subfamilies

CYP71J2     Muscari armeniacum  (Liliopsida, Armenian grape hyacinth)
            AB127340 (mRNA)
            Mori,S., Kobayashi,H., Hoshi,Y., Kondo,M. and Nakano,M.
            Isolation and characterization of a cytochrome P450 gene from
            Muscari armeniacum (ornamental liliaceous plant)
            submitted to nomenclature committee 2/24/2004
            67% to 71J1 47% to 71AD1

CYP71J2     Muscari armeniacum  (Liliopsida, Armenian grape hyacinth)
            AB127341 (gene)
            Mori,S., Kobayashi,H., Hoshi,Y., Kondo,M. and Nakano,M.
            Isolation and characterization of a cytochrome P450 gene from
            Muscari armeniacum (ornamental liliaceous plant)
            67% to 71J1 47% to 71AD1

CYP71K1    Oryza sativa (rice)
            GenEMBL AP002968 
            46% to 71F1 40% to 71A11, 41% to 71G1v2
            40% to 71C7, 40% to 71B24 42% to 71D4 38% to 71E1

CYP71K2P    Oryza sativa (rice)
CYP71K3     Oryza sativa (rice)
CYP71K4     Oryza sativa (rice)
CYP71K5     Oryza sativa (rice)
CYP71K6     Oryza sativa (rice)
CYP71K7P    Oryza sativa (rice)
CYP71K8     Oryza sativa (rice)
CYP71K9     Oryza sativa (rice)
CYP71K10    Oryza sativa (rice)
CYP71K11    Oryza sativa (rice)
CYP71K12    Oryza sativa (rice)
CYP71K13P   Oryza sativa (rice)

CYP71K14    Zea mays
            70% to CYP71K5 

CYP71K15    Zea mays
            75% to 71K3, 67% to CYP71K14 

CYP71K16P   Brachypodium distachyon
CYP71K17    Brachypodium distachyon
CYP71K18    Brachypodium distachyon
CYP71K19    Brachypodium distachyon
CYP71K20    Brachypodium distachyon
CYP71K21    Brachypodium distachyon
CYP71K22    Brachypodium distachyon
CYP71K23    Brachypodium distachyon

CYP71L1     Hordeum vulgare (barley)
            No accession number
            Kirsten A Nielsen
            Most like CYP71E about 50%
            submitted to nomenclature committee 5/16/2002
            526 amino acids

CYP71M1     Hordeum vulgare (barley)
            No accession number
            Kirsten A Nielsen
            Most like CYP71E about 50%
            submitted to nomenclature committee 5/16/2002
            514 amino acids
            only 42% to 71L1

CYP71M2     Sorghum bicolor 
            No accession number
            Kirsten A Nielsen
            70% to CYP71M1
            submitted to nomenclature committee 8/2/2002
            525 amino acids

CYP71M3     Triticum aestivum (wheat) formerly CYP71E3
            No accession number
            Daniele Werck-Reichhart
            Submitted to nomenclature committee 6/4/2001
            clone name 71-2
            52% identical to 71E1 51% to 71E2, 43% to 71A11
            46% to 71B10, 37% to 71C8, 40% to 71D2, 37% to 71F1
            42% to 71G1v1, 40% to 71J, 38% to 71K, 43% to 71L1, 92% to 71M1

CYP71N1v1   Musa acuminata (banana)
            GenEMBL AY062168
            Lee,Y.C. and Pua,E.C.
            Cloning and Characterization of Cytochrome P450 in Banana (Musa
            50% to 71G1 less to other CYP71 subfamilies

CYP71N1v1   Musa acuminata 
            Kesari,R., Trivedi,P.K. and Nath,P.

CYP71N1v2   Musa acuminata 
            Lee,Y.C. and Pua,E.C.
            Cloning and Characterization of Cytochrome P450 in Banana (Musa
            Seq starting with HLL has only 2 aa diffs to 71N1.
            First portion of seq is probably an artifact

CYP71N2     Musa acuminata 
            Lee,Y.C. and Pua,E.C.
            Cloning and Characterization of Cytochrome P450 in Banana (Musa
            89% to 71N1

more names exist here for the rice P450s that have not been added yet to the nomenclature pages

CYP71P1     Oryza sativa (rice)
CYP71P1     Brachypodium distachyon
CYP71P2P    Oryza sativa (rice)
CYP71Q1     Oryza sativa (rice)
CYP71Q2     Oryza sativa (rice)
CYP71Q3P    Oryza sativa (rice)
CYP71Q4P    Oryza sativa (rice)
CYP71Q5     Brachypodium distachyon
CYP71R1     Oryza sativa (rice)
CYP71R2P    Oryza sativa (rice)
CYP71R3     Oryza sativa (rice)

CYP71R4     Lolium rigidum (ryegrass)
            No accession
            Hiromasa Imaishi
            Clone W1B11-HT
            63% to rice AP003575 CYP71R2P

CYP71R5     Brachypodium distachyon

CYP71R6     Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Feb. 25, 2011
            Clone name Ep20
            72% to CYP71R1 rice, 64% to CYP71R5

CYP71S1     Oryza sativa (rice)
CYP71S2     Oryza sativa (rice)

CYP71S3     Zea mays
            66% to 71S1 

CYP71S4     Brachypodium distachyon
CYP71T1     Oryza sativa (rice)
CYP71T2     Oryza sativa (rice)
CYP71T3     Oryza sativa (rice)
CYP71T4     Oryza sativa (rice)
CYP71T5     Oryza sativa (rice)
CYP71T6X    Oryza sativa (rice) = N-term of 71T5
CYP71T7     Oryza sativa (rice)
CYP71T10P   Oryza sativa (rice)

CYP71T11    Leymus cinereus x Leymus triticoides 
            cDNA clone BG01041B1C12.f1, mRNA sequence
            80% to 71T2


CYP71T12P   Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Nov. 12, 2008
            Clone name Eop450-9 pseudogene, C-term
            62% to CYP71T5 rice

CYP71T13P   Brachypodium distachyon
CYP71T14P   Brachypodium distachyon
CYP71T15    Brachypodium distachyon
CYP71T16    Brachypodium distachyon
CYP71T17P   Brachypodium distachyon
CYP71T18P   Brachypodium distachyon

CYP71T19    Sorghum bicolor
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71T20    Phyllostachys praecox (bamboo)
            GenPept ACM69385
            66% to CYP71T2 rice

CYP71T21    Setaria italica
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71T22    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Feb. 25, 2011
            Clone name Ep13
            65% to CYP71T12P Echinochloa phyllopogon
            73% to CYP71T15 Brachypodium distachyon, 72% to CYP71T2 rice

CYP71U1P    Oryza sativa (rice)
CYP71U2     Oryza sativa (rice)
CYP71U3     Oryza sativa (rice)

CYP71U4v1   Hordeum vulgare (barley)
            GenEMBL AJ495774
            Eckey C, Korell M, Leib K, Biedenkopf D, Jansen C, Langen G, Kogel KH.
            Identification of powdery mildew-induced barley genes by cDNA-AFLP: 
            functional assessment of an early expressed MAP kinase.
            Plant Mol Biol. 55, 1-15 (2004)
            Clone name CE13a-5
            60% identical to CYP71U2 from rice

CYP71U4v2   Hordeum vulgare (barley)
            No accession number
            Burkhard Schmidt
            Submitted to nomenclature committee March 1, 2005
            99% identical to CYP71U2v1

CYP71V1P    Oryza sativa (rice)
CYP71V2     Oryza sativa (rice)
CYP71V3     Oryza sativa (rice)
CYP71V4     Oryza sativa (rice)
CYP71V5     Oryza sativa (rice)
CYP71V6P    Oryza sativa (rice)

CYP71V7    Sorghum bicolor
           No accession number
           Zhiqiang Pan
           Submitted to nomenclature committee 10/22/2004
           64% to 71V1 rice
           clone name 69C05

CYP71V8    Lolium rigidum (ryegrass)
           Fischer,T.C., Klattig,J.T. and Gierl,A.
           A general cloning strategy for divergent plant cytochrome P450
           genes and its application in Lolium rigidum and Ocimum basilicum
           Theor. Appl. Genet. 103, 1014-1021 (2001)
           clone Lol-3-k putative cytochrome P450 mRNA
           65% to 71V3, 42% to 71B37 (Arab.) 59% to 7V9v1

CYP71V9v1  Lolium rigidum (ryegrass)
           Fischer,T.C., Klattig,J.T. and Gierl,A.
           A general cloning strategy for divergent plant cytochrome P450
           genes and its application in Lolium rigidum and Ocimum basilicum
           Theor. Appl. Genet. 103, 1014-1021 (2001)
           clone Lol-20-f putative cytochrome P450 mRNA
           79% to 71V2, 42% to 71B37 (Arab.), 59% to 71V8, 98% to 71V9v2

CYP71V9v2  Lolium rigidum (ryegrass)
           Fischer,T.C., Klattig,J.T. and Gierl,A.
           A general cloning strategy for divergent plant cytochrome P450
           genes and its application in Lolium rigidum and Ocimum basilicum
           Theor. Appl. Genet. 103, 1014-1021 (2001)
           clone Lol-20-d putative cytochrome P450 mRNA
           79% to 71V2, 42% to 71B37 (Arab.), 59% to 71V8, 98% to 71V9v1

CYP71V10    Brachypodium distachyon
CYP71V11    Brachypodium distachyon

CYP71V12    Setaria italica
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71V13    Setaria italica
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71V14    Setaria italica
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen

CYP71W1     Oryza sativa (rice)
CYP71W2P    Oryza sativa (rice)
CYP71W3     Oryza sativa (rice)
CYP71W4     Oryza sativa (rice)
CYP71W5P    Oryza sativa (rice)
CYP71W6P    Oryza sativa (rice)

CYP71W7     Zea mays
            70% to CYP71W1

CYP71W8     Brachypodium distachyon

CYP71W9     Sorghum bicolor
            67% to CYP71W1 rice
            57% to CYP71W8 Brachypodium distachyon

CYP71X1P    Oryza sativa (rice)
CYP71X2     Oryza sativa (rice)
CYP71X3     Oryza sativa (rice)
CYP71X4     Oryza sativa (rice)
CYP71X5     Oryza sativa (rice)
CYP71X6P    Oryza sativa (rice)
CYP71X7     Oryza sativa (rice)
CYP71X8     Oryza sativa (rice)
CYP71X9P    Oryza sativa (rice)
CYP71X10    Oryza sativa (rice)
CYP71X11    Oryza sativa (rice)
CYP71X12    Oryza sativa (rice)
CYP71X13P   Oryza sativa (rice)
CYP71X14    Oryza sativa (rice)
CYP71X15    Oryza sativa (rice)
CYP71X16    Oryza sativa (rice) now complete
            aaaa01008333.1b CYP71X16 (indica cultivar-group) 
            runs off end of clone (exon 2 only)
            EST CK084887.1 indica 100% match 
            AAAA02005341.1 = 100% 
            Missing exon 1 is CYP71X17P join

            CYP71X17P (indica cultivar-group) missing exon 2
            CYP71X16 and CYP71X17P are from the same gene. Join
42419  VKVVIR (0) 42436

CYP71X17PX  Oryza sativa (rice) part of 71X16 now complete
CYP71X18    Brachypodium distachyon
CYP71Y1P    Oryza sativa (rice)
CYP71Y2P    Oryza sativa (rice)
CYP71Y3     Oryza sativa (rice)
CYP71Y4     Oryza sativa (rice)
CYP71Y5     Oryza sativa (rice)
CYP71Y6     Oryza sativa (rice)
CYP71Y7     Oryza sativa (rice)
CYP71Y8     Oryza sativa (rice)
CYP71Y9P    Oryza sativa (rice)

CYP71Y10    Zea mays
            77% to CYP71Y3 

CYP71Y11    Brachypodium distachyon
CYP71Y12    Brachypodium distachyon

CYP71Y13    Sorghum bicolor
            Submitted to nomenclature committee May 9, 2011
            Leslie Dutarte and Rene Feyereisen
            76% to CYP71Y3 rice

CYP71Z1     Oryza sativa (rice)
CYP71Z2     Oryza sativa (rice)
CYP71Z3     Oryza sativa (rice)
CYP71Z4     Oryza sativa (rice)
CYP71Z5     Oryza sativa (rice)
CYP71Z6     Oryza sativa (rice)
CYP71Z7     Oryza sativa (rice)
CYP71Z8     Oryza sativa (rice)
CYP71Z9/Z10 Oryza sativa (rice)
            aaaa01088222.1 CYP71Z9/Z10 two seqs. Joined, see Zea mays ortholog
            probably real cannot complete 

CYP71Z9 ortholog Zea mays
        CG111638.1 Zea GSS 68% to CYP71Z9/10
        EST = EE185471.1 EE185472.1 71% to first part, 68% to second part

CYP71Z9     Sorghum bicolor
            71% to CYP71Z9 Zea mays

CYP71Z10X   Oryza sativa (rice) merged with CYP71Z9
CYP71Z11    Brachypodium distachyon

CYP71Z12    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Feb. 25, 2011
            Clone name Ep9
            61% to CYP71Z11 Brachypodium distachyon, 63% to CYP71Z4 rice
            72% to unnamed Sorghum bicolor seq XM_002459446

CYP71Z13    Sorghum bicolor
            66% to CYP71Z9 Zea mays
            59% to CYP71Z9 Sorghum bicolor
            72% to CYP71Z12 Echinochloa phyllopogon (late watergrass)

CYP71AA1    Oryza sativa (rice)P
CYP71AA2    Oryza sativa (rice)
CYP71AA3    Oryza sativa (rice)
CYP71AA4P   Oryza sativa (rice)
CYP71AA5    Oryza sativa (rice)
CYP71AA6    Brachypodium distachyon
CYP71AA7    Brachypodium distachyon
CYP71AA8    Brachypodium distachyon
CYP71AA9    Brachypodium distachyon
CYP71AA10   Brachypodium distachyon
CYP71AB1    Oryza sativa (rice)
CYP71AB2    Oryza sativa (rice)
CYP71AB3    Oryza sativa (rice)
CYP71AB4    Brachypodium distachyon
CYP71AB5P   Brachypodium distachyon

CYP71AB6    Setaria italica 
            Scaffold 7 32585631-32587257 (-) strand
            61% to CYP71AB2 rice

CYP71AC1    Oryza sativa (rice)
CYP71AC2    Oryza sativa (rice)
CYP71AC3P   Oryza sativa (rice)
CYP71AC5P   Oryza sativa (rice)
CYP71AC6P   Oryza sativa (rice)
CYP71AC7P   Oryza sativa (rice)
CYP71AD1    Oryza sativa (rice)
CYP71AD1    Brachypodium distachyon
CYP71AE1X   Oryza sativa (rice) note: CYP71C33 
CYP71AE2X   Oryza sativa (rice) note: CYP71C32
CYP71AF1    Oryza sativa (rice)

CYP71AF1    Sorghum bicolor
            Identical to Sb10g025160|Sorbi1
            Zhiqiang Pan
            Submitted to nomenclature committee Jan. 8, 2013
            Ortholog to rice CYP71AF1 (79% identical

CYP71AF2P   Brachypodium distachyon
CYP71AF3P   Brachypodium distachyon
CYP71AF4    Brachypodium distachyon
CYP71AF5    Brachypodium distachyon
CYP71AF6    Brachypodium distachyon
CYP71AG1    Oryza sativa (rice)
CYP71AG1    Triticum aestivum 
            ortholog of 71AG1 

CYP71AG2P   Oryza sativa (rice)
            69% to 71AG1 59% to Triticum ortholog of 71AG1

CYP71AH1    tobacco
            GSS exons FH940860.1, FI039586.1, FH154883.1, ET761547.1
            Takashi Yamada
            tobacco sequence 2
            submitted to nomenclature committee 9/9/97
            Formerly 71A11, renamed CYP71AH1 only 46% to 71B38

CYP71AH2   Nicotiana tabacum var. 4407 (tobacco)
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D221-BB8
           91% to CYP71AH1

CYP71AH3    Glycine max (soybean, Fabales)
            GenEMBL Y10489 (1603bp)
            Schopfer,C.R. and Ebel,J.
            Identification of elicitor-induced cytochrome P450s of soybean
            (Glycine max L.) using differential display of mRNA
            Mol. Gen. Genet. 258, 315-322 (1998)
            clone CP1
            formerly CYP71A9

CYP71AH4    Vitis vinifera (grapevine)
            53% to CYP71AS6v1, 64% to CYP71AH3 (old 71A9), 
            62% to 71AH2 Nicotiana tabacum DQ350356.1
            note 71A9 is 58% to 71AH2 so it is probably misnamed 
            The name has been changed to CYP71AH3

CYP71AH5P   Vitis vinifera (grapevine)
            CAAP02005003.1b, pseudogene 70% to CYP71AH4
            See Vitis pages for seq.

CYP71AH6    Gossypium raimondii 
            CO072855.1 CO095493.1, CO072856.1
            58% to CYP71AH4, 53% to 71AH3

CYP71AH7P   Glycine max (soybean, Fabales)

CYP71AH8   Thapsia garganica (Apiaceae)
           No accession number
           Corinna Weitzel
           Submitted to nomenclature committee Oct. 14, 2010
           Clone name CYP3339
           59% to CYP76AH4 Vitis vinifera, 56% to CYP71AH1 tobacco

CYP71AH9   Solanum lycopersicum (tomato)

CYP71AH10   Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            78% TO CYP71AH8 Thapsia garganica
            57% to CYP71AH1 tobacco

CYP71AH11   Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            54% to CYP71AH1 tobacco
            63% to CYP71AH8 Thapsia garganica

CYP71AJ1    Ammi majus L. , Apiaceae (Bishops weed)
            GenEMBL AY532370.2
            Silvia Heubner
            Submitted to nomenclature committee 9/25/2003
            51% to 71A5 different from other 71 subfamilies
            clone name sequence 2

CYP71AJ2    Apium graveolens (celery, Apiales)
            No accession number
            Alain Hehn
            Submitted to nomenclature committee 12/5/2006
            89% to CYP71AJ1

CYP71AJ3    Pastinaca sativa (parsnip, Apiales)
            No accession number
            Alain Hehn
            Submitted to nomenclature committee 12/5/2006
            82% to CYP71AJ1

CYP71AJ4    Pastinaca sativa (parsnip, Apiales)
            No accession number
            Alain Hehn
            Submitted to nomenclature committee 12/5/2006
            70% to CYP71AJ1 69% to AJ3

CYP71AJ5    Thapsia garganica L., Apiaceae (deadly carrot)
            No accession number
            Damian Paul Drew, Henrik Toft Simonsen
            Submitted to nomenclature committee 7/5/2010
            61% to CYP71AJ1 Ammi majus, 61% to CYP71AJ3 Pastinaca sativa, 
            60% to CYP71AJ2 Apium graveolens
            57% to CYP71AJ4 Pastinaca sativa, 96% to CYP71AJ6 

CYP71AJ6    Thapsia villosa L., Apiaceae (zumillo)
            No accession number
            Bjorn Dueholm, Damian Paul Drew
            Submitted to nomenclature committee 7/5/2010
            61% to CYP71AJ1, 62% to CYP71AJ3 Pastinaca sativa, 
            61% to CYP71AJ2 Apium graveolens
            58% to CYP71AJ4 Pastinaca sativa, 
            96% to CYP71AJ5

CYP71AJ7    Daucus carota ssp. sativus, Apiaceae (carrot)
            No accession number
            Bjorn Dueholm, Alain Hehn
            Submitted to nomenclature committee 7/5/2010
            91% to CYP71AJ6, 92% to CYP71AJ5, 59% to CYP71AJ1, 61% to CYP71AJ3

CYP71AJ8    Ammi majus L., Apiaceae (Bishops weed)
            No accession number
            Bjorn Dueholm, Alain Hehn
            Submitted to nomenclature committee 7/5/2010
            88% to CYP71AJ5, 87% to CYP71AJ6, 60% to CYP71AJ1

CYP71AJ9    Petroselinum crispum L., Apiaceae (celery)
            No accession number
            Bjorn Dueholm
            Submitted to nomenclature committee 7/5/2010
            87% to CYP71AJ5, 87% to CYP71AJ6, 59% to CYP71AJ1

CYP71AJ10   Pastinaca sativa L., Apiaceae (parsnip)
            No accession number
            Bjorn Dueholm
            Submitted to nomenclature committee 7/5/2010
            88% to CYP71AJ5 partial sequence

CYP71AJ11   Heracleum mantegazzianum L., Apiaceae (giant hogweed)
            No accession number
            Bjorn Dueholm
            Submitted to nomenclature committee 7/5/2010, revised Jan 13, 2011
            89% to CYP71AJ6 (now complete)

CYP71AJ12   Thapsia villosa L., Apiaceae (zumillo)
            No accession number
            Bjorn Dueholm
            Submitted to nomenclature committee 7/5/2010
            88% to CYP71AJ5 partial sequence

CYP71AJ13   Pastinaca sativa L., Apiaceae (parsnip)
            No accession number
            Bjorn Dueholm
            Submitted to nomenclature committee 7/5/2010
            80% to CYP71AJ5 partial sequence

CYP71AJ14   Thapsia garganica L., Apiaceae (deadly carrot)
            No accession number
            Bjorn Dueholm
            Submitted to nomenclature committee 1/13/2011
            77% to CYP71AJ11 
            partial sequence (aa 149-296)

CYP71AJ15   Laserpitium siler L., Apiaceae (laserwort)
            No accession number
            Bjorn Dueholm
            Submitted to nomenclature committee 1/13/2011
            90% to CYP71AJ11 

CYP71AK1    Oryza sativa (rice)
CYP71AK2    Oryza sativa (rice)

CYP71AK2    Brachypodium distachyon

CYP71AK2    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Feb. 25, 2011
            Clone name Ep16
            71% to CYP71AK2 Brachypodium distachyon
            69% to CYP71AK2 rice (probable ortholog), 56% to CYP71AK1 rice

CYP71AL1    Centaurium erythraea (Common Centaury) a plant in Gentianales
            GenEMBL AY596975
            Schwarz,H. and Beerhues,L.
            Molecular cloning of cytochrome P450 enzymes from Centaurium erythraea
            clone 1 cytochrome P450 mRNA, complete cds.
            44% to CYP71Y5, 46% to CYP71Y1, less to other CYP71 subfamilies

CYP71AM1   Sorghum bicolor
           No accession number
           Zhiqiang Pan
           Submitted to nomenclature committee 10/22/2004
           49% to 71X11 rice
           clone name 21G12

CYP71AM1   Sorghum bicolor

CYP71AM1   Brachypodium distachyon (temperate grass) P450s
           66% to CYP71AM1 Sorghum bicolor

CYP71AM2    Sorghum bicolor
            62% to CYP71AM1 Sorghum bicolor
            55% to CYP71AM1 Brachypodium distachyon

CYP71AN1   Populus trichocarpa (Black cottonwood)
           No accession number
           LG_XVI.15 (+ strand) 13154281-13155936  
           71B like 46% to 71AH1 98% to CYP71AN2

CYP71AN2v1 Populus trichocarpa (Black cottonwood)
           No accession number
           LG_XVI.26 (+ strand) 13161865-13163520   
           71A like 44% to 71A12 97% to CYP71AN3 45% to 71AH1
           eugene3.00161323|Poptr1 gene model short at N-term

CYP71AN2v2 Populus trichocarpa (Black cottonwood)
           No accession number
           scaffold_1240 (- strand) 6280-5579   
           71AN like 98% to 71AN2, 3 aa diffs duplicate seq.

CYP71AN3   Populus trichocarpa (Black cottonwood)
           No accession number
           LG_XVI.24 (+ strand) 13169467-13171129  
           71A like 44% to 71A12 
           97% to CYP71AN2, 45% to 71AH1
           eugene3.00161324|Poptr1 gene model short at N-term 

CYP71AN4   Populus trichocarpa (Black cottonwood)
           No accession number
           LG_XII.23 (-) 10752455-10550851  
           71A like 44% to 71A22 65% to CYP71AN5
           45% to 71AH1

CYP71AN5   Populus trichocarpa (Black cottonwood)
           No accession number
           LG_XV.21 (-)  6427585-6426017  
           71B like 46% to 71B2 
           65% to CYP71AN4, 47% to 71J1 
CYP71AN6   Carica papaya
           supercontig_103 :4840..6482 (+ strand)
           80% to 71AN7, 56% to 71AN1 
           51% to 71A10, 50% to 71A1 

CYP71AN7   Carica papaya
           with a sequence gap before IPPK
           44% to CYP71A1

CYP71AN8P  Carica papaya
           supercontig_3:2964847..2976941 (- strand)
           GS_ORF_381_from_ supercontig_3 
           29% to 71B35

CYP71AP1   Populus trichocarpa (Black cottonwood)
           No accession number
           LG_XII.7 (+ strand) 10772698-10774358  
           71B like 44% to 71B2 98% to CYP71AP2

CYP71AP2v1 Populus trichocarpa (Black cottonwood)
           No accession number
           LG_XII.9 (+ strand) 10777737-10779397  
           71B like 43% to 71B2 98% to CYP71AP1

CYP71AP2v2 Populus trichocarpa (Black cottonwood)
           No accession number
           scaffold_9416 (- strand) 764-3      
           1aa diff to 71AP2 duplicate seq. see LG_XII

CYP71AP3   Populus trichocarpa (Black cottonwood)
           No accession number
           LG_XII.11 (+ strand) 10791887-10793547   
           71B like 42% to 71B2 95% to CYP71AP1

CYP71AP4   Populus trichocarpa (Black cottonwood)
           No accession number
           LG_XV.20 (+ strand) 6453904-655556    
           71B like 44% to 71B2 90% to CYP71AP1

CYP71AP5    Vitis vinifera (grapevine)
            78% to 71AP4, 43% to 71B2, 51% to CYP71AS5, 53% to 71A1
            See Vitis pages for seq.

CYP71AP6    Eucalyptus globulus (Myrtales)
            ES588711.1 74% to 71AP5 Vitis, 46% to 71A1, 

CYP71AQ1   Populus trichocarpa (Black cottonwood)
           No accession number
           LG_XV.25 (+ strand) 6442643-6444377   
           71A like 49% to 71AJ1 47% to 71A12, 47% to 71A26

CYP71AR1v1 Fragaria x ananassa (cultivated octoploid strawberry)
           No accession number
           Aharoni A, Giri AP, Verstappen FW, Bertea CM, Sevenier R, Sun Z, 
           Jongsma MA, Schwab W, Bouwmeester HJ.
           Gain and loss of fruit flavor compounds produced by wild and cultivated 
           strawberry species.
           Plant Cell. 2004 16, 3110-3131.
           authors name FaPINH
           10-alpha pinene hydroxylase (affects fruit aroma/flavor)
           Note: pinene synthase (FaPINS) is frameshifted in the cultivated plant
           But not (FvPINS) in the wild strawberry.
           This leads to lack of pinene and downstream products 
           and this changes the aroma/flavor of the strawberry dramatically

CYP71AR1v2 Fragaria vesca (wild strawberry, diploid)
           No accession number
           Aharoni A, Giri AP, Verstappen FW, Bertea CM, Sevenier R, Sun Z, 
           Jongsma MA, Schwab W, Bouwmeester HJ.
           Gain and loss of fruit flavor compounds produced by wild and cultivated 
           strawberry species.
           Plant Cell. 2004 16, 3110-3131.
           authors name FvPINH
           10-alpha pinene hydroxylase (affects fruit aroma/flavor)
           Note: pinene synthase (FaPINS) is frameshifted in the cultivated plant
           But not (FvPINS) in the wild strawberry.
           This leads to lack of pinene and downstream products 
           and this changes the aroma/flavor of the strawberry dramatically

CYP71AR1   Fragaria x ananassa 'Strawberry Festival' cultivar (Octoploid Strawberry)
           GenEMBL CO817923.1 EST sequence

CYP71AS1   Citrus sinensis
           GenEMBL AF426451

CYP71AS2   Linum nodiflorum (flax)
           No accession number
           Maike Petersen
           submitted to nomenclature committee 7/26/05
           56% to CYP71AS1

note CYP71AS3-71AS12 are in grapes.  These names are in progress.

CYP71AS3    Vitis vinifera (grapevine)
            CAAP02000057.1 gene 1
            7 genes in a cluster 62% to CYP71AS1
            See Vitis pages for seq.

CYP71AS3-de1b   Vitis vinifera (grapevine)
            54% to CYP71AS3

CYP71AS4v1  Vitis vinifera (grapevine)
            CAAP02000057.1 gene 2
            7 genes in a cluster

CYP71AS4v2  Vitis vinifera (grapevine)
            7 genes in a cluster
            73% to CYP71AS7v1, 62% to 71AS1 55% to 71B34
            96% to CYP71AS4 and CYP71AS6v1, possible allele of CYP71AS4, 
            since CAN83446.1 = CYP71AS6v2

CYP71AS5    Vitis vinifera (grapevine)
            CAAP02000057.1 gene 3
            7 genes in a cluster

CYP71AS5-de1b   Vitis vinifera (grapevine)
            65% to CYP71AS5

CYP71AS6v1  Vitis vinifera (grapevine)
            CAAP02000057.1 gene 4
            7 genes in a cluster

CYP71AS6v2  Vitis vinifera (grapevine)
            First of 2 genes, 55% to CYP71B 
            97% to CYP71AS6v1, missing some seq after LPII
            This may be an allele of CYP71AS6v1 since it is upstream of CYP71AS7v2

CYP71AS7v1  Vitis vinifera (grapevine)
            CAAP02000057.1 gene 5
            7 genes in a cluster
            58% to CYP71AS1

CYP71AS7v2  Vitis vinifera (grapevine)
            Second of 2 genes, Contains some intron seq. 
            This seq is the ortholog to CYP71AS7v1 

CYP71AS8P   Vitis vinifera (grapevine)
            CAAP02000057.1 gene 6
            7 genes in a cluster
            pseudogene, 74% to CYP71AS5, missing first exon

CYP71AS9P   Vitis vinifera (grapevine)
            CAAP02000057.1 gene 7
            7 genes in a cluster
            pseudogene, 60% to CYP71AS4, I-helix to PERF region

CYP71AS10P  Vitis vinifera (grapevine)
            pseudogene (+) strand, 49% to CYP71AS5 

CYP71AS11P  Vitis vinifera (grapevine)
            this part 66% to CYP71AS7v1
            missing part of exon 1

CYP71AS12P  Vitis vinifera (grapevine)
            second pseudogene on AM481172 
            56% to CYP71AS6v1

CYP71AS13  Coptis japonica (Japanese goldthread, Ranunculales)
           Nobuhiro Ikezawa and Fumihiko Sato
           submitted to nomenclature committee 11/5/07
           clone name B11 
           58% to 71AS4v2, 55% to 71AS2, 51% to 71AT2v2 tobacco

CYP71AS14   Thapsia garganica 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            58% to CYP71AS7v1.e CAAP02000057.1 Vitis vinifera 6 genes in a cluster

CYP71AT1   Solanum lycopersicum (tomato)
           GenEMBL ESTs BM111044 BQ513164.1 DN940809.1 BG888978.1 
           BE919854.1 BE919843.1
           49% to 71B37, 47% to 71G1v1
           Note 71AT1 is 56% identical to CYP83E1 and CYP83E12
           The 71AT subfamily may need to be moved to CYP83E

CYP71AT1a  Solanum tuberosum (potato)
CYP71AT1b  Solanum tuberosum (potato)

CYP71AT2v1 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D247-AH1
           82% to CYP71AT1

CYP71AT2v2 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D228-AH8
           82% to CYP71AT1, 1 aa diff to CYP71AT2v1

CYP71AT2v3 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D228-AD7
           81% to CYP71AT1 5 aa diffs to CYP71AT2v1

CYP71AT3    Vitis vinifera (grapevine)
            CAAP02000328.1 gene 1 of 8, 92% to CAN64422.1

CYP71AT4    Vitis vinifera (grapevine)
            CAAP02000328.1 gene 2 of 8, 
            96% to CAN64422.1 but 5.8 kb upstream, different gene

CYP71AT5P   Vitis vinifera (grapevine)
            CAAP02000328.1 gene 3 of 8, 84167-85735 100% match, 
            96% to CYP71AT4
            48% to CYP83A2/83B1

CYP71AT6P   Vitis vinifera (grapevine)
            CAAP02000328.1 gene 4 of 8, 
            pseudogene 100% to CAN64424.1 in overlaps, 69% to CYP71AT5P

CYP71AT6P   Vitis vinifera (grapevine)
            Pseudogene, 44% to 83A2/B1

CYP71AT7    Vitis vinifera (grapevine)
            CAAP02000328.1 gene 5 of 8
            74% to CYP7AT8

CYP71AT8    Vitis vinifera (grapevine)
            CAAP02000328.1 gene 6 of 8
            71% to CYP7AT5P

CYP71AT8    Vitis vinifera (grapevine)
            58% to 71AT1 tomato

CYP71AT9    Vitis vinifera (grapevine)
            CAAP02000328.1 gene 7 of 8
            73% to CYP7AT5P
            (CAO61031.1) on contig CU459218.1 chr18 scaffold_1

CYP71AT9    Vitis vinifera (grapevine)
            57% to 71AT1 tomato, 88% to CYP71AT8
            same as partial seq CAN71113.1

CYP71AT10Pv1   Vitis vinifera (grapevine)
            CAAP02000328.1 gene 8 of 8
            pseudogene, 70% to CYP7AT5P, 96% to CYP71AT10Pv2
            94% to CYP71AT5P

CYP71AT10Pv2   Vitis vinifera (grapevine)
            pseudogene 70% to CYP71AT8, 56% to 71AT1

CYP71AT11P   Vitis vinifera (grapevine)
            pseudogene 76% to CYP71AT7, 50% to 71B37

CYP71AT12  Thapsia garganica (Apiaceae)
           No accession number
           Corinna Weitzel
           Submitted to nomenclature committee Oct. 14, 2010
           Clone name CYP4272
           55% to CYP71AT1 tomato,56% to CYP71AT5P Vitis vinifera, 
           56% to CYP71AT7 Vitis

CYP71AT13      Solanum lycopersicum (tomato)
CYP71AT13-de1b Solanum lycopersicum (tomato)
CYP71AT13a     Solanum tuberosum (potato)
CYP71AT13b     Solanum tuberosum (potato)
CYP71AT14P     Solanum lycopersicum (tomato)
CYP71AT15      Solanum lycopersicum (tomato)
CYP71AT15v1    Solanum tuberosum (potato)
CYP71AT15v2    Solanum tuberosum (potato)
CYP71AT16      Solanum lycopersicum (tomato)
CYP71AT16v1    Solanum tuberosum (potato)
CYP71AT16Pv2   Solanum tuberosum (potato)
CYP71AT17      Solanum lycopersicum (tomato)
CYP71AT17a     Solanum tuberosum (potato)
CYP71AT17a-de2b  Solanum tuberosum (potato)
CYP71AT17b     Solanum tuberosum (potato)
CYP71AT18P     Solanum lycopersicum (tomato)
CYP71AT19      Solanum lycopersicum (tomato)
CYP71AT20P     Solanum lycopersicum (tomato)
CYP71AT20a     Solanum tuberosum (potato)
CYP71AT20bP    Solanum tuberosum (potato)
CYP71AT21      Solanum lycopersicum (tomato)
CYP71AT21      Solanum tuberosum (potato)
CYP71AT22P     Solanum lycopersicum (tomato)
CYP71AT22      Solanum tuberosum (potato)
CYP71AT23      Solanum lycopersicum (tomato)
CYP71AT23      Solanum tuberosum (potato)
CYP71AT24      Solanum lycopersicum (tomato)
CYP71AT24      Solanum tuberosum (potato)
CYP71AT25P     Solanum lycopersicum (tomato)
CYP71AT25P     Solanum tuberosum (potato)
CYP71AT26P     Solanum lycopersicum (tomato)
CYP71AT25P     Solanum lycopersicum (tomato)
CYP71AT27      Solanum lycopersicum (tomato)
CYP71AT27-de2b Solanum lycopersicum (tomato)
CYP71AT27a     Solanum tuberosum (potato)
CYP71AT27b     Solanum tuberosum (potato)
CYP71AT27-de2b Solanum tuberosum (potato)
CYP71AT27-de2c Solanum tuberosum (potato)
CYP71AT28P     Solanum tuberosum (potato)
CYP71AT29P     Solanum tuberosum (potato)
CYP71AT30      Solanum tuberosum (potato)
CYP71AT31      Solanum tuberosum (potato)
CYP71AT32P     Solanum tuberosum (potato)
CYP71AT33      Solanum tuberosum (potato)
CYP71AT34      Solanum tuberosum (potato)
CYP71AT35P     Solanum tuberosum (potato)
CYP71AT36      Solanum tuberosum (potato)
CYP71AT37Pa    Solanum tuberosum (potato)
CYP71AT37Pb    Solanum tuberosum (potato)
CYP71AT38Pa    Solanum tuberosum (potato)
CYP71AT38Pb    Solanum tuberosum (potato)
CYP71AT39P     Solanum tuberosum (potato)
CYP71AT40P     Solanum tuberosum (potato)
CYP71AT41Pv1   Solanum tuberosum (potato)
CYP71AT41v2    Solanum tuberosum (potato)
CYP71AT42Pv1   Solanum tuberosum (potato)
CYP71AT42v2    Solanum tuberosum (potato)
CYP71AT43      Solanum tuberosum (potato)
CYP71AT44P     Solanum tuberosum (potato)
CYP71AT45P     Solanum tuberosum (potato)
CYP71AT46v1    Solanum tuberosum (potato)
CYP71AT47      Solanum tuberosum (potato)
CYP71AT48      Solanum tuberosum (potato)
CYP71AT49P     Solanum tuberosum (potato)
CYP71AT49P-de1b  Solanum tuberosum (potato)
CYP71AT50P     Solanum tuberosum (potato)
CYP71AT51P     Solanum tuberosum (potato)
CYP71AT52P     Solanum tuberosum (potato)
CYP71AT53P     Solanum tuberosum (potato)
CYP71AT54P     Solanum tuberosum (potato)
CYP71AT55P     Solanum tuberosum (potato)

CYP71AT56  Ruta graveolens (Common Rue, Sapindales)
           No accession number
           Alain Hehn
           Submitted to nomenclature committee June 20, 2011
           91% to CYP71AT57, 61% to CYP71AT1 Vitis
           clone P450-7 (c1737_pep)

CYP71AT57  Ruta graveolens (Common Rue, Sapindales)
           No accession number
           Alain Hehn
           Submitted to nomenclature committee June 20, 2011
           62% to CYP71AT1 Vitis
           clone P450-8 (c2181_pep)

CYP71AT58   Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            54% to CYP71AT1   Solanum lycopersicum (tomato)
            52% CYP83F1v1   Populus trichocarp
            66% to CYP71AT12 Thapsia garganica 

CYP71AT59   Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            56% TO CYP71AT1 Solanum lycopersicum (tomato)
            54% TO CYP83F1v1 Populus trichocarpa
            93% to CYP71AT12 Thapsia garganica 

CYP71AU1   Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D222-BH4
           85% to CYP71AU2 partial tomato seq.

CYP71AU2   Solanum lycopersicum (tomato)
           GenEMBL ESTs AI896171.1 CD002672.1 AW034502.1 

CYP71AU2   Solanum tuberosum (potato)

CYP71AU3  Vitis vinifera (grapevine)
          85% to CYP71AU6P, 54% to 71A26
          see Vitis pages for seq 

CYP71AU4  Vitis vinifera (grapevine)
          CAAP02004888.1 13222-15147 1 aa diff
          46% to 71T4
          see Vitis pages for seq 

CYP71AU5  Vitis vinifera (grapevine)
          92% to CYP71AU3, 53% to 71A26
          see Vitis pages for seq 

CYP71AU6P Vitis vinifera (grapevine)
          CAAP02001743.1b (same contig as CYP71AP5)
          pseudogene, 58% to CYP71AU4
          see Vitis pages for seq 

CYP71AU7  Medicago truncatula (barrel medic, Fabales)
          EST EV262467.1 also GSS CR334389.1, CR334385.1
          56% to 71AU4 Vitis

CYP71AU8  Lotus japonicus 
          BABK01043556.1 BABK01023347.1 (genomic)

CYP71AU9    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 9/26/2008
            Clone C59
            50% to 71A26, 42% to 71D81 medicago, 51% to 71AR1v1
            67% to 71AU7 Medicago, 55% to 71AU3 Vitis

CYP71AU10P  Glycine max (soybean, Fabales)

CYP71AU11P  Glycine max (soybean, Fabales)

CYP71AU12   Glycine max (soybean, Fabales)

CYP71AU12-de1b  Glycine max (soybean, Fabales)

CYP71AU13P  Glycine max (soybean, Fabales)

CYP71AU14P  Glycine max (soybean, Fabales)

CYP71AU15   Glycine max (soybean, Fabales)

CYP71AU16P  Glycine max (soybean, Fabales)

CYP71AU17   Glycine max (soybean, Fabales)

CYP71AU18P  Glycine max (soybean, Fabales)

CYP71AU19P  Glycine max (soybean, Fabales)

CYP71AU20P  Glycine max (soybean, Fabales)

CYP71AU21P  Glycine max (soybean, Fabales)

CYP71AU22P  Glycine max (soybean, Fabales)

CYP71AU23   Glycine max (soybean, Fabales)

CYP71AU24P  Glycine max (soybean, Fabales)

CYP71AU25   Glycine max (soybean, Fabales)

CYP71AU26   Glycine max (soybean, Fabales)

CYP71AU27   Glycine max (soybean, Fabales)

CYP71AU28P  Glycine max (soybean, Fabales)

CYP71AU29P  Glycine max (soybean, Fabales)

CYP71AU30P  Glycine max (soybean, Fabales)

CYP71AU31P  Glycine max (soybean, Fabales)
            Glyma09g02660.1 pseudogene 
            55% to CYP71AU15 mid region
            submitted by Satish Guttikonda

CYP71AU32   Solanum lycopersicum (tomato)
CYP71AU32   Solanum tuberosum (potato)
CYP71AU33   Solanum lycopersicum (tomato)
CYP71AU33   Solanum tuberosum (potato)
CYP71AU34P  Solanum lycopersicum (tomato)

CYP71AU35   Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            53% to CYP71AQ1 cottonwood, 53% to CYP71BF1 Carica papaya
            56% to CYP71AU4 Vitis vinifera, 61% to CYP71AU33 potato

CYP71AU36P  Mimulus guttatus (Lamiales, monkeyflower)
            Pseudogene on scaffold 6 502742-504601 (+) strand
            66% to CYP71AU37 on the same scaffold

CYP71AU37   Mimulus guttatus (Lamiales, monkeyflower)
            on scaffold 6 502742-504601 (+) strand, complete gene
            66% to CYP71AU36P on the same scaffold
            56% to CYP71AU4 Vitis

CYP71AV1 Artemisia annua L. (Sweet Annie, an asterid)
         GenEMBL DQ268763
         Ro,D.-K., Paradise,E.M., Ouellet,M., Fisher,K.J., Newman,K.L.,
         Ndungu,J.M., Ho,K.A., Eachus,R.A., Ham,T.S., Kirby,J.,
         Chang,M.C.Y., Withers,S.T., Shiba,Y., Sarpong,R. and Keasling,J.D.
         Production of the antimalarial drug precursor artemisinic acid in
         engineered yeast
         Nature 440 (7086), 940-943 (2006)
         Submitted to nomenclature committee Oct. 25, 2005
         Clone name 71DA4
         51% to 71D4, less to other CYP71D members

CYP71AV1 Artemisia annua L. (Sweet Annie, sweet wormwood, an asterid)
         GenEMBL DQ315671
         Teoh KH, Polichuk DR, Reed DW, Nowak G, Covello PS. 
         Artemisia annua L. (Asteraceae) trichome-specific cDNAs reveal CYP71AV1, 
         a cytochrome P450 with a key role in the biosynthesis of the antimalarial 
         sesquiterpene lactone artemisinin.
         FEBS Lett. 2006 Feb 20;580(5):1411-6.
         Submitted to nomenclature committee Nov. 1, 2005
         51% to 71D4, less to other CYP71D members

CYP71AV1 Artemisia annua L. (Sweet Annie, sweet wormwood, an asterid)
         GenEMBL DQ872632 (mRNA), DQ826743 (gene)
         Yin,L.L., Yang,R.Y. and Zeng,Q.P.
         Induced expression and quantitation of artemisinin-related genes in
         Artemisia annua L.

CYP71AV1 Artemisia annua L. (Sweet Annie, sweet wormwood, an asterid)
         GenEMBL DQ453967
         Olsson,M.E., Teixeira,M., Brodelius,M. and Brodelius,P.E.
         Amorpha-4,11-diene hydroxylase from Artemisia annua L.
         93% to CYP71AV2, 86% to CYP71AV5, 86% to CYP71AV3, 86% to CYP71AV4
         84% to CYP71AV6, 79% to CYP71AV7, 79% to CYP71AV8

CYP71AV1   Artemisia afra (African wormwood)
           No accession number
           Hikaru Seki
           Submitted to nomenclature committee March 26, 2012
           94% to CYP71AV1 Artemisia annua

CYP71AV1   Artemisia absinthium (absinthe wormwood)
           No accession number
           Hikaru Seki
           Submitted to nomenclature committee March 26, 2012
           94% to CYP71AV1 Artemisia annua

CYP71AV1   Artemisia abrotanum (Southernwood)
           No accession number
           Hikaru Seki
           Submitted to nomenclature committee March 26, 2012
           92% to CYP71AV1 Artemisia annua

CYP71AV1    Artemisia kurramensis (asterid)
            No accession number
            Hiraku Seki
            Submitted to nomenclature committee Sept. 23, 2012
            Seq 4
            89% to CYP71AV2 Artemisia annua
            90% to CYP71AV1 Artemisia absinthium, 
            86% to CYP71AV10 Artemisia campestris
            86% to CYP71AV11 Artemisia campestris

CYP71AV1    Artemisia schmidtiana (asterid)
            No accession number
            Hiraku Seki
            Submitted to nomenclature committee Sept. 23, 2012
            Seq 3
            89% to CYP71AV2 Artemisia annua
            89% to CYP71AV1 Artemisia absinthium, 
            87% to CYP71AV10 Artemisia campestris
            88% to CYP71AV11 Artemisia campestris

CYP71AV2 Artemisia annua L. (Sweet Annie, sweet wormwood, an asterid)
         GenEMBL DQ667171 (mRNA), DQ667170 (gene)
         Kong,J., Wang,W., Zheng,X., Zhu,P. and Cheng,K.
         93% to 71AV1, 90% to CYP71AV5

CYP71AV2    Artemisia maritima (asterid)
            No accession number
            Hiraku Seki
            Submitted to nomenclature committee Sept. 23, 2012
            Seq 2
            99% to CYP71AV2 Artemisia annua
            98% to CYP71AV1 Artemisia absinthium, 
            93% to CYP71AV1 Artemisia annua

CYP71AV2   Tanacetum cinerariifolium (pyrethrum, Asterales)
           No accession number
           Aldana Ramirez
           Submitted to nomenclature committee Dec. 27, 2012
           97% to CYP71AV2 Artemisia annua (probable ortholog)
           93% to CYP71AV1 Artemisia annua

CYP71AV3   Lactuca sativa (lettuce)
           Nguyen,D.T., Gopfert,J.C., Ikezawa,N., Macnevin,G., Kathiresan,M.,
           Conrad,J., Spring,O. and Ro,D.K.
           Biochemical conservation and evolution of germacrene a oxidase in
           J. Biol. Chem. 285 (22), 16588-16598 (2010)
           germacrene A oxidase (GAO1) mRNA, complete cds.
           97% to CYP71AV4, 91% to CYP71AV5

CYP71AV4   Cichorium intybus (chicory)
           Nguyen,D.T., Gopfert,J.C., Ikezawa,N., Macnevin,G., Kathiresan,M.,
           Conrad,J., Spring,O. and Ro,D.K.
           Biochemical conservation and evolution of germacrene a oxidase in
           J. Biol. Chem. 285 (22), 16588-16598 (2010)
           germacrene A oxidase mRNA, complete cds.
           97% to CYP71AV3, 91% to CYP71Av5

CYP71AV5   Saussurea costus (costus)
           Nguyen,D.T., Gopfert,J.C., Ikezawa,N., Macnevin,G., Kathiresan,M.,
           Conrad,J., Spring,O. and Ro,D.K.
           Biochemical conservation and evolution of germacrene a oxidase in
           J. Biol. Chem. 285 (22), 16588-16598 (2010)
           germacrene A oxidase mRNA, complete cds.
           91% to CYP71AV3, 91% to 71AV4

CYP71AV6   Helianthus annuus (sunflower)
           Nguyen,D.T., Gopfert,J.C., Ikezawa,N., Macnevin,G., Kathiresan,M.,
           Conrad,J., Spring,O. and Ro,D.K.
           Biochemical conservation and evolution of germacrene a oxidase in
           J. Biol. Chem. 285 (22), 16588-16598 (2010)
           germacrene A oxidase mRNA, complete cds.
           89% to CYP71AV3, 88% to CYP71AV2

CYP71AV7   Barnadesia spinosa
           Nguyen,D.T., Gopfert,J.C., Ikezawa,N., Macnevin,G., Kathiresan,M.,
           Conrad,J., Spring,O. and Ro,D.K.
           Biochemical conservation and evolution of germacrene a oxidase in
           J. Biol. Chem. 285 (22), 16588-16598 (2010)
           germacrene A oxidase mRNA, complete cds.
           87% to CYP71AV8, 83% to CYP71AV5

CYP71AV8   Cichorium intybus (chicory)
           no accession number
           MJ Beekwilder
           Submitted to nomenclature committee August 19, 2010
           clone name Ci28771prot
           82% to CYP71AV4, 87% to CYP71AV7, 79% to CYP71AV1, 82% to CYP71AV2,
           83% to CYP71AV5, 81% to CYP71AV6

CYP71AV9   Cynara cardunculus var scolymus (globe artichoke)
           No accession number
           Kaouthar Eljounaidi
           Submitted to nomenclature committee Feb. 15, 2012
           95% to CYP71AV5 Saussurea costus (costus)

CYP71AV10  Artemisia campestris (field wormwood or field sagewort)
           No accession number
           Hikaru Seki
           Submitted to nomenclature committee March 26, 2012
           85% to CYP71AV1 Artemisia annua, 88% to CYP71AV2 Artemisia annua

CYP71AV11  Artemisia campestris (field wormwood or field sagewort)
           No accession number
           Hikaru Seki
           Submitted to nomenclature committee March 26, 2012
           85% to CYP71AV1 Artemisia annua, 87% to CYP71AV2 Artemisia annua

CYP71AV11   Artemisia japonica (asterid)
            No accession number
            Hiraku Seki
            Submitted to nomenclature committee Sept. 23, 2012
            Seq 1
            99% (4 aa diffs) to CYP71AV11 campestris

CYP71AV11v1 Artemisia capillaris (asterid)
            No accession number
            Hiraku Seki
            Submitted to nomenclature committee Sept. 23, 2012
            Seq 7
            98% to CYP71AV11 campestris

CYP71AV11v2 Artemisia capillaris (asterid)
            No accession number
            Hiraku Seki
            Submitted to nomenclature committee Sept. 23, 2012
            Seq 8
            98% to CYP71AV11 campestris

CYP71AV12   Artemisia chamaemelifolia (asterid)
            No accession number
            Hiraku Seki
            Submitted to nomenclature committee Sept. 23, 2012
            Seq 6
            93% to CYP71AV1 absinthium, 92% to CYP71AV2 Artemisia annua
            86% to CYP71AV10  Artemisia campestris
            85% to CYP71AV11  Artemisia campestris

CYP71AV13   Artemisia chamaemelifolia (asterid)
            No accession number
            Hiraku Seki
            Submitted to nomenclature committee Sept. 23, 2012
            Seq 5
            92% to CYP71AV1 absinthium, 91% to CYP71AV2 Artemisia annua
            86% to CYP71AV10  Artemisia campestris
            87% to CYP71AV11  Artemisia campestris

CYP71AW1 Lithospermum erythrorhizon 
         No accession number
         Ayako Tsuruga, Najime Mizukami
         Submitted to nomenclature committee Dec. 19, 2005
         52% to CYP71AQ1 cottonwood

CYP71AX1 Solanum lycopersicum (tomato)
         GenEMBL BT012875.1
         52% to CYP71AQ1 cottonwood

CYP71AX2P   Solanum lycopersicum (tomato)
CYP71AX2    Solanum tuberosum (potato)
CYP71AX3    Solanum lycopersicum (tomato)
CYP71AX3    Solanum tuberosum (potato)
CYP71AX4P   Solanum lycopersicum (tomato)
CYP71AX3    Solanum tuberosum (potato)
CYP71AX5    Solanum lycopersicum (tomato)
CYP71AX6P   Solanum lycopersicum (tomato)
CYP71AX7    Solanum lycopersicum (tomato)
CYP71AX7    Solanum tuberosum (potato)
CYP71AX8P   Solanum lycopersicum (tomato)
CYP71AX8P   Solanum tuberosum (potato)
CYP71AX9    Solanum lycopersicum (tomato)
CYP71AX9    Solanum tuberosum (potato)
CYP71AX10   Solanum lycopersicum (tomato)
CYP71AX10   Solanum tuberosum (potato)
CYP71AX11   Solanum lycopersicum (tomato)
CYP71AX11   Solanum tuberosum (potato)
CYP71AX12   Solanum lycopersicum (tomato)
CYP71AX12-de2b   Solanum lycopersicum (tomato)
CYP71AX12   Solanum tuberosum (potato)
CYP71AX13   Solanum lycopersicum (tomato)
CYP71AX13   Solanum tuberosum (potato)
CYP71AX14P  Solanum lycopersicum (tomato)
CYP71AX14P  Solanum tuberosum (potato)
CYP71AX15P  Solanum lycopersicum (tomato)
CYP71AX15   Solanum tuberosum (potato)
CYP71AX16P  Solanum lycopersicum (tomato)
CYP71AX16   Solanum tuberosum (potato)
CYP71AX17P  Solanum lycopersicum (tomato)
CYP71AX17P  Solanum tuberosum (potato)
CYP71AX18P  Solanum tuberosum (potato)
CYP71AX19P  Solanum tuberosum (potato)
CYP71AX20   Solanum tuberosum (potato)
CYP71AX21   Solanum tuberosum (potato)
CYP71AX22P  Solanum tuberosum (potato)
CYP71AX23   Solanum tuberosum (potato)
CYP71AX24P  Solanum tuberosum (potato)
CYP71AX25   Solanum tuberosum (potato)
CYP71AX26   Solanum tuberosum (potato)
CYP71AX27P  Solanum tuberosum (potato)
CYP71AX28P  Solanum tuberosum (potato)
CYP71AX29P  Solanum tuberosum (potato)

CYP71AX  Fragaria x ananassa (strawberry, Rosales)
         Balogh,A., Koncz,T., Tisza,V., Kiss,E. and Heszky,L.
         Identification of ripening-related genes in strawberry fruit by
         Int. J. Hortic. Sci. 11, 33-41 (2006)
         65% to 71AX1 tomato

CYP71AY1 Catharanthus roseus (Madagascar periwinkle)
         GenEMBL AJ295719.1 
identical to X69782.1 CRP450H C.roseus P450CR10 PCR fragment
identical to AM232353.1  Catharanthus roseus cDNA-AFLP fragment
            GenEMBL X69782 (331bp)
            Meijer,A.H., Souer,E., Verpoorte,R. and Hoge,J.H.C.
            Isolation of cytochrome P-450 cDNA clones from the higher plant
            Catharanthus roseus by a PCR strategy.
            Plant Molec. Biol. 22, 379-383 (1993)
            Note: sequence 10 from Fig. 2.
            43% to 71D16

CYP71AY1    Catharanthus roseus
            No accesion number
            Daniele Werck-Reichhart
            Submitted to nomenclature committee Oct. 10, 2011
            Full sequence
            Identical to AJ295719.1 after the first three amino acids

CYP71AY2   Catharanthus roseus
           No accession umber
           Daniele Werck Reichhart
           submitted to nomenclature committee Feb. 20, 2012
           52% to CYP71AY1 Catharanthus roseus
           there is a small set of CYP71AY like sequences in C. roseus

CYP71AZ1    Ammi majus (Bishops weed)
            No accession number
            Sandra Kellner
            Submitted to nomenclature committee Nov. 10 2006
            Clone name ACP
            50% to CYP71AT1, 57% to EC926411.1 Vitis vinifera C-term EST

CYP71AZ2    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            69% to CYP71AZ1 Ammi majus

CYP71AZ3    Pastinaca sativa (parsnip, Apiales)
            No accession number
            Alain Hehn
            Submitted to nomenclature committee 1/16/2012
            71% to CYP71AZ1

CYP71AZ4    Pastinaca sativa (parsnip, Apiales)
            No accession number
            Alain Hehn
            Submitted to nomenclature committee 1/16/2012
            81% to CYP71AZ1

CYP71BA1    Zingiber zerumbet (pinecone ginger, Awapuhi kuahiwi in Hawaii)
            No accession number
            Yu Fn 
            Submitted to nomenclature committee July 2, 2007
            48% to CYP71BB1, 44% to CYP71W1, 43% to 71D16

CYP71BB1    Zingiber zerumbet (pinecone ginger, Awapuhi kuahiwi in Hawaii)
            No accession number
            Yu Fn 
            Submitted to nomenclature committee July 2, 2007
            48% to CYP71BA1, 48% to 71D16, 44% to 71AV1

CYP71BC1    Vitis vinifera (Pinot noir grape)
            GenEMBL AM435124.2
3996  NFAFHLTNDHIKAILL  (0) 4043 

CYP71BC1  Vitis vinifera (grapevine)
          CAN80448.1 = AM435124.2
          CAAP02002092.1 15806-13388 (-) strand 1 aa diff.
          see Vitis pages for seq 

CYP71BC1-de2b   Vitis vinifera (grapevine)
          C-term pseudogene, 67% to 71BC1
          see Vitis pages for seq 

CYP71BC2    Sesamum indicum (a sesame plant)
            No accession number
            Eiichiro Ono
            Submitted to nomenclature committee July 11, 2007
            Clone name SiCYP40
            45% to 71B34, 57% to CYP71BA1 AM435124.2 Vitis vinifera

CYP71BC3-de1b   Vitis vinifera (grapevine)
          N-term pseudogene 80% to 71BC3
          see Vitis pages for seq 

CYP71BC3  Vitis vinifera (grapevine)
          CAN72169.1 62% to CYP71BC1
          CAAP02002092.1 28083-26374 (-) strand 100% match
          see Vitis pages for seq 

CYP71BC3-de1c   Vitis vinifera (grapevine)
          N-term pseudogene 78% to 71BC3
          see Vitis pages for seq 

CYP71BC3-de1d   Vitis vinifera (grapevine)
          N-term pseudogene 79% to 71BC3
          see Vitis pages for seq 

CYP71BC3-de2b   Vitis vinifera (grapevine)
          C-term pseudogene 95% to 71BC3
          see Vitis pages for seq 

CYP71BD1    Sesamum indicum (a sesame plant)
            No accession number
            Eiichiro Ono
            Submitted to nomenclature committee July 11, 2007
            Clone name SiCYP249
            50% to 71AT1, 44% to 83A2, 48% to CYP83E8 Medicago truncatula
            note: CYP83 has been swallowed up by the CYP71 family.  
            It is now like a subfamily of CYP71.

CYP71BE1    Vitis vinifera (Pinot noir grape)
            GenEMBL AM445470.2 

CYP71BE1  Vitis vinifera (grapevine)
          46% to CYP71AP5, 42% to 71B37, 
          6 aa diffs to CYP71BE1 AM445470.2
          see Vitis pages for seq 

CYP71BE2   Carica papaya
           59% to CYP71BE1 Vitis vinifera
           51% to 71D55 Hyoscyamus muticus (Egyptian henbane)
           95% to CYP71BE3P (possible duplicate seq)

CYP71BE3P  Carica papaya
           95% to CYP71BE2
           Combined 44% to 71X11, 53% to CYP71D10 AF022459 Glycine max
           Frameshifted twice in exon 1, one stop codon, 
           possible pseudogene

CYP71BE4P Vitis vinifera (grapevine)
          CAAP02000100.1e, 5 of 5 genes
          see Vitis pages for seq 

CYP71BE5  Vitis vinifera (grapevine)
          CAAP02000100.1d, 4 of 5 genes
          61% to CYP71BE1
          see Vitis pages for seq 

CYP71BE6  Vitis vinifera (grapevine)
          CAAP02000100.1c, 3 of 5 genes
          61% to CYP71BE1
          see Vitis pages for seq 

CYP71BE6-de1b   Vitis vinifera (grapevine)
          CAAP02000100.1c, 3 of 5 genes
          pseudogene N-term
          see Vitis pages for seq 

CYP71BE7  Vitis vinifera (grapevine)
          CAAP02000100.1b, 2 of 5 genes
          61% to CYP71BE1
          see Vitis pages for seq 

CYP71BE8P Vitis vinifera (grapevine)
          CAAP02000100.1a, 1 of 5 genes
          frameshift and stop possible pseudogene  
          44% to CYP71B33, 64% to CYP71BE1
          see Vitis pages for seq 

CYP71BE9Pv1  Vitis vinifera (grapevine)
          pseudogene, 78% to CYP71BE1
          see Vitis pages for seq 

CYP71BE9Pv2  Vitis vinifera (grapevine)
             Pinot noir (a highly heterozygous grape genome)
             top part is a retrotransposon seq like AAP46207 putative 
             retrotransposon protein Oryza sativa
             97% (6 aa diffs) to CYP71BE9Pv1, a probable ortholog to the 
             pseudogene from AM472203.2, exon 2 only
             see Vitis pages for seq 

CYP71BE10v1  Vitis vinifera (grapevine)
             79% to CYP71BE13-de2b
             see Vitis pages for seq 

CYP71BE10v2  Vitis vinifera (grapevine)
             CAN81963.1 (partial translation of intact gene)
             Pinot noir (a highly heterozygous grape genome)
             Overall 98% to 71BE10 probable ortholog 
             from AM487125.2 first exon 97% (7 aa diffs) to 71BE10, 
             second exon 1 aa diff to 71BE10
             see Vitis pages for seq 

CYP71BE11-de1b   Vitis vinifera (grapevine)
             pseudogene N-term
             see Vitis pages for seq 

CYP71BE11    Vitis vinifera (grapevine)
             pseudogene 85% to CYP71BE13-de2b
             see Vitis pages for seq 

CYP71BE12    Vitis vinifera (grapevine)
             one frameshift, 83% to CYP71BE13-de2b
             see Vitis pages for seq 

CYP71BE13-de2b   Vitis vinifera (grapevine)
             pseudogene 94% to CYP71BE10v2
             see Vitis pages for seq 

CYP71BE13    Vitis vinifera (grapevine)
             CAAP02001833.1b, 69% to 71BE1
             see Vitis pages for seq 

CYP71BE14P   Vitis vinifera (grapevine)
             pseudogene 64% to 71BE1
             see Vitis pages for seq 

CYP71BE15P   Vitis vinifera (grapevine)
             pseudogene 78% to 71BE1
             see Vitis pages for seq 

CYP71BE16P   Vitis vinifera (grapevine)
             pseudogene 66% to CYP71BE13
             see Vitis pages for seq 

CYP71BE17   Solanum lycopersicum (tomato)
CYP71BE17   Solanum tuberosum (potato)
CYP71BE18   Solanum lycopersicum (tomato)
CYP71BE18   Solanum tuberosum (potato)
CYP71BE19P  Solanum lycopersicum (tomato)

CYP71BE20   Ruta graveolens (Common Rue, Sapindales)
            No accession number
            Alain Hehn
            Submitted to nomenclature committee June 20, 2011
            63% to CYP71BE6 Vitis
            clone P450-3 (c149_pep)

CYP71BE21   Ruta graveolens (Common Rue, Sapindales)
            No accession number
            Alain Hehn
            Submitted to nomenclature committee June 20, 2011
            56% to CYP71BE7 Vitis, top 12 hits in Vitis are CYP71BE
            clone P450-1 (c643_pep)

CYP71BE22   Ruta graveolens (Common Rue, Sapindales)
            No accession number
            Alain Hehn
            Submitted to nomenclature committee June 20, 2011
            55% to CYP71BE7 Vitis, 73% to CYP71BE21
            clone P450-4 (c643_pep)

CYP71BE23   Thapsia villosa
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            54% to CYP71BE1 Vitis vinifera
            59% to CYP71BE8P best match is a pseudogene?

CYP71BE24   Mimulus guttatus (Lamiales, monkeyflower)
            on scaffold 69 565208-567453 (+) strand
            note: there are 6 P450s in a cluster from 567-767 kb
            57% to CYP71BE7 Vitis
            84% to CYP71BE25P second exon only

CYP71BE25P  Mimulus guttatus (Lamiales, monkeyflower)
            on scaffold 69 569206-569844 (+) strand mgv1a020716m
            note: there are 6 P450s in a cluster from 567-767 kb
            84% to CYP71BE24 
            this seq is only the second exon

CYP71BE26   Mimulus guttatus (Lamiales, monkeyflower)
            on scaffold 69 574527-576190 (+) strand
            note: there are 6 P450s in a cluster from 567-767 kb
            83% to CYP71BE7 Vitis
            97% to CYP71BE29P

CYP71BE27P  Mimulus guttatus (Lamiales, monkeyflower)
            on scaffold 69 605390-606372 (+) strand mgv1a025303m
            note: there are 6 P450s in a cluster from 567-767 kb

CYP71BE28P  Mimulus guttatus (Lamiales, monkeyflower)
            on scaffold 69 615974-617777 (+) strand mgv1a018625m
            note: there are 6 P450s in a cluster from 567-767 kb

CYP71BE29P  Mimulus guttatus (Lamiales, monkeyflower)
            on scaffold 69 615974-617777 (+) strand mgv1a018625m
            note: there are 6 P450s in a cluster from 567-767 kb
            84% to CYP71BE7 Vitis
            77% to CYP71BE24 Mimulus guttatus

CYP71BE30   Podophyllum species (Ranunculales)
            No accession number
            Joaquim Vogt Marques
            Submitted to nomenclature committee August 3, 2012
            56% to CYP71BE6 Vitis
            56% to CYP71BE5 Vitis
            55% to CYP71D326 Ricinus communis (castor bean, Malpighiales)
            54% to 71D55 Hyoscyamus muticus
            54% to 71D4 potato

CYP71BF1   Carica papaya
           52% TO 71A26, 
           81% to CYP71BF2 seq GLHM_ORF_74_from_supercontig_131
           52% to 71AR1 strawberry, 53% to 71AQ1 

CYP71BF2   Carica papaya
           52% to 71A26 FRAMESHIFT AFTER WTM IN EXON 2 
           81% to CYP71BF1
           54% to CYP71AU1 tobacco and 71AU2 in tomato

CYP71BG1   Solanum tuberosum 
           DR034423.1, BQ514535.1, BM114062.1, BQ119583.2, BQ506191.2, CK717210.1
           67% to CYP71BG2P

CYP71BG2   tomato breaker fruit Solanum lycopersicum 
           BM411522.1, BM412569.1, BP881630.1, ES895470.1, DB685010
           DU947425.1 (GSS) 

CYP71BG3   Gossypium hirsutum 
           CO128388.1 from Gossypium raimondii

CYP71BG4    Citrus
            DY280303.1, DY276238.1 from Citrus clementina, 
            Citrus reticulata x Citrus temple EX448715.1 (C-term)
            Hybrid: Two different species of citrus are combined here
            To try to achieve a full seq. Still missing the C-term
            63% to 71BG1, 64% to 71BG3, 63% to 71BG2

CYP71BG5P    Vitis vinifera (grapevine)
             pseudogene 48% to CAAP02001743.1a, 52% to 71P1 rice
             like potato and cotton ESTs, 67% to 71BG1, 65% to 71BG2, 
             65% to 71BG3
             see Vitis pages for seq 

CYP71BH1     Ocimum basilicum (sweet basil, Lamiaceae)
             No accession number
             Anna Berim, David R. Gang
             Submitted to nomenclature committee June 24, 2009
             51% to CYP71AU4, 50% to CYP71AU3, 44% to CYP71AP5

CYP71BJ1     Catharanthus roseus (Madagascar periwinkle)
             No accession number
             David Liscombe
             submitted to nomenclature committee Sept. 7, 2010
             52% to CYP71AX3 tomato

CYP71BK1     Thapsia garganica (Apiaceae)
             No accession number
             Corinna Weitzel
             Submitted to nomenclature committee Oct. 14, 2010
             Clone name CYP1622
             52% to CYP71AS4v2 Vitis vinifera, 47% to CYP71BC1 Vitis

CYP71BK1    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            48% to CYP71BC1 Vitis vinifera
            98% to CYP71BK1 Thapsia garganica probable ortholog

CYP71BK2    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            49% TO CYP71BC1   Vitis vinifera
            61% to CYP71BK1 Thapsia garganica

CYP71BL1     Helianthus annuus (sunflower, Asterales)
             GenEMBL HQ439590
             Nobuhiro Ikezawa and Dae-Kyun Ro
             Submitted to nomenclature committee Jan. 25, 2011
             66% to CYP71BL2, 46% to CYP71BE1 Vitis vinifera

CYP71BL2     Lactuca sativa (lettuce, Asterales)
             Nobuhiro Ikezawa and Dae-Kyun Ro
             Submitted to nomenclature committee Jan. 25, 2011
             66% to CYP71BL1, 50% to CYP71D97 Ammi majus

CYP71BL3     Chicorium intybus (chicory, Asterales)
             Qing Liu
             Submitted to nomenclature committee April 19, 2011

CYP71BL4   Tanacetum cinerariifolium (pyrethrum, Asterales)
           No accession number
           Aldana Ramirez
           Submitted to nomenclature committee Dec. 27, 2012
           88% to Chicorium intybus (chicory, Asterales) JF816041

CYP71BL frag. Taraxacum officinale (dandylion, Asterales)
            Keates,S., Kostman,T., Anderson,J. and Bailey,B.
            Altered gene expression in three plant species in response to
            treatment with Nep1, a fungal protein that causes necrosis
            Unpublished (2003)
            94% to CYP71BL3

CYP71BQ1    Ruta graveolens (Common Rue, Sapindales)
            No accession number
            Alain Hehn
            Submitted to nomenclature committee June 20, 2011
            52% to CYP71BE5 Vitis, probable outlier of the CYP71BE subfamily
            clone P450-2 (c3128_pep)

CYP71BR1    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            52% to CYP71BE1 Vitis vinifera
            54% to CYP71BE6 Vitis vinifera, new subfamily in CYP71
            missing N-term 94 aa
            only 49% to CYP71BE23 Thapsia villosa

CYP71BS1   Solanum lycopersicum (tomato)
           Name changed from CYP71BL1 due to name conflict
CYP71BS1   Solanum tuberosum (potato)
           Name changed from CYP71BL1 due to name conflict

CYP71BT1   Catharanthus roseus
           No accession umber
           Daniele Werck Reichhart
           submitted to nomenclature committee Feb. 20, 2012
           54% to CYP71BE1 Vitis vinifera

CYP71BU1    Sorghum bicolor
            46% to CYP71AU4 Vitis
            45% to CYP71AX3 tomato
            42% to CYP71T5 rice

CYP71BU2P   Sorghum bicolor
            78% to CYP71BU1 Sorghum bicolor

CYP71BU3    Setaria italica
            AGNK01003876 866538-88244 (-) strand
CYP71BU4P   Setaria italica
            AGNK01001222 67747-69209 (-) strand
            73% to CYP71BU3
            No N-term found

CYP71BV1    Catharanthus roseus 

CYP71BV2    Catharanthus roseus 

CYP71BV3    Catharanthus roseus 

CYP71BV4    Catharanthus roseus 

CYP71BW1    Catharanthus roseus 

CYP71BX1    Catharanthus roseus 

CYP71BY1    Catharanthus roseus 

CYP71BY2    Catharanthus roseus 

CYP71BZ1   Tanacetum cinerariifolium (pyrethrum, Asterales)
           No accession number
           Aldana Ramirez
           Submitted to nomenclature committee Dec. 27, 2012
           51% to CYP71BL3 Chicorium intybus (chicory, Asterales)
           51% to CYP71D98 Ammi majus
           50% to 71BE6 Vitis

CYP71CA1   Tanacetum parthenium (Asterales)
           No accession number
           Qing Liu
           Submitted to nomenclature committee April 22, 2013
           Clone name Tp2116
           48% to CYP71BC1 Vitis vinifera
           43% to CYP71B64 Ricinus communis
           44% to CYP71AS13 Coptis japonica

CYP71CA1   Tanacetum parthenium (Asterales)
           No accession number
           Qing Liu
           Submitted to nomenclature committee April 22, 2013
           Clone name Tp8878
           51% to CYP71AJ5 Thapsia garaganica
           51% to CYP71AJ8 Ammi majus
           53% to CYP71AU1 Nicotiana tabacum 
           52% to CYP71AU32 tomato
           52% to CYP71A5v1 Nepeta racemosa (catmint)

CYP71 frag. Taraxacum officinale (dandylion, Asterales)
            Isolation and characterization of candidate genes for pathogen and
            herbivory defense in common dandelion (Taraxacum officinale) upon
            salicylic acid or methyl jasmonate treatment
            50% to 71B18 C-term

CYP71 frag. Teucrium chamaedrys  (Lamiales)
            Barthelson,R.A., Galbraith,D.W. and Woosley,R.
            Development of a Comprehensive Assay for Medicinal Plant Species
            74% to 71A8, 56% to 71A25

CYP71 frag. Chenopodium quinoa (Caryophyllales)
            Coles,N.D., Coleman,C.E., Christensen,S.A., Jellen,E.N., Stevens
            ,M.R., Bonifacio,A., Rojas-Beltran,J.A., Fairbanks,D.J. and Maughan
            Development and use of an expressed sequenced tag library in quinoa
            (Chenopodium quinoa Willd.) for the discovery of single nucleotide
            Plant Sci. 168 (2), 439-447 (2005)
            49% to 71A32, 46% to 71A20

CYP71       Amborella trichopoda
            GenEMBL CD483091.2 CD481896 ESTs
            51% to 71A1, N-term

CYP71       Amborella trichopoda
            GenEMBL CV012267 EST
            N-term 50% to 71A25

CYP71     Amborella trichopoda
          GenEMBL CV012547
          48% to 71X11, C-term, 46% to 736A3

CYP71     Ribes americanum (Saxifragales)
          GenEMBL DT599946
          55% to 71X11

CYP71      Persea americana (avocado, Laurales)
           GenEMBL CV005048.1
           43% to 71Y8, 48% to 71D4

CYP71      Persea americana (avocado, Laurales)
           56% to 71B33

CYP71A       Gossypium hirsutum
             GenEMBL DW518140.1  EST
             60% to 71A2

CYP71      Caulophyllum thalictroides  (Ranunculales)
           GenEMBL AY870901
           51% to 71B23

CYP71      Juglans regia (walnut, Fagales)
           GenEMBL CV195714 EST
           65% to 71A10 soybean, 61% to 71A1

CYP71      Casuarina glauca (swamp oak, Fagales)
           57% to 71E6

CYP71       Casuarina glauca (swamp oak, Fagales)
            52% to 71A10 soybean, 40% to 71A12

CYP71        Cyclamen persicum  (Ericales)
             GenEMBL AJ886911
             61% to 71X2, 60% to 71A8

CYP71        Cucumis sativus (cucumber, Cucurbitales)
             GenEMBL DN909430.1 
             53% to 71B25, 54% to 71A10 soybean, 55% to 71A5

CYP71        Beta vulgaris (beet, Caryophyllales)
             GenEMBL CF542917.1 
             53% to 71A25, 56% to 71A8

CYP71        Aquilegia formosa x Aquilegia pubescens (Ranunculales)
             GenEMBL DT742769.1  EST
             55% to 71X11, 61% to 71A1

CYP71        Fragaria x ananassa (strawberry, Rosales)
             73% to 71AR1

CYP71        Fragaria vesca (wild strawberry, Rosales)

CYP71      Chenopodium quinoa (Caryophyllales)
           GenEMBL DQ462156.1  
           53% to 71B34, 56% to 71W1  C-term

CYP71      Sorbus torminalis  (Rosales)
           GenEMBL AJ313041 genomic
           50% to 71A5  47% to 71A26 (mid region)

CYP71       Malus x domestica (Rosales)
            methylcoclaurine hydroxylase (PROBABLY NOT)
            73% to 71G1,  69% to 80B3  67% to 76C7

CYP71     Ribes americanum (American black currant, Saxifragales)
          44% to 71B37 N-term

CYP71     Ribes americanum  (American black currant, Saxifragales)
          40% to 71B34 N-term

CYP71     Ribes americanum (American black currant, Saxifragales)
          DT599190.1 CV458397.1
          42% to 71B36 N-term

CYP71     Ribes americanum (American black currant, Saxifragales)
          GenEMBL DT599946 DT587066.1
          55% to 71X11 C-term

CYP71-un1 Populus trichocarpa (Black cottonwood)
CYP71-un2 Populus trichocarpa (Black cottonwood)
CYP71-un3 Populus trichocarpa (Black cottonwood)
CYP71-un4 Populus trichocarpa (Black cottonwood)
CYP71-un5 Populus trichocarpa (Black cottonwood)

CYP71 frag  Pisum sativum
            Frank,M.R., Deyneka,J.M. and Schuler,M.A.
            Cloning of wound-induced cytochrome P450 
            monooxygenases expressed in pea
            Plant Physiol. 110 (3), 1035-1046 (1996)
            56% to 71A1

CYP        Marchantia polymorpha (liverwort)
           GenEMBL AU081762.1 EST 
           41% to 71A1 avocado N-term
           note this is the first seq from a liverwort 
           CYP71 may not exist in liverworts, since 
           it is found only in the angiosperms, so this
           may be a new family, not CYP71

CYP71 fragment   Solanum lycopersicum
                 Pseudogene fragment 48% to 71X7 rice

CYP71      Ulmus Americana (American elm, Fagales)
           EG356722.1 60% to 71E6

72A Subfamily

Note on the 72A subfamily.  The 72A subfamily from different species appears to contain 
multiple members.  These sequences are very similar to each other, so they were not present in the common ancestor to the 72A group.  They may represent alleles of the same gene or duplications of a single gene that have diverged slightly.  I have tried to keep families with only one sequence per species with a single name as in CYP72A for all species.  This approach breaks down when multiple alleles or highly similar duplications are present.  The only practical solution is to assign different names to each species as in 72A1, 72A2, 72A3, etc. and use v1, v2, v3 for the highly similar variations in a single species.  Variants had already been assigned to 72A from Catharanthus roseus, but since this was one of the first cases where v numbers were used, the first sequence was not given a v designation.  The second sequence was called v1 and the third v2.  The nomenclature has since been defined such that any new sequence is by default given the v1 designation.  The v1 designation is not used unless other variants are known.  The second sequence is then v2 etc.  To correct this error, the first 72A1 sequence is being relabeled as 72A1v3, while the other two sequences remain the same.  Other species are now assigned different numbers as 72A2 etc. with v numbers given as needed.  It is still acceptable to refer to the 72A subfamily, but different species will now have separate numbers.

CYP72A1v1   Catharanthus roseus
            GenEMBL L19074 (2646bp)
            Mangold,U., Eichel,J., Batschauer,A., Lanz,T., Kaiser,T.,
            Spangenberg,G., Werck-Reichhart,D. and Schroeder,J.
            Gene and cDNA for plant cytochrome P450 proteins (CYP72 family) 
            from Catharanthus roseus: and transgenic expression in tobacco and 
            Arabidopsis thaliana.
            Plant Sci. 96, 129-136 (1994)
            Note: sequence called CYP72B, 8 amino acid differences with
            CYP72A1v3 (see second entry under 72A1v3 for function information)

CYP72A1v2   Catharanthus roseus
            GenEMBL L19075 (1633bp)
            Mangold,U., Eichel,J., Batschauer,A., Lanz,T., Kaiser,T.,
            Spangenberg,G., Werck-Reichhart,D. and Schroeder,J.
            Gene and cDNA for plant cytochrome P450 proteins (CYP72 family) 
            from Catharanthus roseus: and transgenic expression in tobacco and 
            Arabidopsis thaliana.
            Plant Sci. 96, 129-136 (1994)
            Note: sequence called CYP72C, 14 amino acid differences with
            CYP72A1v3 plus a 3 amino acid C-terminal extension.
            (see second entry under 72A1v3 for function information)

CYP72A1v3   Catharanthus roseus L. (Madagascar periwinkle)
            GenEMBL L10081 (1854bp) Swiss Q05047 (524 amino acids)
            Vetter,H.-P., Mangold,U., Schroeder,G., Marner,F.-J.,
            Werck-Reichhart,D. and Schroeder,J.
            Molecular analysis and heterologous expression of 
            an inducible cytochrome P-450 protein from periwinkle
            (Catharanthus roseus L.)
            Plant Physiol. 100, 998-1007 (1992)

NEW         Update on function of CYP72A1 encoded by (L10081):
            Irmler, S., Schršder, G., St-Pierre, B., Crouch, N.P., Hotze, M., 
            Schmidt, J., Strack, D., Matern, U. and Schršder, J. (2000) Indole 
            alkaloid biosynthesis in Catharanthus roseus: new enzyme activities 
            and identification of cytochrome P450 CYP72A1 as secologanin 
            synthase. Plant J. 24, 797-804.
            CYP72A1v3 converts loganin into secologanin.

            GenEMBL X69775 (365bp PCR fragment)
            Meijer,A.H., Souer,E., Verpoorte,R. and Hoge,J.H.C.
            Isolation of cytochrome P-450 cDNA clones from the higher plant
            Catharanthus roseus by a PCR strategy.
            Plant Molec. Biol. 22, 379-383 (1993)
            Note: sequence 3 from Fig. 2. (identical to 72A1)

CYP72A1     Catharanthus roseus (Madagascar periwinkle) PCR fragment
            GenEMBL X69789 (375bp)
            Meijer,A.H., Souer,E., Verpoorte,R. and Hoge,J.H.C.
            Isolation of cytochrome P-450 cDNA clones from the higher plant
            Catharanthus roseus by a PCR strategy.
            Plant Molec. Biol. 22, 379-383 (1993)
            Note: sequence 1 from Fig. 2.
            (see second entry under 72A1v3 for function information)

CYP72A1     Catharanthus roseus (Madagascar periwinkle) PCR fragment
            GenEMBL X69790 (327bp)
            Meijer,A.H., Souer,E., Verpoorte,R. and Hoge,J.H.C.
            Isolation of cytochrome P-450 cDNA clones from the higher plant
            Catharanthus roseus by a PCR strategy.
            Plant Molec. Biol. 22, 379-383 (1993)
            Note: sequence 2 from Fig. 2.
            (see second entry under 72A1v3 for function information)

CYP72A2    Nicotiana plumbaginifolia
           GenEMBL U35226(1787bp)
           LaRosa P.C. and Smigocki, A.C.
           A wound-inducible cytochrome P-450 in Nicotiana plumbaginifolia
           unpublished (1996)

CYP72A3X    Nicotiana tabacum (tobacco)
            no accession number
            Francis Durst
            submitted to nomenclature committee
            Francis Durst denies he ever sent a tobacco CYP72 sequence.  This is  
            Probably an accident, since he did send three tobacco sequences and 
            a wheat CYP72 in one email.  I probably thought they were all 
            tobacco and misnamed this one.

CYP72A4X    Arabidopsis thaliana ESTs
            GenEMBL T13009 (removed from Genbank, same as T04134), T04134 (72A11),     
            T22603 (72A13), H36956 (72A14), T44202 (72A13), R90024 (72A7)
            N-terminal fragments, more than one sequence is present

            GenEMBL T22449 (72A15), T45915 (72A15), H36129 (72A11)
            middle fragments

            GenEMBL Z46541 (72A14), Z46540 (72A14)
            C-terminal fragments

            note: the whole gene sequence can be assembled from these ESTs,
            but it may be a chimera of several isoforms.  There seem to be at 
            least 3 different N-terminals.  
            Note: There is a cluster of 8 CYP72A genes and one pseudogene on
            AB023038.  Therefore, this chimeric sequence has been retired.

CYP72A5    Zea mays (maize)
           ESTs AI855377 (1 amino acid difference), AI637224 (94% identical)
           Persans,M.W., Wang,J. and Schuler,M.A.
           Characterization of maize cytochrome p450 monooxygenases induced in
           response to safeners and bacterial pathogens
           Plant Physiol. 125 (2), 1126-1138 (2001)
           Clone name PCR4
           formerly CYP95A1 (missnamed due to a frame shift in the PCR fragment)

CYP72A5    Zea mays (maize)
           Wang,J. and Schuler,M.A.
           Molecular characterization of the maize CYP71C3 and CYP72A
           subfamily genes

CYP72A5    Zea mays (maize)
           no accession number
           Mike Barrett
           clone A8 most like PCR fragment PCR4 from Mike Persans and Mary Schuler
           The PCR4 fragment was missnamed as CYP95A1 due to a frame shift error in 
           the sequence in the I-helix region.
           also like Arabidopsis GSS BAC end fragment B24203 (67% identical)
           submitted to nomenclature committee 5/15/98
           ESTs AI855377 (1 amino acid difference), AI637224 (94% identical)



CYP72A6v1  Triticum aestivum
           Hehn,A. and Werck-Reichhart,D.
           Triticum aestivum P450
           CYP72A-TA cytochrome P450 mRNA, complete
           submitted to nomenclature committee 1/20/99
           clone name CYP72A 47% identical to C. roseus CYP72A1

CYP72A6v2  Triticum aestivum 
           Hehn,A. and Werck-Reichhart,D.
           Triticum aestivum P450
           CYP72B-NV-TA cytochrome P450 mRNA, complete
           submitted to nomenclature committee 1/20/99
           clone name CYP72B' 96% identical to CYP72A6v3 95% identical to  

CYP72A6v2P  Triticum aestivum 
            Hehn,A. and Werck-Reichhart,D.
            Triticum aestivum P450
            CYP72B-TA cytochrome P450 mRNA, complete
            Note: frameshift between FKFP and LTRLL
            submitted to nomenclature committee 1/20/99
            clone name CYP72B 
            This sequence is 100% identical to the other 72A6v2 sequence 
            from amino acid 130 to the end.  The N-terminal 129 amino acids match 
            no sequences in Genbank.  I suspect this is a frameshifted clone. 

N-term in-frame translation not P450 related

N-term Frameshifted translation 100% to CYP72A6v2

C-term 100% to CYP72A6v2

CYP72A6v3  Triticum aestivum (wheat)
           Hehn,A. and Werck-Reichhart,D.
           Triticum aestivum P450
           CYP72C-TA cytochrome P450 mRNA, complete
           submitted to nomenclature committee 1/20/99
           clone name CYP72C 96% identical to CYP72A6v2 95% identical to CYP72A6v1

CYP72A7    Arabidopsis thaliana
           GenEMBL AB023038 40540-42460
           ESTs R90024 (2/26/99)

CYP72A8    Arabidopsis thaliana
           GenEMBL AB023038 42944-44810
           no ESTs (2/26/99)

CYP72A9    Arabidopsis thaliana
           GenEMBL AB023038 45458-47366
           no ESTs (3/1/99)

CYP72A10   Arabidopsis thaliana
           GenEMBL AB023038 47816-49744
           no ESTs (3/1/99)

CYP72A11   Arabidopsis thaliana
           GenEMBL AB023038 50166-52122
           ESTs H36129, T04134 (3/1/99)

CYP72A12P  Arabidopsis thaliana
           GenEMBL AB023038 52192-52485 lone exon 5
           GSS fragment B24203 97% identical
           no ESTs (3/1/99)

CYP72A13   Arabidopsis thaliana
           GenEMBL AB023038 52920-54868
           ESTs T44202, N96036, N96740 (3/1/99)

CYP72A14   Arabidopsis thaliana
           GenEMBL AB023038 62438-64419
           ESTs H36956, Z46541, Z46540 (3/1/99)

CYP72A15   Arabidopsis thaliana
           GenEMBL AB023038 65370-67267
           ESTs T45915, T22449 (3/1/99)

CYP72A16   Zea mays (maize)
           Wang,J. and Schuler,M.A.
           Molecular Characterization of the Maize CYP71C3 and CYP72A
           subfamily genes
           80% to 72A5 EST AI857222
           submitted to nomenclature committee 12/1/99

CYP72A17   Oryza sativa (rice)
           GenEMBL AP002839.1 36553-39431
            Go to sequences

CYP72A18   Oryza sativa (rice)
           GenEMBL AP002839.1 44993-41630
           Hiromasa Imaishi
           Submitted to nomenclature committee 8/18/2000
            Go to sequences

CYP72A19   Oryza sativa (rice)
           GenEMBL AP002839.1 comp(53699-51708)
            Go to sequences

CYP72A20   Oryza sativa (rice)
           GenEMBL AP002839.1 56581-59004
            Go to sequences

CYP72A21   Oryza sativa (rice)
           GenEMBL AP002839.1 61993-63890
           Hiromasa Imaishi
           Submitted to nomenclature committee 3/2/2000
           Clone name CL-8904
           53% identical to 72A15
            Go to sequences

CYP72A22   Oryza sativa (rice)
           GenEMBL AP002839.1 66435-68424
            Go to sequences

CYP72A23   Oryza sativa (rice)
           GenEMBL AP002839.1 72149-74091
            Go to sequences

CYP72A24   Oryza sativa (rice)
           GenEMBL AP002839.1 109970-113787
            Go to sequences

CYP72A25   Oryza sativa (rice)
           GenEMBL AP002839.1 115472-117492
            Go to sequences

CYP72A26   Zea mays 
           Wang,J. and Schuler,M.
           Characteristics and Transcriptional Regulation of Maize Cytochrome
           P450 Monooxygenases
           Submitted to nomenclature committee Oct. 2, 2000 
           Clone name 12/7B
           62% to 72A5

CYP72A27   Zea mays (maize)
           Wang,J. and Schuler,M.A.
           Molecular Characterization of the Maize CYP71C3 and CYP72A
           subfamily genes
           Submitted to nomenclature committee Oct. 23, 2000 
           Clone name 11G
           95% identical to 72A26, but matches three ESTs at points of difference

CYP72A28v1 Zea mays (maize)
           Wang,J. and Schuler,M.A.
           Molecular Characterization of the Maize CYP71C3 and CYP72A
           subfamily genes
           Submitted to nomenclature committee Oct. 23, 2000 
           Clone name E5D
           66% to CYP72A26

CYP72A28v2 Zea mays (maize)
           2 aa diffs to CYP72A28v1

CYP72A28v3 Zea mays (maize)
           79% to CYP72A24
           3 aa diffs to CYP72A28 EU954634

CYP72A29   Solanum  tuberosum L. May Queen
           Hisaharu Kato
           Submitted to nomenclature committee 1/15/2002
           84% to 72A2, 47% to 72A18

CYP72A30X  Solanum lycopersicum (tomato)
           GenEMBL AF249329
           Bartoszewski,G., Mujer,C.V., Niemirowicz-Szczytt,K. and
           Tomato (Solanum lycopersicum) cDNA sequence encoding a     
           protein similar to a cytochrome P450 enzyme
           74% to 72A29
           note small gap compared to other 72As, may be missing some
           coding sequence 
           same sequence assigned to CYP72A208 when genome named
           CYP72A208 is in many databases so keep the CYP72A208 name

CYP72A31P aaaa01009673.1 (indica cultivar-group) orth AP003278 $P chr 1 96%
CYP72A31P AP003278 $P chromosome 1, PAC clone:P0518F01, similar to 72A22 missing N-term half
AP003330.1 chromosome 1 clone B1085F01 CYP72A like
Pseudogene, no N-term in 9000bp upstream until next p450 ends near 22400
32390 APHTMVTLHPMHGAQMKVRAI 32452 or frameshift after KVR to 
Note there are two more P450s on AP003278 called a and b
CYP72A31P aaaa01035549.1 (indica cultivar-group) orth AP003278 $P chr 1
see aaaa01009673.1 for ortholog
CYP72A32 aaaa01013993.1 (indica cultivar-group) orth AP003278a $F chr 1 100%
CYP72A32 AP003278a $F 19863-22437 chromosome 1, PAC clone:P0518F01, similar to 72A22
AP003330.1 50023-47446 chromosome 1 clone B1085F01, CYP72A like 536aa
AP004738.1 Oryza sativa chromosome 6 clone OSJNBa0090D06 chrom. conflict
      VTMILYEVLR 47842
47481 MHGAQIKIRAI* 47446
CYP72A33 aaaa01003187.1a (indica cultivar-group) orth of AP003278b $F chr 1, 82% to 72A22
CYP72A33 aaaa01003187.1b (indica cultivar-group) orth of AP003278b $F chr 1, 82% to 72A22 these two seem identical only count once
CYP72A33 AP003278b $F chromosome 1, PAC clone:P0518F01, 82% to 72A22
AP003330.1 59493-56536 chromosome 1 clone B1085F01, CYP72A like 516aa
N-term does not match in both, 3278 has MVLGGGWLSMWAPASSPTILAAFGLVGLVLAWQ 
before the AGLQ seq.
note: there is one more gene on AP003278
CYP72A34 aaaa01009485.1 (indica cultivar-group) ortholog of AC119289.1 AQ916317.1
1624 RILNHAFHHEKIK 1662 (0?)
3125 SRLKI 3139 (0?)
CYP72A34 AC119289.1 $F (japonica cultivar-group) chromosome 5 clone
AQ916317.1 nbeb0063E04r CUGI Rice BAC genomicLength = 521 52% to 72A7
AQ871967.1 nbeb0045H22r CUGI Rice BAC genomicLength = 824
54887 HRRILNHAFHHEKIK (0) 54931
56394 SRLKI 56417 (0?)
CYP72A35 aaaa01001473.1 (indica cultivar-group) orth of AP002899 $F 99%
CYP72A35 AP002899 $F 52% to 72A14 = AQ161379
CYP72A36P aaaa01004480.1 (indica cultivar-group) ortholog of AP003142.2
7499 GMSIED 7482
CYP72A36P AP003142.2 $P chromosome 1, PAC clone:P0435H01 probable pseudogene 
53% to 72A15 86% to AP002899
5180 EVGMSIED 5157
1115 IIEECRLFYFAGSETTS 1065 frameshift
CYP72A37P aaaa01005990.1 (indica cultivar-group) orth of AP004019.1b
CYP72A37P AP004019.1b $P chromosome 2 clone OJ1118_C03 similar to CYP72A23 of rice Pseudogene fragment 2
37945 LSLMSLAFPTCNEELVWR*TE 37883 frameshift 
CYP72A38P AP004019.1a $P chromosome 2 clone OJ1118_C03 similar to CYP72A23 of rice Pseudogene fragment 1 no indica ortholog 9/7/02

CYP72A39   Hordeum vulgare (barley)
           Nguyen,L. and Henry,R.J.
           Expression of a P450 gene in barley (Hordeum vulgare)
           Barley Genet. Newsl. 36, 17-27 (2006)
           Submitted to nomenclature committee 11/11/2003
           Clone name 5e2
           72% identical to 72A21 from rice

CYP72A40   Sorghum bicolor
           No accession number
           Zhiqiang Pan
           Submitted to nomenclature committee 10/22/2004
           67% to 72A25 rice
           clone name 28V1

CYP72A41   Sorghum bicolor
           No accession number
           Zhiqiang Pan
           Submitted to nomenclature committee 10/22/2004
           73%% to 72A24 rice
           clone name 28C05, missing N-term about 130 aa

CYP72A42v1    Populus trichocarpa (Black cottonwood)
CYP72A42v2    Populus trichocarpa (Black cottonwood)
CYP72A42v3    Populus trichocarpa (Black cottonwood)
CYP72A42v4    Populus trichocarpa (Black cottonwood)
CYP72A42-de5b Populus trichocarpa (Black cottonwood)
CYP72A43      Populus trichocarpa (Black cottonwood) 
CYP72A44      Populus trichocarpa (Black cottonwood)
CYP72A44-de5b Populus trichocarpa (Black cottonwood)
CYP72A44-de5c Populus trichocarpa (Black cottonwood)
CYP72A44-de5d Populus trichocarpa (Black cottonwood)
CYP72A45P1    Populus trichocarpa (Black cottonwood)
CYP72A45P2    Populus trichocarpa (Black cottonwood)
CYP72A46P1    Populus trichocarpa (Black cottonwood)
CYP72A46P2    Populus trichocarpa (Black cottonwood)
CYP72A47      Populus trichocarpa (Black cottonwood)
CYP72A48P     Populus trichocarpa (Black cottonwood)
CYP72A49P     Populus trichocarpa (Black cottonwood)
CYP72A50P     Populus trichocarpa (Black cottonwood)

CYP72A51    Solanum lycopersicum (tomato)
            GenEMBL AI772781.1 AW034338.1 BI206030.1 BI923458.1 BW686237.1

CYP71A51   Solanum tuberosum (potato)

CYP72A52   Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D135-AE1
           84% to CYP72A51

CYP72A53v1 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D215-AB5
           96% to CYP72A52, 1 aa diff to CYP72A53v2

CYP72A53v2 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D105-AD6
           96% to CYP72A52, 1 aa diff to CYP72A53v1

CYP72A54   Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D134-AE11
           60% to 72A47 cottonwood

CYP72A55v1 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D210-BD4
           58% to CYP72A51, 2 aa diffs to CYP72A55v2

CYP72A55v2 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D87a-AF3
           58% to CYP72A51, 2 aa diffs to CYP72A55v1

CYP72A56   Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D136-AF4
           56% to 72A47 cottonwood

CYP72A57   Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D284-AH5
           65% to CYP72A55v1

CYP72A58   Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D283-AC1
           62% to 72A43 cottonwood

CYP72A59v1 Medicago truncatula
           GenEMBL DQ335783 GenPept ABC59078
           Li,L.Y. and Yu,D.Y.
           Comprehensive analysis of putative P450 genes superfamily in
           Glycine max and Medicago truncatula
           64% to 72A47, 63% to 72A43, 63% to 72A42, 63% to 72A58
           related to poplar and tobacco CYP72As

CYP72A59v2 Medicago truncatula (barrel medic)
           No accession umber
           Hikaru Seki
           Submitted to the nomenclature committee April 19, 2010
           Seq. 1 
           98% to CYP72A59v1

CYP72A60   Stevia rebaudiana (Stevia)
           No accession number
           James Brandle
           58% to 72A58, 58% to 72A51, 57% to 72A54
           57% to 72A59, related to poplar and tobacco CYP72As

CYP72A61v1  Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ335793 GenPept ABC59088

CYP72A61v2 Medicago truncatula (barrel medic)
           No accession umber
           Hikaru Seki
           Submitted to the nomenclature committee April 19, 2010
           Seq. 2 
           99% to CYP72A61v1

CYP72A61    Glycine max (soybeans, Fabales)
            ESTs BE020298, BM188387
            Li,L.Y. and Yu,D.Y.
            Comprehensive analysis of putative P450 genes superfamily in
            Glycine max and Medicago truncatula
            85% to 72A61 Medicago (probable ortholog) Called CYP72A67
            54% to 72A69
            JGI Glyma0 assembly scaffold_18

CYP72A62v1  Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ335811, AC150845.11c GenPept ABC59106, ABE87070

CYP72A62v2 Medicago truncatula (barrel medic)
           No accession umber
           Hikaru Seki
           Submitted to the nomenclature committee April 19, 2010
           Seq. 4 
           95% to CYP72A62v1

CYP72A63   Medicago truncatula (barrel medic)
           No accession umber
           Hikaru Seki
           Submitted to the nomenclature committee April 19, 2010
           Seq. 3 
           97% to CYP72A63P but this sequence is not a pseudogene

CYP72A63P   Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC150845.11b GenPept ABE87068

CYP72A64    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC150845.11a GenPept ABE87066

CYP72A65v1  Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ335784 GenPept ABC59079, ABE87064

CYP72A65v2 Medicago truncatula (barrel medic)
           No accession umber
           Hikaru Seki
           Submitted to the nomenclature committee April 19, 2010
           Seq. 5 
           98% to CYP72A65v1

CYP72A66    Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ335804 GenPept ABC59099

CYP72A67v1  Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ335780 GenPept ABC59075

CYP72A67v2 Medicago truncatula (barrel medic)
           No accession umber
           Hikaru Seki
           Submitted to the nomenclature committee April 19, 2010
           Seq. 6 
           99% to CYP72A67v1

CYP72A68v1  Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ335782 GenPept ABC59077

CYP72A68v2 Medicago truncatula (barrel medic)
           No accession umber
           Hikaru Seki
           Submitted to the nomenclature committee April 19, 2010
           Seq. 7 
           95% to CYP72A68v1

CYP72A69    Glycine max (soybeans, Fabales)
            DQ340242, ESTs BM885818, BM270061
            Li,L.Y. and Yu,D.Y.
            Comprehensive analysis of putative P450 genes superfamily in
            Glycine max and Medicago truncatula
            72% to 72A59, 68% to 72A66, Called CYP72A68
            cannot be sure of the ortholog

CYP72A70    Medicago truncatula (barrel medic, Fabales)
            CR955010.2b  Medicago truncatula chromosome 5
            CR317685, CR317663, 71% to 72A59
79326  LINPAFHSEKLK  79291
78355  NFDGLNNLKI  78326

CYP72A71v1   Lolium rigidum (ryegrass)
             Fischer,T.C., Klattig,J.T. and Gierl,A.
             A general cloning strategy for divergent plant cytochrome P450
             genes and its application in Lolium rigidum and Ocimum basilicum
             Theor. Appl. Genet. 103, 1014-1021 (2001)
             clone Lol-83 putative cytochrome P450 mRNA, complete
             78% to 72A18 (rice) 54% to 72A15 (Arabidopsis)
             2 aa diffs to CYP72A2, 5 aa diffs to 72A5

CYP72A71v2   Lolium rigidum (ryegrass)
             Fischer,T.C., Klattig,J.T. and Gierl,A.
             A general cloning strategy for divergent plant cytochrome P450
             genes and its application in Lolium rigidum and Ocimum basilicum
             Theor. Appl. Genet. 103, 1014-1021 (2001)
             clone Lol-79 putative cytochrome P450 mRNA, complete
             79% to 72A18 (rice), 2 aa diffs to 72A71v1, 5 aa diffs to 72A5

CYP72A71v3   Lolium rigidum (ryegrass)
             Fischer,T.C., Klattig,J.T. and Gierl,A.
             A general cloning strategy for divergent plant cytochrome P450
             genes and its application in Lolium rigidum and Ocimum basilicum
             Theor. Appl. Genet. 103, 1014-1021 (2001)
             clone Lol-22 putative cytochrome P450 mRNA, complete
             78% to 72A18 (rice), 5 diffs to 72A71v1, 5 aa diffs to 72A71v2

CYP72A72v1   Lolium rigidum (ryegrass)
             Fischer,T.C., Klattig,J.T. and Gierl,A.
             A general cloning strategy for divergent plant cytochrome P450
             genes and its application in Lolium rigidum and Ocimum basilicum
             Theor. Appl. Genet. 103, 1014-1021 (2001)
             clone Lol-78 putative cytochrome P450 mRNA, complete
             78% to 72A18 (rice), 6 aa diffs to 72A72v2, 85% to 72A71v1, 72A71v2, 

CYP72A72v2   Lolium rigidum (ryegrass)
             Fischer,T.C., Klattig,J.T. and Gierl,A.
             A general cloning strategy for divergent plant cytochrome P450
             genes and its application in Lolium rigidum and Ocimum basilicum
             Theor. Appl. Genet. 103, 1014-1021 (2001)
             clone Lol-62 putative cytochrome P450 mRNA, complete
             77% to 72A18 (rice), 6 aa diffs to 72A72v1, 85% to 72A71v1, 72A71v2, 

CYP72A73   Carica papaya
           57% to 72A15

CYP72A74   Carica papaya
           GS_ORF_92_from_ supercontig_77 
           57% to 72A15 

CYP72A75   Carica papaya
           GS_ORF_93_from_supercontig_77  = C-term part
           59% to 72A10

CYP72A76P  Carica papaya
           stop codon and a large seq gap inside this gene
           probable pseudogene
           overlaps GS_ORF_94 but more complete
           frameshift after NEVMS
           54% to 72A7 gap near N-term

CYP72A77P  Carica papaya
           supercontig_77:977190,976771 (-) strand
           73% to CYP72A76P, 47% to CYP72C2

CYP72A78P  Carica papaya
           supercontig_77:983015,980848 (-) strand
           81% to 72A81, 54% to 72C2

CYP72A79   Carica papaya
           GS_ORF_98 from_supercontig_77 gene 4 in this ORF 
           59% to 72A7

CYP72A80P  Carica papaya
           GS_ORF_98 from_supercontig_77  gene 3 in this ORF
           possible pseudogene several frameshifts and a stop codon
           52% to 72A7 

CYP72A81   Carica papaya
           GS_ORF_98 from_supercontig_77  gene 2 in this ORF
           58% to 72A7 

CYP72A82   Carica papaya
           GS_ORF_98 from_supercontig_77   gene 1 in this ORF
           57% to 72A7 

CYP72A83   Carica papaya
           88% to 72A79, 
           N-term off the end of the contig

CYP72A84   Coptis japonica (Japanese goldthread, Ranunculales)
           Nobuhiro Ikezawa and Fumihiko Sato
           submitted to nomenclature committee 11/5/07
           clone name 3B08C04901
           60% to 72A58 tobacco

CYP72A85   Vitis vinifera
           See Vitis page for sequence

CYP72A86P  Vitis vinifera
           Also CAAP02000983.1 3aa diffs to CAAP02000598.1b
           See Vitis page for sequence

CYP72A86P-ie5b  Vitis vinifera
           See Vitis page for sequence

CYP72A87   Vitis vinifera
           Also CAN71061.1 2aa diffs to CAAP02000355.1a
           See Vitis page for sequence

CYP72A87-de1b   Vitis vinifera
           3 aa diffs to CAN67740.1
           See Vitis page for sequence

CYP72A88   Vitis vinifera
           97% to CAAP02000355.1d
           See Vitis page for sequence

CYP72A89   Vitis vinifera
           97% to CAAP02000355.1c
           See Vitis page for sequence

CYP72A90   Vitis vinifera
           95% to CAAP02000355.1d
           See Vitis page for sequence

CYP72A91P  Vitis vinifera
           52% to 72A15 95% to CAAP02000355.1c CYP72A88
           See Vitis page for sequence

CYP72A92   Vitis vinifera
           90% to CYP72A103 CAAP02002795.1
           See Vitis page for sequence

CYP72A93   Vitis vinifera
           62% to 72A15
           4 aa diffs to 72A92 CAAP02000149.1b
           See Vitis page for sequence

CYP72A94P  Vitis vinifera
           exon 4 only, 79% to 72A100P CAAP02001786.1
           See Vitis page for sequence

CYP72A95   Vitis vinifera
           same as CAN72247.1
           See Vitis page for sequence

CYP72A96   Vitis vinifera
           97% to 72A95 CAAP02000149.1d
           See Vitis page for sequence

CYP72A97P  Vitis vinifera
           94% to 72A95 CAAP02000149.1d
           See Vitis page for sequence

CYP72A97P-ie5b  Vitis vinifera
           3152 IMMIFHEVLKL 3120

CYP72A98   Vitis vinifera
           CAN63404.1, AM456876.2
           86% to CAAP02002686.1, 88% to CAAP02000149.1d
           See Vitis page for sequence

CYP72A99   Vitis vinifera
           CAAP02004338.1a, CAO16049.1
           See Vitis page for sequence

CYP72A100P  Vitis vinifera
           CAAP02004338.1b, CAAP02001786.1
           100% to CAO16050.1 = CU459449.1
           See Vitis page for sequence

CYP72A101PX  Vitis vinifera
           Merged with 72A100P

CYP72A102P  Vitis vinifera
           91% to 72A96 CAAP02000473.1
           See Vitis page for sequence

CYP72A103  Vitis vinifera
           CAAP02002795.1, CAO62605.1
           90% to 72A92 CAAP02000149.1a
           See Vitis page for sequence

CYP72A104P  Vitis vinifera
           CAN63796.1, AM469525.2
           5 aa diffs plus some errors to 72A103 CAAP02002795.1
           See Vitis page for sequence

CYP72A105  Vitis vinifera
           CAAP02002402.1a, CAN67452.1 (3 aa diffs)
           91% to 72A108 CAAP02004668.1
           See Vitis page for sequence

CYP72A106P  Vitis vinifera
           See Vitis page for sequence

CYP72A107  Vitis vinifera
           CAAP02002484.1, CAN72443.1, AM462621.1
           96% to 72A108 CAAP02004668.1
           See Vitis page for sequence

CYP72A108  Vitis vinifera
           CAAP02004668.1, CAN80407.1, CAO21263.1
           96% to 72A108 96% to 72A107 CAAP02002484.1
           See Vitis page for sequence

CYP72A109  Vitis vinifera
           6 aa diffs to 72A113 CAAP02003454.1
           See Vitis page for sequence

CYP72A110  Vitis vinifera
           6 aa diffs to 72A109 CAAP02001850.1
           See Vitis page for sequence

CYP72A111P  Vitis vinifera
           96% to 72A113 CAAP02003454.1
           See Vitis page for sequence

CYP72A112P  Vitis vinifera
           See Vitis page for sequence

CYP72A113  Vitis vinifera
           91% to 72A90 CAN67740.1
           See Vitis page for sequence

CYP72A114P  Vitis vinifera
           7 aa diffs to 72A113 CAAP02003454.1
           See Vitis page for sequence

CYP72A115P  Vitis vinifera
           See Vitis page for sequence

CYP72A116P  Vitis vinifera
           See Vitis page for sequence

CYP72A117P  Vitis vinifera
           See Vitis page for sequence

CYP72A118P  Vitis vinifera
           See Vitis page for sequence

CYP72A119P  Vitis vinifera
           CAN67214.1, AM437669.2
           CAAP02003489.1 (4 aa diffs)
           See Vitis page for sequence

CYP72A120   Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 9/26/2008
            Clone A14, C50 
            61% to 72A59, 81% to 72A121

CYP72A121   Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 9/26/2008
            Clone A16 
            62% to 72A59, 81% to 72A120

CYP72A122   Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee March 31, 2009
            Clone name BP15
            79% to CYP72A20 rice
            missing approx. 88 amino acids at the N-terminal

CYP72A123  Zea mays (maize)
           76% to 72A21 

CYP72A124  Zea mays (maize)
           68% to 72A25

CYP72A125P  Glycine max (soybean, Fabales)

CYP72A126   Glycine max (soybean, Fabales)

CYP72A127   Glycine max (soybean, Fabales)

CYP72A128   Glycine max (soybean, Fabales)

CYP72A129P  Glycine max (soybean, Fabales)

CYP72A130P  Glycine max (soybean, Fabales)

CYP72A131P  Glycine max (soybean, Fabales)

CYP72A132P  Glycine max (soybean, Fabales)

CYP72A133P  Glycine max (soybean, Fabales)

CYP72A134P  Glycine max (soybean, Fabales)

CYP72A135   Glycine max (soybean, Fabales)

CYP72A136   Glycine max (soybean, Fabales)

CYP72A137P  Glycine max (soybean, Fabales)

CYP72A138P  Glycine max (soybean, Fabales)

CYP72A139P  Glycine max (soybean, Fabales)

CYP72A140P  Glycine max (soybean, Fabales)

CYP72A141   Glycine max (soybean, Fabales)

CYP72A142   Glycine max (soybean, Fabales)

CYP72A143P  Glycine max (soybean, Fabales)

CYP72A144P  Glycine max (soybean, Fabales)

CYP72A145P  Glycine max (soybean, Fabales)

CYP72A146P  Glycine max (soybean, Fabales)

CYP72A147P  Glycine max (soybean, Fabales)

CYP72A148   Glycine max (soybean, Fabales)

CYP72A149P  Glycine max (soybean, Fabales)

CYP72A150P  Glycine max (soybean, Fabales)

CYP72A151   Glycine max (soybean, Fabales)

CYP72A152  Lotus japonicus
           No accession umber
           Hikaru Seki
           Submitted to the nomenclature committee April 19, 2010
           Seq. 9 
           65% to CYP72A65

CYP72A153  Glycyrrhiza echinata (licorice, Fabales)
           No accession umber
           Hikaru Seki
           Submitted to the nomenclature committee April 19, 2010
           Seq. 10 
           79% to CYP72A59

CYP72A154  Glycyrrhiza echinata (licorice, Fabales)
           No accession umber
           Hikaru Seki
           Submitted to the nomenclature committee April 19, 2010
           Seq. 11 
           75% to CYP72A64

CYP72A155  Glycyrrhiza echinata (licorice, Fabales)
           No accession umber
           Hikaru Seki
           Submitted to the nomenclature committee April 19, 2010
           Seq. 12 
           81% to CYP72A61

CYP72A156  Brachypodium distachyon (temperate grass) P450s
CYP72A157  Brachypodium distachyon (temperate grass) P450s
CYP72A158  Brachypodium distachyon (temperate grass) P450s
CYP72A159P Brachypodium distachyon (temperate grass) P450s
CYP72A160  Brachypodium distachyon (temperate grass) P450s
CYP72A161  Brachypodium distachyon (temperate grass) P450s
CYP72A162  Brachypodium distachyon (temperate grass) P450s
CYP72A163  Brachypodium distachyon (temperate grass) P450s
CYP72A164  Brachypodium distachyon (temperate grass) P450s
CYP72A165  Brachypodium distachyon (temperate grass) P450s
CYP72A166  Brachypodium distachyon (temperate grass) P450s
CYP72A167  Brachypodium distachyon (temperate grass) P450s
CYP72A168  Brachypodium distachyon (temperate grass) P450s
CYP72A169  Brachypodium distachyon (temperate grass) P450s
CYP72A170  Brachypodium distachyon (temperate grass) P450s

CYP72A171   Solanum lycopersicum (tomato)
CYP72A171   Solanum tuberosum  (potato, Solanales)
CYP72A172   Solanum lycopersicum (tomato)
CYP72A172   Solanum tuberosum  (potato, Solanales)
CYP72A172-de1b2b  Solanum tuberosum  (potato, Solanales)
CYP72A172-de1c2c  Solanum tuberosum  (potato, Solanales)
CYP72A173   Solanum lycopersicum (tomato)
CYP72A173   Solanum tuberosum  (potato, Solanales)
CYP72A174   Solanum lycopersicum (tomato)
CYP72A174P  Solanum tuberosum  (potato, Solanales)
CYP72A175P  Solanum lycopersicum (tomato)
CYP72A175P  Solanum tuberosum  (potato, Solanales)
CYP72A175-de1b  Solanum tuberosum  (potato, Solanales)
CYP72A176   Solanum lycopersicum (tomato)
CYP72A176aP Solanum tuberosum  (potato, Solanales)
CYP72A176bP Solanum tuberosum  (potato, Solanales)
CYP72A176cP Solanum tuberosum  (potato, Solanales)
CYP72A177   Solanum lycopersicum (tomato)
CYP72A177   Solanum tuberosum  (potato, Solanales)
CYP72A178   Solanum lycopersicum (tomato)
CYP72A178   Solanum tuberosum  (potato, Solanales)
CYP72A179   Solanum lycopersicum (tomato)
CYP72A179   Solanum tuberosum  (potato, Solanales)
CYP72A180a  Solanum lycopersicum (tomato)
CYP72A180bP Solanum lycopersicum (tomato)
CYP72A180   Solanum tuberosum  (potato, Solanales)
CYP72A181   Solanum lycopersicum (tomato)
CYP72A181   Solanum tuberosum  (potato, Solanales)
CYP72A182   Solanum lycopersicum (tomato)
CYP72A182   Solanum tuberosum  (potato, Solanales)
CYP72A182-ie1b  Solanum tuberosum  (potato, Solanales)
CYP72A183   Solanum lycopersicum (tomato)
CYP72A183   Solanum tuberosum  (potato, Solanales)
CYP72A184   Solanum lycopersicum (tomato)
CYP72A184-de1b  Solanum lycopersicum (tomato)
CYP72A184a  Solanum tuberosum  (potato, Solanales)
CYP72A184b  Solanum tuberosum  (potato, Solanales)
CYP72A185   Solanum lycopersicum (tomato)
CYP72A185   Solanum tuberosum  (potato, Solanales)
CYP72A186   Solanum lycopersicum (tomato)
CYP72A186   Solanum tuberosum  (potato, Solanales)
CYP72A187   Solanum lycopersicum (tomato)
CYP72A187   Solanum tuberosum  (potato, Solanales)
CYP72A188   Solanum lycopersicum (tomato)
CYP72A188   Solanum tuberosum  (potato, Solanales)
CYP72A189P  Solanum lycopersicum (tomato)
CYP72A189   Solanum tuberosum  (potato, Solanales)
CYP72A190   Solanum lycopersicum (tomato)
CYP72A190   Solanum tuberosum  (potato, Solanales)
CYP72A191P  Solanum lycopersicum (tomato)
CYP72A191P  Solanum tuberosum  (potato, Solanales)
CYP72A192P  Solanum lycopersicum (tomato)
CYP72A192P  Solanum tuberosum  (potato, Solanales)
CYP72A193   Solanum lycopersicum (tomato)
CYP72A193-de5b   Solanum lycopersicum (tomato)
CYP72A193   Solanum tuberosum  (potato, Solanales)
CYP72A193-de1b   Solanum tuberosum  (potato, Solanales)
CYP72A194   Solanum lycopersicum (tomato)
CYP72A194a  Solanum tuberosum  (potato, Solanales)
CYP72A194a-de1b  Solanum tuberosum  (potato, Solanales)
CYP72A194Pb Solanum tuberosum  (potato, Solanales)
CYP72A195   Solanum lycopersicum (tomato)
CYP72A195Pa Solanum tuberosum  (potato, Solanales)
CYP72A195b  Solanum tuberosum  (potato, Solanales)
CYP72A197P  Solanum lycopersicum (tomato)
CYP72A198   Solanum lycopersicum (tomato)
CYP72A199P  Solanum lycopersicum (tomato)
CYP72A200P  Solanum lycopersicum (tomato)
CYP72A201P  Solanum lycopersicum (tomato)
CYP72A202P  Solanum lycopersicum (tomato)
CYP72A203P  Solanum lycopersicum (tomato)
CYP72A204P  Solanum lycopersicum (tomato)
CYP72A204   Solanum tuberosum  (potato, Solanales)
CYP72A205P  Solanum lycopersicum (tomato)
CYP72A206P  Solanum lycopersicum (tomato)
CYP72A207P  Solanum lycopersicum (tomato)
CYP72A208   Solanum lycopersicum (tomato) formerly CYP72A30
            This sequence was double named but CYP72A208 is used in 
            the tomato database and submitted to GenBank as CYP72A208
CYP72A208a  Solanum tuberosum  (potato, Solanales)
CYP72A208b  Solanum tuberosum  (potato, Solanales)
CYP72A209   Solanum tuberosum  (potato, Solanales)
CYP72A209-de1b2b   Solanum tuberosum  (potato, Solanales)
CYP72A209-de1c   Solanum tuberosum  (potato, Solanales)
CYP72A210P  Solanum tuberosum  (potato, Solanales)
CYP72A211P  Solanum tuberosum  (potato, Solanales)
CYP72A212P  Solanum tuberosum  (potato, Solanales)
CYP72A213   Solanum tuberosum  (potato, Solanales)
CYP72A214P  Solanum tuberosum  (potato, Solanales)
CYP72A215   Solanum tuberosum  (potato, Solanales)
CYP72A215-de4b   Solanum tuberosum  (potato, Solanales)
CYP72A216P  Solanum tuberosum  (potato, Solanales)
CYP72A217   Solanum tuberosum  (potato, Solanales)
CYP72A218P  Solanum tuberosum  (potato, Solanales)
CYP72A218-de1b  Solanum tuberosum  (potato, Solanales)

CYP72A219  Panax ginseng (Apiales)
           No accession number
           Yong Eui Choi
           Submitted to nomenclature committee August 12, 2011
           63% to CYP72A186 tomato

CYP72A220  Panax ginseng (Apiales)
           No accession number
           Yong Eui Choi
           Submitted to nomenclature committee August 14, 2011
           91% to CYP72A219  Panax

CYP72A221  Panax ginseng (Apiales)
           No accession number
           Yong Eui Choi
           Submitted to nomenclature committee August 14, 2011
           92% to CYP72A220  Panax

CYP72A222   Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            72% TO CYP72A7   Arabidopsis thaliana
            70% to CYP72A219 Panax

CYP72A223   Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            54% to CYP72A1v1 Catharanthus roseus
            58% to CYP72A219 Panax

CYP72A224  Catharanthus roseus
           No accession umber
           Daniele Werck Reichhart
           submitted to nomenclature committee Feb. 20, 2012
           57% to CYP72A47 Populus trichocarpa

CYP72A225  Catharanthus roseus
           No accession umber
           Daniele Werck Reichhart
           submitted to nomenclature committee Feb. 20, 2012
           63% to CYP72A54 Nicotiana tabacum

CYP72A226-CYP72A251 confidential genome project

CYP72A252v1 Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Feb. 25, 2011
            Clone name Ep7 and Ep27
            94% to CYP72A160 Brachypodium distachyon, 
CYP72A252v2 Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Feb. 25, 2011
            Clone name Ep28
            97% to CYP72A252v1 probable allele
CYP72A253v1 Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Feb. 25, 2011
            Clone name Ep3
            83% to CYP72A170 Brachypodium distachyon, 
            81% to CYP72A25 rice, 72% to CYP72A252v1 Echinochloa phyllopogon
CYP72A253v2 Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Feb. 25, 2011
            Clone name Ep8
            98% to CYP72A253v1, probable allele
CYP72A254v1 Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Feb. 25, 2011
            Clone name Ep12
            75% to CYP72A161 Brachypodium distachyon, 
            77% to CYP72A21 rice, 96% to CYP72A254v2 Echinochloa phyllopogon
CYP72A254v2 Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Feb. 25, 2011
            Clone name Ep26
            96% to CYP72A254v1, possible allele
CYP72A255   Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee May 9, 2012
            Clone name Ep7.1
            100% to CYP72A252v1 Ep7 C-term fragment
            note: Ep7 is 100% to both CYP72A252v1 and CYP72A255 C-terms
            86% to CYP72A252v1 Ep27 (whole seq)
            86% to CYP72A252v2 Ep28 (whole seq)
CYP72A256v1 Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee May 9, 2012
            Clone name GA-CYP3-1
            97% to CYP72A256v2 
            79% to CYP72A254v1, 68% to CYP72A252v1, 69% to CYP72A122
            71% to CYP72A253v1 Ep3 partial seq	.

CYP72A256v2 Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee May 9, 2012
            Clone name GA-CYP3-2
            97% to CYP72A256v1 

CYP72A257   Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee May 9, 2012
            Clone name GA-CYP1
            65% to Ep33 CYP72A2558v1, 64% to CYP72A252v1 Ep27 

CYP72A258v1 Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee May 9, 2012
            Clone name Ep33
            97% to Ep34 CYP72A2558v2

CYP72A258v2 Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee May 9, 2012
            Clone name Ep34
            97% to Ep33 CYP72A2558v1, 65% to CYP72A122

CYP72A259  Ricinus communis (castor bean, Malpighilaes, Euphorbia)

CYP72A260  Ricinus communis (castor bean, Malpighilaes, Euphorbia)

CYP72A261  Ricinus communis (castor bean, Malpighilaes, Euphorbia)

CYP72A262  Brassica rapa
           On A03 17063206-17065604 (+) strand
           Bra001560, part of a 5 P450 gene cluster 1560-1564
           83% to CYP72A9 Arab.

CYP72A263P Brassica rapa
           On A03 17066833-17068559 (+) strand pseudogene
           Bra001561, part of a 5 P450 gene cluster 1560-1564

CYP72A264  Brassica rapa
           On A03 17069184-17071393 (+) strand
           Bra001562, part of a 5 P450 gene cluster 1560-1564
           81% to CYP72A15 Arab.

CYP72A265P Brassica rapa
           On A03 17072475-17074386 (+) strand pseudogene
           Bra001563, part of a 5 P450 gene cluster 1560-1564
           83% to CYP72A15 Arab.

CYP72A266P Brassica rapa
           On A03 17075160-17076721 (+) strand pseudogene
           Bra001564, part of a 5 P450 gene cluster 1560-1564

CYP72A     Ginkgo biloba
           GenEMBL CB094620
           64% to 72A34 61% to 72A5 58% to CYP72A9

CYP72     Amborella
          48% to 72A13 N-term

CYP72A    Amborella trichopoda
          GenEMBL CK756723
          62% to 72A20

CYP72A    Mesembryanthemum crystallinum (ice plant, Caryophyllales)
          BM301419.1 BM301495.1 78% to 72A18 rice C-term

CYP72     Cucumis sativus (Cucumber, Cucurbitales)
          57% to 72A59 Medicago truncatula, 49% to 72A15 

CYP72A      Malus x domestica (apple, Rosales)
            GenEMBL CO865723.1  EST
            65% to CYP72A51

CYP72A    Ipomoea nil (Solanales)
          Note: not the APETALA2B gene but adjacent 
          53% to 72A1v1 N-term

CYP72A      Persea americana (avocado, Laurales)
            CV000587.1 CV458039.1
            67% to 72A33

CYP72A     Persea americana (avocado, Laurales)
           GenEMBL CK748493.1
           55% to 72A9

CYP72      Citrus sinensis (Sapindales)
           57% to 72A51 

CYP72A    Citrus sinensis (Sapindales)
          71% to 72A14

CYP72A     Gossypium hirsutum (upland cotton, Malvales)
           58% to 72A51

CYP72       Casuarina glauca (swamp oak, Fagales)
            55% to 72A67, 47% TO 72A14, 50% TO 72A19

CYP72       Fagus sylvatica (beech tree, Fagales)
            51% TO 72A25, 53% to 72A28

CYP72       Taraxacum officinale (dandelion, Asterales)
            58% to 72A15

CYP72      Aquilegia formosa x Aquilegia Pubescens (Ranunculales)
           62% to 72A14

CYP72      Ocimum basilicum (sweet basil, Lamiales)
           63% to 72A15

CYP72      Mesembryanthemum crystallinum (Ice plant, Caryophyllales)
           61% to 72A15

CYP72     Aegiceras corniculatum (Ericales)
          56% to 72A15

CYP72      Panax ginseng (ginseng, Apilaes)
           52% to 72A11 (mid region)

CYP72      Ceratopteris richardii (fern)
           GenEMBL CV735871 EST
           45% to 72A18

CYP72 frag. Avicennia marina (Lamiales)
            Parani,M., Mehta,P., Sivaprakash,K.R. and Parida,A.
            Expressed sequence tags from the mangrove species Avicennia marina
            Unpublished (2000)
            47% to 72A59

CYP72 frag. Taraxacum officinale (dandylion, Asterales)
            Isolation and characterization of candidate genes for pathogen and
            herbivory defense in common dandelion (Taraxacum officinale) upon
            salicylic acid or methyl jasmonate treatment
            60% to 72A14

CYP72A      Eucalyptus gunnii (Myrtales)
            CU402955.1 74% to 72A7

CYP72 frag. Eustoma grandiflorum  (Gentianales)
            Li,Y.H., Wang,J.G. and Zhang,K.
            Eustoma grandiflorum putative cytochrome P450 gene
            68% to 72A13 C-term

CYP72clan    Adiantum capillus-veneris (fern)
             GenEMBL BP918676 EST
             52% to 72A7, 55% to 709C9 

72B Subfamily

CYP72B1X    Arabidopsis thaliana ESTs
            GenEMBL AC003105
            42% identical to C. roseus 72A1
            ESTs T04442
            This sequence renamed CYP734A1 based on new
            sequences from rice and other species 
            see tree of the CYP72 clan

CYP72B2X    Arabidopsis thaliana ESTs
            GenEMBL B96503 (661bp)
            C-terminal PERF region to end
            This sequence is actually part of CYP714A1

CYP72C1    Arabidopsis thaliana
           GenEMBL AC007651 88180-91153
           45% identical to 72A9

CYP72C2    Carica papaya
           supercontig_77:897282..899560 (- ) strand)
           56% to 72C1
           N-term in a seq gap

CYP72C3    Carica papaya
           69% to 72C2
           C-term in a seq gap

CYP72C4P   Carica papaya
           supercontig_77:914334,914218 (-) strand
           84% to CYP72C2

CYP72D1    Populus trichocarpa (Black cottonwood) 
CYP72D2    Populus trichocarpa (Black cottonwood) 

CYP72D3    Vitis vinifera
           CAN60851.1, CAAP02015403.1
           See Vitis page for sequence

CYP72D4    Vitis vinifera
           CAN60852.1, AM443849.2
           CAAP02006515.1b 5359-7817 adjacent to 72D3 CAN60851
           See Vitis page for sequence

CYP72D5    Vitis vinifera
           CAAP02007230.1, CAO41622.1
           87% to 72D3 CAN60851
           See Vitis page for sequence

CYP72D6    Vitis vinifera
           CAAP02003169.1, CAN65255.1
           75% to 72D5 CAAP02007230.1
           See Vitis page for sequence

CYP72D7P   Vitis vinifera
           See Vitis page for sequence

CYP72D8    Solanum lycopersicum (tomato)
CYP72D8    Solanum tuberosum  (potato, Solanales)

CYP72clan   Selaginella moellendorffii
            50% to 72A13, 48% to 709C8
            = CYP779E6v2

73A Subfamily

CYP73A1     Helianthus tuberosus (Jerusalem artichoke) cinnamate 4-hydroxylase
            GenEMBL Z17369 (1620bp) Swiss Q04468 (505 amino acids)
            PIR S28495 A47454 (505 amino acids)
            Teutsch,H.G., Hasenfratz,M.P., Lesot,A., Stoltz,C., Garnier,J.-M.,
            Jeltsch,J.-M., Durst,F. and Werck-Reichhart,D.
            Isolation and sequence of a cDNA encoding the Jerusalem
            artichoke cinnamate 4-hydroxylase, a major plant cytochrome P450
            involved in the general phenylpropanoid pathway.
            Proc. Natl. Acad. Sci. USA 90, 4102-4106 (1993)

CYP73A2     Phaseolus aureus (mung bean) PIR listing has Vigna radiata (mung bean)
            GenEMBL L07634 (1766bp) PIR JC1458 (501 amino acids)
            PIR PC1238 (74 amino acids)
            Mizutani,M., Ward,E.R., DiMaio,J., Ryals,J.A., Ohta,D.
            and Sato,R.
            Molecular cloning and sequencing of a cDNA encoding
            mung bean cytochrome P450 (P450C4H) possessing cinnamate
            4-hydroxylase activity.
            Biochem. Biophys. Res. Commun. 190, 875-880 (1993)

CYP73A3     Medicago sativa (alfalfa) cinnamate 4-hydroxylase
            GenEMBL L11046 (1744bp) PIR S36878 (506 amino acids)
            Fahrendorf,T. and Dixon,R.A.
            Molecular cloning of the elicitor-inducible cinnamic acid
            4-hydroxylase cytochrome P450 from alfalfa.
            Arch. Biochem. Biophys. 305, 509-515 (1993)

CYP73A3     Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ335792 GenPept ABC59087, ABE94136
            ortholog to M. sativa 73A3

CYP73A4     Catharanthus roseus (Madagascar periwinkle) PCR fragment
            GenEMBL X69788 (321bp)
            Meijer,A.H., Souer,E., Verpoorte,R. and Hoge,J.H.C.
            Isolation of cytochrome P-450 cDNA clones from the higher plant
            Catharanthus roseus by a PCR strategy.
            Plant Molec. Biol. 22, 379-383 (1993)
            Note: sequence 16 from Fig. 2.

CYP73A4     Catharanthus roseus (Madagascar periwinkle) 
            GenEMBL Z32563 (1713 bp) 
            Hotze,M., Schroeder, G. and Schroeder,J.:  
            Cinnamate 4-hydroxylase from Catharanthus roseus, 
            and a  strategy for the functional expression of 
            plant cytochrome P450 proteins as translational 
            fusions with P450 reductase in Escherichia coli. 
            FEBS Letters 374, 345-350 (1995) 

CYP73A5     Arabidopsis thaliana
            GenEMBL U71080 (5432bp) U71081 (1727bp)
            Bell-Lelong, D.A., Cusamano, J.C., Meyer, K. and Chapple, C.C.
            Cinnamate-4-hydroxylase expression in Arabidopsis.  Regulation
            in response to development and the environment.
            Plant Physiol. 113, 729-738 (1997)

CYP73A5     Arabidopsis thaliana
            GenEMBL U93215

CYP73A5     Arabidopsis thaliana
            GenEMBL U37235
            Mignotte-Vieux,C., Kazmaier,M., Urban,P. and Pompon,D.
            unpublished (1999)

CYP73A5     Arabidopsis thaliana
            GenEMBL D78596 (1711bp, 505 amino acids) also D78597 partial seq.
            Mizutani,M., Ohta,D. and Sato,R.
            Isolation of a cDNA and a genomic clone encoding cinnamate
            4-hydroxylase from Arabidopsis and its expression manner in planta
            Plant Physiol. 113, 755-763 (1997)

CYP73A5     Arabidopsis thaliana EST
            GenEMBL T04086 (480bp) F19837 
            C-terminal fragment
CYP73A6     Zea mays
            EE031751.1, BZ547039.1, CG099721.1, CG099722.1, CG236087.1
            Sharon Potter
            sequence e
            submitted to nomenclature committee 4/21/94
            74% to 73A7, 64% to 73A8

CYP73A7     Zea mays
            Sharon Potter
            sequence c
            submitted to nomenclature committee 6/8/94
            ESTs AI666136 AW519858.1 BG320001.1 BE639176.1
            php20835.x3.b an STS from the CSHL STS Maize Database    
            AY104175.1 includes N-term

CYP73A8     Zea mays
            CC342001.1, CC344748.1, BZ991564.1, CC726385.1
            Sharon Potter
            sequence f
            submitted to nomenclature committee 6/4/94
           (5 aa diffs from original submission)

CYP73A9      Pisum sativum (pea)
             GenEMBL U29243 (1715bp)
             Frank,M.R., Deyneka,J.M. and Schuler,M.A.
             Cloning of phenylpropanoid pathway P450 monooxygenases expressed in
             Pisum sativum.

CYP73A9v1   Pisum sativum
            Whitbred,J.M. and Schuler,M.A.
            Molecular characterization of CYP73A9 and CYP82A1 P450 genes
            involved in plant defense in pea
            Plant Physiol. 124 (1), 47-58 (2000)
            trans-cinnamic acid hydroxylase
            84% to 73A5

CYP73A9v2   Pisum sativum
            Whitbred,J.M. and Schuler,M.A.
            Molecular characterization of CYP73A9 and CYP82A1 P450 genes
            involved in plant defense in pea
            Plant Physiol. 124 (1), 47-58 (2000)
            trans-cinnamic acid hydroxylase
            85% to 73A5

CYP73Av3    Pisum sativum
            Whitbred,J.M. and Schuler,M.A.
            Molecular characterization of CYP73A9 and CYP82A1 P450 genes
            involved in plant defense in pea
            Plant Physiol. 124 (1), 47-58 (2000)
            trans-cinnamic acid hydroxylase
            84% to 73A5

CYP73A10    Petroselinum crispum (parsley, Apiales)
            GenEMBL L38898 (1801bp)
            Logemann,E., Parniske,M. and Hahlbrock,K.
            Modes of expression and common structural features of the complete
            phenylalanine ammonia-lyase gene family in parsley
            Proc. Natl. Acad. Sci. U.S.A. 92, 5905-5909 (1995)
            sequence sent by Edda Koopmann

CYP73A11    Glycine max (soybean, Fabales)
            GenEMBL X92437 (1787bp)
            Schopfer,C.R. and Ebel,J.
            Identification of elicitor-induced cytochrome P450s of soybean
            (Glycine max L.) using differential display of mRNA
            Mol. Gen. Genet. 258, 315-322 (1998)

CYP73A12    Zinnia elegans
            GenEMBL U19922 (1648bp)
            Ye, E. and Varner, J.E. 
            Expression patterns of cinnamic acid 4-hydroxylase gene during lignification
            in Zinnia. 

CYP73A13    Populus tremuloides (quaking aspen)
            GenEMBL U47293 (1803bp)
            Ge,L. and Chiang,V.L.
            A full length cDNA encoding trans-cinnamate 4-hydroxylase from developing 
            xylem of Populus tremuloides 
            Plant Physiol. 112, 861 (1996)

CYP73A14    Glycyrrhiza echinata (licorice, Fabales)
            GenEMBL D87520
            Akashi,T., Aoki, T., Takahashi,T., Kameya,N., Nakamura, I. and Ayabe, S.
            Cloning of cytochrome P450 cDNAs from cultured Glycyrrhiza echinata L. cells 
            and their transcriptional activation by elicitor treatment.
            Plant Science 126, 39-47 (1997)

CYP73A14v1  Glycyrrhiza echinata (licorice)
            GenEMBL D89430
            Akashi,T., Aoki, T., Takahashi,T., Kameya,N., Nakamura, I. and Ayabe, S.
            Cloning of cytochrome P450 cDNAs from cultured Glycyrrhiza echinata L. cells 
            and their transcriptional activation by elicitor treatment.
            Plant Science 126, 39-47 (1997)
            C-terminal PCR fragment with 4/82 amino acid differences to 73A14

CYP73A15    Phaseolus vulgaris (french bean)
            Y09447 (1799bp) Y09448 (2280bp) Y09449 (1065bp)
            Jupe,S.C., Werck-Reichhart,D. and Bolwell,G.P.
            Molecular cloning of a novel CYP73 from French bean: induction by
            elicitor and during xylogenesis.

CYP73A16    Populus kitakamiensis (hybrid aspen)
            GenEMBL D82815(1737bp) mRNA
            GenEMBL D82814(2923bp) partial gene sequence
            GenEMBL D82812, D82813, D82814 closely related genes
            Kawai S, Mori A, Shiokawa T, Kajita S, Katayama Y, Morohoshi N.  
            Isolation and analysis of cinnamic acid 4-hydroxylase homologous genes from a 
            hybrid aspen, Populus kitakamiensis.  
            Biosci Biotech Biochem. 60, 1586-97

CYP73A17    Triticum aestivum (wheat)
            no accession number 
            Francis Durst
            submitted to nomenclature committee

CYP73A17    Triticum aestivum (wheat) 
            GenEMBL AF123608
            Batard,Y., Hehn,A., Nedelkina,S., Schalk,M., Pallett,K.,
            Schaller,H. and Werck-Reichhart,D.
            Increasing expression of P450 and P450-reductase proteins from
            monocots in heterologous systems
            Arch. Biochem. Biophys. 379 (1), 161-169 (2000)

CYP73A18    Solanum lycopersicum (tomato)
            GenEMBL Z70216 PCR fragment (202bp)
            this sequence differs from 73A24, but this might be due to errors
            there are no other ESTs that match this PCR fragment.

CYP73A19    Cicer arietinum (chickpea)
            GenEMBL AJ007449
            Overkamp, S. and W. Barz, W.  Isolation of a Full Length cDNA Encoding 
            Trans-Cinnamate 4-Hydroxylase (Accession No. AJ007449) from Chickpea (Cicer 
            arietinum L.). (PGR99-086) Plant Physiol. 120, 635 (1999)
            91% identical to Medicago sativa CYP73A3

CYP73A20    Pinus taeda (loblolly pine)
            GenEMBL AF096998
            Anterola,A.M., Jeon,J.H., Davin,L.B. and Lewis,N.G.
            Pinus taeda mRNA for trans-cinnamate 4-hydroxylase (PTC4H) is
            induced in cell suspension cultures by 8% sucrose/20mM KI treatment

CYP73A21    Capsicum chinense (habanero chile)
            GenEMBL AF088847
            Curry,J. and O'Connell,M.A.
            Cinnamic acid 4-hydroxylase from habanero chile

CYP73A22     Mesembryanthemum crystallinum (Caryophyllales)
             GenEMBL AF097664
             Michalowski,C.B. and Bohnert,H.J.
             cinnamate 4-hydroxylase mRNA from the common ice plant

CYP73A23    Pinus taeda
            GenEMBL AI812813, AA556941, AI812771, AI812842, AI919827
            sequence made from ESTs only
            missing 160 amino acids at N-terminal
            81% to 73A20 and many other 73A sequences

CYP73A24  Solanum lycopersicum (tomato)
           GenEMBL ESTs only
AI484139  EST248946 cLER1C5
AI894646  EST264089 cLEC4L12
AI490789  EST241497 cLEB3H9
AI774477  EST255577 cLER12O4
AI895653  EST265096 cLEC9O20
AI484136  EST248943 cLER1C5
AI899232  EST268675 cLED37P6
AI490786  EST241494 cLEB3H9
AI774140  EST255240 cLER10B24
AI773934  EST255034 cLER8N1
AI487946  EST246268 cLED19L20
AI484879  EST243140 cLED3A21
AI894393  EST263848 cLEC4G23
AI895830  EST265273 cLEC10A6
AI895463  EST264906 cLEC7J20


CYP73A24c   Solanum tuberosum  (potato, Solanales)
CYP73A24dP  Solanum tuberosum  (potato, Solanales)

CYP73A25    Gossypium arboreum (cotton)
            GenEMBL AF286647
            Xiao-Ya Chen and Ping Luo
            Clone name LP89
            92% to 73A16

CYP73A26    Gossypium arboreum (cotton)
            GenEMBL AF286648
            Xiao-Ya Chen and Ping Luo
            Clone name LP125
            91% to 73A25

CYP73A27    Nicotiana tabacum (tobacco)
            GenEMBL AF368378
            Ralston L, Kwon ST, Schoenbeck M, Ralston J, Schenk DJ, Coates RM, 
            Chappell J.
            Cloning, heterologous expression, and functional characterization of
            5-epi-aristolochene-1,3-dihydroxylase from tobacco 
            (Nicotiana tabacum).
            Arch Biochem Biophys. 2001 Sep 15;393(2):222-35.
            Submitted to nomenclature committee Oct. 10, 2000
            67% to 73A22, 71% to 73A15, 72% to 73A29
            clone name cDNA 1

CYP73A28    Nicotiana tabacum (tobacco)
            GenEMBL AF368379
            Ralston L, Kwon ST, Schoenbeck M, Ralston J, Schenk DJ, Coates RM, 
            Chappell J.
            Cloning, heterologous expression, and functional characterization of
            5-epi-aristolochene-1,3-dihydroxylase from tobacco 
            (Nicotiana tabacum).
            Arch Biochem Biophys. 2001 Sep 15;393(2):222-35.
            Submitted to nomenclature committee Oct. 10, 2000
            95% to 73A27
            clone name cDNA 2

CYP73A29    Citrus sinensis 
            GenEMBL AF255013.1
            Betz,C., McCollum,T.G. and Mayer,R.T.
            Differential expression of two cinnamate 4-hydroxylase genes in
            cinnamate 4-hydroxylase (C4H1)
            72% to 73A27

CYP73A30    Lithospermum erythrorhizon (a Japanese medicinal plant)
            Yamamura,Y., Ogihara,Y. and Mizukami,H.
            Cinnamic acid 4-hydroxylase from Lithospermum erythrorhizon: cDNA
            cloning and gene expression
            Plant Cell Rep. 20, 655-662 (2001)
            Submitted to nomenclature committee Oct. 25, 2000
            Clone name LEC4H1 83% to 73A4, 91% identical to 73A31

CYP73A31    Lithospermum erythrorhizon (a Japanese medicinal plant)
            Yamamura,Y., Ogihara,Y. and Mizukami,H.
            Cinnamic acid 4-hydroxylase from Lithospermum erythrorhizon: cDNA
            cloning and gene expression
            Plant Cell Rep. 20, 655-662 (2001)
            Submitted to nomenclature committee Oct. 25, 2000
            Clone name LEC4H2 91% identical to 73A30

CYP73A32v1  Ruta graveolens (common rue, Sapindales)
            GenEMBL AJ309127
            Antoine Gravot
            Submitted to nomenclature committee 3/29/01
            87% to cotton CYP73A25

CYP73A32v2  Ruta graveolens (common rue, Sapindales)
            GenEMBL AF548370.1 
            cinnamate 4-hydroxylase (C4H)

CYP73A33    Sorghum bicolor
            Lauer,B., Nicholson,R. and Coolbaugh,R.
            Isolation of a C4H cDNA from Sorghum
            cinnamic acid 4-hydroxylase (C4H) mRNA, complete
            95% to 73A7, 90% to 73A17, 73% to 73A6, 61% to 73A8

CYP73A34    Hordeum vulgare (barley)
            Assembled from overlapping ESTs
            88% to 73A33, 87% to 73A7
BF620285.2 1-176 (no diffs) BE413007.1 49-282 (no diffs) BG367496 128-302 (no diffs)
AL504406.1 182-383 (no diffs) BE519761.2 245-401 (no diffs) BE412402.1 383-501 (no diffs)

CYP73A35P   Oryza sativa (rice) 
            GenEMBL AP003446.1 March 29, 2001
                    AP003302.1  Feb. 21, 2001
            Both sequences have the same frameshifts so
            This is probably a pseudogene

VYGDHWRKMRRIMTVPFFTGKVVQRHRAGWEAEAAAVVDGLRADPAAA 168 (25 nuc. deletion and frameshift in both sequences)
AIETTLWSMEWAIAEL (2 nuc. insertion and frameshift in both seqs.)

CYP73A35P   rice
            aaaa01004255.1 $PI (indica ) ortholog of 73A35P

CYP73A36    Citrus sinensis 
            GenEMBL AF255014.2
            Betz,C., McCollum,T.G. and Mayer,R.T.
            Differential expression of two cinnamate 4-hydroxylase 
            genes in Citrus
            88% to 73A1

CYP73A37    Citrus paradisi (Marsh Grapefruit)
            GenEMBL AF378333.1
            Legrum,W., McCollum,T.G., Doostdar,H., Shatters,R. and Mayer,R.T.
            Cinnamate 4-hydroxylase in Marsh grapefruit flavedo
            This sequence is 100% identical to 73A36 from aa 35 ITV to the end
            The N-terminal of 73A36 is conserved on other 73As but the 73A37 N-
            terminal is not conserved.  I suspect it is not processed correctly
            This may be the same gene as 73A36

CYP73A38    rice
            aaaa01002376.1 $FI (indica ) ortholog to AQ256364.1 

CYP73A39    rice
            aaaa01006093.1a $FI CYP73 (indica ) 99% to AP004850.1b

CYP73A40    rice
            aaaa01006093.1b $FI CYP73 (indica ) 99% to AP004850.1a
            98% to AAAA01006093.1a 73A39

CYP73A41    Ammi majus L. , Apiaceae (Bishops weed)
            GenEMBL AY219918.1
            Silvia Huebner
            Submitted Jan 7, 2003
            Only 8 amino acid differences to CYP73A10 from Petroselinum crispum

CYP73A42    Populus trichocarpa (Black cottonwood) 

CYP73A42v1  Populus tremuloides trans-cinnamate 4-hydroxylase (C4H2-1) mRNA,
            Lu,S., Zhou,Y., Li,L. and Chiang,V.L.
            Distinct Roles of Cinnamate 4-hydroxylase Genes in Populus
            Plant Cell Physiol. 47 (7), 905-914 (2006)
            5 aa diffs to 73A42

CYP73A42v2  Populus tremuloides trans-cinnamate 4-hydroxylase (C4H2-2) mRNA,
            Lu,S., Zhou,Y., Li,L. and Chiang,V.L.
            Distinct Roles of Cinnamate 4-hydroxylase Genes in Populus
            Plant Cell Physiol. 47 (7), 905-914 (2006)
            99% (4 aa diffs) to 73A42, 97% (15 aa diffs) to 73A43

CYP73A42    Populus trichocarpa X Populus deltoides cinnamate 4-hydroxylase
            (C4H) mRNA, complete cds.
            Ro,D.K., Mah,N., Ellis,B.E. and Douglas,C.J.
            Functional characterization and subcellular localization of poplar
            (Populus trichocarpa x Populus deltoides) cinnamate 4-hydroxylase
            Plant Physiol. 126 (1), 317-329 (2001)
            1 aa diff to 73A42

CYP73A43    Populus trichocarpa (Black cottonwood) 

CYP73A43v1  Populus tremuloides trans-cinnamate 4-hydroxylase (C4H1-1) mRNA,
            complete cds.
            Lu,S., Zhou,Y., Li,L. and Chiang,V.L.
            Distinct Roles of Cinnamate 4-hydroxylase Genes in Populus
            Plant Cell Physiol. 47 (7), 905-914 (2006)
            3 aa diffs to 73A43, 1 aa diff to CYP73A43v2

CYP73A43v2  Populus tremuloides trans-cinnamate 4-hydroxylase (C4H1-2) mRNA,
            complete cds.
            Lu,S., Zhou,Y., Li,L. and Chiang,V.L.
            Distinct Roles of Cinnamate 4-hydroxylase Genes in Populus
            Plant Cell Physiol. 47 (7), 905-914 (2006)
            3 aa diffs to 73A43

CYP73A44    Populus trichocarpa (Black cottonwood) 
CYP73A45P   Populus trichocarpa (Black cottonwood) 

CYP73A46     Verbena x hybrida cultivar Tapien Pink (Lamiales)
             GenEMBL AB234900 (not available on Sept 16, 2005)
             Yoshikazu Tanaka
             Cinnamic acid 4-hydroxylase homologue
             submitted to nomenclature committee Sept. 16, 2005
             86% to 73A5 Arabidopsis

CYP73A47v1 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D128-AB7
           90% to CYP73A46

CYP73A47v2 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D243-AA2
           2 aa diffs to CYP73A47v1

CYP73A47v3 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D125-AF11
           5 aa diffs to CYP73A47v1

CYP73A47v4X Nicotiana tabacum (tobacco)
           96% to 73A47v3 (5 aa diffs) 
           93% to Medicago truncatula 73A3, 69% to 73A27 and 73A28
           renamed CYP73A85 based on full length seq

CYP73A48   Physcomitrella patens (moss)
BJ156825 BJ601621 AW598785 AW156067 BJ960273 BJ962155
BJ173522 BJ170223 BJ955206 BJ608342 BJ603676 BJ955206
BJ605702 BJ593402 BJ607994 BJ596392 BJ609670 BJ944446
BJ606143 BJ598803 BJ583187 BQ041736 BJ597214 BJ599148
BJ607151 BJ595328 BJ163543 BJ203089 BJ199707 BJ201130
BJ197619 BJ178048 BJ195721 BJ970670 BJ193565 BJ199312
BJ206667 BJ204697 BJ200793 BJ173402 BJ185972 BJ190015
            69% to 73A5

CYP73A49   Physcomitrella patens (moss)
BJ177355.1 BJ182198.1 BJ176060.1 BJ186266.1 BJ197128.1
BJ963588.1 BJ192275.1 BJ179214.1 BJ191683.1
BJ975047 = mate pair of BJ966530.1 BJ600264 BJ611038
BJ975788 = mate pair of BJ967270.1 BJ587131 BJ593693 BQ039467
BJ582985 = mate pair of BJ177851.1 BJ581278 BJ582455 BJ584349
           71% to 73A5

CYP73A50   Physcomitrella patens (moss)
           Trace archive 1005948486 895358221 852123011 710919274 759458758
           67% to 73A48, 60% to 73A5
           (no ESTs) lower part from AIE to end = 755680881
exon starting with KLGNA has no exact matches in trace archive
This is proably the same seq as 755680881

CYP73A51   Physcomitrella patens (moss)
           Trace archive 710919188 717596474 756814972 762526716 
           883857969 977890599 no ESTs

CYP73A52P   Physcomitrella patens (moss)
            GenEMBL BJ163406 aa 169-308 mate pair to BJ173377 
            this seq seen in at least 6 trace archive seqs 1023200166 
            883856438 869788433 891417707 866058619 884943991
            890407139 838586233 816063061
            This seems to be an expressed pseudogene 76% to 73A49

CYP73A53P   Physcomitrella patens (moss)
            Trace archive 755683069 710485186 
            72% to 73A5 with frameshift and stop codon
            pseudogene, stop codon seen in 12 sequences
            815536458 41/47 (87%) to 73A48 824722097 pseudogene
            816099016 87% to CYP73A48, suspect these join with 755683069

CYP73A54P   Physcomitrella patens (moss)
            Trace archive 710518592 755698511 
            44% to 73A5 C-term to PERF 
            pseudogene stop codon seen in 11 seqs

CYP73A56    Selaginella moellendorffii
            traces 880077204, 890756642, 720080815
            70% to 73A5

CYP73A57    Cucumis sativus 
            GenEMBL AM284167
            cinnamate-4-hydroxylase (c4H gene).

CYP73A58    Camellia sinensis (Ericales)
            GenEMBL AY641731
            trans-cinnamate 4-hydroxylase (C4H)

CYP73A59   Ceratopteris richardii (fern)
           71% TO 73A5

CYP73A60  Amborella trichopoda
          GenEMBL CV007005.1 DT578804 ESTs
          80% to 73A5

CYP73A61  Malus x domestica (apple, Rosales)
          GenEMBL DQ075002
          GenEMBL CX023386.1 DT041951.1 EB141051.1 EB175312.1 ESTs
          cinnamic acid hydroxylase (C4H1) mRNA, complete

CYP73A62   Ginkgo biloba 
           GenEMBL AY748324 DR064967
           cinnamic acid 4-hydroxylase 

CYP73A63    Capsicum annuum
            cinnamic acid 4-hydroxylase (C4H)
            95% to 73A21 Capsicum chinense

CYP73A64    Arnebia euchroma (asterids; lamiids; Boraginaceae)
            cinnamic acid 4-hydroxylase (C4H)

CYP73A65    Agastache rugosa (Lamiales)
            cinnamic acid 4-hydroxylase mRNA, complete cds.

CYP73A66   Solanum tuberosum  (potato, Solanales)
           95% to 73A21 
           cinnamic acid 4-hydroxylase

CYP73A67   Camptotheca acuminata (Cornales)
           90% to 73A37

CYP73A68   Lithospermum erythrorhizon (asterids; lamiids; Boraginaceae)
           GenEMBL AB055507
           C4H-1 mRNA for cinnamic acid 4-hydroxylase
           97% to 73A64

CYP73A69   Lithospermum erythrorhizon (asterids; lamiids; Boraginaceae)
           GenEMBL AB055508
           C4H-2 mRNA for cinnamic acid 4-hydroxylase
           92% to 73A68

CYP73A70   Verbena x hybrida 
           GenEMBL AB234902
           89% to 73A4

CYP73A71    Lactuca sativa (Lettuce sativa, Asterales)
            Takeuchi,A., Imanishi,S. and Nagata,M.
            Gene expression in wounded Lettuce leaf
            cinnamate 4-hydroxylase
            86% to 73A5

CYP73A72    Parthenocissus henryana (core eudicotyledons; Vitales)
            Liu,S.J., Hu,Y.L. and Lin,Z.P.
            Cinnamate-4-Hydroxylase Expression in Parthenocissus henryana in
            Response to the Environment
            85% to 73A5

CYP73A73    Hibiscus cannabinus 
            Ruotolo,G., Chiaiese,P. and Filippone,E.
            Cloning of kenaf (Hibiscus cannabinus L.) lignin and cellulose
            biosynthesis genes
            cinnamate-4-hydroxylate-like (c4h) mRNA, partial cds
            87% to 73A5 missing N-term

CYP73A74    Allium cepa 
            Kim,S., Binzel,M.L., Yoo,K. and Pike,L.M.
            Isolation of anthocyanin biosynthesis genes from onion (Allium
            cinammate 4-hydroxylase mRNA, complete cds.
            74% to 73A38 rice, 85% to 73A5 Arab.

CYP73A75    Sesamum indicum (a sesame plant)
            No accession number
            Eiichiro Ono
            Submitted to nomenclature committee July 11, 2007
            Clone name SiCYP201
            80% to CYP73A5

CYP73A76    Sesamum indicum (a sesame plant)
            No accession number
            Eiichiro Ono
            Submitted to nomenclature committee July 11, 2007
            Clone name SiCYP30
            65% to CYP73A5

CYP73A77    Sesamum indicum (a sesame plant)
            No accession number
            Eiichiro Ono
            Submitted to nomenclature committee July 11, 2007
            Clone name SiCYP263
            64% to CYP73A5

CYP73A78    AM455281.2 Vitis vinifera
            CAN70035.1 = AM455281.2
            CAAP02004907.1 7360-5632 (-) strand, 1 aa diff

CYP73A79    Carica papaya
            supercontig_2 :3548202..3550796 (+ strand)
            93% to CYP73A42v1  Populus tremuloides, 
            86% to 73A5, 64% to CYP73Ab

CYP73A80    Carica papaya
            64% to 73A5 Arab., 77% to 73A78 Vitis vinifera, 
            82% to CYP73A29 Citrus sinensis, 
            81% to CYP73A27 Nicotiana tabacum (tobacco) AF368378

CYP73A81    Vitis vinifera (grapevine)
            CAAP02000489.1 94% to 73A78
134181  TPITA*  134198

CYP73A82   Vitis vinifera (grapevine)
           CAN77208.1, CAAP02000415.1
           63% to CYP73A78

CYP73A83    Actinidia deliciosa (asterids, Ericales, Kiwifruit)
            Lesley Beuning
            Submitted to nomenclature committee Jan. 10, 2008
            84% to CYP73A5 Arabidopsis
            clone name EST 234778

CYP73A84    Actinidia chinensis (asterids, Ericales, Kiwifruit)
            Lesley Beuning
            Submitted to nomenclature committee Jan. 10, 2008
            62% to CYP73A5 Arabidopsis
            clone name EST242951

CYP73A85   Nicotiana tabacum (tobacco)
           AB236952.1  (also EB446576, EB441841, EB440462
           EG649736, FG159568)
           Whole seq submitted by Dany Werck Aug. 26, 2008
           formerly CYP73A47v4 name changed based on full length seq
           93% to CYP73A47v1, v2 and v3

CYP73A86   Polypodium aureum (fern)
           Adam Takos
           Submitted to nomenclature committee Jan. 7, 2009
           83% to 73A59 Ceratopteris richardii (fern) CV735819.1

CYP73A87    Glycine max (soybean, Fabales)

CYP73A88P   Glycine max (soybean, Fabales)

CYP73A89P   Glycine max (soybean, Fabales)

CYP73A90    Glycine max (soybean, Fabales)

CYP73A91    Festuca rubra (red fescue)
            No accesion number
            Tengfang Huang 
            Submitted to nomenclature committee Oct. 2, 2009
            Clone 29
            83% to CYP73A38 rice

CYP73A92    Brachypodium distachyon (temperate grass)

CYP73A93    Brachypodium distachyon (temperate grass)

CYP73A94    Brachypodium distachyon (temperate grass)

CYP73A95    Thapsia garganica L., Apiaceae (deadly carrot)
            No accession number
            Bjorn Dueholm, Damian Paul Drew, Henrik Toft Simonsen
            Submitted to nomenclature committee 7/5/2010
            85% to CYP73A5 Arabidopsis

CYP73A95    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            84% to CYP73A5 Arabidopsis thaliana
            only 9 aa diffs to CYP73A95 Thapsia garganica

CYP73A96    Solanum lycopersicum (tomato)
CYP73A96    Solanum tuberosum  (potato, Solanales)
CYP73A97P   Solanum lycopersicum (tomato)

CYP73A98    Lotus japonicus
            No accession number
            Dale Shelton and Soren Bak
            Submitted to nomenclature committee Feb. 10, 2011
            89% to CYP73A25 cotton

CYP73A99a   Lotus japonicus
            No accession number
            Dale Shelton and Soren Bak
            Submitted to nomenclature committee Feb. 10, 2011
            90% to CYP73A25 cotton

CYP73A99b   Lotus japonicus
            No accession number
            Dale Shelton and Soren Bak
            Submitted to nomenclature committee Feb. 10, 2011
            ESTAV779085, CYP73A_LjSGA_082453.1
            92% to CYP73A25 cotton
            note CYP73A99a and b do not overlap but it seems likely
            that they are from the same gene

CYP73A100  Panax ginseng (Apiales)
           No accession number
           Yong Eui Choi
           Submitted to nomenclature committee August 12, 2011
           79% to CYP73A96 tomato

CYP73A101v1   Leucaena leucocephala (white popinac, Fabales)
            84% to CYP73A5 Arabidopsis
            3 amino acid differences to CYP73A101v2

CYP73A101v2   Leucaena leucocephala (white popinac, Fabales)
            84% to CYP73A5 Arabidopsis
            3 amino acid differences to CYP73A101v1

CYP73A101v3   Leucaena leucocephala (white popinac, Fabales)
            84% to CYP73A5 Arabidopsis
            8 amino acid differences to CYP73A101v1

CYP73A102a  Nelumbo nucifera (sacred lotus, Proteales)
CYP73A102b  Nelumbo nucifera (sacred lotus, Proteales)
CYP73A103   Nelumbo nucifera (sacred lotus, Proteales)
CYP73A104   Ricinus communis (castor bean, Malpighiales)
CYP73A104   Jatropha curcas  (Malpighiales)
CYP73A105   Ricinus communis (castor bean, Malpighiales)
CYP73A106   Catharanthus roseus (Madagascar periwinkle, Gentianales)

CYP73A107   Podophyllum species (Ranunculales)
            No accession number
            Joaquim Vogt Marques
            Submitted to nomenclature committee August 3, 2012
            89% to CYP73A42 Populus trichocarpa x Populus deltoides

CYP73A frag.  Scutellaria baicalensis (Lamiales)
            Brundage,M.E. and Winget,G.D.
            Cloning of Known and Novel Cytochrome P450s in Scutellaria
            C4H, 90% to 73A5

CYP73A frag.  Astragalus membranaceus 
              Pan,H.Y., Zhou,T.S. and Chen,J.K.
              Cloning and expression in E. coli of a trans-cinnamate
              4-monooxygenase gene from Astragalus membranaceus var. mongholicus
              trans-cinnamate 4-monooxygenase
              93% to 73A3

CYP73A frag.  Vigna unguiculata
              Okeola,O.G., Omitogun,O.G. and Machuka,J.S.
              Vigna unguiculata (cowpea) cytochrome P450 clone LC 17

CYP73A frag.  Vigna unguiculata
              Okeola,O.G., Omitogun,O.G. and Machuka,J.S.
              Vigna unguiculata (cowpea) cytochrome P450 clone LC 17

CYP73      Ceratopteris richardii (fern)
           49% to 73A59, 54% TO 73A5, 56% TO 73A62

CYP73      Adiantum capillus-veneris (fern)
           GenEMBL BP919958 EST
           64% to CYP73A59

CYP73      Adiantum capillus-veneris
           GenEMBL BP919715 EST
           57% to 73A35P

CYP73Anew    Ginkgo biloba
             DR064771 N-term

CYP73Anew    Ginkgo biloba
             DR065088 C-term

CYP73        Cucumis melo (Cucurbitales)
             GenEMBL AM284168.1 
             cinnamate-4-hydroxylase (c4H gene)

CYP73      Casuarina glauca (swamp oak, fagales)
           GenEMBL CO037468.1 CO037891.1 ESTs

CYP73A      Aquilegia formosa x Aquilegia pubescens (Ranunculales)
            GenEMBL DT751396.1 EST

CYP73     Persea americana (avocado, Laurales)
          GenEMBL CK752489.1 CK754025.1 ESTs
          84% to 73A5

CYP73     Eucalyptus tereticornis (Myrtales)
          GenMBL CD668578.1 EST

CYP73     Melaleuca alternifolia (Cheel, Myrtales)
          GenEMBL BI096937.1 EST 

CYP73A     Zamia furfuracea (cycad)
           GenEMBL CB095334 EST
           81% to 73A5

CYP73       Fagus sylvatica (beech tree, Fagales)
            53% to 73A5

CYP73       Casuarina glauca (swamp oak, Fagales)
            75% TO 73A5

CYP73       Casuarina glauca (swamp oak, Fagales)
            88% TO 73A5

CYP73      Casuarina glauca (swamp oak, fagales)
           GenEMBL CO037468.1 CO037891.1 CO037407 CO037541 CO037391 ESTs

CYP73       Phaseolus vulgaris (kidney bean)
            PIR S34739 (23 amino acids)
            Rodgers, M.W., Zimmerlin, A., Werck-Reichhart, D. and Bolwell, G.P.
            Microsomally associated heme proteins from French bean:
            characterization of the cytochrome P450
            cinnamate-4-hydroxylase and two peroxidases.
            Arch. Biochem. Biophys. 304, 74-80 (1993)

74A Subfamily

Note on nomenclature of 74A sequences.  Historically, each species has had only one 74A gene described.
This was true up until 2000 when the tomato and Hordeum vulgare both had two 74A genes.  For simplicity in the 
Nomenclature, 74A sequences were not numbered sequentially, but they were just named 74A.  With the discovery of 
multiple 74As in tomato and Hordeum it became necessary to assign numbers to the sequences.  Once more, to keep the 
nomenclature simple, all sequences from species with only one 74A are named CYP74A1.  Those sequences that are from 
species with two 74As have a number assigned to distinguish them from 74A1.  

CYP74A1     Linum usitatissimum (flaxseed)
            GenEMBL U00428 (2038bp)
            Song,W.-C., Funk,C.D. and Brash,A,R.
            Molecular cloning of an allene oxide synthase: A cytochrome
            P450 specialized for the metabolism of fatty acid hydroperoxides.
            Proc. Natl. Acad. Sci. USA 90, 8519-8523 (1993)
            Note: This sequence has two exceptions to the P450 motif.

CYP74A1     Parthenium argentatum (guayule, a desert shrub)
            GenEMBL X78166 (1674bp)
            Pan,Z., Durst,F., Werck-Reichhart,D., Gardner,H.W., Camara,B.,
            Cornish,K. and Backhaus,R.A.
            The major protein of guayule rubber particles is a cytochrome
            P450: Characterization based on cDNA cloning and spectroscopic
            analysis of the solubilized enzyme and its reaction products
            J. Biol. Chem. 270, 8487-8494 (1995)

CYP74A1     Arabidopsis thaliana
            GenEMBL X92510 (1799bp)
            Laudert D., Pfannschmidt, U., Lottspeich, F., Hollanderczytko, H., and 
            Weiler, E.W.
            Cloning, molecular and functional characterization of Arabidopsis thaliana allene 
            oxide synthase (CYP-74), the first enzyme of the octadecanoid pathway to 
            J. Mol. Biol. 31, 323-335 (1996)
            Note: The EST N65720 matches this sequence closely, but not completely.

CYP74A1     Arabidopsis thaliana
            GenEMBL AB007647

CYP74A1     Arabidopsis thaliana
            GenEMBL Y12636
            Kubigsteltig,I.I., Laudert,D. and Weiler,E.W.
            Structure and regulation of the Arabidopsis thaliana allene oxide
            synthase gene

CYP74A1     Arabidopsis thaliana
            GenEMBL AF172727
            Sequence of an Allene Oxide Synthase cDNA from Arabidopsis thaliana
            (Accession No. AF172727). (PGR99-130)
            Plant Physiol. 121 (1), 312 (1999)

CYP74A1     Arabidopsis thaliana
            GenEMBL N65720(426bp)
            middle region starting about 234 amino acids in.

CYP74A1     Solanum lycopersicum (tomato)
            GenEMBL AJ271093
            Sivasankar,S., Sheldrick,B. and Rothstein,S.J.
            Expression of allene oxide synthase determines defense-gene
            activation in tomato
            64% to Arabidopsis 74A1, 70% to tomato 74A2

CYP74A1     Solanum tuberosum (potato)
            GenEMBL AJ457080
            Stumpe,M. and Feussner,I.
            The family of allene oxide synthases (Cytochrome P450 74A) of
            aos1 gene

CYP74A1     Hordeum vulgare
            GenEMBL AJ250864
            Maucher,H., Hause,B., Feussner,I., Ziegler,J. and Wasternack,C.
            Allene oxide synthases of barley (Hordeum vulgare cv. Salome):
            tissue specific regulation in seedling development
            Plant J. 21 (2), 199-213 (2000)
            53% to Arabidopsis AOS, 89% to Hordeum 74A3

CYP74A1     Nicotiana attenuata 
            GenEMBL AJ295274 16-NOV-2001 
            mRNA for allene oxide synthase (aos gene).

CYP74A1     Capsicum annuum cultivar TL 1791 mRNA,
            allene oxide synthase
            91% to 74A1 potato

CYP74A1     Medicago truncatula (barrel medic, Fabales)
            GenEMBL AJ316561
            Stenzel,I. and Hause,B.
            The role of allene oxide synthase in mycorrhizal interaction

CYP74A1     Glycine max (soybeans, Fabales)
            Li,L.Y. and Yu,D.Y.
            Comprehensive analysis of putative P450 genes superfamily in
            Glycine max and Medicago truncatula
            80% to 74A1 Medicago Called CYP74A3

CYP74A1     Pisum sativum 
            Ishiga,Y., Inagaki,Y., Toyoda,K., Shiraishi,T. and Ichinose,Y.
            Expression of allene oxide synthase and allene oxide cyclase in the
            interactions between pea and fungal pathogens
            J. Gen. Plant Pathol. 69, 351-357 (2003)
            66% to 74A1 

CYP74A1     Citrus sinensis (orange, Sapindales)
            GenEMBL AY243478
            Wu,Z. and Burns,J.K.
            Molecular cloning and characterization of allene oxide synthase
            gene isolated from orange leaf

CYP74A1    Citrus clementina (Sapindales)
           61% to 74A1 Arab.

CYP74A1     Cucumis melo (cantaloupe melon)
            GenEMBL AF081954
            Tijet,N., Brash,A.R. and Whitehead,I.M.
            cDNA sequences from melon (Cucumis melo) related to fatty acid
            hydroperoxide metabolizing enzymes
            allene oxide synthase (AOS)

CYP74A1     Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            65% TO CYP74A1   Arabidopsis thaliana

CYP74A1     Vitis vinifera (grapevine)
            CAAP02000063.1 (CAO61246.1) 
            in contig CU459218.1 chr18 scaffold_1
            61% to 74A1 Arab. 70% to 74A1 tomato
            next closest match to the tomato 74A1 is CYP74A14, 60%
            so this is considered the ortholog of CYP74A1. 
            Note it is distant from the other CYP74 gene cluster on chr 3

CYP74A1     Picea glauca (white spruce)
            GenEMBL ESTs DR575387 DV977399 DR514607 DR533074 DR499922
            48% to 74A4 rice 49% to 74A1 Arab.
            52% to CYP74A1 Linum

CYP74A1     Populus trichocarpa (Black cottonwood) 

CYP74A1     Physcomitrella patens (moss)
            GenEMBL AJ316566.1 Allene oxide synthase, complete 
            BJ158304 BJ166090 BJ174856 BJ177756 BJ178183 BJ166090 BJ174856
            BJ177756 BJ178183 BJ180158 BJ183079 BJ186758 BJ187084 BJ187922
            BJ191679 BJ194574 BJ195562 BJ197445 BJ580030 BJ583315 BJ585498
            BJ587579 BJ592267 BJ597789 BJ598633 BJ588378
            46% to 74A1 40% to 74E1, 40% to 74F1 47% to 74C1 40% to 74B3
            37% to 74D1 

CYP74A1  Prunus persica (peach, Rosales)
         Ziosi,V., Rasori,A., Bregoli,A.M., Biondi,S. and Torrigiani,P.
         Isolation and cloning of a putative pp-AOS1 in peach
         partial mRNA for allene oxide synthase (aos gene)
         65% to 74A1 Arab.

CYP74A1P1   Lupinus luteus (yellow lupine)
            GenEMBL Z49255 comp(1719-2132)
            possible pseudogene of CYP74A
            42% identical to 74A of guayule, nearly identical to 74AP2

CYP74A1P2   Lupinus luteus (yellow lupine)
            GenEMBL Z49255 comp(4284-4697)
            possible pseudogene of CYP74A
            42% identical to 74A of guayule

CYP74A2     Solanum lycopersicum (tomato)
            GenEMBL AF230371
            Howe,G.A., Lee,G.I., Itoh,A., Li,L. and DeRocher,A.E.
            Cytochrome P450-dependent metabolism of oxylipins in tomato.
            Cloning and expression of allene oxide synthase and fatty acid
            hydroperoxide lyase
            Plant Physiol. 123 (2), 711-724 (2000)
            63% to Arabidopsis 74A1, 70% to tomato 74A1, 91% to 74A6

CYP74A2     Solanum lycopersicum (tomato)
            GenEMBL BT013345

CYP74A3     Hordeum vulgare
            GenEMBL AJ250864
            Maucher,H., Hause,B., Feussner,I., Ziegler,J. and Wasternack,C.
            Allene oxide synthases of barley (Hordeum vulgare cv. Salome):
            tissue specific regulation in seedling development
            Plant J. 21 (2), 199-213 (2000)
            54% to Arabidopsis AOS, 89% to Hordeum 74A1

CYP74A4     Oryza sativa (rice)
CYP74A4     Brachypodium distachyon (temperate grass)
CYP74A5     Oryza sativa (rice)
CYP74A5     Brachypodium distachyon (temperate grass)

CYP74A6v1   Solanum tuberosum (potato)
            GenEMBL AJ457081
            Note: an error in accession numbers was discovered 1/4/06
            AJ457081 = aos2, AJ457080 = aos1, so the accession number 
            here was corrected.
            Stumpe,M. and Feussner,I.
            The family of allene oxide synthases (Cytochrome P450 74A) of
            Called AOS2 a second AOS gene in potato
            (compare to 74A2 of tomato)
            note: this seq. was briefly named CYP74A4, a rice gene
            71% to 74A1 of Solanum tuberosum

CYP74A6v2   Solanum tuberosum (potato)
            GenEMBL AY135640
            99% (4 aa diffs to 74A6v1)

CYP74A7     Populus trichocarpa (Black cottonwood) 

CYP74A8     Physcomitrella patens (moss)
            Trace archive 856891456 
            70% to 74A1 moss no ESTs, complete
            1028581451 1009321611 moves upstream
            goes downstream 1036017357

CYP74A9     Hevea brasiliensis, Euphorbiaceae (rubberwood tree, source of latex)
            GenEMBL DQ004684
            Norton,G., Arokiaraj,P., Yusof,F., Pujade-Renaud,V., Griffiths,D.
            and Jones,H.
            Hevea brasiliensis allene oxide synthase (aos) mRNA isolated from
            leaf tissue
            N-term matches Arabidopsis

CYP74A9P    Hevea brasiliensis allene oxide synthase (AOS) mRNA, complete cds.
            Zeng,R.Z., Duan,C.F. and Tian,W.M.
            Molecular cloning and expression analysis of bark AOS gene of
            rubber tree (Hevea brasiliensis)
            Pseudogene, 7 aa diffs and one in frame stop codon
            N-term frameshifted from 74A9v1 lower case is wrong N-term
lsslpihtwssclmgraflffstylrskrkif FTGTYMPSTELTGGYRILSYLDPSEP

CYP74A10    Hevea brasiliensis 
            Duan,C., Zeng,R., Nie,Z. and Li,Y.
            Isolation and characterization of latex allene oxide synthase (AOS)
            gene in Hevea brasiliensis
            92% to 74A9

CYP74A11     Zea mays 
             Xu,T., Wang,J., Zeng,R. and Luo,S.
             Molecular cloning and expression induction by herbivory and methyl
             jasmonate of the maize jasmonate biosynthetic pathway genes allene
             oxide synthase (Zmaos) and allene oxide cyclase (Zmaoc)
             allene oxide synthase (aos) mRNA, complete cds.
             77% to 74A5 rice

CYP74A12    Carica papaya
            79% to 74A Arabidopsis
            the rest of this seq is in a seq gap

CYP74A13    Vitis vinifera (grapevine)
            CAO47688.1 in contig CU459225.1 chr3 scaffold_8
            54% to 74A4 

CYP74A14    Vitis vinifera (grapevine)
            CAO47689.1 in contig CU459225.1 chr3 scaffold_8
            54% to 74A4 

CYP74A15    Vitis vinifera (grapevine)
            CAO47690.1 fused with CYP74A16, in contig CU459225.1 chr3 scaffold_8 
            upstream of CYP74A16
            CYP74A 56% to 74A5 

CYP74A16    Vitis vinifera (grapevine)
            CAO47690.1 fused with CYP74A15, in contig CU459225.1 chr3 scaffold_8 
            96% to CYP74A15

CYP74A17    Vitis vinifera (grapevine)
            CAO47691.1 in contig CU459225.1 chr3 scaffold_8
            84% to CYP74A15 

CYP74A18    Zea mays 
            85% to CYP74A4

CYP74A19   Zea mays 
           92% to CYP74A11, 56% to CYP74A18

CYP74A20P   Glycine max (soybeans, Fabales)

CYP74A21    Glycine max (soybeans, Fabales)

CYP74A22    Glycine max (soybeans, Fabales)

CYP74A      Humulus lupulus (Rosales)
            GenEMBL AY745883
            plastid allene oxide synthase  partial cds;
            nuclear gene for plastid product.
            62% to 74A1 Arab.

CYP74A     Coffea canephora (Gentianales)
           60% to 74A1 Arab.

CYP74A      Aquilegia formosa x Aquilegia pubescens (Ranunculales)
            59% to 74A1 Arab.

CYP74A      Gossypium hirsutum (cotton, Malvales)
            73% to 74A1 Arab.

CYP74A      Fagus sylvatica (beech tree, Fagales)
            66% to 74A1 Arab. C-term

CYP74A     Ipomopsis aggregata (Ericales)
           72% to 74A1 Arab.

CYP74A      Citrus jambhiri
            Gomi,K., Yamasaki,Y., Yamamoto,H. and Akimitsu,K.
            Characterization of a hydroperoxide lyase gene and effect of
            C6-volatiles on expression of genes of the oxylipin metabolism in
            J. Plant Physiol. 160 (10), 1219-1231 (2003)
            allene oxide synthase
            56% to 74A1 

CYP74       Saruma henryi (magnoliids)
            CV191286.1 73% to 74A1 Arab

CYP74       Amborella trichopoda
            FD438364  66% to 74A1 Arab

CYP74       Cycas rumphii (cycads)
            EX918042.1 EX919315.1 49% to 74A1 Arab. 

CYP74       Cycas rumphii (cycads)
            EX918448.1 EX918629.1 49% to 74A1 Arab. 71% to other CYP74 in cycas

CYP74       Ginkgo biloba
            EX934208.1 60% to 74A Arab N-term

CYP74       Adiantum capillus-veneris (fern)
            BP917011 54% to 74A Arab. 71% to 74A rice heme region

74B Subfamily

CYP74B1    Capsicum annuum (bell pepper)
           GenEMBL U51674 (1647bp)
           Matsui, K. Shibutani,M., Kajiwara,T. and Hase,T.
           fatty acid hydroperoxide lyase

CYP74B1    Capsicum annuum (bell pepper)
           GenEMBL AY028374
           Richard,S. and Atwal,A.S.
           Comparative study between fatty acid hydroperoxide lyases from
           tomato and red bell pepper sources

CYP74B2     Arabidopsis thaliana
            GenEMBL Z97339 full length EST T20864 (367bp)
            unpublished (1994)
            N-terminal 121 amino acids, different from X92510 full length 74A sequence.

CYP74B2     Arabidopsis thaliana
            GenEMBL AF087932
            Bate,N.J., Sivasankar,S., Moxon,C., Riley,J.C.M., Thompson,J.E. and
            Molecular characterization of an arabidopsis gene encoding
            hydroperoxide lyase, a cytochrome P-450 that is wound inducible
            Plant Physiol. 117, 1393-1400 (1998)

CYP74B3v1   Solanum lycopersicum (tomato)
            GenEMBL AJ239065
            Thesis (1999) University of Guelph, Dept. of Molecular Biology and
            Genetics, Guelph, ON, Canada
            58% to 74B2

CYP74B3v2   Solanum lycopersicum (tomato)
            GenEMBL AF230372
            Howe,G.A., Lee,G.I., Itoh,A., Li,L. and DeRocher,A.E.
            Cytochrome P450-dependent metabolism of oxylipins in tomato.
            Cloning and expression of allene oxide synthase and fatty acid
            hydroperoxide lyase
            Plant Physiol. 123 (2), 711-724 (2000)
            4 amino acid diffs with 74B3v1

CYP74B3v3   Solanum lycopersicum (tomato)
            2 aa diffs with CYP74B3v2, 4 aa diffs to CYP74B3v1

CYP74B3       Solanum tuberosum (potato)

CYP74B4v1     Medicago sativa (alfalfa)
              GenEMBL AJ249245
              Noordermeer,M.A., van Dijken,A.J.H., Smeekens,S.C.M., Veldink,G.A.
              and Vliegenthart,J.F.G.
              Cloning and expression of alfalfa hydroperoxide lyase genes
              characterization of 13-hydroperoxide lyase isoenzymes with an
              unusual presequence and a proposal for a reaction mechanism                  
              63% identical to 74B2 61% to 74B1 and 74B3
              submitted to the nomenclature committee 8/23/99

CYP74B4v2     Medicago sativa (alfalfa)
              GenEMBL AJ249246
              Noordermeer,M.A., van Dijken,A.J.H., Smeekens,S.C.M., Veldink,G.A.
              and Vliegenthart,J.F.G.
              Cloning and expression of alfalfa hydroperoxide lyase genes
              characterization of 13-hydroperoxide lyase isoenzymes with an
              unusual presequence and a proposal for a reaction mechanism                  
              97.5% identical to v1
              the three forms show different activities
              submitted to the nomenclature committee 8/23/99

CYP74B4v3     Medicago sativa (alfalfa)
              GenEMBL AJ249246
              Noordermeer,M.A., van Dijken,A.J.H., Smeekens,S.C.M., Veldink,G.A.
              and Vliegenthart,J.F.G.
              Cloning and expression of alfalfa hydroperoxide lyase genes
              characterization of 13-hydroperoxide lyase isoenzymes with an
              unusual presequence and a proposal for a reaction mechanism                  
              99% identical to v1
              the three forms show different activities
              submitted to the nomenclature committee 8/23/99

CYP74B4     Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ011231 GenPept ABD32413
            ortholog to M. sativa 74B4

CYP74B5     Psidium guajava (guava, Myrtales)
            Tijet N, Waspi U, Gaskin DJ, Hunziker P, Muller BL, Vulfson EN, 
            Slusarenko A, Brash AR, Whitehead IM.
            Purification, molecular cloning, and expression of the gene 
            encoding fatty acid 13-hydroperoxide
            lyase from guava fruit (Psidium guajava).
            Lipids. 2000 Jul;35(7):709-20.
            69% identical to CYP74B3
            submitted to nomenclature committee 4/14/00

CYP74B6P     Cucumis sativus (cucumber)
             GenEMBL AF229812
             Matsui,K., Wilkinson,J., Hiatt,B., Knauf,V. and Kajiwara,T.
             Fatty acid hydroperoxide lyases in cucumber hypocotyls

CYP74B7     Populus trichocarpa (Black cottonwood) 

CYP74B8     Solanum tuberosum 
            GenEMBL AJ310520
            fatty acid hydroperoxide lyase (hpl gene)
            95% to 74B3v2

CYP74B9     Nicotiana attenuata 
            hydroperoxide lyase (hpl gene).
            87% to 74B3v2

CYP74B9     Nicotiana tabacum
            74B9 ortholog frag. 1 aa diff to 74B9 Nicotiana attenuata

CYP74B9     Nicotiana tabacum 
            96% to 74B9 Nicotiana attenuata (ortholog)
            fatty acid hydroperoxide lyase

CYP74B10     Citrus sinensis 
             Wu,Z. and Burns,J.K.
             Molecular cloning and expression of fatty acid hydroperoxide lyase
             gene isolated from orange leaf
             fatty acid hydroperoxide lyase (HPL) mRNA, complete cds
             71% to 74B5 60% to 74B2, 98% to AB077765.1 Citrus jambhiri

CYP74B11     Citrus jambhiri 
             Gomi,K., Yamamato,H. and Akimitsu,K.
             Epoxide hydrolase: a mRNA induced by the fungal pathogen Alternaria
             alternata on rough lemon (Citrus jambhiri Lush)
             Plant Mol. Biol. 53 (1-2), 189-199 (2003)
             hydroperoxide lyase, complete cds

CYP74B12 Citrullus lanatus (watermelon, Cucurbitales)
         Fukushige,H. and Hildebrand,D.F.
         Watermelon (Citrullus lanatus) hydroperoxide lyase greatly
         increases C6-aldehyde formation in transgenic leaves
         13-hydroperoxide lyase mRNA, complete cds
         56% to 74B2

CYP74B13   Vitis vinifera (Pinot noir grape)
           GenEMBL AM441513 PLN 18-MAY-2007

CYP74B13    Vitis vinifera (grapevine)
            CAAP02000110.1 (CAO24035.1) in contig CU459253.1
            chr12 scaffold_36
            no heme Cys 56% to 74B2 also w/o Cys, 3 aa diffs to AM441513

CYP74B14   Carica papaya
           64% to 74B2, 
           66% to CYP74B5 AF239670  Psidium guajava fatty acid hydroperoxide lyase
           65% to CYP74B10 AY242385.1 Citrus sinensis, 
           62% to Vitis vinifera 74B13

CYP74B15   Glycine max (soybeans, Fabales)

CYP74B16   Linum usitatissimum (flaxseed)
           63% to CYP74B7 Populus trichocarpa

CYP74B frag.  Cucumis melo (Cucurbitales)
          Tijet,N., Brash,A.R. and Whitehead,I.M.
          cDNA sequences from melon (Cucumis melo) related to fatty acid
          hydroperoxide metabolizing enzymes
          fatty acid hydroperoxide metabolizing enzyme mRNA, partial cds
          68% to 74B2

CYP74B frag.  Citrus aurantium
            Pan,D., Guo,F., Chen,G., She,W. and Xia,H.
            Molecular Cloning of cDNA Encoding Conservative Regions of
            Hydroperoxide Lyase in Petals of 'Daidai' [C. aurantium L.]
            67% to 74B2

CYP74B frag.  Citrus maxima
            She,W., Guo,F., Chen,G., Pan,D. and Xia,H.
            Molecular Cloning of cDNA Encoding Conservative Regions of
            Hydroperoxide Lyase from the Petals of Pumello [C. grandis (L.)
            hydroperoxide lyase mRNA, partial cds
            67% to 74B2

CYP74B       Murraya paniculata (Sapindales)
             GenEMBL DQ179654.1 
             hydroperoxide lyase
             69% to 74B2

CYP74B       Sesamum indicum 
             60% to 74B2 mid region

74C Subfamily

CYP74C1      Cucumis sativus (cucumber)
             GenEMBL AF229811
             Matsui,K., Wilkinson,J., Hiatt,B., Knauf,V. and Kajiwara,T.
             Fatty acid hydroperoxide lyases in cucumber hypocotyls

CYP74C2      Cucumis melo (cantaloupe melon)
             GenEMBL AF081955
             Tijet N. et al (2001) Arch. Biochem. Biophys. 386, 281-289.
             a hydroperoxide lyase with specificity for both 9- and
             13-hydroperoxides of linoleic and linolenic acids

CYP74C3      Solanum lycopersicum (tomato)
             GenEMBL AF454634.1
             Gregg Howe
             Submitted to nomenclature committee May 16, 2001
             94% to 74C10, 57% to 74C1 58% to 74C2
             clone name LeAOS3

CYP74C4      Solanum lycopersicum (tomato)
             GenEMBL AF461042.1
             Gregg Howe
             Submitted to nomenclature committee Nov. 28, 2001
             61% to 74C2 60% to 74C1 58% to 74C3

CYP74C4      Solanum tuberosum (potato)

CYP74C5      Prunus dulcis (almond) 
             GenEMBL AJ578748
             Mita,G., Quarta,A., De Paolis,A., Casey,R. and Santino,A.
             Molecular cloning and characterization of an almond gene encoding a
             cytochrome P450 CYP74C5

CYP74C6v1    Populus trichocarpa (Black cottonwood) 
CYP74C6v2    Populus trichocarpa (Black cottonwood) 
CYP74C6v3    Populus trichocarpa (Black cottonwood) 
CYP74C7v1    Populus trichocarpa (Black cottonwood) 
CYP74C7v2    Populus trichocarpa (Black cottonwood) 
CYP74C8      Populus trichocarpa (Black cottonwood) 

CYP74C9      Petunia inflata
             GenEMBL DQ351288 (mRNA) DQ351289 (gene)
             Xu,Y., Ishida,H., Reisen,D. and Hanson,M.R.
             Upregulation of a tonoplast-localized cytochrome P450 during petal
             senescence in Petunia inflata
             (er) BMC Plant Biol. 6 (1), 8 (2006)
             Submitted to nomenclature committee Jan. 4, 2006
             70% to 74C3, 63% to 74C4, 61% to 74C2, 59% to 74C5, 59% to 74C1

CYP74C10v1   Solanum tuberosum (potato)
             GenEMBL AJ868542
             Stumpe,M., Goebel,C., Demchenko,K., Pawlowski,K. and Feussner,I.
             Characterization of an allene oxide synthase (CYP74C) from potato
             roots that metabolizes 9-hydroperoxides of linoleic and linolenic
             aos3 gene
             biosynthesis of 10-oxo-11-phytoenoic acid
             94% to 74C3, 69% to 74C9, 58% to 74C4

CYP74C10v2   Solanum tuberosum (potato)
             GenEMBL DQ174273.1
             Kongrit,D., Jisaka,M., Kobayasi,K., Nishigaichi,Y., Nishimura,K.,
             Nagaya,T. and Yokota,K.
             Molecular Cloning, Functional Expression, and Tissue Distribution
             of a Potato Sprout Allene Oxide Synthase Involved in a
             9-Lipoxygenase Pathway
             Biosci. Biotechnol. Biochem. 70 (9), 2160-2168 (2006)
             99% to 74C10v1 (2 aa diffs)

CYP74C10v3   Solanum tuberosum (potato)
             GenEMBL AY615276
             98% to 74C10v1 (5 aa diffs)

CYP74C11     Lotus corniculatus var. japonicus 
             GenEMBL AP004629.1 complement(58238-59701)
             75% to 74C13, 66% to 74C12, 62% to 74C5

CYP74C12     Medicago truncatula (barrel medic)
             GenEMBL AJ316563.1 
             Cloning and expression of Medicago truncatula hpl genes
             mRNA for 9/13 hydroperoxide lyase (hpl2 gene)
             60% to CYP74C2, 60% to 74C5, 59% to 74C1

CYP74C12    Glycine max (soybeans, Fabales)
            Li,L.Y. and Yu,D.Y.
            Comprehensive analysis of putative P450 genes superfamily in
            Glycine max and Medicago truncatula
            74% to 74C12 Medicago (probable ortholog), 
            only 63% to 74C13 Medicago

CYP74C13     Medicago truncatula (barrel medic)
             GenEMBL AJ316562.1 
             Cloning and expression of Medicago truncatula hpl genes
             mRNA for 9/13 hydroperoxide lyase (hpl1 gene)
             75% to CYP74C11, 65% to 74C12

CYP74C13    Glycine max (soybeans, Fabales)
            Li,L.Y. and Yu,D.Y.
            Comprehensive analysis of putative P450 genes superfamily in
            Glycine max and Medicago truncatula
            78% to 74C13 (probable ortholog), 71% to 74C12, Called CYP74A2

CYP74C14     Lycopersicon pennellii 
             83% to 74C4, 61% to 74C3
             fatty acid 9/13-hydroperoxide lyase

CYP74C15X    Solanum lycopersicum
             92% to 74C14
             86% to 74C4, 62% to 74C3 
             renamed CYP74C27 (whole gene)

CYP74C16X   Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C52
            68% to 74C12
            note CYP74C16 = CYP74C13

CYP74C17P   Glycine max (soybean, Fabales)

CYP74C18P   Glycine max (soybean, Fabales)

CYP74C19P   Glycine max (soybean, Fabales)

CYP74C20P   Glycine max (soybean, Fabales)

CYP74C21P   Glycine max (soybean, Fabales)

CYP74C22P   Glycine max (soybean, Fabales)

CYP74C23P   Glycine max (soybean, Fabales)

CYP74C24P   Glycine max (soybean, Fabales)

CYP74C25P   Glycine max (soybean, Fabales)

CYP74C26P   Glycine max (soybean, Fabales)

CYP74C27    Solanum lycopersicum (tomato)

CYP74C      Chenopodium quinoa (Caryophyllales)
            55% to 74C2 49% to 74A5 

CYP74D1      Solanum lycopersicum (tomato)
             GenEMBL AF317515
             Itoh A, Howe GA (2001) Molecular cloning of a divinyl ether synthase.
             Identification as a novel CYP74 cytochrome P450. J. Biol. Chem. 276: 3620-3627
             Submitted to nomenclature committee Aug. 28, 2000
             divinyl ether synthase (LeDES)
             54% to 74C4 50% to 74C2

CYP74D2      Solanum tuberosum (potato)
             GenEMBL AJ309541
             Stumpe,M., Kandzia,R., Goebel,C., Rosahl,S. and Feussner,I.
             A pathogen induced divinyl ether synthase (CYP74D)from potato
             suspension cultures
             divinyl ether synthase (LeDES)
             96% identical to 74D1 51% to 74C2

CYP74D3      Nicotiana tabacum (tobacco, Solanales)
             GenEMBL AF070976
             Cardinale,F.C., Esquerre-Tugaye,M.T. and Fournier,J.
             Elicitor-induced divinyl ether synthase from tobacco cells
             divinyl ether synthase (des1)
             87% to 74D2

CYP74D4     Capsicum annuum cultivar TL 1791 mRNA, (bell pepper, Solanales)
            91% to 74D2 
            divinyl ether synthase

CYP74E1     Oryza sativa (rice)
CYP74E2     Oryza sativa (rice)
CYP74E3P    Oryza sativa (rice)
CYP74E4     Brachypodium distachyon (temperate grass)
CYP74F1     Oryza sativa (rice)
CYP74F1     Brachypodium distachyon (temperate grass)

CYP74F1     Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Feb. 25, 2011
            Clone name Ep23
            82% to CYP74F1 rice (probable ortholog)
            79% to CYP74F1 Brachypodium distachyon

CYP74F2     Zea mays (maize)
            Xu,T., Wang,J. and Luo,s.
            Green leaf volatiles induce the expression of the maize
            defense-related genes
            hydroperoxide lyase (HPL) mRNA, complete cds.
            73% to 74F1 

CYP74F3     Hordeum vulgare 
            Matsui,K., Koeduka,T., Stumpe,M. and Feussner,I.
            The 13-HPL from barley leaves
            fatty acid hydroperoxide lyase (13-hpl)
            71% to 74F1 

CYP74G1     Physcomitrella patens (moss)
            GenEMBL AJ316567.1 divinyl ether synthase 12-AUG-2002
            GenEMBL AJ316567.2 hydroperoxide lyase (hpl gene) 21-SEP-2005
            function assignment changed from AJ316567.1 to AJ316567.2
            This is a hydroperoxide lyase confirmed by Dr. Feussner 7/3/08
            39% to 74D1 39% to 74C1 41% to 74B2 42% to 74A5 
            39% to 74E2 38% to 74F1
            BJ583519 BJ158039 BJ600124 BQ039802 BJ588073 BJ167917
            BJ965095 BJ588288 BJ172167 BJ170523 BJ166295 BJ596848
            BJ604932 BJ606484 BJ166967 BJ167535 BJ971827 BJ165862
            BJ609895 BJ604409 BJ198021 BJ159658 BJ191836 BJ162716
            BJ158982 BJ158406 BJ973612 BJ182787 BJ963293 BJ962527
            BJ198621 BJ178387 BJ203304 BJ196986 BJ969377 BJ971054 

CYP74H1     Allium sativum (garlic)
            Carsjens,J.G., Stumpe,M., Goebel,C. and Feussner,I.
            An unspecific 9/13-divinyl ether synthase (CYP74D) from garlic
            47% to 74A5, 42% to 74E1, 42% to 74C4, 40% to 74D2, 37% to 74F1, 
            38% to 74G1, 36% to 74B5

CYP74J1   Selaginella moellendorffii (lycopod moss)

CYP74K1   Selaginella moellendorffii (lycopod moss)

CYP74K2   Selaginella moellendorffii (lycopod moss)

CYP74K3   Selaginella moellendorffii (lycopod moss)

CYP74L1   Selaginella moellendorffii (lycopod moss)

CYP74L2   Selaginella moellendorffii (lycopod moss)

CYP74L3   Selaginella moellendorffii (lycopod moss)

CYP74M1   Selaginella moellendorffii (lycopod moss)

CYP74M2   Selaginella moellendorffii (lycopod moss)

CYP74M3   Selaginella moellendorffii (lycopod moss)

CYP74N1   Marchantia polymorpha (liverworts)
CYP74N1   Marchantia paleacea (liverworts)
CYP74N2   Marchantia polymorpha (liverworts)
CYP74N2   Marchantia paleacea (liverworts)
CYP74P1   Treubia lacunose (liverworts)

CYP74Q1   Ranunculus acris (Ranunculales, deepest eudicot order)
          No accession number
          Alexander Grechkin
          Submitted to nomenclature committee June 26, 2013
          About 50% to several CYP71A and CYP71C sequences

75A Subfamily

CYP75A1     Petunia hybrida cv. Blue Star
            GenEMBL X71130 (1326bp) PIR S32110 (425 amino acids)
            Toguri,T., Azuma,M. and Ohtani, T.
            The cloning and characterization of a cDNA encoding a cytochrome P450 
            from the flowers of Petunia hybrida.
            Plant Sci. 94, 119-126 (1993)

CYP75A1     Petunia hybrida
            GenEMBL Z22545 (1740bp) PIR S33515 and S38984 (508 amino acids)
            Holton,T.A., Brugliera,F., Lester,D.R., Tanaka,Y., Hyland,C.D., 
            Menting,J.G.T., Lu,C.-Y., Farcy,E., Stevenson,T.W. and       
            Cloning and expression of cytochrome P450 genes controlling flower 
            Nature 366, 276-279 (1993)
            Note: the accession numbers for 75A1 and 75A3 Z22544 and Z22545
            Had been missassigned (switched).  This is corrected now.

CYP75A1     Petunia hybrida
            GenEMBL D14588 (1846bp)
            Ohbayashi,M., Shimada,Y. Nakano,R., Kiyokawa,S. and 
            unpublished (1994)
            flavanoid 3', 5' hydroxylase

CYP75A1     Petunia hybrida 
            DQ352142.1, AY245545.1, AB196180, AF081575
            Note these seqs are identical to Z22545, X71130 and D14588
            94% to Z22544

CYP75A2     Solanum melongena cv. Sinsadoharanasu (eggplant)
            GenEMBL X70824 (1696bp) Swiss P37120 (513 amino acids)
            PIR S43342 (513 amino acids)
            Toguri,T., Umemoto,N., Kobayashi,O. and Ohtani,T.
            Activation of anthocyanin synthesis genes by white light in eggplant 
            hypocotyl tissues, and identification of an inducible P-450 cDNA.
            Plant Molec. Biol. 23, 933-946 (1993)

CYP75A3     Petunia hybrida
            GenEMBL Z22544 (1923bp) PIR S33521 and S38985 (506 amino acids)
            Holton,T.A., Brugliera,F., Lester,D.R., Tanaka,Y., Hyland,C.D., 
            Menting,J.G.T., Lu,C.-Y., Farcy,E., Stevenson,T.W. and       
            Cloning and expression of cytochrome P450 genes controlling flower
            Nature 366, 276-279 (1993)
            Note: the accession numbers for 75A1 and 75A3 Z22544 and Z22545
            Had been missassigned (switched).  This is corrected now.

CYP75A3     Petunia x hybrida
            GenEMBL AB239773.1 
            Hf2 gene for flavonoid 3',5'-hydroxylase

CYP75A4     Gentiana triflora 
            GenEMBL D85184 (1666bp)
            Tonaka,Y. Yonekura,K., Fukuchi-Mizutani,M., Fukui,Y. Fujiwara,H.
            Ashikari,T. and Kusumi,T. 
            Molecular and biochemical characterization of three anthocyanin synthetic
            enzymes from Gentiana triflora
            Plant Cell Physiol. 37, 711-716 (1996)

CYP75A5     Eustoma grandiflorum (lisianthus)
            GenEMBL U72654 (2124bp)
            Nielsen, K.M. and Podivinsky,E.
            cDNA cloning and expression of a flavinoid 3'5' hydroxylase from petals
            of Lisianthus (Eustoma grandiflorum Grise)
            unpublished (1996)

CYP75A6     Campanula medium
            GenEMBL D14590 (1927bp)

CYP75A7     Eustoma russellianum
            GenEMBL D14589 (2174bp)

CYP75A7     Eustoma grandiflorum
            GenEMBL AB078957.1 
            flavonoid 3',5'-hydroxylase
            100% to 75A7 Eustoma russellianum (ortholog)
            98% to 75A5 (9 aa diffs) allele?

CYP75A8     Catharanthus roseus (Madagascar periwinkle)
            GenEMBL AJ011862 (1595bp)
            Kaltenbach,M., Schroeder,G., Schmelzer,E. Lutz,V. and Schroeder,J.
            Flavonoid hydroxylase from Catharanthus roseus: cDNA, heterologous
            expression, enzyme properties and cell type specific expression
            in plants.
            Plant J. 19, 183-193 (1999)

CYP75A9     Lycianthes rantonnei 
            GenEMBL AF313490
            Eder,C.M. and Forkmann,G.
            Lycianthes rantonnetii flavonoid 3',5'-hydroxylase
            86% identical to 75A2

CYP75A10    Torrenia hybrida (cultivar:Summerwave Blue)
            GenEMBL AB012925
            Suzuki,K., Xue,H., Tanaka,Y., Fukui,Y., Fukuchi-Mizutani,M.,
            Murakami,Y., Katsumoto,Y., Tsuda,S. and Kusumi,T.
            Flower color modifications of Torenia hybrida by cosuppression of
            anthocyanin biosynthesis genes
            Mol. Breed. 6, 239-246 (2000)
            73% to CYP75A8

CYP75A11    Oryza sativa (rice)

CYP75A11    Zea mays ortholog

CYP75A11P   Brachypodium distachyon (temperate grass)

CYP75A12    Populus trichocarpa (black cottonwood)
            No accession number

CYP75A13    Populus trichocarpa (black cottonwood)
            No accession number

CYP75A14    Pinus taeda 
            GenEMBL CO174864.1 CO361705.1 CF387652.1 CF402353.1
            CO174097.1 CF478545.1 CF386770.1
            70% to 75A1 

CYP75A15    Pinus taeda 
            GenEMBL CF400297.1 CO200490.1 CO172737.1
            CF385271.1 CO200407.1
            96% to 75A14

CYP75A16 Nierembergia sp.
         GenEMBL AB078514
         submitted to nomenclature committee 2/14/02
         flavonoid 3',5'-hydroxylase
         87% to 75A3

CYP75A17 Glycine max 
         GenEMBL AY117551.1
         flavonoid 3', 5'-hydroxylase
         76% to 75A1

CYP75A18v1  Solanum tuberosum (potato)
            GenEMBL AY675558.1, AY675559
            flavonoid 3',5'-hydroxylase
            85% to 75A1

CYP75A18v2  Solanum tuberosum (potato)
            GenEMBL AY675561.1, AY675560
            Jung,C.S., Griffiths,H.M., De Jong,D.M., Cheng,S., Bodis,M. and De
            The potato P locus codes for flavonoid 3',5'-hydroxylase
            Theor. Appl. Genet. 110 (2), 269-275 (2005)
            flavonoid 3',5'-hydroxylase
            98% to 75A18v1, 
            P-recessive allele

CYP75A18v3    Solanum tuberosum 
              flavonoid 3',5'-hydroxylase (P) gene, P-recessive allele
              98% to AY675558.1, 97% to AY675561.1

CYP75A18P     Solanum tuberosum 

CYP75A19v1 Verbena x hybrida 
           flavonoid 3',5'-hydroxylase
           74% to 75A1 

CYP75A19v1 Verbena x hybrida 
           GenEMBL AY566988
           100% to AY604727.1

CYP75A19v2   Verbena x hybrida cultivar Temari Violet
             GenEMBL AB234898
             Yoshikazu Tanaka
             Flavonoid 3',5'-hydoxylase 
             submitted to nomenclature committee Sept. 16, 2005
             2aa diffs to AY604727.1, 74% to 75A1

CYP75A20 Gossypium hirsutum 
         flavonoid 3',5'-hydroxylase
         77% to 75A1

CYP75A21 Delphinium grandiflorum 
         flavonoid 3'5'-hydroxylase
         72% to 75A1

CYP75A22 Vinca major 
         GenEMBL AB078781
         VFH gene for Flavonoid 3',5'-hydroxylase
         83% to Catharanthus roseus 75A8

CYP75A23     Verbena x hybrida cultivar Tapien Pink
             GenEMBL AB234899
             Yoshikazu Tanaka
             Flavonoid 3',5'-hydoxylase 
             submitted to nomenclature committee Sept. 16, 2005
             95% to 75A19v2

CYP75A24     Clitoria ternatea
             GenEMBL AB234897
             Yoshikazu Tanaka
             Flavonoid 3',5'-hydoxylase 
             submitted to nomenclature committee Sept. 16, 2005
             70% to 75A19, 80% to 75A17 Glycine max AY117551

CYP75A25     Cycas rumphii (Ceylon sago, a cycad)
             GenEMBL DR061629.1 iq01h03.g1 Cycas sporophyll (w/o ovule) (NYBG) 
             66% to 75A1, 53% to 75A11
             N-term only

CYP75A26     Camellia sinensis (Ericales)
             GenEMBL DQ194358
             flavonoid 3',5'-hydroxylase
             75% to 75A20 

CYP75A27        Gentiana scabra
                GenEMBL AB222604.1 
                flavonoid 3',5'-hydroxylase
                94% to 75A4 Gentiana triflora, probable ortholog

CYP75A27P1 pseudo   Gentiana scabra
                GenEMBL AB222605.1 
                F3',5'H pseudogene for flavonoid 3',5'-hydroxylase, 

CYP75A27P2 pseudo   Gentiana scabra
                GenEMBL AB222606.1 
                F3',5'H pseudogene for flavonoid 3',5'-hydroxylase, 

CYP75A28    Vitis vinifera (core eudicotyledons; Vitales)
            AJ880356, CAI54277 (protein, 508 aa)
            Bogs,J., Ebadi,A., McDavid,D. and Robinson,S.P.
            Identification of the Flavonoid Hydroxylases from Grapevine and
            Their Regulation during Fruit Development
            (er) Plant Physiol. (2005) In press
            89% to 75A20

CYP75A28    Vitis vinifera (grapevine)
            ABC48918.1 (239 aa fragment)
            1 aa diff

CYP75A28    Vitis vinifera (grapevine)
            ABC72066.1 (487 aa)
            3 aa diffs

CYP75A28    Vitis vinifera (grapevine)
            CAN82592.1 (449 aa)
            3 aa diffs

CYP75A28-de2b  Vitis vinifera (grapevine)

CYP75A29    Phalaenopsis hybrid cultivar
            Wang,J., Ming,F., Han,Y. and Shen,D.
            Flavonoid-3',5'-hydroxylase from Phalaenopsis: A Novel Member of
            Cytochrome P450s, its cDNA Cloning, Endogenous Expression and
            Molecular Modeling
            Biotechnol. Lett. 28 (5), 327-334 (2006)
            54% to 75A11, 53% to 75A21

CYP75A30   Carica papaya
           54% to 75A11, 
           76% to CYP75A28 Vitis AJ880356.1 (best blast hit)

CYP75A31   Solanum lycopersicum also Solanum lycopersicum (tomato)
           No accession number
           Kristine Olsen and Alain Hehn
           Submitted to nomenclature committee April 9, 2008
           94% to CYP75A18v2 potato 

CYP75A32P  Vitis vinifera 
           See Vitis page for sequence

CYP75A33   Vitis vinifera 
           See Vitis page for sequence

CYP75A34   Vitis vinifera 
           CAN81079.1, AM457118.1
           See Vitis page for sequence

CYP75A35   Vitis vinifera 
           CAN62887.1, AM437324.2
           See Vitis page for sequence

CYP75A36   Vitis vinifera 
           CAAP02004490.1, ABC86840.1,  DQ356236.1
           See Vitis page for sequence

CYP75A36   Vitis vinifera 
           ABC48919.1, DQ298204.1
           this seq is called VvF3'5'H-2a in Castellarin et al. BMC Genomics 2006
           See Vitis page for sequence

CYP75A36   Vitis vinifera 
           ABC48920.1, DQ298205.1
           this seq is called VvF3'5'H-2b in Castellarin et al. BMC Genomics 2006
           See Vitis page for sequence

CYP75A37P  Vitis vinifera 
           CAN60359.1, AM429113.2
           93% to CYP75A28 wrong N-term
           See Vitis page for corrected sequence

CYP75A37P  Vitis vinifera 
           CAAP02002140.1c  translation = CAO23867
           CAN60359.1 pseudogene
           missing the N-term not in next 15kb
           See Vitis page for corrected sequence

CYP75A38v1 Vitis vinifera 
           CAO63558.1, CAAP02005443.1
           See Vitis page for sequence

CYP75A38v2 Vitis vinifera 
           CAO68617.1, CU460585.1
           See Vitis page for sequence

CYP75A38v3 Vitis vinifera 
           CAN82588.1, AM436340.2a
           See Vitis page for sequence

CYP75A38v4 Vitis vinifera 
           ABH06585.1 translated from DQ786631.1
           See Vitis page for sequence

CYP75A38v5 Vitis vinifera 
           BAE47007.1, AB213606.1
           See Vitis page for sequence

CYP75A38v6 Vitis vinifera 
           ABC86841.1, DQ356237.1
           See Vitis page for sequence

CYP75A39Pv1 Vitis vinifera 
           CAO70765.1, CU460864.1, CAAP02008469.1
           See Vitis page for sequence

CYP75A39Pv2 Vitis vinifera 
           See Vitis page for sequence

CYP75A40P  Vitis vinifera 
           CAN60738.1, AM440112.2
           See Vitis page for sequence

CYP75A41   Vitis vinifera 
           See Vitis page for sequence

CYP75A41   Vitis vinifera 
           CAN82604.1, AM436584.2
           See Vitis page for sequence

CYP75A42   Vitis vinifera 
           See Vitis page for sequence

CYP75A43   Vitis vinifera 
           See Vitis page for sequence

CYP75A43   Vitis vinifera 
           See Vitis page for sequence

CYP75A44   Gossypium hirsutum
           ES792016.1 ES798131.1 DT553583.1 
           CO101056.1 Gossypium raimondii
           47% to 75B1 Arab, 80% to Vitis CYP75A38 DQ786631.1

CYP75A45   Glycine max (soybean, Fabales)

CYP75A46P  Glycine max (soybean, Fabales)

CYP75A46    Festuca rubra (red fescue)
            No accesion number
            Tengfang Huang 
            Submitted to nomenclature committee Oct. 2, 2009
            Clone 22
            82% to CYP75A1 rice

CYP75A47    Antirrhinum kelloggii (climbing snapdragon)
            Yoshikazu Tanaka
            Submitted to nomenclature committee Feb. 23, 2010
            79% to CYP75A23, 74% to CYP75A1

CYP75A48    Antirrhinum kelloggii (climbing snapdragon)
            Yoshikazu Tanaka
            Submitted to nomenclature committee Feb. 23, 2010
            98% to CYP75A47

CYP75A49    Brachypodium distachyon (temperate grass)

CYP75A50    Lavandula angustifolia (lavender)
            GenPept ADA34527, patent GP750950
            flavonoid 3',5'-hydroxylase
            74% to CYP75A19v1

CYP75A     Casuarina glauca (Fagales)
           GenEMBL CO038451.1 
           79% to 75A27, 63% to 75A11

CYP75B1     Arabidopsis thaliana
            GenEMBL AL133421 and AB005249 at end of cosmid
            GenEMBL AF241643 exon 1, AF241644 exon 2, AF241645 exon 3, AF241646 exon 4,
            GenEMBL AF241647 exon 1 mutant

CYP75B2     Petunia hybrida
            GenEMBL AF155332 
            Brugliera, F., Barri-Rewell, G., Holton, T.A. and Mason, J.G.
            Isolation and Characterization of a flavonoid 3'-hydroxylase cDNA clone 
            corresponding to the Ht1 locus of Petunia hybrida. 
            The Plant Journal, 19, 441-451 1999 
            Florigene Ltd.
            clone OGR-38    (67% identical to 75B1 N-terminal exon)
            submitted to nomenclature committee 6/9/98

CYP75B3   Oryza sativa (rice)
          GenEMBl AK064736.1 AC021892
          chromosome 10 clone 53D03 
          seq about 60% to 75B1 Missing part of N-term
          seq AK064736.1 is complete

CYP75B4      Perilla frutescens var. crispa (Lamiaceae) (an Asiatic mint that produces oil seeds, Red Perilla, 
             beefsteak plant, chinese basil, purple mint)
             GenEMBL AB045593
             C. Kitada, M. Yamazaki, Y. Tanaka and K. Saito
             69% to 75B2
             Flavonoid 3'-hydroxylase
             clone name SHT12

CYP75B5     Callistephus chinensis 
            GenEMBL AF313489
            Eder,C.M. and Forkmann,G.
            Callistephus chinensis flavonoid 3',5'-hydroxylase
            66% identical to CYP75B2

CYP75B6     Callistephus chinensis 
            GenEMBL AF313488
            Eder,C.M. and Forkmann,G.
            Callistephus chinensis putative flavonoid 3'-hydroxylase
            73% identical to CYP75B5

CYP75B7    Matthiola incana 
           GenEMBL AF313491
           Eder,C.M. and Forkmann,G.
           Matthiola incana flavonoid 3'-hydroxylase
           63% identical to 75B5

CYP75B8    Pelargonium x hortorum 
           GenEMBL AF315465
           Eder,C.M. and Forkmann,G.
           Sequence of flavonoid 3'-hydroxylase
           64% identical to 75B5

CYP75B9    Gentiana triflora (gentian)
           GenEMBL AB057673.1
           Yukiko Ueyama from Dr. Ohkawa's lab Kobe, Japan
           flavonoid 3'-hydroxylase (F3'H)
           submitted to nomenclature committee March 21, 2001
           71% identical to CYP75B2, 
           partial sequence missing the N-terminal
           note: Dr. Yoshikazu Tanaka indicates the Torenia hybrida name
           in this GenBank entry is incorrect. It is really Gentiana triflora 

CYP75B9    Gentiana triflora (gentian)
           GenEMBL AB193313.1
           Nakatsuka,T., Nishihara,M., Mishiba,K. and Yamamura,S.
           Temporal expression of flavonoid biosynthesis-related genes
           regulates flower pigmentation in gentian plants
           Plant Sci. 168, 1309-1318 (2005)
           Complete sequence

CYP75B10   Torenia hybrida (torenia hybrid)
           GenEMBL AB057672.1
           Yukiko Ueyama from Dr. Ohkawa's lab Kobe, Japan
           flavonoid 3'-hydroxylase (F3'H)
           submitted to nomenclature committee March 21, 2001
           67% identical to CYP75B2

CYP75B11   Oryza sativa (rice) NAME CONFLICT 75B4 CHANGE RICE TO 75B11
           GenEMBL AP008216.1 AK070442.1
8018942  DDRITDTEIKALIL  8018983

CYP75B12   Populus trichocarpa (black cottonwood)
           No accession number

CYP75B13   Pinus taeda (loblolly pine)
           GenEMBL CX650419.1 CX650345.1 CV036239.1 CF479071.1 
           CF664732.1 DN462800.1
           58% to CYP75B2

CYP75B14 Osteospermum hybrida (Asteraceae)
         GenEMBL DQ250711
         Seitz,C., Eder,C., Deiml,B., Kellner,S., Martens,S. and Forkmann,G.
         Cloning, functional identification and sequence analysis of
         flavonoid 3'-hydroxylase and flavonoid 3',5'-hydroxylase cDNAs
         reveals independent evolution of flavonoid 3',5'-hydroxylase in the
         Asteraceae family
         Plant Mol. Biol. 61 (3), 365-381 (2006)
         submitted to nomenclature committee 7/29/05
         69% to 75B1 84% to 75B6
         76% to Osteospermum_hybrida_F3'5'H (CYP75B17)
         F3'H flavonoid 3'-hydroxylase

CYP75B15 Gerbera hybrida (Asteraceae)
         GenEMBL DQ218417
         Seitz,C., Eder,C., Deiml,B., Kellner,S., Martens,S. and Forkmann,G.
         Cloning, functional identification and sequence analysis of
         flavonoid 3'-hydroxylase and flavonoid 3',5'-hydroxylase cDNAs
         reveals independent evolution of flavonoid 3',5'-hydroxylase in the
         Asteraceae family
         Plant Mol. Biol. 61 (3), 365-381 (2006)
         submitted to nomenclature committee 7/29/05
         67% to 75B1 81% to 75B6

CYP75B16 Hieracium_pilosella (Asteraceae)
         GenEMBL DQ319866.1
         Seitz,C., Eder,C., Deiml,B., Kellner,S., Martens,S. and Forkmann,G.
         Cloning, functional identification and sequence analysis of
         flavonoid 3'-hydroxylase and flavonoid 3',5'-hydroxylase cDNAs
         reveals independent evolution of flavonoid 3',5'-hydroxylase in the
         Asteraceae family
         Plant Mol. Biol. 61 (3), 365-381 (2006)
         submitted to nomenclature committee 7/29/05
         69% to 75B1 81% to AF313488 Callistephus chinensis (75B6)

CYP75B17 Osteospermum hybrida (Asteraceae)
         GenEMBL DQ257627.1
         Seitz,C., Eder,C., Deiml,B., Kellner,S., Martens,S. and Forkmann,G.
         Cloning, functional identification and sequence analysis of
         flavonoid 3'-hydroxylase and flavonoid 3',5'-hydroxylase cDNAs
         reveals independent evolution of flavonoid 3',5'-hydroxylase in the
         Asteraceae family
         Plant Mol. Biol. 61 (3), 365-381 (2006)
         submitted to nomenclature committee 7/29/05
         63% to 75B1 76% to 75B6

CYP75B18v1 Pericallis_cruenta (Asteraceae) also Senecio cruentus (Cineraria)
         GenEMBL AY791885.1 
         Meng,L., Ma,Y. and Dai,S.
         cDNA cloning and expression of F3'5'H from petals of 
         Senecio cruentus
         61% to 75B1 72% to 75B6 
         98% to CYP75B18v2, only 7 aa diffs

CYP75B18v2 Pericallis_cruenta (Asteraceae) also Senecio cruentus (Cineraria)
         GenEMBL DQ257626
         Seitz,C., Eder,C., Deiml,B., Kellner,S., Martens,S. and Forkmann,G.
         Cloning, functional identification and sequence analysis of
         flavonoid 3'-hydroxylase and flavonoid 3',5'-hydroxylase cDNAs
         reveals independent evolution of flavonoid 3',5'-hydroxylase in the
         Asteraceae family
         Plant Mol. Biol. 61 (3), 365-381 (2006)
         submitted to nomenclature committee 7/29/05
         61% to 75B1 72% to 75B6
         98% to AY791885.1 CYP75B18v1

CYP75B18v3      Pericallis cruenta 
                GenEMBL DQ672578
                Xiang,T. and Xu,J.
                A gene encoding flavonoid-3',5'-hydroxylase cloned from 
                Senecio cruentus
                4aa diffs to CYP75B18v2, 5 aa diffs to CYP75B18v1

CYP75B18v4   Pericallis_cruenta (Asteraceae) also Senecio cruentus (Cineraria)
             No accession number
             Yoshikazu Tanaka
             submitted to nomenclature committee 9/26/11
             clone name Ci5a18 
             61% to CYP75B1 Arabidopsis
             99% to AY791885.1 Pericallis cruenta flavonoid-3',5'-hydroxylase 
             CYP75B18v1 2 aa diffs
             99% to DQ257626.1 Pericallis cruenta flavonoid 3'5'-hydroxylase
             CYP75B18v2 4 aa diffs
             97% to CYP75B18v3 Pericallis cruenta DQ672578 (partial seq) 
             5 aa diffs

CYP75B19 Ipomoea nil Magenta
         GenEMBL AB113261.1
         mRNA for flavonoid 3'-hydroxylase

CYP75B19    Ipomoea nil (morning glory)
            AB113264.1 (gene)
            Hoshino,A., Morita,Y., Choi,J.D., Saito,N., Toki,K., Tanaka,Y. and
            Spontaneous mutations of the flavonoid 3'-hydroxylase gene
            conferring reddish flowers in the three morning glory species
            Plant Cell Physiol. 44 (10), 990-1001 (2003)
            flavonoid 3'-hydroxylase  magenta

CYP75B19    Ipomoea nil (morning glory)
            No accession number
            Eiishiro Ono
            Submitted to nomenclature committee 7/22/2010
            Clone name InF3'H
            100% to CYP75B19 AB113261.1, 65% to CYP75B1 Arab.

CYP75B20 Ipomoea purpurea Pink
         GenEMBL AB113262.1
         mRNA for flavonoid 3'-hydroxylase

CYP75B20    Ipomoea purpurea
            No accession number
            Eiishiro Ono
            Submitted to nomenclature committee 7/22/2010
            Clone name IpF3'H
            100% to CYP75B19 AB113262.1, 65% to CYP75B1 Arab.

CYP75B20v1  Ipomoea purpurea (morning glory)
            GenEMBL AY333419 
            Zufall,R.A. and Rausher,M.D.
            The Genetic Basis of a Flower Color Polymorphism in the Common
            Morning Glory (Ipomoea purpurea)
            J. Hered. 94 (6), 442-448 (2003)
            65% to 75B1, 96% to AB113261.1 75B19, 93% to 75B21
            flavonoid 3'-hydroxylase purple allele (normnal third exon)

CYP75B20v1  Ipomoea purpurea (morning glory)
            AB113265.1 (gene)
            Hoshino,A., Morita,Y., Choi,J.D., Saito,N., Toki,K., Tanaka,Y. and
            Spontaneous mutations of the flavonoid 3'-hydroxylase gene
            conferring reddish flowers in the three morning glory species
            Plant Cell Physiol. 44 (10), 990-1001 (2003)
            flavonoid 3'-hydroxylase  pink

CYP75B20v2  Ipomoea purpurea (morning glory)
            GenEMBL AY333420 
            Zufall,R.A. and Rausher,M.D.
            The Genetic Basis of a Flower Color Polymorphism in the Common
            Morning Glory (Ipomoea purpurea)
            J. Hered. 94 (6), 442-448 (2003)
            65% to 75B1, 96% to AB113261.1 75B19, 93% to 75B21
            flavonoid 3'-hydroxylase pink allele (insertion in third exon)

CYP75B20v2  Ipomoea purpurea (morning glory)
            AB113266.1 (gene)
            Hoshino,A., Morita,Y., Choi,J.D., Saito,N., Toki,K., Tanaka,Y. and
            Spontaneous mutations of the flavonoid 3'-hydroxylase gene
            conferring reddish flowers in the three morning glory species
            Plant Cell Physiol. 44 (10), 990-1001 (2003)
            flavonoid 3'-hydroxylase  pink mutant allele

CYP75B21 Ipomoea Ipomoea tricolor Fuchsia
         GenEMBL AB113263.1
         mRNA for flavonoid 3'-hydroxylase

CYP75B21    Ipomoea purpurea (morning glory)
            AB113268.1 (gene)
            Hoshino,A., Morita,Y., Choi,J.D., Saito,N., Toki,K., Tanaka,Y. and
            Spontaneous mutations of the flavonoid 3'-hydroxylase gene
            conferring reddish flowers in the three morning glory species
            Plant Cell Physiol. 44 (10), 990-1001 (2003)
            flavonoid 3'-hydroxylase fuchsia mutant allele.

CYP75B21    Ipomoea purpurea (morning glory)
            AB113267.1 (gene)
            Hoshino,A., Morita,Y., Choi,J.D., Saito,N., Toki,K., Tanaka,Y. and
            Spontaneous mutations of the flavonoid 3'-hydroxylase gene
            conferring reddish flowers in the three morning glory species
            Plant Cell Physiol. 44 (10), 990-1001 (2003)
            flavonoid 3'-hydroxylase fuchsia allele.

CYP75B21    Ipomoea tricolor (morning glory)
            No accession number
            Eiishiro Ono
            Submitted to nomenclature committee 7/22/2010
            Clone name ItF3'H
            100% to CYP75B19 AB113263.1, 65% to CYP75B1 Arab.

CYP75B22 Ipomoea quamoclit
         GenEMBL AY463157.1
         mRNA for flavonoid 3'-hydroxylase

CYP75B23v1 Glycine max (soybean) 
         GenEMBL AF499731.1, AF499730.1, AB061212.1, AF499735.1
         T-T allele tawny pubescence flavonoid 3'-hydroxylase
         69% to 75B2

CYP75B23v2P Glycine max (soybean) 
         GenEMBL AF499728, AF499729
         T-t allele pseudogene frameshift at PKG motif
         gray pubescence flavonoid 3'-hydroxylase
         frameshift = &

CYP75B24 Allium cepa (onion)
         GenEMBL AY541035.1
         flavonoid 3'-hydroxylase
         59% to 75B1

CYP75B25 Sorghum bicolor
         GenEMBL AY675075.1
         78% to 75B3 rice

CYP75B26     Verbena x hybrida cultivar Tapien Pink
             GenEMBL AB234900
             Yoshikazu Tanaka
             Flavonoid 3'-hydoxylase 
             submitted to nomenclature committee Sept. 16, 2005
             64% to 75B1, 73% to CYP75B4 AB045593 Perilla frutescens var. crispa

CYP75B27     Pinus taeda (loblolly pine)
             GenEMBL DR018310
             50% to CYP76A6 58% to 75B3 73% to 75B13

CYP75B28    Dianthus caryophyllus (Caryophyllales)
            GenEMBL DQ371290
            flavonoid 3'-hydroxylase-like gene
            66% to 75B1 

CYP75B29   Antirrhinum majus
           GenEMBL DQ272592.1 
           75% to 75B4 

CYP75B30   Verbena x hybrida
           GenEMBL AB234901.1
           Togami,J., Tamura,M., Ishiguro,K., Hirose,C., Okuhara,H.,
           Ueyama,Y., Nakamura,N., Yonekura-Sakakibara,K.,
           Fukuchi-Mizutani,M., Suzuki,K., Fukui,Y., Kusumi,T. and Tanaka,Y.
           Molecular characterization of the flavonoid biosynthesis of Verbena
           hybrida and the functional analysis of verbena and Clitoria
           ternatea F3'5'H genes in transgenic verbena
           Plant Biotechnol. 23, 5-11 (2006)
           79% to 75B29
           flavonoid 3'-hydroxylase 

CYP75B31   Ageratina adenophora (Asterales)
           GenEMBL AY954290
           75% to 75B1

CYP75B32v1  Vitis vinifera (core eudicotyledons; Vitales, shiraz)
            AJ880357, CAI54278.1 (protein)
            Bogs,J., Ebadi,A., McDavid,D. and Robinson,S.P.
            Identification of the Flavonoid Hydroxylases from Grapevine and
            Their Regulation during Fruit Development
            (er) Plant Physiol. (2005) In press
            67% to 75B1

CYP75B32v1  Vitis vinifera (grapevine, strain PN40024)
            CAAP02002732.1 7596-5384 (-) strand
            1 aa diff, same gene

CYP75B32v2  Vitis vinifera (grapevine, Pinot noir)
            CAN68303.1 AM471220.2 99% 
            5 aa diffs to shiraz CAI54278.1, 
            3 aa diffs to BAE47005.1 Cabernet

CYP75B32v3  Vitis vinifera (grapevine, Cabernet Sauvignon)
            flavonoid 3'-hydroxylase 
            99% 6 aa diffs to shiraz CAI54278.1, 
            4 aa diffs to ABH06586.1 Cabernet

CYP75B32v4  Vitis vinifera (grapevine, Cabernet Sauvignon)
            flavonoid 3' hydroxylase 
            99% 8 aa diffs to Shiraz CAI54278.1, 
            4 aa diffs to BAE47005.1 Cabernet

CYP75B32v4  Vitis vinifera (grapevine, Cabernet Sauvignon)
            BAE47006.1, AB213605.1
            flavonoid 3' hydroxylase 

CYP75B33    Trifolium pratense
            Isobe,S., Klimenko,I., Ivashuta,S., Gau,M. and Kozlov,N.N.
            First RFLP linkage map of red clover (Trifolium pratense L.) based
            on cDNA probes and its transferability to other red clover
            Theor. Appl. Genet. 108 (1), 105-112 (2003)
            flavonoid 3'-hydroxylase
            65% to 75B1 

CYP75B34    Sorghum bicolor 
            Shih,C.H. and Lo,C.
            Functional characterization of flavonoid 3'-hydroxylase genes in
            80% to 75B3, 96% to 75B36, 95% to 75B35

CYP75B35v1  Sorghum bicolor 
            Shih,C.H. and Lo,C.
            Functional characterization of flavonoid 3'-hydroxylase genes in
            79% to 75B3, 95% to 75B34, 94% to 75B36

CYP75B35v2  Sorghum bicolor 
            Boddu,J., Svabek,C., Sekhon,R.S., Gevens,A., Nicholson,R.L.,
            Jones,A.D., Pedersen,J.F., Gustine,D.L. and Chopra,S.
            Expression of a putative flavonoid 3'-hydroxylase in sorghum
            mesocotyls synthesizing 3-deoxyanthocyanidin phytoalexins
            Physiol. Mol. Plant Pathol. 65 (2), 101-113 (2004)
            3 aa diffs to 75B35v1, 78% to 75B3

CYP75B36    Sorghum bicolor 
            Shih,C.H. and Lo,C.
            Functional characterization of flavonoid 3'-hydroxylase genes in
            78% to 75B3, 96% to DQ787855, 94% to DQ787856

CYP75B37   Carica papaya
           61% to 75B3 Arab. 72% to 75B32 Vitis (top hit in GenBank)

CYP75B38    Vitis vinifera (grapevine, Cabernet Sauvignon)
            ABC48911.1, DQ298196.1
            flavonoid 3' hydroxylase 
            this seq is called VvF3'H-1a in Castellarin et al. BMC Genomics 2006

CYP75B38    Vitis vinifera (grapevine, Cabernet Sauvignon)
            ABC48912.1, DQ298197.1
            flavonoid 3' hydroxylase 
            this seq is called VvF3'H-1b in Castellarin et al. BMC Genomics 2006

CYP75B38    Vitis vinifera (grapevine, Cabernet Sauvignon)
            ABC48913.1, DQ298198.1
            flavonoid 3' hydroxylase 
            this seq is called VvF3'H-1c in Castellarin et al. BMC Genomics 2006

CYP75B38    Vitis vinifera (grapevine, Cabernet Sauvignon)
            ABC48914.1, DQ298199.1
            flavonoid 3' hydroxylase 
            this seq is called VvF3'H-1d in Castellarin et al. BMC Genomics 2006

CYP75B38    Vitis vinifera (grapevine, PN40024)
            CAO64444.1, CU459229.1,100% to CAN75347.1
            flavonoid 3' hydroxylase 
            1 aa diff to AB213603.1

CYP75B38-de3b  Vitis vinifera (grapevine)
            CU459229.1 1206 bp upstream of CAO64444
            Same as CAAP02002916.1-de3b C-term fragment

CYP75B38-de3c  Vitis vinifera (grapevine)
            Same as CAAP02002916.1-de3c C-term fragment

CYP75B38    Vitis vinifera (grapevine)
            flavonoid 3' hydroxylase 

CYP75B38    Vitis vinifera (grapevine)
            CAAP02002916.1  100% to CAN75347.1
            flavonoid 3' hydroxylase 

CYP75B38-de3b  Vitis vinifera (grapevine)
            CAAP02002916.1-de3b C-term fragment

CYP75B38-de3c  Vitis vinifera (grapevine)
            CAAP02002916.1-de3c  C-term fragment

CYP75B38    Vitis vinifera (grapevine)
            BAE47004.1, AB213603.1
            flavonoid 3' hydroxylase 

CYP75B39P   Vitis vinifera (grapevine)
            ABC48915.1, DQ298200.1
            flavonoid 3' hydroxylase 

CYP75B39P   Vitis vinifera (grapevine)
            BAE47003.1, AB213602.1
            flavonoid 3' hydroxylase 

CYP75B39P   Vitis vinifera (grapevine)
            CAN62275.1, AM488740.1
            flavonoid 3' hydroxylase 

CYP75B40    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 9/26/2008
            Clone A1
            75% to 75B23v1

CYP75B41    Glycine max (soybean, Fabales)

CYP75B42P   Glycine max (soybean, Fabales)

CYP75B43    Glycine max (soybean, Fabales)

CYP75B44P   Glycine max (soybean, Fabales)

CYP75B45P   Glycine max (soybean, Fabales)

CYP75B46    Glycine max (soybean, Fabales)

CYP75B47P   Glycine max (soybean, Fabales)

CYP75B48    Ocimum basilicum (sweet basil, Lamiaceae)
            No accession number
            Anna Berim, David R. Gang
            Submitted to nomenclature committee June 24, 2009
            Basil_0431, putative flavone 3«-hydroxylase
            63% to CYP75B1 Arabidopsis,
            77% to CYP75B29 Antirrhinum majus flavonoid-3'-hydroxylase DQ272592.1

CYP75B49    Solanum lycopersicum (tomato, Solanales)
            No accesion number
            A. Hehn
            Submitted to nomenclature committee Jan. 8, 2010

CYP75B49    Solanum tuberosum (potato)

CYP75B50    Antirrhinum kelloggii (climbing snapdragon)
            Yoshikazu Tanaka
            Submitted to nomenclature committee Feb. 23, 2010
            90% to CYP75B29

CYP75B51    Brachypodium distachyon

CYP75B52    Brachypodium distachyon

CYP75B53    Brachypodium distachyon

CYP75B54    Brachypodium distachyon

CYP75B55    Calystegia soldanella (Solanales; Convolvulaceae) 
            Japanese sand dune plant
            No accession number
            Eiishiro Ono
            Submitted to nomenclature committee 7/22/2010
            Clone name Cs F3'H-like
            64% to CYP75B1 Arab.

CYP75B56    Calystegia pubescens (Solanales; Convolvulaceae) 
            No accession number
            Eiishiro Ono
            Submitted to nomenclature committee 7/22/2010
            Clone name Cp F3'H-like
            65% to CYP75B1 Arab.

CYP75B57   Zea mays (maize)
           ESTs: EE181307.2, DR814647.1
           N-term = EB816452.1, C-term = FL449487.1
           58% to CYP75B1 Arabidopsis, 80% to CYP75B3 rice
           formerly named CYP75B49 but 5that was already assigned to tomato

CYP75B58     Pericallis_cruenta (Asteraceae) also Senecio cruentus (Cineraria)
             No accession number
             Yoshikazu Tanaka
             submitted to nomenclature committee 9/26/11
             clone name Ci5a13 
             69% to CYP75B1 Arab. 73% to CYP75B59
             90% to CYP75B59 AB550253.1 Gynura bicolor GbF3'H mRNA for flavonoid 
             3' hydroxylase
             86% to CYP75B14 DQ250711.1  Osteospermum hybrid cultivar flavonoid 3     
             85% to CYP75B60 FJ753548.1  Cichorium intybus flavonoid 3'hydroxylase
             84% to CYP75B16 Hieracium_pilosella (Asteraceae) DQ319866.1

CYP75B59   Gynura bicolor (Okinawan spinach)
           GbF3'H mRNA for flavonoid 3' hydroxylase 

CYP75B60   Cichorium intybus (chicory)
           flavonoid 3'-hydroxylase

CYP75B61    Nelumbo nucifera (sacred lotus, Proteales)
CYP75B62    Nelumbo nucifera (sacred lotus, Proteales)
CYP75B63    Ricinus communis (castor bean, Malpighiales)
CYP75B63    Jatropha curcas  (Malpighiales)
CYP75B64    Catharanthus roseus (Madagascar periwinkle, Gentianales)

CYP75B65    Podophyllum species (Ranunculales)
            No accession number
            Joaquim Vogt Marques
            Submitted to nomenclature committee August 3, 2012
            74% to CYP75B32v1 Vitis
            68% to CYP75B63 Ricinus communis (castor bean, Malpighiales)

CYP75B66    Cichorium intybus (chicory, Asterales)
            No accession number
            Christian Seitz
            Submitted to nomenclature committee August 25, 2012
            81% to CYP75B60 Cichorium intybus

CYP75B67    Cichorium intybus (chicory, Asterales)
            No accession number
            Christian Seitz
            Submitted to nomenclature committee August 25, 2012
            90% to CYP75B16 Hieracium pilosella

CYP75B68    Echinops bannaticus (medicinal plant, Asterales)
            Christian Seitz
            Submitted to nomenclature committee August 25, 2012
            83% to CYP75B60 Cichorium intybus

CYP75B69    Echinops bannaticus (medicinal plant, Asterales)
            No accession number
            Christian Seitz
            Submitted to nomenclature committee August 25, 2012
            79% to CYP75B60 Cichorium intybus
            82% to CYP75B68 Echinops bannaticus

CYP75B70    Centraurea cyanus (blue cornflower, Asterales)
            No accession number
            Christian Seitz
            Submitted to nomenclature committee August 25, 2012
            82% to CYP75B60 Cichorium intybus
            82% to CYP75B68 Echinops bannaticus

CYP75B71    Taraxacum officinalis (dandylion, Asterales)
            No accession number
            Christian Seitz
            Submitted to nomenclature committee August 25, 2012
            86% to CYP75B60 Cichorium intybus

CYP75B72    Lactuca sativa (lettuce, Asterales)
            No accession number
            Christian Seitz
            Submitted to nomenclature committee August 25, 2012
            90% to CYP75B60 Cichorium intybus

CYP75B73    Helianthus tuberosus (Jerusalem artichoke, Asterales)
            No accession number
            Christian Seitz
            Submitted to nomenclature committee August 25, 2012
            84% to CYP75B60 Cichorium intybus

CYP75B74    Sollya heterophylla (Australian bluebell creeper, Apiales)
            FW556954.1 (patent)
            Christian Seitz
            Submitted to nomenclature committee August 25, 2012
            72% to CYP75B32v1 Vitis vinifera
            73% to CYP75B2 Petunia x hybrida

CYP75B frag.  Triticum aestivum cultivar Blue-58 
              Yang,G., Li,B., Gao,J., Liu,J. and Li,Z.
              flavonoid 3'-hydroxylase mRNA,
              81% to 75B36 C-term

CYP75B        Persea Americana (avocado, magnoliids)
              FD508510.1 75% to CYP75B20, 70% to 75B1

CYP75B Frag.  Lupinus cosentinii
              Ratanasanobon,K. and Wylie,S.J.
              flavonoid 3'-hydroxylase 1
              67% to 75B1 

CYP75B frag.  Glycine max (soybeans, Fabales)
              Zabala,G. and Vodkin,L.
              Cloning of the pleiotropic T locus in soybean and two recessive
              alleles that differentially affect structure and expression of the
              encoded flavonoid 3' hydroxylase
              Genetics 163 (1), 295-309 (2003)
              defective flavonoid 3'-hydroxylase
              100% to CYP75B23v1, 62% to 75B1 

CYP75B frag.  Lotus corniculatus
              Allison,G.G. and Robbins,M.P.
              Molecular design of condensed tannins in higher plants: new
              strategies for the genetic modification of polymer structure
              flavonoid 3' hydroxylase 1
              65% to 75B1 

CYP75B frag.   Glycine max (soybeans, Fabales)
               Zabala,G. and Vodkin,L.
               Cloning of the pleiotropic T locus in soybean and two recessive
               alleles that differentially affect structure and expression of the
               encoded flavonoid 3' hydroxylase
               Genetics 163 (1), 295-309 (2003)
               flavonoid 3'-hydroxylase
               100% to CYP75B23v1, 73% to 75B1 

CYP75B frag.  Ageratina adenophora (Asterales)
            Wang,D.-L., Guo,J.-Y., Xie,B.-Y. and He,L.-F.
            Clone and identification of a cDNA fragment of CYP75 gene from
            Eupatorium adenophorum
            Zhi Wu Bao Hu Xue Hui Hui Kan 31 (3) (2005) In press
            75% to 75B1

CYP75B     Prunus persica (peach, Rosales) 
           GenEMBL BU048897
           72% to CYP75B3 

CYP75B     Actinidia deliciosa (Kiwifruit, Ericales)
           FG468164.1 57% to 93A4, 75% to 75B1 Arab

CYP75B?     Amborella trichopoda
            GenEMBL CD482391 EST N-term

CYP75B     Citrus clementina (Sapindales)
           GenEMBL DY269620 EST
           65% to 75B1 

CYP75B       Kalanchoe blossfeldiana (Saxifragales)
             GenEMBL DQ012097.1 
             66% to 75B1 
             flavonoid 3'-hydroxylase (mid region)

CYP75?       Adiantum capillus-veneris (fern)
             GenEMBL BP921525
             53% to 75A11, 54% to 92A11, 53% to 76C4

76A Subfamily

CYP76A1     Solanum melongena cv. Sinsadoharanasu (eggplant)
            GenEMBL X71658 (1571bp) Swiss P37121 (467 amino acids)
            PIR S38535 (467 amino acids)
            Toguri,T., Kobayashi,O. and Umemoto,N.
            The cloning of eggplant seedling cDNAs encoding proteins from a
            novel cytochrome P450 family (CYP76)
            Biochim. Biophys Acta 1216, 165-169 (1993)
            Note: clone name F94 also called CYPEG8

CYP76A2     Solanum melongena cv. Sinsadoharanasu (eggplant)
            GenEMBL X71657 (1827bp) Swiss P37122 (505 amino acids)
            PIR S38534 (505 amino acids)
            Toguri,T., Kobayashi,O. and Umemoto,N.
            The cloning of eggplant seedling cDNAs encoding proteins from a
            novel cytochrome P450 family (CYP76)
            Biochim. Biophys Acta 1216, 165-169 (1993)
            Note: clone name G17 also called CYPEG7.

CYP76A3     Petunia
            GenEMBL AB016060
            Hiromasa Imaishi
            submitted to nomenclature committee 6/22/98
            clone IMT-4 64% identical to 76A2

CYP76A4     Petunia
            GenEMBL AB016061
            Hiromasa Imaishi
            submitted to nomenclature committee 6/22/98
clone IMT-6 63% identical to 76A1 and 76A3

CYP76A5      Petunia
            no accession number
            Hiromasa Imaishi
            submitted to nomenclature committee 1/5/99
            clone IMT-9 66% identical to 76A1 and 76A2

CYP76A6      tomato
            GenEMBL ESTs only
AI779370  EST260249 cLES7J14
AI779369  EST260248 cLES7J14
AI488667  EST247006 cLED18N24
AI895030  EST264473 cLEC6H17
AI771692  EST252792 cLED34O18
AI774262  EST255457 cLER12I1 5 prime end = ARG10 homolog on reverse strand
AI779703  EST260582 cLES8J16
AI895857  EST265300 cLEC10E22
AI777873  EST258752 cLES3C24
AI777872  EST258751 cLES3C24
85% identical to 76A2

CYP76A6      Solanum tuberosum (potato)

CYP76A7      Catharanthus roseus (Madagascar periwinkle)
             No accession number
             Joachim Schroeder
             54% identical to 76A4 and 76A5
             submitted to nomenclature committee Aug. 2, 2000 

CYP76A8        Populus trichocarpa (Black cottonwood) 
CYP76A9P       Populus trichocarpa (Black cottonwood) 
CYP76A9P-de2b  Populus trichocarpa (Black cottonwood) 

CYP76A10    Vitis vinifera (Pinot noir grape)
            GenEMBL AM451133.2

CYP76A11   Carica papaya
           59% to Vitis 76A10 
           59% to CYP76A4 AB016061.1  Petunia x hybrida IMT-6, 
           47% to 76G1

CYP76A12   Vitis vinifera (grape)
           CAN77399.1 AM476034.2
           See Vitis pages for sequence

CYP76A13   Vitis vinifera (grape)
           CAN77400.1 AM476034.2
           See Vitis pages for sequence

CYP76A14P  Vitis vinifera (grape)
           See Vitis pages for sequence

CYP76A15   Vitis vinifera (grape)
           CAN76783.1, CAAP02013124.1 
           See Vitis pages for sequence

CYP76A15-de2b  Vitis vinifera (grape)

CYP76A16   Vitis vinifera (grape)
           CAN76784.1, CAAP02000672.1a
           See Vitis pages for sequence

CYP76A17P  Vitis vinifera (grape)
           See Vitis pages for sequence

CYP76A18   Glycine max (soybean, Fabales)

CYP76A19   Solanum lycopersicum (tomato, Solanales)
CYP76A19   Solanum tuberosum (potato)
CYP76A20   Solanum lycopersicum (tomato, Solanales)
CYP76A20   Solanum tuberosum (potato)
CYP76A21   Solanum lycopersicum (tomato, Solanales)
CYP76A21   Solanum tuberosum (potato)
CYP76A22   Solanum lycopersicum (tomato, Solanales)
CYP76A22   Solanum tuberosum (potato)
CYP76A23Pv1   Solanum lycopersicum (tomato, Solanales)
CYP76A23Pv2   Solanum lycopersicum (tomato, Solanales)
CYP76A23   Solanum tuberosum (potato)
CYP76A24   Solanum tuberosum (potato)
CYP76A25   Solanum tuberosum (potato)

CYP76A26   Catharanthus roseus
           No accession umber
           Daniele Werck Reichhart
           submitted to nomenclature committee Feb. 20, 2012
           59% to CYP76A16 Vitis vinifera

76B Subfamily

CYP76B1     Helianthus tuberosus (Jerusalem artichoke)
            GenEMBL Y09920 (1742bp) Y10098 (1685bp)
            Batard,Y., LeRet,M., Schalk,M., Zimmerlin,A., Durst,F. and
            Molecular cloning and functional expression in yeast of CYP76B1, a
            xenobiotic-inducible 7-ethoxycoumarin O-deethylase from Helianthus
            unpublished (1997)

CYP76B2     petunia
            no accession number
            Hiromasa Imaishi
            submitted to nomenclature committee

CYP76B3X    Medicago sativa (alfalfa)
            no accession number
            Chris Steele
            clone TF26
            submitted to nomenclature committee
            renamed CYP76F5

CYP76B4X    Medicago sativa (alfalfa)
            no accession number
            Chris Steele
            clone A231
            submitted to nomenclature committee
            sequence below released directly from Chris Steele
            This sequence is not in Genbank (1/19/01)
            renamed CYP76F6

19 A231 76B4 Length: 509  July 30, 1997 Medicago sativa (alfalfa)

CYP76B5     petunia
            GenEMBL AB016062
            Hiromasa Imaishi
            submitted to nomenclature committee 9/26/98
            IMT-7 56% identical to 76B1, 62% identical to 76B2

CYP76B6     Catharanthus roseus (Madagascar periwinkle)
            mRNA for geraniol 10-hydroxylase (g10h gene)
            Collu,G., Unver,N., Peltenburg-Looman,A.M., van der Heijden,R.,
            Verpoorte,R. and Memelink,J.
            Geraniol 10-hydroxylase, a cytochrome P450 enzyme involved in
            terpenoid indole alkaloid biosynthesis
            FEBS Lett. 508 (2), 215-220 (2001)
            submitted to nomenclature committee 1/14/99
            67% identical to 76B2, 66% to 76B5, 53% with 76B3 and 76B4,  
            61% with 76B1

CYP76B7    Pastinaca sativa (wild parsnip, Apilaes)
           GenEMBL AF479661.1
           Art Zangerl and May Berenbaum
           See webworms and parsnips website
             40% to 76A7 54% to 76B1 58% to 76B2 50% to 76B3 50% to 76B4 57% to 76B5 61% to 76B6 
             48% to 76C2 42% to 76D1 48% to 76E1 49% to 76F1 54% to 76F2 38% to 76G1 43% to 76H1 
             and 76H2 53% to 76J1
           submitted to nomenclature committee 1/29/02

CYP76B8     Ammi majus L. , Apiaceae (Bishops weed)
            GenEMBL AY532372.1
            Silvia Heubner
            Submitted to nomenclature committee 9/25/2003
            60% to 76B7 
            clone name sequence 4

CYP76B9     Petunia
            GenEMBL AB265193
            Hiromasa Imaishi
            CYP76J1, a Cytochrome P450 from Petunia hybrida, Catalyzes the
            w-Hydroxylation of Capric Acid and Lauric Acid. Effects of Fatty
            Acids on Growth of Higher Plants
            submitted to nomenclature committee 7/24/98
            clone IMT-8 
            Renamed CYP76B9 from CYP76J1 (1/7/2005)

CYP76B10    Swertia mussotii (Gentianales)
            Junfeng Wang
            submitted to nomenclature committee 1/09/2010
            80% to CYP76B6

CYP76B11   Solanum lycopersicum (tomato, Solanales)
CYP76B11P  Solanum tuberosum (potato)
CYP76B12   Solanum lycopersicum (tomato, Solanales)
CYP76B12-de3b   Solanum lycopersicum (tomato, Solanales)
CYP76B12-de3c   Solanum lycopersicum (tomato, Solanales)
CYP76B12P  Solanum tuberosum (potato)
CYP76B13   Solanum lycopersicum (tomato, Solanales)
CYP76B13-de1b   Solanum lycopersicum (tomato, Solanales)
CYP76B13-de3b   Solanum lycopersicum (tomato, Solanales)
CYP76B13-de3c   Solanum lycopersicum (tomato, Solanales)
CYP76B13a  Solanum tuberosum (potato)
CYP76B13b  Solanum tuberosum (potato)
CYP76B14P  Solanum lycopersicum (tomato, Solanales)
CYP76B15P  Solanum lycopersicum (tomato, Solanales)
CYP76B16P  Solanum lycopersicum (tomato, Solanales)
CYP76B17   Solanum lycopersicum (tomato, Solanales)
CYP76B17   Solanum tuberosum (potato)
CYP76B18   Solanum lycopersicum (tomato, Solanales)
CYP76B18-de3b  Solanum lycopersicum (tomato, Solanales)
CYP76B19   Solanum lycopersicum (tomato, Solanales)
CYP76B20P  Solanum lycopersicum (tomato, Solanales)
CYP76B21   Solanum lycopersicum (tomato, Solanales)
CYP76B21a  Solanum tuberosum (potato)
CYP76B21b  Solanum tuberosum (potato)
CYP76B22P  Solanum lycopersicum (tomato, Solanales)
CYP76B23   Solanum lycopersicum (tomato, Solanales)
CYP76B23   Solanum tuberosum (potato)
CYP76B24   Solanum lycopersicum (tomato, Solanales)
CYP76B24   Solanum tuberosum (potato)
CYP76B25   Solanum lycopersicum (tomato, Solanales)
CYP76B25-de2b3b   Solanum lycopersicum (tomato, Solanales)
CYP76B25   Solanum tuberosum (potato)
CYP76B26   Solanum lycopersicum (tomato, Solanales)
CYP76B26   Solanum tuberosum (potato)
CYP76B27P  Solanum lycopersicum (tomato, Solanales)
CYP76B27P  Solanum tuberosum (potato)
CYP76B28   Solanum lycopersicum (tomato, Solanales)
CYP76B28P  Solanum tuberosum (potato)
CYP76B29P  Solanum lycopersicum (tomato, Solanales)
CYP76B30   Solanum lycopersicum (tomato, Solanales)
CYP76B30   Solanum tuberosum (potato)
CYP76B31P  Solanum lycopersicum (tomato, Solanales)
CYP76B32P  Solanum lycopersicum (tomato, Solanales)
CYP76B32P  Solanum tuberosum (potato)
CYP76B33P  Solanum lycopersicum (tomato, Solanales)
CYP76B34   Solanum tuberosum (potato)
CYP76B34-de1b   Solanum tuberosum (potato)
CYP76B35P  Solanum tuberosum (potato)
CYP76B36P  Solanum tuberosum (potato)
CYP76B37P  Solanum tuberosum (potato)
CYP76B38   Solanum tuberosum (potato)
CYP76B39P  Solanum tuberosum (potato)
CYP76B40Pa Solanum tuberosum (potato)
CYP76B40Pb Solanum tuberosum (potato)
CYP76B41Pa Solanum tuberosum (potato)
CYP76B41Pb Solanum tuberosum (potato)
CYP76B42Pa Solanum tuberosum (potato)
CYP76B42b  Solanum tuberosum (potato)
CYP76B43   Solanum tuberosum (potato)
CYP76B44P  Solanum tuberosum (potato)
CYP76B45   Solanum tuberosum (potato)
CYP76B46P  Solanum tuberosum (potato)
CYP76B47P  Solanum tuberosum (potato)
CYP76B48   Solanum tuberosum (potato)
CYP76B49P  Solanum tuberosum (potato)
CYP76B50   Solanum tuberosum (potato)
CYP76B50-de3b  Solanum tuberosum (potato)
CYP76B51   Solanum tuberosum (potato)
CYP76B52   Solanum tuberosum (potato)
CYP76B53P  Solanum tuberosum (potato)
CYP76B53P-de3b  Solanum tuberosum (potato)
CYP76B54   Solanum tuberosum (potato)
CYP76B55   Solanum tuberosum (potato)
CYP76B56P  Solanum tuberosum (potato)
CYP76B57P  Solanum tuberosum (potato)

CYP76B58    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            52% TO CYP76B4 Medicago sativa
            63% t0 CYP76B8 Ammi majus 

CYP76B      Catharanthus roseus (Madagascar periwinkle) PCR fragment
            GenEMBL AM232344.1  
            100% to X69784, 60% to 76B6
            GenEMBL X69784 (294bp) 76C-like
            Meijer,A.H., Souer,E., Verpoorte,R. and Hoge,J.H.C.
            Isolation of cytochrome P-450 cDNA clones from the higher plant
            Catharanthus roseus by a PCR strategy.
            Plant Molec. Biol. 22, 379-383 (1993)
            Note: sequence 12 from Fig. 2. 53% to 76C2

CYP76B frag.  Digitalis lanata (Lamiales)
            Barthelson,R.A., Galbraith,D.W. and Woosley,R.
            Development of a Comprehensive Assay for Medicinal Plant Species
            67% to 76B5

CYP76B frag.  Tanacetum vulgare (Asterales)
            Barthelson,R.A., Galbraith,D.W. and Woosley,R.
            Development of a Comprehensive Assay for Medicinal Plant Species
            72% to 76B1

CYP76       Aquilegia formosa x Aquilegia pubescens (Ranunculales)
            GenEMBL DT762735.1 
            54% to 76B6

CYP76B      Apium graveolens (Apiales)
            81% to 76B7, 54% to CYP80C1

76C Subfamily

CYP76C1     Arabidopsis thaliana
            GenEMBL AC003680 F17K2.9  Also D78600
            Mizutani,M., Ward,E. and Ohta,D.
            Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
            cDNAs, differential expression, and RFLP mapping of multiple
            cytochromes P450
            Plant Mol. Biol. 37, 39-52 (1998)

CYP76C2     Arabidopsis thaliana
            GenEMBL AC003680 F17K2.10
            ESTS H37250, T04013, T04014, T04015, T04016, T04017, Z33828, Z34697

CYP76C3     Arabidopsis thaliana
            GenEMBL AC003680 F17K2.11
            no ESTs

CYP76C4     Arabidopsis thaliana
            GenEMBL AC003680 F17K2.8

CYP76C5     Arabidopsis thaliana
            GenEMBL AC010164 93429-96444
            clone F14M2

CYP76C6     Arabidopsis thaliana
            GenEMBL AC010164 comp(88950-90642)
            clone F14M2

CYP76C7    Arabidopsis thaliana
      No accession number yet
      clone T27I15 contig 5 from European Chr. 3 project 
      contains CYP76C7 and CYP76C8P

CYP76C8P    Arabidopsis thaliana
      No accession number yet
      clone T27I15 contig 5 from European Chr. 3 project 
      contains CYP76C7 and CYP76C8P

CYP76      Prunus persica (peach, Rosales)
           GenEMBL AJ826943
           61% to 76C4 

CYP76       Gossypium hirsutum (cotton, Malvales)
            GenEMBL DT464363.1 EST
            56% to 76C4

CYP76      Beta vulgaris (beet, Caryophyllales)
           GenEMBL BQ582634.1 
           59% to 76C7, 56% to 76B6

CYP76     Citrus clementina (Sapindales)
          GenEMBL DY300993.1 
          54% to 76C4

CYP76      Cyclamen persicum (Ericales)
           GenEMBL AJ887863.1 
           60% to 76A2

76D Subfamily

CYP76D1     Cicer arietinum (chickpea)
            GenEMBL AB032833 (1310 bp)
            Overkamp,S., Hein,F. and Barz,W.
            Cloning and characterization of elicitor induced cytochrome P450s
            from chickpea cell suspension cultures
            Unpublished (1999)

CYP76D1     Cicer arietinum   (chickpea)
            GenEMBL AB026263
            Ichinose,Y., Tiemann,K., Schwenger-Erger,C., Toyoda,K., Hein,F.,
            Hanselle,T. and Barz,W.
            Genes Expressed in Ascochyta rabiei-Inoculated-Chickpea Plants and
            Elicited Cell Cultures as Detected by Differential
            Unpublished (1999) internal fragment from C-helix on 
            most like 76B (35%)

CYP76E1     Medicago sativa (alfalfa)
            no accession number
            Chris Steele
            clone A11
            submitted to nomenclature committee
            sequence below released directly from Chris Steele
            This sequence is not in Genbank (1/19/01)
            From Chris Steele (5/15/98) alfalfa 76E1 
            searched nr 4/1/2000
                 CO513758.1 EST 2 aa diffs

CYP76E1     Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ335808, DQ335812 GenPept ABC59103, ABC59107
            Ortholog to M. sativa 76E1 (94%)

CYP76E2     Medicago truncatula (barrel medic, Fabales)
            GenEMBL ESTs CA917001.1 (aa 40-316) CA918016.1 (aa 244-448),
            GSS seq. CG923322.1 (aa 90-289)
            TIGR contig TC107627

CYP76E3     Glycine max (soybeans, Fabales)
            GenEMBL DQ340250 EST CA937279
            JGI Glyma0 assembly Scaffold_108 60% to 76E5

CYP76E4     Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 9/26/2008
            Clone A2
            62% to 76E3, 77% to 76E5

CYP76E5     Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 9/26/2008
            Clone A3
            60% to 76E3, 77% to 76E4

CYP76E5-de2b  Glycine max (soybean, Fabales)

CYP76E5-de1c2c  Glycine max (soybean, Fabales)

CYP76E5-de2d Glycine max (soybean, Fabales)

CYP76E6P    Glycine max (soybean, Fabales)

CYP76E7P    Glycine max (soybean, Fabales)

CYP76E8     Glycine max (soybean, Fabales)

CYP76E8-de2b  Glycine max (soybean, Fabales)

CYP76E9P    Glycine max (soybean, Fabales)

CYP76E10P   Glycine max (soybean, Fabales)

CYP76E11P   Glycine max (soybean, Fabales)

CYP76E12P   Glycine max (soybean, Fabales)

CYP76E13P   Glycine max (soybean, Fabales)

CYP76E14P   Glycine max (soybean, Fabales)

CYP76E15P   Glycine max (soybean, Fabales)

CYP76E16P   Glycine max (soybean, Fabales)

CYP76E17P   Glycine max (soybean, Fabales)

CYP76F1     Cicer arietinum
            GenEMBL AJ249799, AJ249802
            Stefan Overkamp and Wolfgang Barz
            submitted to nomenclature committee 9/27/99
            41% to 76A1, 46% to 76B1, 44% to 76C2, 46% to 76D1, 47% to 76E1
            This sequence is identical to CYP81D9.  Both are partial sequences
            One of the names needs to be retired.  

CYP76F2     Vitis vinifera (grapevine)
            GenEMBL AJ237995
            Davies,C. and Robinson,S.P.
            Differential screening indicates a dramatic change in mRNA 
            Profiles during grape berry ripening. Cloning and characterization 
            of cDNAs encoding putative cell wall and stress response proteins.
            Plant Physiol. 122, 803-812 (2000)
            mRNA for putative ripening-related P-450 enzyme (gfh2 gene)
            53% identical to CYP76F1

CYP76F2     Vitis vinifera (grapevine)
            CAB85635.1 (protein) 100% to AJ237995 (gfh2)
            putative ripening-related P-450 enzyme

CYP76F3     Populus trichocarpa (black cottonwood)
CYP76F4     Populus trichocarpa (black cottonwood)

CYP76F5     Medicago sativa (alfalfa)
            no accession number
            Chris Steele
            clone TF26
            submitted to nomenclature committee
            renamed CYP76F5 from CYP76B3

CYP76F6     Medicago sativa (alfalfa)
            no accession number
            Chris Steele
            clone A231
            submitted to nomenclature committee
            sequence below released directly from Chris Steele
            This sequence is not in Genbank (1/19/01)
            renamed CYP76F6 from CYP76B4

CYP76F7    Hypericum androsaemum (sweet-amber or tutsan) a plant in Malpighiales
           GenEMBL AY596977 
           Schwarz,H. and Beerhues,L.
           Molecular cloning of cytochrome P450 from Hypericum androsaemum
           cytochrome P450 mRNA, complete cds.
           46% to CYP76H4 47% to CYP76S1 52% to CYP76B6
           renamed CYP76F7 from CYP76R1

CYP76F8   Carica papaya
          supercontig_29:416698..418279 (- strand)
          60% to 76F2 Vitis (best blast hit), 
          46% to 76H5 rice, 48% to 76C4

CYP76F9P  Carica papaya
          59% to 76F8 C-term

CYP76F10P  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76F11  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76F11  Vitis vinifera (grapevine)
          CAN72997.1, AM480526.2
          See Vitis pages for sequence

CYP76F12  Vitis vinifera (grapevine)
          CAAP02002347.1d = CAN79423.1
          See Vitis pages for sequence

CYP76F13P Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76F14  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76F15  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76F16    Cicer arietinum (chickpea, Fabales)
            Entrez Protein CAB56741

CYP76F17    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 9/26/2008
            Clone A8, C30, C54
            59% to 76F16, 56% to 76F12

CYP76F18    Glycine max (soybean, Fabales)

CYP76F19P   Glycine max (soybean, Fabales)

CYP76F20P   Glycine max (soybean, Fabales)

CYP76F21P   Glycine max (soybean, Fabales)

CYP76F22    Glycine max (soybean, Fabales)

CYP76F23    Glycine max (soybean, Fabales)

CYP76F24    Glycine max (soybean, Fabales)

CYP76F25P   Glycine max (soybean, Fabales)

CYP76F26P   Glycine max (soybean, Fabales)

CYP76F27P   Glycine max (soybean, Fabales)

CYP76F28P   Glycine max (soybean, Fabales)

CYP76F29P   Glycine max (soybean, Fabales)

CYP76F30P   Glycine max (soybean, Fabales)

CYP76F      Pisum sativum (pea, Fabales)
            84% to 76F1, 58% to 76C4, 54% to CYP80C1, 

CYP76G1     Arabidopsis thaliana
            GenEMBL AL132966
            F08J02 from the EU Chr 3 project comp(64780-66639)

CYP76G2        Populus trichocarpa (Black cottonwood)
CYP76G3        Populus trichocarpa (Black cottonwood)
CYP76G4        Populus trichocarpa (Black cottonwood)
CYP76G5        Populus trichocarpa (Black cottonwood)
CYP76G-se1[2]  Populus trichocarpa (Black cottonwood) 
CYP76G-se2[1]  Populus trichocarpa (Black cottonwood) 

CYP76G6     Vitis vinifera (Pinot noir grape)
            GenEMBL AM452176.2  
            67% to 76G1, 100 to CAN76624.1

CYP76G7   Carica papaya
          61% to 76G1 Arab., 76% to CYP76G6 Vitis vinifera best GenBank hit
          Seems to be about 14 amino acids short before I-helix,
          But the DNA sequence is contiguous here

CYP76G8   Glycine max (soybean, Fabales)

CYP76G9P  Glycine max (soybean, Fabales)

CYP76G    Juglans hindsii x Juglans regia (walnut, Fagales)
          EL901251 67% to 76G1 N-term

CYP76H1    Triticum aestivum (wheat)
           No accession number 
           Daniele Werck-Reichhart
           Clone name 76-12 prime
           Submitted to nomenclature committee 6/4/2001
           86% to 76H2 and 76H3

CYP76H2    Triticum aestivum (wheat)
           No accession number 
           Daniele Werck-Reichhart
           Clone name 76-11
           Submitted to nomenclature committee 6/4/2001
           95% to 76H3 

CYP76H3    Triticum aestivum (wheat)
           No accession number 
           Daniele Werck-Reichhart
           Clone name 76-17a
           Submitted to nomenclature committee 6/4/2001
           95% to 76H2, 36% to 76A6, 41% to 76B4, 45% to 76C2, 
           41% to 76D1 partial seq, 40% to 76E1, 46% to 76F2, 39% to 76G1

CYP76H4     Oryza sativa (rice)
CYP76H5     Oryza sativa (rice)
CYP76H6     Oryza sativa (rice)
            AAAA02028560.1 (indica strain)
            Note: indica seq does not have two first exons, 
            only the one shown here that is equivalent to the first in japonica

CYP76H6     Oryza sativa (rice, japonica)
            exon 1 (first of two exon 1s)
            Alt. splice form
            AC116603.1b formerly CYP76H7 Nipponbare strain
            EST CI621068.1 100%, CI625002.1 (expressed)
11546 VFT (0) 11538

CYP76H6-ie1b  Oryza sativa (rice, japonica)
            AACV01020930.1 japonica has 76H6 exon 1 (From 13386-14276) in front of 
            this internal exon with frameshifts
            from 16679- 17192 (partial exon 1 runs off the end, 
            two frameshifts = &) first frameshift matches EST CI667414.1
16679 MAALFLWLSWLVLS 16720 &
17077 FSTS 17088 &

76H6 and 76H6-de1b first exons are 91% identical

CYP76H6-ie1b first exon matches CI667414.1 (japonica) EST with 2 frameshifts
So both first exon sequences are expressed
The EST CI667414.1 matches the first frameshift from AACV01020930 exactly 
So the second first exon is probably a duplicate that occurred in japonica
And is defective. 

CYP76H7X    Oryza sativa (rice) name changed to 71H6-de1b
CYP76H8     Oryza sativa (rice)
CYP76H9     Oryza sativa (rice)
CYP76H10    Oryza sativa (rice)
CYP76H11    Oryza sativa (rice)
CYP76H12P   Oryza sativa (rice)
CYP76H13P   Oryza sativa (rice)
CYP76H14P   Oryza sativa (rice)
CYP76H15P   Oryza sativa (rice)
CYP76H16P   Oryza sativa (rice)

CYP76H17    Echinochloa phyllopogon (late watergrass)
            No accession number
            Akira Uchino
            Submitted to nomenclature committee Oct. 31, 2007
            Clone name Ep11
            70% to 76H4 
            complete revised sequence submitted Dec. 15, 2008

CYP76H18    Zea mays (maize)
            67% to CYP76H10 

CYP76H19    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Jan. 10, 2010
            Clone name BP18
            92% to CYP76H17, 71% to CYP76H4

CYP76H20    Brachypodium distachyon (temperate grass)
CYP76H21    Brachypodium distachyon (temperate grass)

CYP76J1X    Petunia
            no accession number
            Hiromasa Imaishi
            submitted to nomenclature committee 7/24/98
            clone IMT-8 
            Renamed CYP76B9 (1/7/2005)

CYP76K1     Oryza sativa (rice)
CYP76K1     Brachypodium distachyon (temperate grass)
CYP76K2P    Oryza sativa (rice)
CYP76L1     Oryza sativa (rice)
CYP76L1     Brachypodium distachyon (temperate grass)
CYP76L2P    Brachypodium distachyon (temperate grass)
CYP76M1     Oryza sativa (rice)
CYP76M2     Oryza sativa (rice)
CYP76M3P    Oryza sativa (rice)
CYP76M4P    Oryza sativa (rice)
CYP76M5     Oryza sativa (rice)
CYP76M6     Oryza sativa (rice)
CYP76M7     Oryza sativa (rice)
CYP76M8     Oryza sativa (rice)
CYP76M9     Oryza sativa (rice)
CYP76M10    Oryza sativa (rice)
CYP76M11P   Oryza sativa (rice)
CYP76M12P   Oryza sativa (rice)
CYP76M13    Oryza sativa (rice)
CYP76M14    Oryza sativa (rice)

CYP76M15    Zea mays (maize)
            65% to CYP76M9 

CYP76M16P   Brachypodium distachyon (temperate grass)

CYP76M17    Oryza sativa (rice)
            93% to CYP76M7 (new seq in rice)

CYP76N1P    Oryza sativa (rice)
CYP76N2     Oryza sativa (rice)
CYP76N3X    Oryza sativa (rice) reanmed CYP76V1
CYP76N4P    Oryza sativa (rice)
CYP76P1     Oryza sativa (rice)
CYP76P2     Oryza sativa (rice)
CYP76P3     Oryza sativa (rice)
CYP76P4P    Oryza sativa (rice)
CYP76P5X    Oryza sativa (rice) renamed CYP76U1
CYP76P6     Oryza sativa (rice)
CYP76P7     Brachypodium distachyon (temperate grass)
CYP76P8P    Brachypodium distachyon (temperate grass)
CYP76P9P    Brachypodium distachyon (temperate grass)
CYP76Q1     Oryza sativa (rice)
CYP76Q2     Oryza sativa (rice)

CYP76R1X   Hypericum androsaemum (sweet-amber or tutsan) a plant in Malpighiales
           GenEMBL AY596977 
           Schwarz,H. and Beerhues,L.
           Molecular cloning of cytochrome P450 from Hypericum androsaemum
           cytochrome P450 mRNA, complete cds.
           46% to CYP76H4 47% to CYP76S1 52% to CYP76B6
           renamed CYP76F7 

CYP76S1    Centaurium erythraea (Common Centaury) a plant in Gentianales
           GenEMBL AY596979
           Schwarz,H. and Beerhues,L.
           Molecular cloning of cytochrome P450 from Centaurium erythraea cell
           clone 2 cytochrome P450 mRNA, complete cds. 
           49% to CYP76E1 48% to CYP76H4 47% to CYP76C2 47% to CYP76R1

CYP76S2      Verbena x hybrida cultivar Tapien Pink (Lamiales)
             GenEMBL AB234904
             Yoshikazu Tanaka
             submitted to nomenclature committee Sept. 16, 2005
             55% to CYP76S1 Centaurium erythraea AY596979

CYP76S3     Mimulus guttatus (Lamiales, monkeyflower)
            GenEMBL CV515139.1 
            66% to 76S2, 56% to 76C7, 58% to 76B6, 49% to CYP80C1

CYP76S4     Sesamum indicum (a sesame plant)
            No accession number
            Eiichiro Ono
            Submitted to nomenclature committee July 11, 2007
            Clone name SiCYP168
            59% to 76S2 AB234904, 57% to 76S1 AY596979, 50% to 76C3

CYP76S5     Sesamum indicum (a sesame plant)
            No accession number
            Eiichiro Ono
            Submitted to nomenclature committee July 11, 2007
            Clone name SiCYP-sd115
            62% to 71S2, 50% to 76C7, 73% to CYP76S4

CYP76S6     Sesamum indicum (sesame plant)
            Lin,L.-J., Chen,H.-J. and Tzen,J.
            Cloning of cDNA fragments encoding cytochrome P450 monooxygenase
            from maturing sesame seeds
            74% to 76S4, 91% to 76S5

CYP76T1     Populus trichocarpa (Black cottonwood)
CYP76T2     Populus trichocarpa (Black cottonwood)
CYP76T3     Populus trichocarpa (Black cottonwood)
CYP76T4     Populus trichocarpa (Black cottonwood)
CYP76T5     Populus trichocarpa (Black cottonwood)
CYP76T6     Populus trichocarpa (Black cottonwood)

CYP76T7P  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T7P-de2b  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T8P-de2b  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T8P  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T8P-de2c  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T9   Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T10  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T11  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T12  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T12-de2b  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T12-de2c  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T12-de2d  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T13P Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T14P Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T15  Vitis vinifera (grapevine)
          CAAP02001585.1c , CAN81641.1
          See Vitis pages for sequence

CYP76T15-de3b  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T16  Vitis vinifera (grapevine)
          CAN81642.1 AM476785.2
          See Vitis pages for sequence

CYP76T17  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T17-de3b  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T18  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T19  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T20  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T20-de1b  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T21  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T22P  Vitis vinifera (grapevine)
          CAN69411.1, AM436706.1
          See Vitis pages for sequence

CYP76T22P  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T22P  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T22P-de2b  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T23P  Vitis vinifera (grapevine)
          See Vitis pages for sequence

CYP76T24    Catharanthus roseus
            No accesion number
            Daniele Werck-Reichhart
            Submitted to nomenclature committee Oct. 10, 2011
            Full sequence
            56% to CYP76T17 Vitis vinifera

CYP76U1     Oryza sativa (rice) formerly CYP76P5
CYP76V1     Oryza sativa (rice) formerly CYP76N3

CYP76X1     Trifolium pratense (Fabales)
            GenEMBL AB236753  

CYP76X2     Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ335810 GenPept ABC59105

CYP76X3     Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ394573, CT027663.2c GenPept ABD97100

CYP76X4     Medicago truncatula (barrel medic, Fabales)
            GenEMBL CT027663.2b

CYP76X5     Medicago truncatula (barrel medic, Fabales)
            GenEMBL CT027663.2a

CYP76X6     Glycine max (soybeans, Fabales)
            Li,L.Y. and Yu,D.Y.
            Comprehensive analysis of putative P450 genes superfamily in
            Glycine max and Medicago truncatula
            65% to 76X1, 76X2, Called CYP76O2

CYP76X7     Glycine max (soybeans, Fabales)

CYP76X8     Glycine max (soybeans, Fabales)

CYP76X8-de2b  Glycine max (soybeans, Fabales)

CYP76X9P    Glycine max (soybeans, Fabales)

CYP76X10P   Glycine max (soybeans, Fabales)

CYP76Y1   Vitis vinifera (grape)
          See Vitis pages for sequence

CYP76Y2   Vitis vinifera (grape)
          CAN66456.1, CAAP02002687.1, CAAP02006631.1
          See Vitis pages for sequence

CYP76Y3   Vitis vinifera (grape)
          CAN83490.1, CAAP02002003.1
          See Vitis pages for sequence

CYP76Y4P  Vitis vinifera (grape)
          See Vitis pages for sequence

CYP76Y5   Solanum lycopersicum (tomato)
CYP76Y5   Solanum tuberosum  (potato, Solanales)
CYP76Y5-de1b2b   Solanum tuberosum  (potato, Solanales)
CYP76Y6   Solanum lycopersicum (tomato)
CYP76Y7P  Solanum lycopersicum (tomato)
CYP76Y7   Solanum tuberosum  (potato, Solanales)
CYP76Y8   Solanum lycopersicum (tomato)
CYP76Y8   Solanum tuberosum  (potato, Solanales)
CYP76Y9P  Solanum tuberosum  (potato, Solanales)
CYP76Y10P Solanum tuberosum  (potato, Solanales)
CYP76Y11P Solanum tuberosum  (potato, Solanales)
CYP76Y12P Solanum tuberosum  (potato, Solanales)

CYP76Z1   Picea sitchensis 
          46% to 76H10 rice, 43% to 76C4 Arab. 49% to CYP76Y1 cycas
          46% to 76B5, 47% to 76S6, 46% to 76B6

CYP76AA1  Cycas rumphii (cycad)
          GenEMBL CB091985 EX924662.1 EX919108.1 EX918142.1
          42% to 76C2, 46% to 76H1 rice
          This seq was accidentally name CYP76Y1,
          But that name was already given to a Vitis sequence

CYP76AB1   Vanda coerulea (Vanda orchid)
           No accession number
           Kumrop Ratanasut 
           Submitted to nomenclature committee Jan. 31, 2009
           49% to 76T18 Vitis
           47% to CYP76S6 Sesamum indicum (sesame plant)

CYP76AC1   Polypodium aureum (fern)
           no accession number
           Adam Takos
           Submitted to nomenclature committee March 7, 2009
           Partial seq from I-helix to end
           61% to CYP76AC2, 51% to CYP76F3 Populus
           49% to 76H2 wheat

CYP76AC2   Ceratopteris richardii (fern)
           GenEMBL BQ086989 EST
           61% to CYP76AC1, 50% to 76F3 Populus 
           46% to 75B1, 46% to 75B6, 47% to 75B3, 48% to 75B4

CYP76AD1   Beta vulgaris (beets, Caryophyllales) 
           No accession number
           Alan Lloyd
           Submitted to nomenclature committee Oct. 25, 2010
           55% to CYP76T21 Vitis vinifera 
           other CYP76T matches are less than 55%

CYP76AD2   Amaranthus cruentus (blood amaranth, Caryophyllales) 
           No accession number
           Alan Lloyd
           Submitted to nomenclature committee Oct. 25, 2010
           55% to CYP76T21 Vitis vinifera 
           other CYP76T matches are less than 55%

CYP76AD3   Mirabilis jalapa (garden four-oclock, Caryophyllales) 
           No accession number
           Alan Lloyd
           Submitted to nomenclature committee Oct. 25, 2010
           55% to CYP76T21 Vitis vinifera 
           other CYP76T matches are less than 55%

CYP76AE1   Thapsia garganica (Apiaceae)
           No accession number
           Corinna Weitzel
           Submitted to nomenclature committee Oct. 14, 2010
           Clone name CYP394
           52% to CYP76A10 Vitis vinifera, 51% to CYP76A3, 42% to CYP76G1

CYP76AE2   Thapsia garganica (Apiaceae)
           No accession number
           Corinna Weitzel
           Submitted to nomenclature committee Oct. 14, 2010
           Clone name CYP862
           66% to CYP76AE1
           55% to CYP76A10 Vitis vinifera, 51% to CYP76A3
           other matches to CYP76A are less than 55%

CYP76AE2    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            53% TO CYP76A3 Petunia
            91% to CYP76AE2 Thapsia garganica probable ortholog
            66% to CYP76AE1 Thapsia garganica

CYP76AE3    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            51% to CYP76A3 Petunia
            67% to CYP76AE1 Thapsia garganica

CYP76AF1    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            45% to CYP76Y1 Vitis vinifera

CYP76AG1    Nelumbo nucifera (sacred lotus, Proteales)

CYP76AG2    Nelumbo nucifera (sacred lotus, Proteales)

CYP76AG3P   Nelumbo nucifera (sacred lotus, Proteales)

CYP76AH1    Salvia miltiorrhiza (Lamiaceae)
            No accession number for whole seq
            Juan Guo
            ESTs CV171606.1, CV164395.1
            Submitted to nomenclature committee April 30, 2012
            50% to CYP76S1 Centaurium erythraea (Common Centaury) Gentianales

CYP76AH2    Mimulus guttatus (monkeyflower, Lamiales)

CYP76AH3    Salvia miltiorrhiza (Lamiaceae)
            No accession number
            Juan Guo
            Submitted to nomenclature committee April 28, 2013
            80% to CYP76AH1 Salvia miltiorrhiza

CYP76AH4    Rosmarinus officinalis (rosemary
            No accession number
            Reuben Peters
            Submitted to nomenclature committee July 29, 2013
            85% to CYP76AH1 

CYP76AH5v1  Rosmarinus officinalis (rosemary
            No accession number
            Reuben Peters
            Submitted to nomenclature committee July 29, 2013
            87% to 76AH3, 96% to 76AH5v2 (diffs in mid region)

CYP76AH5v2  Rosmarinus officinalis (rosemary
            No accession number
            Reuben Peters
            Submitted to nomenclature committee July 29, 2013
            88% to 76AH3, 96% to 76AH5v2 (diffs = CYP76AH4)
            Probable hybrid sequence with CYP76AH4

CYP76AH6    Rosmarinus officinalis (rosemary
            No accession number
            Reuben Peters
            Submitted to nomenclature committee July 29, 2013
            62% to CYP76AH1 

CYP76AH7    Rosmarinus officinalis (rosemary
            No accession number
            Reuben Peters
            Submitted to nomenclature committee July 29, 2013
            61% to CYP76AH1 

CYP76AJ1    Persicaria hydropiper (Caryophyllales)
            No accession number
            Maurice Henquet
            Submitted to nomenclature committee March 7, 2013
            52% to CYP76F12 Vitis vinifera

CYP76AK1    Salvia miltiorrhiza (Lamiaceae)
            No accession number 
            Juan Guo
            Submitted to nomenclature committee July 30, 2013
            46% to CYP76AH1 Salvia miltiorrhiza

CYP76-un1  Glycine max (soybeans, Fabales)

CYP76 Pinus taeda (loblolly pine)
CF667935 58% to 76T10, 55% to 76A10 Vitis, 57% to 76C1 
57% to 76Z1 Picea

CYP76 frag. Tussilago farfara (Asterales)
            Barthelson,R.A., Galbraith,D.W. and Woosley,R.
            Development of a Comprehensive Assay for Medicinal Plant Species
            60% to 76S1, 55% to 76C4 

CYP76 frag. Tussilago farfara (Asterales)
            Barthelson,R.A., Galbraith,D.W. and Woosley,R.
            Development of a Comprehensive Assay for Medicinal Plant Species
            55% to 76F1 

CYP76 frag. Teucrium canadense (Lamiales)
            Barthelson,R.A., Galbraith,D.W. and Woosley,R.
            Development of a Comprehensive Assay for Medicinal Plant Species
            65% to 76S2

CYP76 frag. Tanacetum vulgare (Asterales)
            Barthelson,R.A., Galbraith,D.W. and Woosley,R.
            Development of a Comprehensive Assay for Medicinal Plant Species
            53% to 76C4

CYP76 frag. Lobelia inflata (Asterales)
            Barthelson,R.A., Galbraith,D.W. and Woosley,R.
            Development of a Comprehensive Assay for Medicinal Plant Species
            57% to 76A1

CYP76 frag. Lobelia inflata (Asterales)
            AY870913, AY870914
            Barthelson,R.A., Galbraith,D.W. and Woosley,R.
            Development of a Comprehensive Assay for Medicinal Plant Species
            68% to Populus CYP76, 71% to Atemisia frag. AY870896

CYP76 frag. Artemisia vulgaris (Asterales)
            Barthelson,R.A., Galbraith,D.W. and Woosley,R.
            Development of a Comprehensive Assay for Medicinal Plant Species
            63% to 76G1, 73% to Populus CYP76

CYP76 frag. Echinacea angustifolia (Asterales)
            Barthelson,R.A., Galbraith,D.W. and Woosley,R.
            Development of a Comprehensive Assay for Medicinal Plant Species
            59% to 76H4 rice

CYP76 frag. Artemisia absinthium (Asterales)
            Barthelson,R.A., Galbraith,D.W. and Woosley,R.
            Development of a Comprehensive Assay for Medicinal Plant Species
            52% to 76X3

CYP76 frag. Scutellaria baicalensis (Lamiales)
            Brundage,M.E. and Winget,G.D.
            Cloning of Known and Novel Cytochrome P450s in Scutellaria
            67% to 76G1 

CYP76 frag. Limonium sinense (Caryophyllales)
            Chena,S., Guob,S., Wang,Z., Zhao,J., Zhao,Y. and Zhang,H.
            Expressed sequence tags from a halophyte Limonium sinense cDNA
            Library under Normal Growing Condition
            Unpublished (2006)
            44% to 76H6 N-term

CYP76       Persea Americana (avocado, magnoliids)
            FD505692 58% to 76F12, 53% to 76C4, 53% to 76H4

CYP76       Amborella trichopoda
            GenEMBL CK761327.1 EST
            46% to 76H10 44% to 76C2, 47% to 76B7 (mid region)

CYP76       Amborella trichopoda
            52% to 76C2, 49% to 76H4

CYP76        Gossypium hirsutum (cotton, Malvales)
             GenEMBL DW520447.1  EST
             56% to 76C4

CYP76        Eucalyptus gunnii (Myrtales)
             CU396720.1 54% to 76C4, 54% to 76H4

CYP76        Ginkgo biloba
             DR064319.1 DR064266.1
             54% to 76G1, 54% to 76H11, 60% to 76E3 Glycine max DQ340250.1

CYP76      Quercus petraea  (sessile oak, Fagales)
           48% TO 76H10, 46% to 76B1

CYP76 frag.  Glycyrrhiza uralensis
             Barthelson,R.A., Galbraith,D.W. and Woosley,R.
             Development of a Comprehensive Assay for 
             Medicinal Plant Species
             57% to 76E2 

CYP76       Zamia vazquezii (cycad)
            FD772888.1 52% to 736A26 55% to 76H10, 58% to 76T10 Vitis

CYP76       Zamia furfuracea (cycad)
            GenEMBL CB095823
            57% to 76C5

77A Subfamily

CYP77A1     Solanum melongena cv. Sinsadoharanasu (eggplant)
            GenEMBL X71656 (1683bp) Swiss P37123 (499 amino acids)
            PIR S41599 S40267 (499 amino acids)
            Toguri,T. and Tokugawa,K.
            Cloning of eggplant hypocotyl cDNAs encoding cytochrome P450
            belonging to a novel family (CYP77)
            FEBS Lett. 338, 290-294 (1994)
            Note: clone name H1

CYP77A2     Solanum melongena cv. Sinsadoharanasu (eggplant)
            GenEMBL X71655 (1673bp) Swiss P37124 (511 amino acids)
            PIR S41598 S40266 (511 amino acids)
            Toguri,T. and Tokugawa,K.
            Cloning of eggplant hypocotyl cDNAs encoding cytochrome P450
            belonging to a novel family (CYP77)
            FEBS Lett. 338, 290-294 (1994)
            Note: clone name H2

CYP77A3     Glycine max (soybean, Fabales)
            GenEMBL AF022464 (1644bp)
            Siminszky,B., Dewey,R.E. and Corbin,F.T.
            clone name 6/10

CYP77A4     Arabidopsis thaliana
            GenEMBL B97241
            GSS fragment BAC end T32M21TR
            note: contains N-terminal 65% identical to 77A3
            No ESTs

CYP77A5P    Arabidopsis thaliana
            GenEMBL AP000414 13981-14298 fragment
            65% identical to 77A2 with an in frame stop codon and 
            several frameshifts in the PERF to heme region
            identical match to EST H36337 clone 178A11T7
            opposite end = AA651240 clone 178A11XP 3', mRNA sequence
            matches AP00414 from 16129-16750 = 3 prime UTR

CYP77A6     Arabidopsis thaliana
            GenEMBL AC011560 71181-72725 clone F13M14 also on AC013428
            No introns

CYP77A7     Arabidopsis thaliana
            GenEMBL AC011560 72998-74939 clone F13M14 also on AC013428
            No introns

CYP77A8P    Arabidopsis thaliana
            GenEMBL AB010077 
            Pseudogene fragments
            51066-51110 (26-40), 56196-56252 (167-185), 
            56264-56377 (195-232), 75123-75146 (233-240)

CYP77A9     Arabidopsis thaliana

CYP77A9X    Oryza sativa (rice)
            The name of this gene was in conflict with an Arabidopsis
            Gene.  It has been renamed 

CYP77A10    Populus trichocarpa (Black cottonwood)
CYP77A11P   Populus trichocarpa (Black cottonwood)

CYP77A12    Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ335813 GenPept ABC59108

CYP77A12v1  Glycine max (soybeans, Fabales)
            DQ340247, ESTs BQ741739, BU089673
            Li,L.Y. and Yu,D.Y.
            Comprehensive analysis of putative P450 genes superfamily in
            Glycine max and Medicago truncatula
            84% to 77A12 (probable ortholog) Called CYP77A3v2
            JGI Glyma0 assembly scaffold_87

CYP77A12v2  Glycine max (soybeans, Fabales)
            JGI Glyma0 assembly Scaffold_280 98.1% to 77A12
            Possible allele

CYP77A13    Citrus clementina (Sapindales)
            GenEMBL DY267743.1 DY268122 ESTs
            77% to 77A4

CYP77A14   Vitis vinifera (Pinot noir grape)
           GenEMBL AM463740.2, CAN65790.1 (protein)

CYP77A14   Vitis vinifera (grapevine, strain PN40024)
           1 aa diff

CYP77A15   Carica papaya
           74% to CYP77A4 Arab., 71% to 77A14 Vitis

CYP77A16   Eucalyptus globulus (Myrtales)
           ES592892.1 EW688435.1 ES594372.1 74% to 77A4

CYP77A17   Zea mays (maize)
           DR812116, DR812115, DY690105, EE035940.2, EE027266.2
           GSS seq CG220252 and CG098470.1 extends it
           56% to CYP77A4 Arabidopsis, 77% to CYP77A9 rice 

CYP77A18   Oryza sativa (rice)
           Formerly named CYP77A9 but there was a name conflict with 

CYP77A18   Brachypodium distachyon (temperate grass)
           Ortholog of rice CYP77A18 78% identical

CYP77A19      Solanum lycopersicum (tomato)
CYP71A19      Solanum tuberosum (potato)
CYP77A20      Solanum lycopersicum (tomato)
CYP71A20      Solanum tuberosum (potato)

CYP77A     Diospyros kaki (Ericales)
           DC587158.1 62% to 77A9, 73% to 77A4

CYP77A frag.  Chenopodium quinoa (Caryophyllales)
            Coles,N.D., Coleman,C.E., Christensen,S.A., Jellen,E.N., Stevens
            ,M.R., Bonifacio,A., Rojas-Beltran,J.A., Fairbanks,D.J. and Maughan
            Development and use of an expressed sequenced tag library in quinoa
            (Chenopodium quinoa Willd.) for the discovery of single nucleotide
            Plant Sci. 168 (2), 439-447 (2005)
            81% to 77A1, 57% to 77A4

CYP77A      Gossypium hirsutum (cotton, Malvales)
            GenEMBL DT553651.1 
            67% to 77A1

CYP77A      Amborella trichopoda
            GenEMBL CD483271 CK757439 ESTs
            58% to 77A4 N-term

CYP77        Ginkgo biloba
             GenEMBL DR074407 EST
             57% to 77A1, 51% to 77A4

CYP77A      Malus x domestica  (apple, Rosales) 
            GenEMBL DW248976
            69% to 77A1

CYP77A      Ocimum basilicum (Lamiales)
            GenEMBL DY343672.1 EST
            77% to 77A1 

CYP77A     Helianthus petiolaris (plains sunflower, Asterales) 
           GenEMBL DY944627.1 
           68% to 77A4

CYP77A      Cucumis sativus (Cucumber, Cucurbitales) 
            GenEMBL DN909619.1 
            66% to 77A1

CYP77A      Mesembryanthemum crystallinum (ice plant, Caryophyllales)
            GenEMBL DY030899.1  
            62% to 77A1 

CYP77A      Aquilegia formosa x Aquilegia pubescens (Ranunculales)
            GenEMBL DT768338.1 
            63% to 77A1 

CYP77B1     Arabidopsis thaliana
            GenEMBL AC007296 comp(89516-91048) 
            45% to 77A3 sequences no introns 
            ESTs Z30775, Z30776 noGSSs

CYP77B2     Oryza sativa (rice)
CYP77B2     Brachypodium distachyon

CYP77B2     Zea mays (maize) 
            FL400039, DR826813.1, DR816220.1, EC900372.2, EE159435.2
            GSS seqs. BZ645255.1 CC651036.1 CG262290.1 extend it
            89% to CYP77B2 rice, 62% to CYP77B1 Arabidopsis
            formerly CYP77B10 but this is the CYP77B2 ortholog

CYP77B3     Populus trichocarpa (Black cottonwood)
CYP77B4     Populus trichocarpa (Black cottonwood)

CYP77B5     Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ394574 GenPept ABD97101, ABE77793

CYP77B5  Glycine max (soybeans, Fabales)
         JGI Glyma0 assembly Scaffold_68, 68% to 77B1 Arab., 
         80% to 77B5 Medicago (ortholog)

CYP77B6     Vitis vinifera (Pinot noir grape)
            GenEMBL AM482217.2
            revise it at N-term

CYP77B6     Vitis vinifera (grapevine, strain PN40024)
            CAAP02006523.1 11458-10193, CAN68641.1 (protein)
            100% identical

CYP77B7     Carica papaya
            76% to 77B1, 
            77% to CYP77B6 Vitis vinifera best GenBank hit

CYP77B8     Saruma henryi (magnoliids)
            DT595603.1 DT587889.1 DT600061.1 67% to CYP77B1 

CYP77B9  Glycine max (soybeans, Fabales)
         JGI Glyma0 assembly Scaffold_25, 80% to 77B5 Medicago (ortholog)
         One frameshift = &, 93% to 77B5 Glycine max
         Possible homeolog of CYP77B5 due to a recent genome duplication

CYP77B10X Zea mays (maize) 
         Rernamed CYP77B2 ortholog

CYP77B11      Solanum lycopersicum (tomato)
CYP71B11      Solanum tuberosum (potato)

CYP77B      Gossypium herbaceum (cotton)
            Hawkins,J.S., Kim,H., Nason,J.D., Wing,R.A. and Wendel,J.F.
            Differential lineage-specific amplification of transposable
            elements is responsible for genome size variation in Gossypium
            Unpublished (2006)
            74% to 77B1 

CYP77B     Ribes americanum (Saxifragales)
           GenEMBL DT597668.1 
           69% to 77B1

CYP77B      Amborella trichopoda
            GenEMBL CV008470 EST
            62% to 77B1 N-term

CYP77B     Coffea canephora (Gentianales)
           GenEMBL DV697453
           69% to 77B1 

CYP77C1   Selaginella mollendorffii (lycopod moss)

CYP77C2   Selaginella mollendorffii (lycopod moss)

CYP77D1   Selaginella mollendorffii (lycopod moss)

CYP77      Picea glauca
           EX395923.1 49% to 77B1 

CYP77      Picea sitchensis (Sitka spruce)

CYP77      Pinus sylvestris
           AM983327.1 59% to 77B1 

CYP77      Pinus taeda
           DR102502.1 DR102435.1 99% to AM983327.1 53% to 77B1

CYP77       Cycas rumphii (cycad)
            GenEMBL DR061734
            53% to 77B2 

CYP77       Cycas rumphii (cycad)
            69% to the other cycas CYP77 seq DR061734

78A Subfamily

CYP78A1     Zea mays (maize)
            GenEMBL L23209 (2087bp)
            Isolation of a cytochrome P450 homologue preferentially expressed
            in developing inflorescences of Zea mays L
            Unpublished (1993)

CYP78A1     Zea mays (maize)
            2 aa diffs to CYP78A1 and frameshifted region (lower case)

CYP78A2     Phalaenopsis sp. hybrid SM9108 (moth orchid)
            GenEMBL U34744 (1799bp)
            Nadeau,J.A., Zhang,X., Li,J. and O'Neill,S.D.
            Molecular Characterization of Ovule Development: Isolation of
            Stage- and Tissue-specific cDNAs.
            unpublished (1995)

CYP78A3     Glycine max (soybean)
            GenEMBL AF022463 (1611bp)
            Siminszky,B., Dewey,R.E. and Corbin,F.T.
            clone name 6/4, 73% to 78A50, 54% to 78A51

CYP78A4     Pinus radiata (Monterey pine)
            GenEMBL AF049067
            Bishop-Hurley,S.L., Walter,C. and Gardner,R.C.
            Isolation and Expression of Abundant mRNAs during Somatic
            Embryogenesis of Pinus radiata

CYP78A5    Arabidopsis
           GenEMBL AC027656 comp(32530-34190)
           Susan Carr Zondlo
           submitted to nomenclature committee Sept. 22, 1998
           58% identical to 78A2
           EST T45256

CYP78A6    Arabidopsis thaliana
           GenEMBL AC005819 AC006418
           65% identical to 78A3

CYP78A7    Arabidopsis thaliana
           GenEMBL AC016893
           59% identical to 78A4 and 78A1

CYP78A8     Arabidopsis thaliana
            GenEMBL AC007323 comp(15232-17051) 
            62% identical to 78A6 
            no ESTs no GSSs

CYP78A9     Arabidopsis thaliana
            GenEMBL AB036059
            Toshiro Ito
            submitted to nomenclature committee 9/9/99
            81% identical to 78A6
            EST AI995549 no GSSs

CYP78A9     Arabidopsis thaliana
            GenEMBL AB036059
            contig 31 of clone F21F14 from the EU chr 3 project 
            8955-10728 numbering will change as contigs are joined 
            (formerly confidential)

CYP78A9     Arabidopsis thaliana
            GenEMBL AL138642 (chr 3 F21F14)

CYP78A10    Arabidopsis thaliana
            GenEMBL AC016662

CYP78A11    Oryza sativa (rice)
            GenEMBL AC083943.6  25-JUL-2001
            clone OSJNBa0044A10, 61% to 78A7
            also submitted by Ahn Byoung-Ohg and N. Kurata 10/31/2001

CYP78A12  Oryza sativa (rice) now complete
          aaaa01004390.1 CYP78B4 (indica cultivar-group) 
          N term missing one frameshift
          new 78B4 seq AAAA02009304.1 complete gene, no frameshift
          formerly CYP78B4
13224 TESDMVAVLW (0)

CYP78A13    Oryza sativa (rice) formerly 78B5
CYP78A14    Oryza sativa (rice) formerly 78B6
CYP78A15    Oryza sativa (rice) formerly 78C5
CYP78A15    Brachypodium distachyon
CYP78A16    Oryza sativa (rice) formerly 78C6
CYP78A16    Brachypodium distachyon
CYP78A17    Oryza sativa (rice) formerly 78C7
CYP78A17    Brachypodium distachyon

CYP78A18   Populus trichocarpa (Black cottonwood)
CYP78A19   Populus trichocarpa (Black cottonwood)
CYP78A20   Populus trichocarpa (Black cottonwood)
CYP78A21v1 Populus trichocarpa (Black cottonwood)
CYP78A21v2 Populus trichocarpa (Black cottonwood)
CYP78A22   Populus trichocarpa (Black cottonwood)
CYP78A23   Populus trichocarpa (Black cottonwood)
CYP78A24   Populus trichocarpa (Black cottonwood)
CYP78A25   Populus trichocarpa (Black cottonwood)
CYP78A26P  Populus trichocarpa (Black cottonwood)

CYP78A27   Physcomitrella patens (moss)
           GenEMBL BJ976918 mate = BJ968430 
           BJ583325 Trace archive 686708553 
           1023015550 828195390 complete
           47% to BJ601765 55% to 78A11

CYP78A28   Physcomitrella patens (moss)
           GenEMBL BJ608079 75% to CYP78A27 
           BJ591726 BJ594024 BJ594365 BJ609075 BJ169137 BJ591774
           BJ602430 BJ589265 BJ590426 
           Trace archive 993690276 1006187613 976463611

CYP78A29    Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ335794, CG964690.1 genomic clone 
            GenPept ABC59089

CYP78A30    Selaginella moellendorffii
            traces 880083254, 957156508, 724408695
            62% to 78A4 pine, 56% to 78A9

CYP78A31X  Solanum lycopersicum 
           62% to 78A9
           renamed CYP78A77 in tomato database and elsewhere.

CYP78A32   Solanum melongena (eggplant, Solanales)
           68% to 78A10

CYP78A33    Carica papaya
            71% to CYP78A6

CYP78A34    Carica papaya
            69% to 78A7

CYP78A35    Carica papaya
            70% to 78A10, 53% to 78Aa

CYP78A36    Vitis vinifera (grapevine)
73% to CAN80496.1 (CAO41852.1) on contig CU459222.1
chr1 scaffold_5

CYP78A37    Vitis vinifera (grapevine)
            CAAP02000784.1 69669-66363 (-) strand 1 aa diff
            CAO66175.1 on contig CU459353.1 chr1 scaffold_136
            57% to CYP78A41

CYP78A38    Vitis vinifera (grapevine)
            CAAP02000944.1 90793-92451 (+) strand 2 aa diffs 
            CAO62916.1 on contig CU459322.1 chr2 scaffold_105
            66% to 78A9

CYP78A39    Vitis vinifera (grapevine)
            CAO71766.1 on contig CU459237.1 chr7 scaffold_20 
            upstream of the CYP736A25, 736A26, 736A27 gene cluster
            79% to CYP78A42

CYP78A40    Vitis vinifera (grapevine)
            CAAP02000145.1 = CAN78960.1 
            CAO24293.1 on contig CU459254.1 chr15 scaffold_37
            61% to 78A6
            note 704A19 is also on this scaffold

CYP78A40    Vitis vinifera (grapevine)
            61% to 78A6

CYP78A41    Vitis vinifera (grapevine)
            CAO62448.1 ON CONTIG CU459318.1 chr17 scaffold_101
            67% to 78A10

CYP78A42    Vitis vinifera (grapevine)
            CAAP02000829.1  50046-51958 (+) strand 2 aa diffs
            CAO70823.1 on contig CU459415.1 scaffold_198 chr?
            71% to 78A7 N-term added

CYP78A43    Selaginella mollendorffii (lycopod moss)
CYP78A44    Selaginella mollendorffii (lycopod moss)
CYP78A45    Selaginella mollendorffii (lycopod moss)
CYP78A46    Selaginella mollendorffii (lycopod moss)
CYP78A47    Selaginella mollendorffii (lycopod moss)
CYP78A48    Selaginella mollendorffii (lycopod moss)
CYP78A49    Selaginella mollendorffii (lycopod moss)

CYP78A50    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C45
            Note name changed from 78A43 already assigned to Selaginella
            75% to 78A29, 73% to 78A3 soybean

CYP78A51    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C46
            Note name changed from 78A44 already assigned to Selaginella
            66% to 78A10, 54% to 78A3 soybean

CYP78A52    Zea mays (maize)
            75% to CYP78A15, 96% to 78A53, 88% to 78A54, 60% to 78A55 

CYP78A53    Zea mays (maize)
            75% to CYP78A15 

CYP78A54    Zea mays (maize)
            77% to CYP78A15, 88% to 78A52, 86% to 78A53, 59% to 78A55

CYP78A55    Zea mays (maize)
            85% to 78A17

CYP78A56    Glycine max (soybean, Fabales)

CYP78A57    Glycine max (soybean, Fabales)

CYP78A58    Glycine max (soybean, Fabales)

CYP78A59P    Glycine max (soybean, Fabales)

CYP78A60P   Glycine max (soybean, Fabales)

CYP78A61P   Glycine max (soybean, Fabales)

CYP78A62   Glycine max (soybean, Fabales)

CYP78A63P   Glycine max (soybean, Fabales)

CYP78A64P   Glycine max (soybean, Fabales)

CYP78A65P   Glycine max (soybean, Fabales)

CYP78A66P   Glycine max (soybean, Fabales)

CYP78A67P   Glycine max (soybean, Fabales)

CYP78A68    Glycine max (soybean, Fabales)

CYP78A69    Glycine max (soybean, Fabales)

CYP78A70    Glycine max (soybean, Fabales)

CYP78A71   Glycine max (soybean, Fabales)

CYP78A72   Glycine max (soybean, Fabales)

CYP78A73P   Brachypodium distachyon

CYP78A74    Solanum lycopersicum (tomato)
CYP78A74    Solanum tuberosum  (potato, Solanales)
CYP78A75    Solanum lycopersicum (tomato)
CYP78A75    Solanum tuberosum  (potato, Solanales)
CYP78A76    Solanum lycopersicum (tomato)
CYP78A76    Solanum tuberosum  (potato, Solanales)
CYP78A77    Solanum lycopersicum (tomato)
CYP78A77    Solanum tuberosum  (potato, Solanales)
CYP78A78    Solanum lycopersicum (tomato)
CYP78A78    Solanum tuberosum  (potato, Solanales)
CYP78A79    Solanum lycopersicum (tomato)
CYP78A79    Solanum tuberosum  (potato, Solanales)
CYP78A80    Solanum tuberosum  (potato, Solanales)

CYP78A81    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            64% to CYP78A5 Arabidopsis thaliana

CYP78A82    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            49% to CYP78A5 Arabidopsis thaliana
            63% to CYP78A80 potato, 69% to CYP78A39 Vitis

CYP78A83    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            47% to CYP78A5 Arabidopsis thaliana
            63% to CYP78A74 tomato, 66% to CYP78A38 Vitis

CYP78A     Gossypium hirsutum (cotton, Malvales)
           GenEMBL DT553799.1
           79% to 78A9

CYP78A      Coffea canephora (Gentianales)
            GenEBL DV690954
            64% to 78A9

CYP78A     Lactuca sativa (lettuce sativa, Asterales) 
           GenEMBL DY979794.1
           72% to 78A9 

CYP78A    Eschscholzia californica (Ranunculales)
          GenEMBL CD476723.2 
          68% to 78A7 59% to 78A11

CYP78A    Actinidia deliciosa (Kiwifruit, Ericales)
          FG466295.1 74% to 78A29

CYP78A       Citrus clementina (Sapindales)
             GenEMBL DY267583.1 
             68% to 78A7

CYP78A      Prunus persica (peach, Rosales)
            GenEMBL DW345553.1 
            67% to 78A7 58% to 78A11

CYP78A      Juglans hindsii x Juglans regia (walnut, Fagales)
            EL892271.1 72% to 78A36 Vitis

CYP78A      Saruma henryi (magnoliids)
            DT602792.1 DT591875.1 DT599008.1 68% to 78A10 

CYP78A      Zamia vazquezii (cycad)
            FD765538.1 69% to Saruma CYP78

CYP78A     Ceratopteris richardii (fern)
           53% to 78A7 N-term

CYP78B4X   Oryza sativa (rice) now complete
          aaaa01004390.1 CYP78B4 (indica cultivar-group) 
          N term missing one frameshift
          new 78B4 seq AAAA02009304.1 complete gene, no frameshift
          renamed CYP78A12

CYP78B5X     Oryza sativa (rice) renamed CYP78A13
CYP78B6X     Oryza sativa (rice) renamed CYP78A14
CYP78C5X     Oryza sativa (rice) renamed CYP78A15
CYP78C6X     Oryza sativa (rice) renamed CYP78A16
CYP78C7X     Oryza sativa (rice) renamed CYP78A17

CYP78D1     Oryza sativa (rice)

CYP78D2       Populus trichocarpa (Black cottonwood)
CYP78D3v1     Populus trichocarpa (Black cottonwood)
CYP78D3v2     Populus trichocarpa (Black cottonwood)
CYP78D-se1[2] Populus trichocarpa (Black cottonwood)

CYP78D4     Thapsia villosa
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            66% to CYP78D2 Populus trichocarpa, missing the C-term

CYP78E1     Physcomitrella patens (moss)
            BJ601765 mate = BJ204837 
            BJ157387 mate = BJ165354
            BJ163959 mate = BJ172406
            BJ596508 mate = BJ192420
            BJ164880 BJ605699 BJ604521 BJ595714 BJ601611 BJ602476 BJ582121
            BJ604032 BJ603006 
            Trace arcive 710548465 54% to 78A9
            997125033 839338142 785867756 N-term is a little long
            47% to 78A9 48% to 78A4 pinus complete

79A Subfamily

CYP79A1     Sorghum bicolor
            GenEMBL U32624 
            Koch, B.M., Sibbessen, O., Halkier, B.A., Svendsen, I. and Lindberg Moller, B.
            Arch. Biochem. Biophys. 323, 177-186 (1995)

CYP79A2      Arabidopsis thaliana (thale cress)
             GenEMBL AB010692 comp(11000-13200 region)
             about 53% identical to 79A1
             Note: this sequence was included in 79A when there was only one
             other CYP79A sequence.  Now that there are several, this sequence
             does not really fit well in the CYP79A subfamily.  However, the
             name will remain the same for historical reasons.

CYP79A3P     Arabidopsis thaliana
             GenEMBL AB025602 14755-16760 
             Stop codon in Heme signature and frameshifts at K-helix and after
             Heme signature. Probable pseudogene but alternative C-terminal lies beyond.
             88% identical to 79A2

CYP79A4P     Arabidopsis thaliana
             GenEMBL AB025602 22090-22536
             Lone C-terminal exon.  Note: this exon may join with N-terminal exons of 
             CYP79A3P to make a complete P450 gene.  The natural last exon my be skipped. 
             same as GSS B61504

CYP79A5     Triticum aestivum (wheat)
            CJ695606, CJ589481 ESTs
            Daniele Werck-Reichhart
            58% to 79A1
            clone name 79A14
            submitted to nomenclature committee July 18, 2000
            whole seq known but confidential

CYP79A6     Triticum aestivum (wheat)
            CJ697139 EST
            Daniele Werck-Reichhart
            96% to 79A5
            clone name 79A1
            submitted to nomenclature committee July 18, 2000 
            whole seq known but confidential

CYP79A7     Oryza sativa (rice)
            GenEMBL AC084319.5
               also AC091302.3
               58% to 79A1

CYP79A8     Hordeum vulgare (barley)
            No accession number
            Soren Bak and Katrine Pontoppidan
            Submitted to nomenclature committee 4/9/02

CYP79A9     rice
            See rice pages

CYP79A10    rice
            See rice pages

CYP79A11    rice
            CK078050.1 Oryza sativa (indica cultivar-group) cDNA 
            Intact 79A11
            EST has only 2 aa diffs with indica 79A11, 
            missing piece is present, so 79A11 is not a 
            japonica assembly may be wrong. Or there may be a difference 
            between the two 
            with the 79A11 gene broken in japonica, but intact in indica.

exon 1 is shown as a pseudogene part in Japonica in front of CYP79A9
79A10 is in front of it on two different genomic sequences CR933498.1 and 
AP008210.1.  The third exon has a frameshift and occurs 20kb after 79A9,
Like the gene has been split in japonica.  There is no exon 2 in japonica.
In indica this is all one gene

CYP79A12    Hordeum vulgare (barley)
            No accession number
            Kirsten Nielsen
            Submitted to nomenclature committee 5/21/03

CYP79A13    Ricinus communis,  Malpighiales (castor bean) 
            GenEMBL AASG01026124.1
            57% to 79A2

CYP79A14   Bambusa ventricosa  (tu tu chu or Buddha bamboo, Liliopsida)
           GenEMBL DQ409175
           59% to 79A7

CYP79A15   Vitis vinifera (grape)
           CAAP02002475.1f, CAO41497.1
           See Vitis pages for sequence

CYP79A16P  Vitis vinifera (grape)
           See Vitis pages for sequence

CYP79A17   Vitis vinifera (grape)
           CAAP02002475.1d CAO41496.1
           See Vitis pages for sequence

CYP79A18P  Vitis vinifera (grape)
           See Vitis pages for sequence

CYP79A18P-de1b  Vitis vinifera (grape)
           See Vitis pages for sequence

CYP79A19   Vitis vinifera (grape)
           CAAP02002475.1b CAO41496.1
           See Vitis pages for sequence

CYP79A20P  Vitis vinifera (grape)
           See Vitis pages for sequence

CYP79A21v1 Vitis vinifera (grape)
           See Vitis pages for sequence

CYP79A21v1 Vitis vinifera (grape)
           See Vitis pages for sequence

CYP79A21v2 Vitis vinifera (grape)
           CAN74072.1 = AM444092.2
           See Vitis pages for sequence

CYP79A22P  Vitis vinifera (grape)
           See Vitis pages for sequence

CYP79A22P  Vitis vinifera (grape)
           CAN74071.1 AM444092.2
           See Vitis pages for sequence

CYP79A23   Vitis vinifera (grape)
           See Vitis pages for sequence

CYP79A23-de2b   Vitis vinifera (grape)
           See Vitis pages for sequence

CYP79A24   Vitis vinifera (grape)
           See Vitis pages for sequence

CYP79A25   Vitis vinifera (grape)
           See Vitis pages for sequence

CYP79A26   Vitis vinifera (grape)
           CAN75997.1, CAAP02001548.1
           See Vitis pages for sequence

CYP79A27   Vitis vinifera (grape)
           CAN61661.1, CAAP02000528.1
           See Vitis pages for sequence

CYP79A27-de1b   Vitis vinifera (grape)
           See Vitis pages for sequence

CYP79A28P  Vitis vinifera (grape)
           CAN67567.1, AM447848.2
           See Vitis pages for sequence

CYP79A29P  Vitis vinifera (grape)
           CAAP02005443.1b  = CAN82591.1 AM436340.2b
           See Vitis pages for sequence

CYP79A30P  Vitis vinifera (grape)
           See Vitis pages for sequence

CYP79A31P  Vitis vinifera (grape)
           See Vitis pages for sequence

CYP79A32   Solanum lycopersicum (tomato, Solanales)
           AP009323.1 50% to 79A2, 54% to 79A26

CYP79A32    Solanum tuberosum (potato)

CYP79A33    Zea mays (maize)
            57% to CYP79A9 

CYP79A34   Eucalyptus yarraensis (a cyanide producing tree)
           No accession number
           Elizabeth Neilson
           Submitted to nomenclature committee Oct. 4, 2009
           Clone name EY1
           63% to CYP79A1 Sorghum

CYP79A35   Eucalyptus yarraensis (a cyanide producing tree)
           No accession number
           Elizabeth Neilson
           Submitted to nomenclature committee Oct. 4, 2009
           Clone name EY2
           64% to CYP79A1 Sorghum, 63% to CYP79D6v2
           note there is now overlap in the CYP79A and CYP79D subfamilies

CYP79A36   Eucalyptus yarraensis (a cyanide producing tree)
           No accession number
           Elizabeth Neilson
           Submitted to nomenclature committee Oct. 4, 2009
           Clone name EY3
           63% to CYP79A1 Sorghum

CYP79A37   Eucalyptus yarraensis (a cyanide producing tree)
           No accession number
           Elizabeth Neilson
           Submitted to nomenclature committee Oct. 4, 2009
           Clone name EY4
           64% to CYP79A1 Sorghum

CYP79A38P  Brachypodium distachyon
CYP79A39   Brachypodium distachyon
CYP79A40   Brachypodium distachyon
CYP79A41   Brachypodium distachyon
CYP79A42   Brachypodium distachyon

CYP79A43   Solanum lycopersicum (tomato)
CYP79A44P  Solanum lycopersicum (tomato)
CYP79A45P  Solanum lycopersicum (tomato)
CYP79A46   Solanum lycopersicum (tomato)
CYP79A47   Solanum lycopersicum (tomato)
CYP79A48P  Solanum lycopersicum (tomato)
CYP79A49P  Solanum lycopersicum (tomato)
CYP79A50P  Solanum lycopersicum (tomato)
CYP79A51P  Solanum lycopersicum (tomato)
CYP79A52   Solanum tuberosum (potato)
CYP79A53P  Solanum tuberosum (potato)
CYP79A54P  Solanum tuberosum (potato)
CYP79A55P  Solanum tuberosum (potato)
CYP79A56   Solanum tuberosum (potato)
CYP79A57P  Solanum tuberosum (potato)
CYP79A58P  Solanum tuberosum (potato)
CYP79A59   Solanum tuberosum (potato)
CYP79A59-de2b   Solanum tuberosum (potato)
CYP79A60   Nelumbo nucifera (sacred lotus, Proteales))
CYP79A61   Zea mays

CYP79A-se1[3]  Vitis vinifera (grape)
           CAAP02002475.1 between 79A19 and 79A20P
26788 IVDNPA*AAEWAIA 26747

CYP79A-se2[3]  Vitis vinifera (grape)
            C-term pseudogene, 85% to 79A29P CAAP02005443.1b

CYP79       Malus x domestica (apple, Rosales)
            DR990828 DR998423
            60% to 79B2, 61% to 79A1, 63% to 79D4

CYP79       Solanum lycopersicum (tomato)
            GenEMBL DU941042.1 genomic 
            53% to 79A2 N-term, 61% to 79A32 tomato

CYP79       Solanum lycopersicum (tomato)
            GenEMBL DU972839.1 genomic 
            61% to 79A2 N-term, 52% to 79A32 tomato
19   PL  14

CYP79       Solanum lycopersicum (tomato)
            GenEMBL BH016189.1 genomic survey sequence.
            66% to 79A1, 86% to 79A32 tomato

CYP79A      Citrus clementina (Sapindales)
            GenEMBL DY290108
            60% to 79A2 

CYP79       Aquilegia formosa x Aquilegia pubescens (Ranunculales)
            GenEMBL DT728924.1 
            55% to 79B2

CYP79     Helianthus Argophyllus (silverleaf sunflower, Asterales) 
          GenEMBL EE619416.1 
          52% to 79A2 

CYP79A    Gossypium raimondii (Malvales)
          62% to 79A2
LKGDGV  1386

CYP79A      Aquilegia formosa x Aquilegia pubescens  (Ranunculales)
            GenEMBL DT735649.1 EST 
            67% to 79A2

CYP79       Aristolochia fimbriata (White Veined Dutchman's Pipe, magnoliids)
            FD754257.1 58% to 79A2, 59% to 79D12, 61% to CYP79A1

CYP79       Triphysaria pusilla (Lamiales)
            EY159380.1 46% to 79A26 N-term 
            probably same gene as EY174919.1

CYP79       Triphysaria pusilla (Lamiales)
            EY174919.1 58% to 79A2 C-term, 62% to 79A26 

CYP79 frag. Artemisia vulgaris (Asterales)
            Barthelson,R.A., Galbraith,D.W. and Woosley,R.
            Development of a Comprehensive Assay for Medicinal Plant Species
            64% to 79A2

79B Subfamily

CYP79B1     Sinapis alba (white mustard)
            GenEMBL AF069494 (1886 bp)
            Bak,S., Nielsen,H.L. and Halkier,B.A.
            The presence of CYP79 homologues in glucosinolate-producing plants
            shows evolutionary conservation of the enzymes in the conversion of
            amino acids to aldoximes in the biosynthesis of cyanogenic
            glucosides and glucosinolates.
            Plant Mol. Biol. 38, 725-734 (1998) 

CYP79B2     Arabidopsis thaliana (thale cress)
            GenEMBL AF069495 (1370 bp) AL035708 T5J17.120 complete sequence 
            Bak,S., Nielsen,H.L. and Halkier,B.A.
            The presence of CYP79 homologues in glucosinolate-producing plants
            shows evolutionary conservation of the enzymes in the conversion of
            amino acids to aldoximes in the biosynthesis of cyanogenic
            glucosides and glucosinolates.
            Plant Mol. Biol. 38, 725-734 (1998) 
            ESTs T42902 from C-helix on
            Contig 1510 of the TIGR Landsberg erecta sequences has 99% match

            Hull, A.K., Vij, R. and Celenza, J.L. (2000) 
            Arabidopsis cytochrome P450s that catalyze the first step of tryptophan-dependent 
            Indole-3-acetic acid biosynthesis.
            PNAS Early Edition (preprint)
            Converts trp to indole-3-acetic acetaldoxime (IAOx)

CYP79B2     Brassica rapa cultivar R500
            Fourmann,M., Froger,N. and Brunel,D.
            Amplified consensus gene markers: Tools designing for a genetic map
            of Arabidopsis-known-function genes in Brassica
            97% to 79B2 ortholog

CYP79B2v1   Brassica napus cultivar Darmor
            Fourmann,M., Froger,N. and Brunel,D.
            Amplified consensus gene markers: Tools designing for a genetic map
            of Arabidopsis-known-function genes in Brassica
            98% to 79B2 ortholog

CYP79B2v2   Brassica napus cultivar Darmor
            Fourmann,M., Froger,N. and Brunel,D.
            Amplified consensus gene markers: Tools designing for a genetic map
            of Arabidopsis-known-function genes in Brassica
            97% to 79B2 ortholog

CYP79B3    Arabidopsis
            GenEMBL AC006592 comp(103303-105685) also AC007168 76873-79255
            85% identical to 79B2
            no ESTs no GSSs

            Hull, A.K., Vij, R. and Celenza, J.L. (2000) 
            Arabidopsis cytochrome P450s that catalyze the first step of tryptophan-dependent 
            Indole-3-acetic acid biosynthesis.
            PNAS Early Edition (preprint)
            Converts trp to indole-3-acetic acetaldoxime (IAOx)

CYP79B4P      Arabidopsis
            GenEMBL AC006592 comp(101836-101952) and comp(102489-102605)
            also AC007168 79953-80069 and 80606-80722 clone T26C19
            lone exons at C-terminal

CYP79B5     Brassica napus 
            Naur,P., Hansen,C.H., Bak,S., Hansen,B.G., Jensen,N.B.,
            Nielsen,H.L. and Halkier,B.A.
            CYP79B1 from Sinapis alba converts tryptophan to
            Arch. Biochem. Biophys. 409 (1), 235-241 (2003)
            Submitted to nomenclature committee 6/7/00

CYP79B5     Brassica napus (rape)
            BD350086, AX195522.1
            Andersen,M.D., Moeller,B.L., Nielsen,J.S., Wittstock,U.,
            Hansen,C.H., Halkier,B.A., Mikkelsen,M.D., Busk,P.K. and Bak,S.
            P450 monooxygenases of the CYP79 family
            93% to 79B2

       %identity (aa level) to other CYP79s is: 44.1 to E1, 44.1 to E2, 
       50.8 to D1, 51.4 to D2, 95.9 to B1, 93.5 to B2, 85.3 to B3, 
       52.0 to A1, 48.4 to A2, 38.4 to F1, 38.4 to F2, 41.0 to C1.

CYP79B6    Carica papaya
           58% to 79B3 

CYP79B7    Carica papaya
           supercontig_213:86297..89401 (+ strand)
           56% to 79B3, 58% to 79A12 barley

CYP79B8    Carica papaya
           supercontig_213:32639..36808 (+ strand)
           GS_ORF_5_from_ supercontig_213 
           59% to 79B2
           85% to 79B7

79C Subfamily

CYP79C1      Arabidopsis thaliana (thale cress)
            GenEMBL AC002986 comp(75-1680) AC007202 comp(77381-79610)
            C-terminal missing from AC002986.  Intron sequence after PKG runs off the end
            of the DNA on the complementary strand.  AC007202 complete
            Contig 505 and 1241 of the TIGR Landsberg erecta sequences have 100% matches

CYP79C2     Arabidopsis thaliana (thale cress)
            GenEMBL AC008051 1899-4148
            this gene has four frameshifts in a preliminary version of the sequence.  It may be a    
            pseudogene there are three pseudogene fragments associated with it 
            CYP79C3P (see below), 
            CYP79C4P and CYP79C5P
            chromosome 1, 52% to 79C1

CYP79C3PX   Arabidopsis thaliana (thale cress)
            GenEMBL AC008051 5709-6541
            Improved curation in this region eliminates this pseudogene
            It is discontinued

CYP79C4P    Arabidopsis thaliana (thale cress)
            GenEMBL AC008051 7210-7435

CYP79C5P    Arabidopsis thaliana (thale cress)
            GenEMBL AC008051 9049-9895

79D Subfamily

CYP79D1     Manihot esculenta (cassava)
            GenEMBL AF140613
            Mette Dahl Andersen
            submitted to nomenclature committee
            clone val152

CYP79D1    Manihot esculenta (cassava)
           BD350035 (Patent)
           P450 monooxygenases of the CYP79 family.

CYP79D1     Manihot esculenta (cassava)
            Jorgensen,K., Bak,S., Busk,P.K., Sorensen,C., Olsen,C.E.,
            Puonti-Kaerlas,J. and Moller,B.L.
            Cassava Plants with a Depleted Cyanogenic Glucoside Content in
            Leaves and Tubers. Distribution of Cyanogenic Glucosides, Their
            Site of Synthesis and Transport, and Blockage of the Biosynthesis
            by RNA Interference Technology
            Plant Physiol. 139 (1), 363-374 (2005)
            N-hydroxylating cytochrome P450

CYP79D2     Manihot esculenta (cassava)
            GenEMBL AF140614
            Mette Dahl Andersen
            submitted to nomenclature committee
            clone val211

CYP79D2    Manihot esculenta (cassava)
           BD350036 (patent)
           P450 monooxygenases of the CYP79 family.

CYP79D2     Manihot esculenta 
            Jorgensen,K., Bak,S., Busk,P.K., Sorensen,C., Olsen,C.E.,
            Puonti-Kaerlas,J. and Moller,B.L.
            Cassava Plants with a Depleted Cyanogenic Glucoside Content in
            Leaves and Tubers. Distribution of Cyanogenic Glucosides, Their
            Site of Synthesis and Transport, and Blockage of the Biosynthesis
            by RNA Interference Technology
            Plant Physiol. 139 (1), 363-374 (2005)
            N-hydroxylating cytochrome P450

CYP79D3     Lotus corniculatus var. japonicus
            Forslund,K., Morant,M., Jorgensen,B., Olsen,C.E., Asamizu,E.,
            Sato,S., Tabata,S. and Bak,S.
            Biosynthesis of the Nitrile Glucosides Rhodiocyanoside A and D and
            the Cyanogenic Glucosides Lotaustralin and Linamarin in Lotus
            Plant Physiol. 135 (1), 71-84 (2004)
            submitted to nomenclature committee Feb. 7, 2003

CYP79D4     Lotus corniculatus var. japonicus
            Forslund,K., Morant,M., Jorgensen,B., Olsen,C.E., Asamizu,E.,
            Sato,S., Tabata,S. and Bak,S.
            Biosynthesis of the Nitrile Glucosides Rhodiocyanoside A and D and
            the Cyanogenic Glucosides Lotaustralin and Linamarin in Lotus
            Plant Physiol. 135 (1), 71-84 (2004)
            submitted to nomenclature committee Feb. 7, 2003

CYP79D5     Populus trichocarpa (black cottonwood)
CYP79D6v1   Populus trichocarpa (black cottonwood)
CYP79D6v2   Populus trichocarpa (black cottonwood)
CYP79D7     Populus trichocarpa (black cottonwood)
CYP79D8     Populus trichocarpa (black cottonwood)
CYP79D9P    Populus trichocarpa (black cottonwood)

CYP79D10    Ricinus communis,  Malpighiales (castor bean) 
            GenEMBL AASG01001235.1
            57% to 79D4 (Lotus japonicus) 51% to 79B3, 51% to 79A2
            62% to 79D6
            several frameshifts, may be a pseudogene

CYP79D11P   Medicago truncatula (barrel medic, Fabales)
            GenPept ABE84069 pseudogene
            Note: ABE84069 is not assembled correctly
            AC125480.33 Medicago truncatula
            Genbank entry has poor assembly. See my assembly below
            57% to 79D3 pseudogene
38511  NALLTEQEIKSVIL  38552

CYP79D12    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC152421.8b GenPept ABE77661
            58% TO 79D4 50% to 79B2

CYP79D13    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC152421.8a GenPept ABE77660
            58% TO 79D4 50% to 79B2

CYP79D14    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC146720.23 GenPept ABE89633
            Genbank assembly is wrong 
            96% to AC152421.8, 52% to 79B2, 58% to 79D4

CYP79D15    Trifolium repens
            No accession number
            Kenneth M. Olsen
            submitted to nomenclature committee June 4, 2007
            ~92% identical to 79D3 and 79D4

CYP79D16    Prunus dulcis (almond)
            no accession number
            Tricia Franks
            submitted to nomenclature committee Sept. 8, 2008
            63% to 79D6v1 Populus, 61% to 79D7 Populus
            60% to 79A13 Ricinus
            57% to 79A21v2 Vitis, 57% to 79A17 Vitis
            56% to 79D4 Lotus, 55% to 79D3 Lotus
            59% to 79D13 Medicago, 58% to 79D12 Medicago,
            57% to 79D10 Ricinus

CYP79D17   Glycine max (soybean, Fabales)

CYP79D18   Glycine max (soybean, Fabales)

CYP79D19P  Glycine max (soybean, Fabales)

CYP79D20P  Glycine max (soybean, Fabales)

CYP79D21   Glycine max (soybean, Fabales)

CYP79D22P  Glycine max (soybean, Fabales)

CYP79D23P  Glycine max (soybean, Fabales)

CYP79D24   Glycine max (soybean, Fabales)

CYP79D25   Glycine max (soybean, Fabales)

79E Subfamily

CYP79E1     Triglochin maritima
            GenEMBL AF140609
            Nielsen,J.S. and Moller,B.L.
            Cloning and expression of cytochrome P450 enzymes catalyzing the
            conversion of tyrosine to p-hydroxyphenylacetaldoxime in the
            biosynthesis of cyanogenic glucosides in Triglochin maritima
            Plant Physiol. 122 (4), 1311-1321 (2000)
            clone tri 361

CYP79E1     Triglochin maritima
            Andersen,M.D., Moeller,B.L., Nielsen,J.S., Wittstock,U.,
            Hansen,C.H., Halkier,B.A. and Mikkelsen,M.D.
            P450 monooxygenases of the cyp79 family

CYP79E1     Triglochin maritima
            Andersen,M.D., Moeller,B.L., Nielsen,J.S., Wittstock,U.,
            Hansen,C.H., Halkier,B.A., Mikkelsen,M.D., Busk,P.K. and Bak,S.
            P450 monooxygenases of the CYP79 family

CYP79E2     Triglochin maritima
            GenEMBL AF140610
            Nielsen,J.S. and Moller,B.L.
            Cloning and expression of cytochrome P450 enzymes catalyzing the
            conversion of tyrosine to p-hydroxyphenylacetaldoxime in the
            biosynthesis of cyanogenic glucosides in Triglochin maritima
            Plant Physiol. 122 (4), 1311-1321 (2000)
            submitted to nomenclature committee 3/26/99
            95% identical to CYP79E1

CYP79E2     Triglochin maritima
            Andersen,M.D., Moeller,B.L., Nielsen,J.S., Wittstock,U.,
            Hansen,C.H., Halkier,B.A. and Mikkelsen,M.D.
            P450 monooxygenases of the cyp79 family

CYP79E2     Triglochin maritima
            Andersen,M.D., Moeller,B.L., Nielsen,J.S., Wittstock,U.,
            Hansen,C.H., Halkier,B.A., Mikkelsen,M.D., Busk,P.K. and Bak,S.
            P450 monooxygenases of the CYP79 family
            94% to 79E1, 50% to 79A7

CYP79F1     Arabidopsis thaliana
          GenEMBL AC006341 comp(63874-66127)
          46% identical to 79C1 less with other 79s
          ESTs F14189, F14190

CYP79F2   Arabidopsis thaliana
          GenEMBL AC006341 comp(60246-62290)
          89% identical to 79F1 no ESTs 98% identical to GSS B20058

CYP79F3   Boechera stricta
          No accession number
          Carrie Olson-Manning and Mary Schuler
          submitted to nomenclature committee 9/30/2008
          90% to CYP79F1, 86% to CYP79F2

CYP79F4v1 Boechera stricta
          No accession number
          Carrie Olson-Manning and Mary Schuler
          submitted to nomenclature committee 9/30/2008
          90% to CYP79F1, 87% to CYP79F2, 89% to CYP79F3
          note: there are two strains MT (Montana) and CO (Colorado)
          both strains CYP79F4 sequences are 100% identical

CYP79F5v1 Boechera stricta
          No accession number
          Carrie Olson-Manning and Mary Schuler
          submitted to nomenclature committee 2/20/2012
          91% to CYP79F4, 96% to CYP79F3, 2 aa diffs to CYP79F5v2
          note: there are two strains MT (Montana) and CO (Colorado)
          this is the MT strain

CYP79F5v2 Boechera stricta
          No accession number
          Carrie Olson-Manning and Mary Schuler
          submitted to nomenclature committee 2/20/2012
          90% to CYP79F1, 87% to CYP79F2, 89% to CYP79F3
          note: there are two strains MT (Montana) and CO (Colorado)
          this is the CO strain

80A Subfamily

CYP80A1     Berberis stolonifera, Ranunculales
            GenEMBL U09610 
            Kraus.P.F.X. and Kutchan,T.M.
            Molecular cloning and heterologous expression of a cDNA encoding
            berbamunine synthase, a C-O phenol-coupling cytochrome P450
            from the higher plant Berberis stolonifera.      
            unpublished (1994)
            submitted to nomenclature committee
            a tree of CYP80 sequences

80B Subfamily

CYP80B1v1   Eschscholzia californica (California poppy, Ranunculales)
            GenEMBL AF014800 (1901bp)
            Pauli,H.H. and Kutchan,T.M.
            Molecular cloning and functional heterologous expression of two
            alleles encoding (S)-N-methylcoclaurine 3‚-hydroxylase (CYP80B1), a
            new methyl jasmonate-inducible cytochrome P-450-dependent
            monooxygenase of benzylisoquinoline alkaloid biosynthesis
            Plant J. 13, 793-801 (1998)
            41.8% identical to 80A1
            a tree of CYP80 sequences

CYP80B1v2   Eschscholzia californica (California poppy, Ranunculales)
            GenEMBL AF014801 (1613bp)
            Pauli,H.H. and Kutchan,T.M.
            Molecular cloning and functional heterologous expression of two
            alleles encoding (S)-N-methylcoclaurine 3'-hydroxylase (CYP80B1), a
            new methyl jasmonate-inducible cytochrome P-450-dependent
            monooxygenase of benzylisoquinoline alkaloid biosynthesis
            Plant J. 13, 793-801 (1998)
            99% identical to 80B1v1 possible allele
            a tree of CYP80 sequences

CYP80B2    Coptis japonica (Japanese goldthread, Ranunculales)
           GenEMBL AB025030
           Ikezawa,N., Tanaka,M., Nagayoshi,M., Shinkyo,R., Sakaki,T.,
           Inouye,K. and Sato,F.
           Molecular Cloning and Characterization of CYP719, a Methylenedioxy
           Bridge-forming Enzyme That Belongs to a Novel P450 Family, from
           cultured Coptis japonica Cells
           J. Biol. Chem. 278 (40), 38557-38565 (2003)
           Submitted to nomenclature committee 3/21/99
           70% identical to CYP80B1
           function: (S)-N-methylcoclaurine-3‚-hydroxylase
           clone name CYPCJA
           a tree of CYP80 sequences

CYP80B3    Papaver somniferum (opium poppy, Ranunculales)
           GenEMBL AF191772
           Facchini,P.J. and Yu,M.
           cDNA cloning and characterization of (S)-N-methylcoclaurine
           3'-hydroxylase (CYP80B1) from elicitor-treated opium poppy cell
           suspension cultures
           a tree of CYP80 sequences

CYP80B3     Papaver somniferum 
            GenEMBL AF134590 (3 aa diffs to AF191772)
            Huang,F.-C. and Kutchan,T.M.
            Distribution of morphinan and benzophenanthridine alkaloid gene
            transcript accumulation in the opium poppy Papaver somniferum
            function="hydroxylates the 3'-position of the
            tetrahydrobenzylisoquinoline alkaloid
            (S)-N-methylcoclaurine to
            /note="CYP80B1; cytochrome P-450-dependent monooxygenase;
            biosynthetic pathway leading to morphine and sanguinarine"

CYP80B4    Thalictrum flavum (yellow meadow rue, Ranunculales)
           No accession number
           David Liscombe
           Submitted to nomenclature committee 10/14/04
           85% to CYP80B2 and 71% to CYP80B1, 100% to AY610509
           a tree of CYP80 sequences

CYP80B4     Thalictrum flavum subsp. glaucum (Ranunculales)
            GenEMBL AY610509
            Samanani,N., Park,S.U. and Facchini,P.J.
            Cell Type-Specific Localization of Transcripts Encoding Nine
            Consecutive Enzymes Involved in Protoberberine Alkaloid
            (er) Plant Cell 17 (3), 915-926 (2005)
            (S)-N-methylcoclaurine  3'-hydroxylase mRNA, complete cds.

CYP80C1    Populus trichocarpa (black cottonwood)

CYP80C1-se[1] Populus trichocarpa (black cottonwood)

CYP80C2    Populus trichocarpa (black cottonwood)

CYP80C     Hevea brasiliensis (rubbertree, Malpighiales)
           72% to 80C1 Populus

CYP80C     Euphorbia esula (Malpighiales)
           60% to CYP80C1, 49% to 80B2, 49% to 80B4

CYP80D1    Populus trichocarpa (black cottonwood)

CYP80D1-se[1] Populus trichocarpa (black cottonwood)

CYP80D2    Populus trichocarpa (black cottonwood)

CYP80E1    Populus trichocarpa (black cottonwood)

CYP80E2    Populus trichocarpa (black cottonwood)

CYP80E3    Vitis vinifera (grapes, Rosids, uncertain placement)
           GenEMBL EE091942.1 EE096408.1, CF205652.1 ESTs
           57% to 8E2, 55% to 80E1, 56% to 80C1

CYP80E3    Vitis vinifera (grapevine)
           CAAP02000058.1 55% to 80K1, 
           only 8 aa diffs to CYP80E3 (EE091942.1 EE096408.1, CF205652.1)
           CAAP02013654.1 CYP80E3 842-3125 100% match to CAAP02000058.1
           CAAP02016884.1   4 aa diffs to CAAP02000058.1
           CAAP02000275.1 2791-5054 6 aa diffs 

CYP80E4    Vitis vinifera (grapevine)
           CAAP02001975.1a  56% to CYP80E3 FRAMESHIFT AFTER VAALI

CYP80E5    Vitis vinifera (grapevine)
           CAAP02001975.1b  57% to CYP80E3

CYP80E6    Solanum esuclentum (tomato)
CYP80E6    Solanum tuberosum (potato)
CYP80E7    Solanum esuclentum (tomato)
CYP80E7    Solanum tuberosum (potato)

CYP80E8    Ipomoea nil (Solanales)
           69% to CYP80E6 tomato, 64% to 80C1 Populus, 56% to 80B2

CYP80E9    Solanum tuberosum (potato)

CYP80F1    Hyoscyamus niger (black henbane)
           Li,R., Reed,D.W., Liu,E., Nowak,J., Pelcher,L.E., Page,J.E. and
           Functional Genomic Analysis of Alkaloid Biosynthesis in Hyoscyamus
           niger Reveals a Cytochrome P450 Involved in Littorine Rearrangement
           Chem. Biol. 13 (5), 513-520 (2006)
           submitted to nomenclature committee July 6, 2005
           46% to 80C1, 45% to 80B2
           a tree of CYP80 sequences

CYP80F2P   Solanum esuclentum (tomato)
CYP80F3    Solanum esuclentum (tomato)
CYP80F3    Solanum tuberosum (potato)
CYP80F4P   Solanum esuclentum (tomato)
CYP80F4    Solanum tuberosum (potato)

CYP80G1    Aquilegia formosa x Aquilegia pubescens (Ranunculales)
           DR912881.1, DR923264, DT766891 ESTs
           85% to CYP80G2, 53% to 80A1, 46% to 80B4, 44% to 80C1, 
           44% to 80D1, 43% to 80E2, 40% to 80H1, 39% to 80F1

CYP80G2    Coptis japonica (Ranunculales)
           Ikezawa N, Iwasa K, Sato F.
           Molecular Cloning and Characterization of CYP80G2, a Cytochrome P450 
           That Catalyzes an Intramolecular C-C Phenol Coupling of (S)-Reticuline 
           in Magnoflorine Biosynthesis, from Cultured Coptis japonica Cells
           J. Biol. Chem. 2008 April;283(14):8810-8821.
           Clone name CjCYP80A1L
           85% to 80G1 from Aquilegia formosa x Aquilegia pubescens
           53% to 80A1, 47% to 80B4, 45% to 80C1, 45% to 80E2, 
           43% to 80D1, 42% to 80H1, 39% to 80F1

CYP80G3     Podophyllum species (Ranunculales)
            No accession number
            Joaquim Vogt Marques
            Submitted to nomenclature committee August 3, 2012
            75% to CYP80G2 Coptis japonica (Ranunculales)
            74% to CYP80G1 Aquilegia formosa x Aquilegia pubescens (Ranunculales)

CYP80H1    Aquilegia formosa x Aquilegia pubescens (Ranunculales)
           DT766793.1 DT766794.1, DT754266.1 ESTs
           50% to 80C1, 47% to 80D1, 42% to 80B2, 43% to 80E1
           42% to 80F1, 42% to 80G2, 39% to 80B1, 38% to 80A1 

CYP80J1    Carica papaya
           45% to 80B3, 
           Papaver somniferum (S)-N-methylcoclaurine 3'-hydroxylase
           51% to 80E3 Vitis vinifera

CYP80J2    Carica papaya
           95% to 80J1

CYP80J3    Carica papaya
           supercontig_107:101960..103681 (- strand)
           99% to CYP80J1

CYP80K1    Vitis vinifera (Pinot noir grape)
           GenEMBL AM430618.2
           49% to 80J1 papaya, 52% to 80E3 Vitis

CYP80K1    Vitis vinifera (grapevine)
           CAN62647.1 = AM430618.2
           CAAP02001529.1b 100% match 19493-17900 (-) strand

CYP80K2    Vitis vinifera (grapevine)
           77% to CYP80K1

CYP80K2    Vitis vinifera (grapevine)
           same as CAN62646.1 

CYP80K3    Vitis vinifera (grapevine)
           76% to CYP80K1 (end does not match)

CYP80K3    Vitis vinifera (grapevine)
           Same as CAN70170.1 but with correct C-term

CYP80L1    Sesamum indicum (a sesame plant)
           No accession number
           Eiichiro Ono
           Submitted to nomenclature committee July 11, 2007
           Clone name SiCYP-EST-G05
           34% to 76C7, 36% to CYP80F1, 43% to CYP80K1 AM430618.2 Vitis vinifera, 
           40% to CYP80E3, 37% to CYP80B2, 36% to CYP80B1, 36% to 80B4, 
           34% to CYP80A1, 40% to 80H1, 41% to 80J1, 37% to 80G1, 44% to 80D1, 
           44% to 80D2, 43% to 80E2, 42% to 80C1, 40% to 80E1

CYP80M1    Solanum esuclentum (tomato)
CYP80M1    Solanum tuberosum (potato)
CYP80M2    Solanum esuclentum (tomato)
CYP80M3P   Solanum tuberosum (potato)
CYP80M4    Solanum tuberosum (potato)
CYP80M5P   Solanum tuberosum (potato)
CYP80M5-de2b  Solanum tuberosum (potato)
CYP80M6P   Solanum tuberosum (potato)
CYP80M7P   Solanum tuberosum (potato)
CYP80M8P   Solanum tuberosum (potato)
CYP80M9P   Solanum tuberosum (potato)
CYP80M10P  Solanum tuberosum (potato)
CYP80M11P  Solanum tuberosum (potato)
CYP80N1    Solanum tuberosum (potato)
           Temp name CYP80x.1

CYP80N2    Nicotiana tabacum (tobacco)
           FI059551 GSS fragment
           89% to CYP80N1

CYP80      Helianthus argophyllus (silverleaf sunflower, Asterales) 
           EE624368.1, EE610836.1
           61% to CYP80C2, 57% to 80H1, 57% to 80E2

CYP80       Coffea canephora (Gentianales)
            57% to 80C1, 56% to CYP80B2, 50% to 76C4

CYP80       Liriodendron tulipifera (tulip poplar, magnoliids)
            FD501592.1 52% to 80K1 Vitis, 51% to 80B1

81A Subfamily

Note: The 81 and 91 families have been joined due to new Arabidpsis sequences that have 
strong sequence identity to both families.  The CYP91 family sequences have been 
renamed with new CYP81 family names.  The old names will still be recognized, but the 
newer names will be preferred.

CYP81A1     Zea mays
            EE190429.1 EE190429.1 CZ348508.1
            Sharon Potter
            sequence g 
            submitted to nomenclature committee September 7, 1994

CYP81A1     Zea mays (maize)
            3 aa diffs

CYP81A2     Zea mays
            CG385442.1, BZ534933.1, EE048430.1 CG297642.1 CG297633.1
            Sharon Potter
            sequence h
            submitted to nomenclature committee September 7, 1994

CYP81A3v1   Zea mays
            EE041851.1, CG315926.1, BM661077.1, EC880391.1 EE286764.1
            Sharon Potter
            sequence i
            submitted to nomenclature committee September 7, 1994

CYP81A3v2   Zea mays
            98% to CYP81A3 7 aa diffs

CYP81A4     Zea mays
            CG227774.1, CG211329.1, AW257915.1, DR964271.1, AI920363.1, 
            Sharon Potter
            sequence k
            submitted to nomenclature committee September 7, 1994
            ESTs AI920363 (100% match) AI947634 (1 amino acid difference)

CYP81A4     Zea mays
            2 aa diffs and 2 indels

CYP81A5     rice

CYP81A6     rice

CYP81A7     rice

CYP81A8     rice

CYP81A9     Zea mays (maize)
            GenEMBL AY109406.1
            CC734820.1, CC641623.1, CC714624.1, CC641618.1, CC166933.1
            Gardiner,J., Schroeder,S., Polacco,M.L., Sanchez-Villeda,H.,
            Fang,Z., Morgante,M., Landewe,T., Fengler,K., Useche,F.,
            Hanafey,M., Tingey,S., Chou,H., Wing,R., Soderlund,C. and Coe,E.H.
            Jr. Anchoring 9,371 maize expressed sequence tagged unigenes to the
            bacterial artificial chromosome contig map by two-dimensional
            overgo hybridization
            Plant Physiol. 134 (4), 1317-1326 (2004)
            77% to 81A2, 80% to 81A3 (partial seq), 72% to 81A4 (partial seq),
            60% to 81A1 (partial seq)

CYP81A9     Zea mays (maize)
            1 aa diff

CYP81A10v1  Lolium rigidum (ryegrass)
            GenEMBL AB159037
            Clone name CYP81B1v1
            97% to 81A10v4

CYP81A10v2  Lolium rigidum (ryegrass)
            GenEMBL AB159038
            Clone name CYP81B1v2
            97% to 81A10v4

CYP81A10v3  Lolium rigidum (ryegrass)
            GenEMBL AB159039
            Clone name CYP81B1v3
            98% to 81A10v4

CYP81A10v4  Lolium rigidum (ryegrass)
            GenEMBL AF321856
            Fischer,T.C., Klattig,J.T. and Gierl,A.
            A general cloning strategy for divergent plant cytochrome P450
            genes and its application in Lolium rigidum and Ocimum basilicum
            Theor. Appl. Genet. 103, 1014-1021 (2001) 
            clone Lol-FHH-t 
            73% to 81A9, 78% to AC084282 (rice)
            44% to 81D5 (Arab.), 7 aa diffs to 81A10v6, 97% to 81A0v5

CYP81A10v5  Lolium rigidum (ryegrass)
            GenEMBL AF321855
            Fischer,T.C., Klattig,J.T. and Gierl,A.
            A general cloning strategy for divergent plant cytochrome P450
            genes and its application in Lolium rigidum and Ocimum basilicum
            Theor. Appl. Genet. 103, 1014-1021 (2001) 
            clone Lol-FHH-v 
            98% to 81A10v4, 72% to 81A9, 78% to AC084282 (rice)
            44% to 81D5 (Arab.)

CYP81A10v6  Lolium rigidum (ryegrass)
            GenEMBL AF321857
            Fischer,T.C., Klattig,J.T. and Gierl,A.
            A general cloning strategy for divergent plant cytochrome P450
            genes and its application in Lolium rigidum and Ocimum basilicum
            Theor. Appl. Genet. 103, 1014-1021 (2001) 
            clone Lol-FHH-y 
            98% to 81A10v4, 72% to 81A9, 78% to AC084282 (rice)
            44% to 81D5 (Arab.)

CYP81A11    Echinochloa phyllopogon (late watergrass)
            No accession number
            Akira Uchino
            Submitted to nomenclature committee Oct. 31, 2007
            Clone name Ep16
            59% to 81A10v4 Lolium, 57% to 81A6 rice

CYP81A12    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Nov. 12, 2008
            Clone name Eop450-1
            71% to CYP81A6 rice, 58% to CYP81A11

CYP81A13P   Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Nov. 12, 2008
            Clone name Eop450-5
            73% to 81A12

CYP81A14    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Dec. 4, 2008
            Clone name BP14
            58% to 81A6 rice, 58% to 81A12, 79% to 81A1 Zea, 95% to 81A11

CYP81A15    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee March 31, 2009
            Clone name BP08
            87% to CYP81A11, 87% to CYP81A14, 78% to CYP81A1 Zea mays

CYP81A16    Zea mays (maize)
            97% to 81A9, 73% to CYP81A6, 79% to 81A2, 70% to 81A4 

CYP81A17    Zea mays (maize)
            70% to 81A6, 70% TO 81A16, 68% TO 81A2, 69% TO 81A9

CYP81A18    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee May 17, 2009
            Clone name BP09 (full seq)
            94% to CYP81A14, 88% to CYP81A15, 59% to CYP81A16 Zea mays
            57% to CYP81A17 Zea mays
            note: this seq is 98% to CYP81A11 
            and it does not match nucleotide seq BP09-6

CYP81A19    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee May 17, 2009
            Clone name BP04 (partial seq)
            72% to CYP81A16 Zea mays, 67% to CYP81A17 Zea mays
            62% to CYP81A14, 64% to CYP81A15

CYP81A20    Festuca rubra (red fescue)
            No accesion number
            Tengfang Huang 
            Submitted to nomenclature committee Oct. 2, 2009
            Clone 2
            63% to CYP81A6 rice

CYP81A21    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Jan. 10, 2010
            Clone name CH1
            94% to CYP81A12, 82% to CYP81A24, 71% to CYP81A6

CYP81A22    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Jan. 10, 2010
            Clone name CH2
            73% to CYP81A6, 93% to CYP81A24

CYP81A23    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Jan. 10, 2010
            Clone name CH3
            72% to CYP81A6, 79% to CYP81A24

CYP81A24    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Jan. 10, 2010
            Clone name CH4
            76% to CYP81A6, 93% to CYP81A22

CYP81A25P   Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Jan. 10, 2010
            Clone name CH5
            70% to CYP81A6, 74% to CYP81A24 short at the C-terminal,
            missing 42 amino acids

CYP81A26    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Jan. 10, 2010
            Clone name EEF11 (partial sequence from C-term
            91% to CYP81A13P, 76% to CYP81A6, 73% to CYP81A7, 79% to CYP81A24

CYP81A27P   Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Jan. 10, 2010
            Clone name BP09-6
            93% to CYP81A25P, 2 frameshifts at &

CYP81A28    Brachypodium distachyon (temperate grass)
CYP81A29    Brachypodium distachyon (temperate grass)

81B Subfamily

CYP81B1v1   Helianthus tuberosus (Jerusalem artichoke)
            GenEMBL AJ000477
            Cabello-Hurtado,F., Batard,Y., Salaun,J.P., Durst,F., Pinot,F. and
            Cloning, expression in yeast, and functional characterization of
            CYP81B1, a plant cytochrome P450 that catalyzes In-chain
            hydroxylation of fatty acids
            J. Biol. Chem. 273, 7260-7267 (1998)
            CYPYAN also called CYP81B1c

CYP81B1v2   Helianthus tuberosus (Jerusalem artichoke)
            GenEMBL AJ000478
            Cabello-Hurtado,F., Batard,Y., Salaun,J.P., Durst,F., Pinot,F. and
            Cloning, expression in yeast, and functional characterization of
            CYP81B1, a plant cytochrome P450 that catalyzes In-chain
            hydroxylation of fatty acids
            J. Biol. Chem. 273, 7260-7267 (1998)
            also called CYP81B1l

CYP81B2v1   Nicotiana tabacum (tobacco)
            no accession number 
            tobacco sequence 1
            submitted to nomenclature committee

CYP81B2v1  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D100A-AC3
           100% to CYP81B2 of Yamada

CYP81B2v2  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D100-BE2
           8aa diffs to CYP81B2v1

CYP81B3v1 Populus trichocarpa (black cottonwood)

CYP81B3v2 Populus trichocarpa (black cottonwood)

CYP81B4   Populus trichocarpa (black cottonwood)

CYP81B5   Populus trichocarpa (black cottonwood)

CYP81B6   Populus trichocarpa (black cottonwood)

CYP81B6P  Populus trichocarpa (black cottonwood)

CYP81B7   Populus trichocarpa (black cottonwood)

CYP81B8P1 Populus trichocarpa (black cottonwood)

CYP81B8P2 Populus trichocarpa (black cottonwood)

CYP81B9P  Populus trichocarpa (black cottonwood)

CYP81B10  Populus trichocarpa (black cottonwood)

CYP81B11  Populus trichocarpa (black cottonwood)

CYP81B12  Populus trichocarpa (black cottonwood)

CYP81B12-de2b Populus trichocarpa (black cottonwood)

CYP81B13P Populus trichocarpa (black cottonwood)

CYP81B-se1[2] Populus trichocarpa (black cottonwood)

CYP81B-se2[1] Populus trichocarpa (black cottonwood)

CYP81B-se3[1] Populus trichocarpa (black cottonwood)

CYP81B14   Magnolia kobus (Kobus magnolia, ornamental tree)
           No accession number
           Eiichiro Ono, Suntory LTD, Japan
           Clone name MgP450-3
           59% to 81B3 
           Submitted to nomenclature committee June 9, 2005

CYP81B15   Magnolia kobus (Kobus Magnolia)
           No accession number
           Eiichiro Ono
           Submitted to nomenclature committee July 11, 2007
           Clone name MkCYP1 
           92% to CYP81B16, 84% to CYP81B17, 80% to CYP81B18, 50% to CYP81D13, 
           50% to 81D2, 58% to 81B3v1, 55% to 81T1, 54% to 81B7, 54% to 81B11

CYP81B16   Magnolia kobus (Kobus Magnolia)
           No accession number
           Eiichiro Ono
           Submitted to nomenclature committee July 11, 2007
           Clone name MkCYP1F 
           86% to CYP81B15, 55% to 81B3v1

CYP81B17   Magnolia kobus (Kobus Magnolia)
           No accession number
           Eiichiro Ono
           Submitted to nomenclature committee July 11, 2007
           Clone name MkCYP2 
           82% to CYP81B15, 56% to 81B6, 56% to 81B4, 55% to 81B2, 57% to 81B3v1

CYP81B18   Magnolia kobus (Kobus Magnolia)
           No accession number
           Eiichiro Ono
           Submitted to nomenclature committee July 11, 2007
           Clone name MkCYP3 
           77% to CYP81B16, 56% to 81B3v1, 55% to 81B2v2, 54% to 81Q1, 
           54% to 81T1, 49% to 81D2

CYP81B19   Carica papaya
           44% to 81D1, 45% TO 81A5
           61% to 81B20, 55% to 81B2 tobacco

CYP81B20   Carica papaya
           43% to 81A6 
           80% to 81B24, 85% to 81B21

CYP81B21   Carica papaya
           44% to 81A6 
           85% to 81B20

CYP81B22   Carica papaya
           43% to 81A6 
           78% to CYP81B20

CYP81B23   Carica papaya
           supercontig_688:5847,16242, with a seq gap in mid region
           87% to CYP81B24

CYP81B24   Carica papaya
           supercontig_17:2384354..2385990 (+ strand)
           last part of GS_ORF_225_from_supercontig_17
           58% to 81B2v2 tobacco, 45% to 81F3

CYP81B25   Coptis japonica (Japanese goldthread, Ranunculales)
           Nobuhiro Ikezawa and Fumihiko Sato
           submitted to nomenclature committee 11/5/07
           clone name 3B08D02701
           59% to 81B2v2 tobacco
           64% to Vitis CAAP02007087.1a = CAN68429.1 (CYP81B26)

CYP81B26   Vitis vinifera (grapevine)
           CAAP02007087.1a = CAN68429.1

CYP81B27   Vitis vinifera (grapevine)
           See Vitis pages for sequence

CYP81B28P  Vitis vinifera (grapevine)
           See Vitis pages for sequence

CYP81B29   Vitis vinifera (grapevine)
           See Vitis pages for sequence

CYP81B29   Vitis vinifera (grapevine)
           See Vitis pages for sequence

CYP81B29   Vitis vinifera (grapevine)
           See Vitis pages for sequence

CYP81B30   Vitis vinifera (grapevine)
           CAN78219.1, CAAP02000568.1a
           See Vitis pages for sequence

CYP81B31   Vitis vinifera (grapevine)
           See Vitis pages for sequence

CYP81B32   Vitis vinifera (grapevine)
           See Vitis pages for sequence

CYP81B33P  Vitis vinifera (grapevine)
           See Vitis pages for sequence

CYP81B34   Vitis vinifera (grapevine)
           See Vitis pages for sequence

CYP81B35P  Vitis vinifera (grapevine)
           See Vitis pages for sequence

CYP81B35P  Vitis vinifera (grapevine)
           See Vitis pages for sequence

CYP81B36   Scoparia dulcis (licorice weed, sweet broom, escobilla, Lamiales)
           No accession number
           Yoshimi Yamamura
           Submitted to nomenclature committee Nov. 11, 2009
           Clone name SdCYP1
           65% to CYP81B2v1 tobacco, 62% to CYP81B27 Vitis

CYP81B37   Solanum lycopersicum (tomato, Solanales)
CYP81B37   Solanum tuberosum (potato)
CYP81B38   Solanum lycopersicum (tomato, Solanales)
CYP81B38a  Solanum tuberosum (potato)
CYP81B38b  Solanum tuberosum (potato)
CYP81B38b-de1b  Solanum tuberosum (potato)
CYP81B39   Solanum lycopersicum (tomato, Solanales)
CYP81B39   Solanum tuberosum (potato)
CYP81B40   Solanum lycopersicum (tomato, Solanales)
CYP81B40   Solanum tuberosum (potato)
CYP81B41   Solanum lycopersicum (tomato, Solanales)
CYP81B41   Solanum tuberosum (potato)
CYP81B42P  Solanum lycopersicum (tomato, Solanales)
CYP81B43P  Solanum lycopersicum (tomato, Solanales)
CYP81B44P  Solanum lycopersicum (tomato, Solanales)
CYP81B45P  Solanum lycopersicum (tomato, Solanales)
CYP81B46P  Solanum lycopersicum (tomato, Solanales)

CYP81B47    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            57% to CYP81B1v1 Helianthus tuberosus

CYP81B48    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            55% TO CYP81B1v1 Helianthus tuberosus

CYP81B49    Nelumbo nucifera (sacred lotus, Proteales)
CYP81B50    Nelumbo nucifera (sacred lotus, Proteales)
CYP81B51P   Nelumbo nucifera (sacred lotus, Proteales)
CYP81B52    Nelumbo nucifera (sacred lotus, Proteales)
CYP81B53P   Nelumbo nucifera (sacred lotus, Proteales)
CYP81B54    Ricinus communis (castor bean, Malpighiales)
CYP81B54    Jatropha curcas  (Malpighiales)
CYP81B55    Ricinus communis (castor bean, Malpighiales)
CYP81B55    Jatropha curcas  (Malpighiales)

CYP81B56    Podophyllum species (Ranunculales)
            No accession number
            Joaquim Vogt Marques
            Submitted to nomenclature committee August 3, 2012
            64% to CYP81B25 Coptis japonica (Ranunculales)
            60% to CYP81B1v1 Helianthus tuberosus
            60% to CYP81B32 Vitis

CYP81B57    Podophyllum species (Ranunculales)
            No accession number
            Joaquim Vogt Marques
            Submitted to nomenclature committee August 3, 2012
            72% to CYP81B25 Coptis japonica (Ranunculales)
            66% to CYP81B56 Podophyllum species (Ranunculales)
            58% to CYP81B1v1 Helianthus tuberosus
            60% to CYP81B26 Vitis

CYP81B58    Artemisia annua (sweet Annie, sweet wormwood, Asterales)
            No accession number
            Tessa Moses
            Submitted to nomenclature committee July 1, 2013
            Clone name comp9232
            61% to CYP81B39 potato

CYP81B     Oryza sativa (rice)
           GenEMBL AF140486 partial sequence
           57% to 81B1v1 over C-terminal fragment

CYP81B    Panax ginseng (ginseng, Apiales)
          61% to 81B1

CYP81B    Mimulus guttatus (Lamiales)
          62% to 81B1, 61% to 81D2

CYP81     Cucumis melo (Cucurbitales)
          61% to 81B1

CYP81     Mesembryanthemum crystallinum  (Ice plant, Caryophyllales)
          52% to 81B1, 53% to 81D11

CYP81B    Aquilegia formosa x Aquilegia Pubescens (Ranunculales)
          65% to 81B1

81C Subfamily

CYP81C1     Nicotiana tabacum (tobacco)
            EB427074.1, EB426777.1 mid region 3 aa diffs and one frameshift
            tobacco sequence 3
            complete sequence submitted to nomenclature committee

CYP81C2     Nicotiana tabacum (tobacco)
            DW000362.1 (partial seq)
            tobacco sequence 4
            complete sequence submitted to nomenclature committee

CYP81C3   Populus trichocarpa (black cottonwood)

CYP81C4   Populus trichocarpa (black cottonwood)

CYP81C5   Populus trichocarpa (black cottonwood)

CYP81C6v1  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D205-BG9
           66% to 81C2

CYP81C6v2  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D205-BE9
           66% to 81C2, 1 aa diff to CYP81C6v1

CYP81C7    Nicotiana tabacum 
           91% to 81C2, 82% to 82C1, 67% to 81C6, 52% to 81D5

CYP81C8     Solanum lycopersicum (tomato)

CYP81C8     Solanum tuberosum (potato)

CYP81C9     Solanum lycopersicum (tomato)

CYP81C9P    Solanum tuberosum (potato)

CYP81C10    Solanum lycopersicum (tomato)

CYP81C10    Solanum tuberosum (potato)

CYP81C11    Solanum lycopersicum (tomato)

CYP81C11    Solanum tuberosum (potato)

CYP81C12P   Solanum lycopersicum (tomato)

CYP81C13    Catharanthus roseus
            No accesion number
            Daniele Werck-Reichhart
            Submitted to nomenclature committee Oct. 10, 2011
            Full sequence
            58% to CYP81C2 full seq Nicotiana tabacum (tobacco)
            57% to CYP81C1 full seq Nicotiana tabacum (tobacco)
            54% to CYP81C5 Populus trichocarpa

81D Subfamily

CYP81D1 formerly CYP91A1 (families joined)
            Arabidopsis thaliana
            D78606 (500 amino acids)
            Mizutani,M., Ward,E. and Ohta,D.
            Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
            cDNAs, differential expression, and RFLP mapping of multiple
            cytochromes P450
            Plant Mol. Biol. 37, 39-52 (1998)

CYP81D1     Arabidopsis thaliana 
            GenEMBL AB026661 comp(8484-10672)

CYP81D2     Arabidopsis thaliana
            GenEMBL Z99707 C7A10.10 C-terminal fragment 
            AL035601 F6G17.10  complete sequence 
            GSS AQ250603

CYP81D2     Arabidopsis thaliana
            GenEMBL AL161591 possibly 9 genes

CYP81D3     Arabidopsis thaliana
            GenEMBL Z99707 C7A10.20
            Complete sequence 

CYP81D3     Arabidopsis thaliana
            GenEMBL AL161591 possibly 9 genes
            CDS complement(join(58723..59340,59438..59824,59979..60476))

CYP81D4     Arabidopsis thaliana
            GenEMBL Z99707 C7A10.30
            Complete sequence 

CYP81D4     Arabidopsis thaliana
            GenEMBL AL161591 possibly 9 genes

CYP81D5     Arabidopsis thaliana
            GenEMBL Z99707 C7A10.40
            Complete sequence

CYP81D5     Arabidopsis thaliana
            GenEMBL AL161591 possibly 9 genes
            CDS complement(join(53512..54114,54191..54574,54960..55460))
CYP81D6     Arabidopsis thaliana
            GenEMBL AC002391 T20D16.15
            Complete sequence 

CYP81D7        Arabidopsis thaliana
            GenEMBL AC002391 T20D16.18
            Complete sequence 

CYP81D8 formerly CYP91A3 (families joined)
            Arabidopsis thaliana
            GenEMBL AL035601 F6G17.20
            65% identical with 81D1
            ESTs AA586064, N38687, T41596, H76015

CYP81D8 formerly CYP91A3 (families joined)
            GenEMBL AL161591 possibly 9 genes

CYP81D9X   Cicer arietinum (chickpea)
           GenEMBL AJ249802
           Stefan Overkamp
           submitted to nomenclature committee 4/28/99
           60% identical to 81D8 over J-helix to end of gene
           Note: 81D9 and 76F1 seem to be the same sequence
           One of the names must be discontinued.  This seq is partial
           And this reflects the difficulties of assigning a name to a partial 
           sequence.  The best match to 81D9 is a grape P450 AJ237995
           the grape seq seems to belong to the 76 family, so 76F1 is correct
           This is a problem I should have caught, but missed.

CYP81D10   Arabidopsis thaliana
           GenEMBL AC013288 14837-27604 clone T12I7
           74% to 81D2 chromosome I 
           GSSs B23310 B21261 no ESTs

CYP81D11   Arabidopsis thaliana
           GenEMBL AP002057 comp(8441-10208)
           chromosome 3, BAC clone T19N8, 67% to 81D2
           ESTs T14177 Z29010, Z29011, Z26103, H77232, F14118

CYP81D12   This seq has become lost
           If anyone knows the origin of CYP81D12 let me know
           54% to 81D3, 54% to 81D10

CYP81D13   Hydrocotyle sibthorpioides (lawn marshpennywort)
           No accession number
           Eiichiro Ono
           Submitted to nomenclature committee July 11, 2007
           Clone name HsCYP3 
           55% to 81D1, 56% to 81D8, 55% to 81D11, 54% to 81Q1, 
           48% to 81B18, 54% to 81Q

CYP81D14P  Carica papaya
           supercontig_6:676464,678071  (+ strand)
           80% to 81D16

CYP81D15P  Carica papaya
           Upstream of CYP81D14P
           62% to 81D18

CYP81D16   Carica papaya
           55% to 81D18

CYP81D17P  Carica papaya
           76% to 81D18

CYP81D18   Carica papaya
           60% to 81D8

CYP81D19   Carica papaya
           Model is too long at N-term, missing C-term in a seq gap
           57% to 81D8

CYP81D20   Carica papaya
           supercontig_6:652529..655017 (-) strand
           55% TO 81D2 

CYP81D21   Carica papaya
           71% to 81D18

CYP81D22   Brassica rapa
           On A03 11838308-11840091 (-) strand Bra000572
           67% to CYP81D7
           note Bra00568 is a terpene synthase

CYP81    Coffea arabica x Coffea canephora (Gentianales)
         GenEMBL DQ123987.1 
         57% to 81D10

CYP81       Fragaria vesca (wild strawberry, Rosales)
            GenEMBL DY675817.1 
            65% to 81E2, 64% to 81D11, 54% to 81A10, 55% to 81A6 

CYP81      Aconitum napellus (Ranunculales)
           GenEMBL AY870893.1  
           60% to 81F region before EXXR

81E Subfamily

CYP81E1 formerly CYP91A4 (families joined)
            Glycyrrhiza echinata_ L. (licorice; Fabaceae)
            GenEMBL AB001379  or D89431
            Akashi,T., Aoki,T., Kameya,N., Nakamura,I. and Ayabe,S.
            Two new cytochrome P450 cDNAs (Accession Nos. AB001379 and
            AB001380) from elicitor-induced licorice (Glycyrrhiza echinata L.)
            cells (PGR97-167)
            Plant Physiol. 115, 1288 (1997)            Ge-3
            50.1% identical to 81D1

            Akashi, T., Aoki, T. and Ayabe, S. 
            CYP81E1, a cytochrome P450 cDNA of licorice (Glycyrrhiza echinata L.)
            encodes isoflavone 2'-hydroxylase.
            Biochem. Biophys. Res. Commun. 251, 67-70 (1998)

CYP81E1v2   Glycyrrhiza echinata
            GenEMBL   AB022732
            Akashi,T., Aoki,T. and Ayabe,S.
            A cytochrome P450 cDNA from cultured Glycyrrhiza echinata L. cells
            unpublished (1999) In press
            CYP Ge-31 97% identical to CYP81E1

CYP81E2 formerly CYP91A5 
            Cicer arietinum (chickpea)
            GenEMBL AJ239051
            Overkamp,S., Hein,F. and Barz,W.
            Isolation of elicitor induced cytochrome P450 sequences from
            chickpea (Cicer arietinum) cell suspension cultures
            submitted to nomenclature committee, sequence revised 5/20/99
            52.7% identical to CYP81E1

CYP81E3v1   Cicer arietinum (chickpea)
            GenEMBL AJ012581
            Stefan Overkamp and Wolfgang Barz
            Cloning of Two Cicer arietinum L.
            cDNA's (Accession Nos. AJ012581 and AJ238439) Encoding Cytochrome P450s 
            Highly Homologous to Isoflavone 2'-Hydroxylase from Licorice. (PGR99-102)
            Plant Physiol. 120, 935 (1999)
            86% identical to CYP81E1 from licorice

CYP81E3v2   Cicer arietinum (chickpea)
            GenEMBL AJ238439
            Stefan Overkamp and Wolfgang Barz
            Cloning of Two Cicer arietinum L.
            cDNA's (Accession Nos. AJ012581 and AJ238439) Encoding Cytochrome P450s 
            Highly Homologous to Isoflavone 2'-Hydroxylase from Licorice. (PGR99-102)
            Plant Physiol. 120, 935 (1999)
            (revised sequence sent 4/28/99)
            85% identical to CYP81E1 from licorice
            96% identical to 81E3v1 (6 amino acid differences in N-terminal 20 amino acids)

CYP81E4     Cicer arietinum (chickpea)
            GenEMBL AJ249801
            Stefan Overkamp 
            62% identical to 81E1 from I-helix to end of gene
            84% identical to 81E5
            submitted to nomenclature committee 8/17/99 revised 9/6/99

CYP81E5     Cicer arietinum (chickpea)
            GenEMBL AJ249800
            Stefan Overkamp 
            submitted to nomenclature committee 9/16/99
            84% identical to 81E4

CYP81E6     Lotus japonicus
            GenEMBL AB025016
            Shimada,N., Aoki,T. and Ayabe,S.
            A cytochrome P450 cDNA from Lotus japonicus
            Unpublished April 4, 2000

CYP81E7     Medicago truncatula (barrel medic)
            GenEMBL AY278227 GenPept AAQ20040
            Liu,C.J., Huhman,D., Sumner,L.W. and Dixon,R.A.
            Regiospecific hydroxylation of isoflavones by cytochrome P450 81E
            enzymes from Medicago truncatula
            Plant J. 36 (4), 471-484 (2003)
            submitted to nomenclature committee 3/10/2003
            clone name MtCYP81E1V2
            84% to 81E1v2

CYP81E8v1   Medicago truncatula (barrel medic, Fabales)
            GenEMBL AY278229 GenPept AAQ20042
            Liu,C.J., Huhman,D., Sumner,L.W. and Dixon,R.A.
            Regiospecific hydroxylation of isoflavones by cytochrome P450 81E
            enzymes from Medicago truncatula
            Plant J. 36 (4), 471-484 (2003)
            submitted to nomenclature committee 3/10/2003
            clone name MtCYP81E2
            62% to 81E1v2 60% to 81E2

CYP81E8v2   Medicago truncatula (barrel medic, Fabales)
            GenEMBL CT573077.2a

CYP81E9     Medicago truncatula (barrel medic, Fabales)
            GenEMBL AY278228 GenPept AAQ20041
            Liu,C.J., Huhman,D., Sumner,L.W. and Dixon,R.A.
            Regiospecific hydroxylation of isoflavones by cytochrome P450 81E
            enzymes from Medicago truncatula
            Plant J. 36 (4), 471-484 (2003)
            submitted to nomenclature committee 3/10/2003
            clone name MtCYP81E3
            61% to 81E1v2 63% to 81E3v1

CYP81E10    Medicago truncatula (barrel medic, Fabales)
            GenEMBL CT573077.2b

CYP81E11    Glycine max (soybeans, Fabales)
            Li,L.Y. and Yu,D.Y.
            Comprehensive analysis of putative P450 genes superfamily in
            Glycine max and Medicago truncatula
            58% to 81E7, Called CYP81E10
            note 81E11 and 81E13 are the same seq.

CYP81E11    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C44

CYP81E11-de2b  Glycine max (soybeans, Fabales)

CYP81E12    Glycine max (soybeans, Fabales)
            Li,L.Y. and Yu,D.Y.
            Comprehensive analysis of putative P450 genes superfamily in
            Glycine max and Medicago truncatula
            60% to 81E7 Called CYP81E11

CYP81E12    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C7

CYP81E12-de1b  Glycine max (soybeans, Fabales)

CYP81E13X   Glycine max (soybeans, Fabales)
            Li,L.Y. and Yu,D.Y.
            Comprehensive analysis of putative P450 genes superfamily in
            Glycine max and Medicago truncatula
            58% to 81E7 Called CYP82E13
            note 81E11 and 81E13 are the same seq. rename this seq to 81E11

CYP81E14    Pisum sativum
            Savenstrand,H. and Strid,A.
            Six genes strongly regulated by mercury in Pisum sativum roots
            Plant Physiol. Biochem. 42 (2), 135-142 (2004)
            79% to 81E9

CYP81E15    Astragalus membranaceus
            Pan,H.Y., Zhou,T.S. and Chen,J.K.
            Cloning and expression in E. coli of an isoflavone 3'-hydroxylase
            gene from Astragalus membranaceus var. mongholicus
            isoflavone 3'-hydroxylase
            83% to 81E9

CYP81E16P   Glycine max (soybean, Fabales)

CYP81E17    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C42
            4 aa diffs to 81E19, 93% to 81E11

CYP81E18    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C22, C43
            2 aa diffs to 81E24, 98% to 81E16v9, 89% to 81E11

CYP81E19    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C8
            4 AA diffs to 81E24, 7 aa diffs to 81E18, 92% to 81E11

CYP81E20    Glycine max (soybean, Fabales)

CYP81E21    Glycine max (soybean, Fabales)

CYP81E22    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C13, C24
            77% to 81E8

CYP81E22-de1b  Glycine max (soybean, Fabales)

CYP81E23P   Glycine max (soybean, Fabales)

CYP81E24    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C41
            60% to 81E22, 59% to 81E8

CYP81E25P   Glycine max (soybean, Fabales)

CYP81E26P   Glycine max (soybean, Fabales)

CYP81E27P   Glycine max (soybean, Fabales)

CYP81E28    Glycine max (soybean, Fabales)

CYP81E29    Glycine max (soybean, Fabales)

CYP81E30P   Glycine max (soybean, Fabales)

CYP81E31P   Glycine max (soybean, Fabales)

CYP81E32P   Glycine max (soybean, Fabales)

CYP81E33P   Glycine max (soybean, Fabales)

CYP81E34P   Glycine max (soybean, Fabales)

CYP81E35P   Glycine max (soybean, Fabales)

CYP81E36P   Glycine max (soybean, Fabales)

CYP81E37P   Glycine max (soybean, Fabales)

CYP81E38P   Glycine max (soybean, Fabales)

CYP81E39P   Glycine max (soybean, Fabales)

CYP81E40    Lotus japonicus
            No accession number
            Dale Shelton and Soren Bak
            Submitted to nomenclature committee Feb. 10, 2011
            74% to CYP81E8, 60% to CYP81E6

CYP81E41    Lotus japonicus
            No accession number
            Dale Shelton and Soren Bak
            Submitted to nomenclature committee Feb. 10, 2011
            CYP81ELT_1 chr2.CM0250.2
            59% to CYP81E8, 52% to CYP81E6, 57% to CYP81E40

CYP81E frag.  Astragalus membranaceus
              Pan,H.Y., Zhou,T.S. and Chen,J.K.
              Cloning and expression in E. coli of an isoflavone 2'-hydroxylase
              gene from Astragalus membranaceus var. mongholicus
              isoflavone 2'-hydroxylase
              77% to 81E7 

CYP81E frag.  Cicer arietinum
              Dopico,B. and Labrador,E.
             A cytochrome P450 monooxygenase is 
             expressed in chickpea epicotyls
              77% to 81E7

81F Subfamily

CYP81F1 formerly CYP91A2 (families joined)
            Arabidopsis thaliana
            D78607 (500 amino acids) also AL035601 F6G17.80
            Mizutani,M., Ward,E. and Ohta,D.
            Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
            cDNAs, differential expression, and RFLP mapping of multiple
            cytochromes P450
            Plant Mol. Biol. 37, 39-52 (1998)

CYP81F2     Arabidopsis thaliana
            GenEMBL AB019233 11949 - 13701
            about 70% identical to 81F1

CYP81F3    Arabidopsis
           GemEMBL AL035601 F6G17.50 
           ESTs AA712784
           68% identical to 81F1

CYP81F3     Arabidopsis thaliana
            GenEMBL AL161591 possibly 9 genes
            CDS join(78416..78736,78839..78898,79333..79968) partial

CYP81F4    Arabidopsis
           GemEMBL AL035601 F6G17.60 
           ESTs T46441 AA598000 AI099973 
           65% identical to 81F2

CYP81F4    Arabidopsis
           AL161591 possibly 9 genes
           CDS join(84619..85494,85922..86551)

81G Subfamily

CYP81G1        Arabidopsis thaliana
            GenEMBL AB007645 (comp. 8707-7177)
            Complete sequence 

81H Subfamily

CYP81H1       Arabidopsis thaliana
              GenEMBL Z99707 C7A10.50
              Complete sequence

CYP81H1       Arabidopsis thaliana
              GenEMBL AL161591 possibly 9 genes
              CDS complement(join(49922..50578,51085..51474,52094..52603))

CYP81J1 formerly CYP717A1       Hemerocallis hybrid cultivar (daylily)
             GenEMBL AF082028 (1373bp)
             Panavas,T., Pikula,A., Reid,P.D., Rubinstein,B. and Walker,E.L.
             Identification of senescence-associated genes from daylily

CYP81K1     Arabidopsis thaliana
           GenEMBL AL353995 comp(9841..11343)
           chromosome 5, BAC clone F12B17

CYP81K2     Arabidopsis thaliana
           GenEMBL AL353995 comp(11529..11633,11733..11837,12108..13583)
           chromosome 5, BAC clone F12B17
           note: this sequence has a C-terminal extension that may be incorrect

CYP81K3    Carica papaya
           43% to 81M1
           58% to CYP81K1

CYP81L1    Triticum aestivum (wheat)
           BT009640.1, CA614064.1, CA648984.1, CA653823.1
           Daniele Werck-Reichhart
           Clone name 81-1
           Submitted to nomenclature committee 6/4/2001
           45% to 81A2, 48% to 81B1, 40% to 81C1, 46% to 81D10
           40% to 81E1v2, 39% to 81F1, 41% to 81G1, 40% to 81H1
           43% to 81J1 partial, 38% to 81K1
           complete seq. known but confidential

CYP81L2     rice

CYP81L3     rice

CYP81L4     rice

CYP81L5     rice

CYP81L6     Zea mays (maize)
            60% to CYP81L4 

CYP81L7     Brachypodium distachyon
CYP81L8P    Brachypodium distachyon

CYP81M1     rice
CYP81M1     Brachypodium distachyon

CYP81N1     rice

CYP81N2     rice

CYP81N3P    rice

CYP81N4     Zea mays (maize)
            68% to CYP81N2 

CYP81N5     Zea mays (maize)
            66% to CYP81N2, 72% TO 81N4 

CYP81N6     Brachypodium distachyon
CYP81N7     Brachypodium distachyon
CYP81N8P    Brachypodium distachyon

CYP81N9v1   Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Feb. 25, 2011
            Clone name LADEG1
            79% to CYP81N6 Brachypodium distachyon, 
            77% to CYP81N2 rice, 95% to CYP81N10 Echinochloa phyllopogon

CYP81N9v2   Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Feb. 25, 2011
            Clone name Ep22
            95% to CYP81N9v1 Echinochloa phyllopogon

CYP81N10    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Feb. 25, 2011
            Clone name LADEG2
            87% to CYP81N4 Zea mays, 
            80% to CYP81N2 rice, 83% to CYP81N9v1 Echinochloa phyllopogon

CYP81P1     rice
CYP81P2     Brachypodium distachyon
CYP81P3     Brachypodium distachyon

CYP81Q1     Sesamum indicum (sesame plant in Japan)
            GenEMBL AB194714
            Ono,E., Nakai,M., Fukui,Y., Tomimori,N., Fukuchi-Mizutani,M.,
            Saito,M., Satake,H., Tanaka,T., Katsuta,M., Umezawa,T. and
            Formation of two methylenedioxy bridges by a Sesamum CYP81Q protein
            yielding a furofuran lignan, (+)-sesamin
            Proc. Natl. Acad. Sci. U.S.A. 103 (26), 10116-10121 (2006)                       
            Submitted to nomenclature committee 11/1/2001
            Clone name SST
            54% to 81D2 95% to 81Q2, 86% to 81Q3
CYP81Q2     Sesamum radiatum (sesame plant in India)
            GenEMBL AB194715
            Ono,E., Nakai,M., Fukui,Y., Tomimori,N., Fukuchi-Mizutani,M.,
            Saito,M., Satake,H., Tanaka,T., Katsuta,M., Umezawa,T. and
            Formation of two methylenedioxy bridges by a Sesamum CYP81Q protein
            yielding a furofuran lignan, (+)-sesamin
            Proc. Natl. Acad. Sci. U.S.A. 103 (26), 10116-10121 (2006)                       
            Submitted to nomenclature committee 11/1/2001
            Clone name SrSST
            53% to 81D2 
CYP81Q3     Sesamum alatum (sesame plant in Africa)
            GenEMBL AB194716
            Ono,E., Nakai,M., Fukui,Y., Tomimori,N., Fukuchi-Mizutani,M.,
            Saito,M., Satake,H., Tanaka,T., Katsuta,M., Umezawa,T. and
            Formation of two methylenedioxy bridges by a Sesamum CYP81Q protein
            yielding a furofuran lignan, (+)-sesamin
            Proc. Natl. Acad. Sci. U.S.A. 103 (26), 10116-10121 (2006)                       
            Submitted to nomenclature committee 11/1/2001
            Clone name SaSST
            53% to 81D2 

CYP81Q4     Sesamum schinzianum (sesame plant from Namibia)
            No accession number
            Eiishiro Ono, Advanced Technology Suntory Ltd. Japan
            Submitted to nomenclature committee 5/21/2006
            96% to 81Q2, 95% to 81Q1, 85% to 81Q3
            54% to 81E8, 54% to 81D3 

CYP81Q5     Sesamum indicum (Sesame)
            No accession number
            Eiishiro Ono
            Submitted to nomenclature committee 7/22/2010
            Clone name SiCYP12
            60% to CYP81Q20 Vitis, 56% to Sesamum schinzianum CYP81Q4,
            56% to CYP81D8 Arab.,
            note: there is a little overlap between CYP81Q and CYP81D. 
            The CYP81V subfamily in Vitis has been renamed to CYP81Q.

CYP81Q6     Sesamum indicum (Sesame)
            No accession number
            Eiishiro Ono
            Submitted to nomenclature committee 7/22/2010
            Clone name SiCYP32
            59% to CYP81Q20 Vitis, 56% to Sesamum schinzianum CYP81Q4, 
            56% to CYP81D8 Arab.,
            note: there is a little overlap between CYP81Q and CYP81D. 
            The CYP81V subfamily in Vitis has been renamed to CYP81Q.

CYP81Q7      Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V1

CYP81Q8      Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V2

CYP81Q9      Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V3

CYP81Q10P    Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V4P

CYP81Q11P    Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V5P

CYP81Q12     Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V6

CYP81Q13P    Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V7P

CYP81Q14P    Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V8P

CYP81Q15     Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V9

CYP81Q16     Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V10

CYP81Q17P    Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V11P

CYP81Q18P    Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V12P

CYP81Q19     Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V13

CYP81Q20     Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V14

CYP81Q21P    Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V15P

CYP81Q22P    Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V16P

CYP81Q23     Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V17

CYP81Q24     Vitis vinifera (grape)
             CAAP02009879.1 , CAN60308.1
             See Vitis pages for sequence
             formerly CYP81V18

CYP81Q25     Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V19

CYP81Q26     Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V20

CYP81Q27     Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V21

CYP81Q27     Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V21

CYP81Q27-de1b  Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V21-de1b

CYP81Q27-de1b  Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V21-de1b

CYP81Q28P    Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V22P

CYP81Q29     Vitis vinifera (grape)
             See Vitis pages for sequence
             formerly CYP81V23

CYP81Q30     Solanum lycopersicum (tomato)

CYP81Q30     Solanum tuberosum (potato)

CYP81Q31     Solanum lycopersicum (tomato)

CYP81Q31     Solanum tuberosum (potato)

CYP81Q32     Catharanthus roseus
             No accesion number
             Daniele Werck-Reichhart
             Submitted to nomenclature committee Oct. 10, 2011
             Full sequence
             60% to CYP81Q7 Vitis vinifera
             57% to CYP81D8 Arabidopsis (some overlap with CYP81D)

CYP81Q33    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            65% to CYP81Q7 Vitis vinifera

CYP81Q34    Hypericum calycinum
            No accession number
            Ludger Beerhues
            Submitted to nomenclature committee March 15, 2012
            60% to CYP81Q15 Vitis vinifera, 60% to CYP81D8 Arabidopsis
            note: ther is overlap between the CYP81D and CYP81Q subfamilies

CYP81R1       Populus trichocarpa (black cottonwood)
CYP81R2       Populus trichocarpa (black cottonwood)
CYP81R3P      Populus trichocarpa (black cottonwood)
CYP81R4       Populus trichocarpa (black cottonwood)
CYP81R5P      Populus trichocarpa (black cottonwood)
CYP81R6       Populus trichocarpa (black cottonwood)
CYP81R6-de2b  Populus trichocarpa (black cottonwood)
CYP81S1v1     Populus trichocarpa (black cottonwood)
CYP81S1v2     Populus trichocarpa (black cottonwood)
CYP81S1v3     Populus trichocarpa (black cottonwood)
CYP81S2       Populus trichocarpa (black cottonwood)
CYP81S3       Populus trichocarpa (black cottonwood)
CYP81S4       Populus trichocarpa (black cottonwood)
CYP81S5P      Populus trichocarpa (black cottonwood)
CYP81S6       Populus trichocarpa (black cottonwood)
CYP81S7       Populus trichocarpa (black cottonwood)
CYP81S8       Populus trichocarpa (black cottonwood)
CYP81S9       Populus trichocarpa (black cottonwood)
CYP81S10P     Populus trichocarpa (black cottonwood)
CYP81S11      Populus trichocarpa (black cottonwood)
CYP81S12v1    Populus trichocarpa (black cottonwood)
CYP81S12v2    Populus trichocarpa (black cottonwood)
CYP81S13      Populus trichocarpa (black cottonwood)
CYP81S14v1    Populus trichocarpa (black cottonwood)
CYP81S14v2    Populus trichocarpa (black cottonwood)
CYP81S-se1[2] Populus trichocarpa (black cottonwood)
CYP81T1       Populus trichocarpa (black cottonwood)
CYP81T1-de2b  Populus trichocarpa (black cottonwood)
CYP81T1-de2c  Populus trichocarpa (black cottonwood)

CYP81U1     Iris hollandica (Iris, monocot)
            Minowa,M., Yoshihara,N., Imayama,T., Tanaka,Y. and Yabuya,T.
            Molecular cloning of cytochrome P450 from Iris hollandica
            Published Only in Database (2003)
            IhCYP-1 mRNA for cytochrome P450, complete cds.
            47% to 81D2 with missing part at heme region
            52% to 81B4
(seq gap 44 amino acids)

CYP81V1X     Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q7

CYP81V2X     Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q8

CYP81V3X     Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q9

CYP81V4PX    Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q10P

CYP81V5PX    Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q11P

CYP81V6X     Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q12

CYP81V7PX    Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q13P

CYP81V8PX    Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q14P

CYP81V9X     Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q15

CYP81V10X    Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q16

CYP81V11PX   Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q17P

CYP81V12PX   Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q18P

CYP81V13X    Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q19

CYP81V14X    Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q20

CYP81V15PX   Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q21P

CYP81V16PX   Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q22P

CYP81V17X    Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q23

CYP81V18X    Vitis vinifera (grape)
             CAAP02009879.1 , CAN60308.1
             See Vitis pages for sequence
             Renamed CYP81Q24

CYP81V19X    Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q25

CYP81V20X    Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q26

CYP81V21X    Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q27

CYP81V21X    Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q27

CYP81V21-de1bX Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q27-de1b

CYP81V21-de1bX Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q27-de1b

CYP81V22PX   Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q28P

CYP81V23X    Vitis vinifera (grape)
             See Vitis pages for sequence
             Renamed CYP81Q29

CYP81W1      Vitis vinifera (grape)
             See Vitis pages for sequence

CYP81X1    Glycine max (soybean, Fabales)

CYP81X2P   Glycine max (soybean, Fabales)

CYP81Y1    tomato
CYP81Y1    Solanum tuberosum (potato)

CYP81Z1    Catharanthus roseus (Madagascar periwinkle)
           David K. Liscombe
           Submitted to nomenclature committee Jan. 20, 2011
           50% to CYP81B1v1 sunflower

CYP81Z1     Catharanthus roseus
            No accession number
            Daniele Werck-Reichhart
            Submitted to nomenclature committee Oct. 10, 2011
            Full sequence
            identical to JF266590.1

CYP81Z2     Catharanthus roseus
            No accession number

CYP81Z3     Catharanthus roseus
            No accession number

CYP81Z4v1   Catharanthus roseus
            No accession number

CYP81Z4v2   Catharanthus roseus
            No acces`sion number
            Vonny Salim
            Submitted to nomenclature committee Jan. 30, 2013
            95% to CYP81Z4v1 Catharanthus roseus

CYP81AA1    Hypericum calycinum
            No accession number
            Ludger Beerhues
            Submitted to nomenclature committee March 15, 2012
            52% to CYP81C3 Populus trichocarpa

CYP81AA1    Hypericum perforatum
            No accession number
            Ludger Beerhues
            Submitted to nomenclature committee March 15, 2012
            53% to CYP81C3 Populus trichocarpa

CYP81AA2    Hypericum perforatum
            No accession number
            Ludger Beerhues
            Submitted to nomenclature committee March 15, 2012
            53% to CYP81C3 Populus trichocarpa
            70% to CYP81AA1 Hypericum perforatum

CYP81 frag.  Citrus aurantium
             Barthelson,R.A., Galbraith,D.W. and Woosley,R.
             Development of a Comprehensive Assay for Medicinal Plant Species
             hydroperoxide lyase mRNA, partial cds
             61% to 81F1

CYP81 frag. Ceratopteris richardii 
            GenEMBL AJ438346
            Morant,M., Hehn,A. and Werck-Reichhart,D.
            Conservation and diversity of gene families explored using the
            CODEHOP strategy in higher plants
            BMC Plant Biol. 2 (1), 7 (2002)
            called a CYP98A gene, but probably CYP81
            58% to 81D10, 61% to 81U1 Iris hollandica

CYP81        Citrus clementina (Sapindales)
             GenEMBL DY293382.1  EST
             56% to 81E1, 61% to AY278229.1  Medicago truncatula CYP81E8

CYP81        Diospyros kaki (Ericales)
             DC588962.1 62% to 81A6, 58% to 81D11

CYP81       Gossypium hirsutum (cotton, Malvales)
            GenEMBL DT466734.1  EST
            64% to 81D8, 55% to 81E1

CYP81       Liriodendron tulipifera (tulip poplar, magnoliids)
            FD495019.1 56% to 81A7, 65% to 81D11

CYP81       Juglans hindsii x Juglans regia (walnut, Fagales)
            EL896452.1 58% to 81A8 60% to 81D2

CYP81 frag. Taraxacum officinale (dandylion, Asterales)
            Isolation and characterization of candidate genes for pathogen and
            herbivory defense in common dandelion (Taraxacum officinale) upon
            salicylic acid or methyl jasmonate treatment
            62% to 81D2 C-term

CYP81 frag. Hypericum perforatum 
            Barthelson,R.A., Galbraith,D.W. and Woosley,R.
            Development of a Comprehensive Assay for Medicinal Plant Species
            69% to 81D2 before EXXR motif

CYP81      Casuarina glauca (swamp oak, Fagales)
           56% to 81B1v1, 51% to 81D11 mid region

CYP81      Eucalyptus globules (Myrtales)
           ES591508.1 88% to ES588765.1, 53% to 81V13 Vitis N-term

CYP81      Eucalyptus globulus (Myrtales)
           ES588765.1 52% to 81V13 Vitis

82A Subfamily

CYP82A1     Pisum sativum (pea)
            GenEMBL U29333 (1763bp)
            Frank,M.R., Deyneka,J.M. and Schuler,M.A.
            Cloning of phenylpropanoid pathway P450 monooxygenases expressed in
            Pisum sativum.

CYP82A2     Glycine max (soybean)
            GenEMBL Y10491 (1757bp)
            Schopfer,C.R. and Ebel,J.
            Identification of elicitor-induced cytochrome P450s of soybean
            (Glycine max L.) using differential display of mRNA
            Mol. Gen. Genet. 258, 315-322 (1998)
            clone CP4

CYP82A3     Glycine max (soybean)
            GenEMBL Y10982 (1798bp)
            Schopfer,C.R. and Ebel,J.
            Identification of elicitor-induced cytochrome P450s of soybean
            (Glycine max L.) using differential display of mRNA
            Mol. Gen. Genet. 258, 315-322 (1998)
            clone CP6

CYP82A3     Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C25, C39

CYP82A4     Glycine max (soybean)
            GenEMBL Y10983 (1818bp)
            Identification of elicitor-induced cytochrome P450s of soybean
            (Glycine max L.) using differential display of mRNA
            Mol. Gen. Genet. 258, 315-322 (1998)
            clone CP9

CYP82A5     Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC157489.18h

CYP82A6     Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC157489.18g

CYP82A6     Pisum sativum
            Whitbred,J.M. and Schuler,M.A.
            Molecular characterization of CYP73A9 and CYP82A1 P450 genes
            involved in plant defense in pea
            Plant Physiol. 124 (1), 47-58 (2000)
            84% to 82A6 (ortholog)

CYP82A7     Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC157489.18f

CYP82A8     Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC157489.18e

CYP82A9     Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC157489.18d

CYP82A10P   Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC157489.18c pseudogene

CYP82A11    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC157489.18b, AC141109.13a

CYP82A12    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC157489.18a GenPept ABE79893

CYP82A13    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC152936.21

CYP82A14    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC135464.13

CYP82A15X   Vitis vinifera (Pinot noir grape)
            AM487302.1 same as AY226829, CAN64371.1
            renamed CYP82H5

CYP82A16PX  Vitis vinifera (Pinot noir grape)
            Pseudogene adjacent to CYP82a
            67% to CYP82H5
            renamed CYP82H6P

CYP82A17X   Vitis vinifera (Pinot noir grape)
            71% to 82A15
            renamed CYP82H14.b 

CYP82A18    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C40
            71% to CYP82A4, 59% to 82D5, some overlap with 82D subfamily

CYP82A19    Glycine max (soybean, Fabales)

CYP82A20    Glycine max (soybean, Fabales)

CYP82A21P   Glycine max (soybean, Fabales)

CYP82A22    Glycine max (soybean, Fabales)

CYP82A23    Glycine max (soybean, Fabales)

CYP82A24    Glycine max (soybean, Fabales)

CYP82A25    Glycine max (soybean, Fabales)

CYP82A26    Glycine max (soybean, Fabales)

CYP82A27P   Glycine max (soybean, Fabales)

CYP82A28P   Glycine max (soybean, Fabales)

CYP82A29    Lotus japonicus
            EST TC64045
            Dale Shelton and Soren Bak
            Submitted to nomenclature committee Feb. 10, 2011
            65% to CYP82A1 pea, 68% allowing for a 15 aa gap

CYP82A       Castanea sativa (European chestnut, Fagales)
             GenEMBL AF269100  
             68% to 82A4 soybean, 59% to 82C4

CYP82 frag. Gossypium herbaceum
            Hawkins,J.S., Kim,H., Nason,J.D., Wing,R.A. and Wendel,J.F.
            Differential lineage-specific amplification of transposable
            elements is responsible for genome size variation in Gossypium
            Unpublished (2006)
            41% to 82C4

CYP82 frag. Scutellaria baicalensis (Lamiales)
            Brundage,M.E. and Winget,G.D.
            Cloning of Known and Novel Cytochrome P450s in Scutellaria
            52% to 82C2, 59% to 82A5

CYP82 frag. Ageratum conyzoides (Asterales)
            monooxygenase, mRNA sequence.
            Ditt,R.F., Nester,E.W. and Comai,L.
            Plant gene expression response to Agrobacterium tumefaciens
            Proc. Natl. Acad. Sci. U.S.A. 98 (19), 10954-10959 (2001)
            60% to 82G1 C-term

CYP82      Rhododendron catawbiense  (Ericales)
           56% to 82E4 

CYP82A     Ocimum basilicum (sweet basil, Lamiales)
           57% to 82A1 54% to 82C4

CYP82      Dianthus caryophyllus (Caryophyllales)
           55% to 82C3, 52% to 82A1

CYP82      Coffea canephora (Gentianales)
           60% to 82G1, 59% to 82C4

CYP82      Juglans regia (walnut, Fagales)
           57% to 82A11 Medicago, 46% TO 82F1, 46% TO 92A11 C-TERM

82B Subfamily

CYP82B1       Eschscholzia californica (California poppy)
            GenEMBL AF014802 (1915bp)
            Pauli,H.H. and Kutchan,T.M.
            Molecular cloning and functional heterologous expression of two
            alleles encoding (S)-N-methylcoclaurine 3'-hydroxylase (CYP80B1), a
            new methyl jasmonate-inducible cytochrome P-450-dependent
            monooxygenase of benzylisoquinoline alkaloid biosynthesis
            Plant J. 13, 793-801 (1998)
            43.8% identical to 82A3
            (S)-N-methylcoclaurine 3'-hydroxylase

82C Subfamily

CYP82C1      Glycine max (soybean)
            GenEMBL AF022461 (1788bp)
            Siminszky,B., Dewey,R.E. and Corbin,F.T.
            clone name 6/2

CYP82C2 Arabidopsis thaliana
            GenEMBL AL021636 
            F10N7.200  comp(74899-76846)
            GenEMBL AL049607 89014-90961
            Contig 404 of the TIGR Landsberg erecta sequences has 100% match

CYP82C3 Arabidopsis thaliana
            GenEMBL AL021636 
            F10N7.220  comp(82167-84090)
            GenEMBL AL049607 81769-83693

CYP82C4 Arabidopsis thaliana
            GenEMBL AL021636 
            F10N7.230  comp(85290-87213)
            GenEMBL AL049607 78646-80569

CYP82C5       Populus trichocarpa (black cottonwood)
CYP82C5P      Populus trichocarpa (black cottonwood)
CYP82C6P      Populus trichocarpa (black cottonwood)
CYP82C7Pv1    Populus trichocarpa (black cottonwood)
CYP82C7Pv2    Populus trichocarpa (black cottonwood)
CYP82C8P1     Populus trichocarpa (black cottonwood)
CYP82C8P2     Populus trichocarpa (black cottonwood)
CYP82C8P3     Populus trichocarpa (black cottonwood)
CYP82C9       Populus trichocarpa (black cottonwood)
CYP82C9P1     Populus trichocarpa (black cottonwood)
CYP82C9P2     Populus trichocarpa (black cottonwood)
CYP82C10      Populus trichocarpa (black cottonwood)
CYP82C10P     Populus trichocarpa (black cottonwood)
CYP82C11      Populus trichocarpa (black cottonwood)
CYP82C11P1    Populus trichocarpa (black cottonwood)
CYP82C11P2    Populus trichocarpa (black cottonwood)
CYP82C12P1    Populus trichocarpa (black cottonwood)
CYP82C12P1-de2b Populus trichocarpa (black cottonwood)
CYP82C12P2    Populus trichocarpa (black cottonwood)
CYP82C13P     Populus trichocarpa (black cottonwood)
CYP82C14P     Populus trichocarpa (black cottonwood)
CYP82C15v1    Populus trichocarpa (black cottonwood)
CYP82C15v2    Populus trichocarpa (black cottonwood)
CYP82C15v3    Populus trichocarpa (black cottonwood)
CYP82C-se1[2] Populus trichocarpa (black cottonwood)
CYP82C-se2[2] Populus trichocarpa (black cottonwood)
CYP82C-se3[2] Populus trichocarpa (black cottonwood)
CYP82C-se4[2] Populus trichocarpa (black cottonwood)
CYP82C-se5[2] Populus trichocarpa (black cottonwood)

CYP82C16P   Carica papaya
            48% to 82C14P poplar

CYP82C17    Carica papaya
            70% to 82C5 poplar, 64% to 82C4

CYP82C18P   Glycine max (soybean, Fabales)

CYP82C19    Glycine max (soybean, Fabales)

CYP82C20    Glycine max (soybean, Fabales)

CYP82C21   Glycine max (soybean, Fabales)

CYP82C21-de1b  Glycine max (soybean, Fabales)

CYP82C22   Solanum lycopersicum (tomato)
CYP82C22   Solanum tuberosum  (potato, Solanales)

CYP82C      Poncirus trifoliata (Sapindales)
            GenEMBL CX638620.1 
            72% to 82C3

CYP82       Cucumis melo subsp. melo Piel de Sapo T-111 (Cucurbitales)
            AM739650.1 60% to 82C4

CYP82       Persea Americana (avocado, magnoliids)
            FD505802 61% to 82C4, 62% to 82H5

CYP82       Lactuca serriola (lettuce serriola, Asterales)
            52% to 82C3

CYP82?     Coffea arabica x Coffea canephora (Gentianales)
           GenEMBL DQ123934.1
           49% to 82C2  

CYP82?         Fragaria x ananassa (strawberry, Rosales)
               GenEMBL AY679602
               48% to 82A1 37% to 82C3 (mid region before I-helix)

82D Subfamily

CYP82D1     Medicago sativa (alfalfa)
            no accession number
            Chris Steele
            clone A48
            submitted to nomenclature committee
            sequence below released directly from Chris Steele
            This sequence is not in Genbank (1/19/01)
>30 C Steele, July 30, 1997 13:45. A48 82D1 Medicago sativa (alfalfa)


CYP82D2    Populus trichocarpa (black cottonwood)

CYP82D3    Coptis japonica (Japanese goldthread, Ranunculales)
           Nobuhiro Ikezawa and Fumihiko Sato
           submitted to nomenclature committee 11/5/07
           clone name C04
           58% to 82D1 Medicago sativa, 58% to 82D2 Populus
           may be some overlap with the 82C subfamily

CYP82D4    Vitis vinifera (grape)
           Seq Vitis pages for sequence

CYP82D5    Vitis vinifera (grape)
           Seq Vitis pages for sequence

CYP82D6    Vitis vinifera (grape)
           Seq Vitis pages for sequence

CYP82D7    Vitis vinifera (grape)
           Seq Vitis pages for sequence

CYP82D8P   Vitis vinifera (grape)
           Seq Vitis pages for sequence

CYP82D9    Vitis vinifera (grape)
           Seq Vitis pages for sequence

CYP82D9-de1b  Vitis vinifera (grape)
           Seq Vitis pages for sequence

CYP82D10   Vitis vinifera (grape)
           Seq Vitis pages for sequence

CYP82D11P  Vitis vinifera (grape)
           Seq Vitis pages for sequence

CYP82D12P  Vitis vinifera (grape)
           Seq Vitis pages for sequence

CYP82D13   Vitis vinifera (grape)
           CAAP02005229.1a, CAN74205.1
           Seq Vitis pages for sequence

CYP82D14   Vitis vinifera (grape)
           Seq Vitis pages for sequence

CYP82D15   Vitis vinifera (grape)
           Seq Vitis pages for sequence

CYP82D16P  Vitis vinifera (grape)
           Seq Vitis pages for sequence

CYP82D17   Vitis vinifera (grape)
           Seq Vitis pages for sequence

CYP82D18   Vitis vinifera (grape)
           Seq Vitis pages for sequence

CYP82D18-de1b   Vitis vinifera (grape)
           Seq Vitis pages for sequence

CYP82D19   Vitis vinifera (grape)
           CAAP02003355.1 , CAN66846.1
           Seq Vitis pages for sequence

CYP82D20v1  Vitis vinifera (grape)
           CAN76287.1 = AM442953.1
           Seq Vitis pages for sequence

CYP82D20v2  Vitis vinifera (grape)
           Seq Vitis pages for sequence

CYP82D21   Vitis vinifera (grape)
           Seq Vitis pages for sequence

CYP82D22P  Vitis vinifera (grape)
           Seq Vitis pages for sequence

CYP82D23   Vitis vinifera (grape)
           CAN74206.1 = AM447864.1
           Seq Vitis pages for sequence

CYP82D24   Vitis vinifera (grape)
           Seq Vitis pages for sequence

CYP82D25    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C26
            52% to CYP82C1, 52% to 82A3, 79% to 82D28
            55% to 82D3 Coptis japonica, 73% to 82D1 Medicago

CYP82D26    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C36
            79% to 82D27, 52% to 82C1, 50% to 82A1, 56% to 82D7 Vitis

CYP82D27    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C37
            79% to 82D26, 50% to 82C1, 55% to 82D7

CYP82D28    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C38
            79% to 82D25, 55% to 82A4, 56% to 82C1, 73% to 82D1 medicago

CYP82D28    Glycine max (soybean, Fabales)
            EST BG042439.1 (Glycine soja)
            EST BE660505.1 N-term
            GSS seq CL878620.1 = C-term
            79% to 82D25, 55% to 82A4, 56% to 82C1, 
            73% to 82D1 medicago

CYP82D29P   Glycine max (soybean, Fabales)

CYP82D30    Glycine max (soybean, Fabales)

CYP82D31P   Glycine max (soybean, Fabales)

CYP82D32P   Glycine max (soybean, Fabales)

CYP82D33     Ocimum basilicum (sweet basil, Lamiaceae)
             Anna Berim, David R. Gang
             Submitted to nomenclature committee June 24, 2009
             57% to CYP82D10 Vitis vinifera (grapevine)

CYP82D34P   Solanum lycopersicum (tomato)
CYP82D34    Solanum tuberosum  (potato, Solanales)
CYP82D34-de1b  Solanum tuberosum  (potato, Solanales)
CYP82D35P   Solanum lycopersicum (tomato)
CYP82D36    Solanum lycopersicum (tomato)
CYP82D37P   Solanum lycopersicum (tomato)
CYP82D37P   Solanum tuberosum  (potato, Solanales)
CYP82D38    Solanum lycopersicum (tomato)
CYP82D39P   Solanum lycopersicum (tomato)
CYP82D39    Solanum tuberosum  (potato, Solanales)
CYP82D40    Solanum lycopersicum (tomato)
CYP82D40    Solanum tuberosum  (potato, Solanales)
CYP82D41    Solanum tuberosum  (potato, Solanales)
CYP82D41-de1b  Solanum tuberosum  (potato, Solanales)
CYP82D42    Solanum tuberosum  (potato, Solanales)
CYP82D43    Solanum tuberosum  (potato, Solanales)
CYP82D44    Solanum tuberosum  (potato, Solanales)
CYP82D45    Solanum tuberosum  (potato, Solanales)

CYP82D46    Ruta graveolens (Common Rue, Sapindales)
            No accession number
            Alain Hehn
            Submitted to nomenclature committee June 20, 2011
            56% to CYP82D6 Vitis
            clone P450-10 (c1672_pep)

CYP82D47   Panax ginseng (Apiales)
           No accession number
           Yong Eui Choi
           Submitted to nomenclature committee August 12, 2011
           63% to CYP82D5 Vitis

CYP82D48    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            51% to CYP82D1 Medicago sativa
            62% to CYP82D19 Vitis
            82% to CYP82 Thapsia villosa comp4724

CYP82D49    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            49% to CYP82C2 Arabidopsis thaliana
            52% to CYP82D45 potato
            62% to CYP82D19 Vitis

CYP82D50    Nelumbo nucifera (sacred lotus, Proteales)
CYP82D51    Nelumbo nucifera (sacred lotus, Proteales)
CYP82D52P   Nelumbo nucifera (sacred lotus, Proteales)
CYP82D53P   Nelumbo nucifera (sacred lotus, Proteales)
CYP82D54P   Nelumbo nucifera (sacred lotus, Proteales)
CYP82D55    Nelumbo nucifera (sacred lotus, Proteales)
CYP82D56P   Nelumbo nucifera (sacred lotus, Proteales)
CYP82D57P   Ricinus communis (castor bean, Malpighiales)
CYP82D58    Ricinus communis (castor bean, Malpighiales)
CYP82D58    Jatropha curcas  (Malpighiales)
CYP82D59    Ricinus communis (castor bean, Malpighiales)
CYP82D60    Catharanthus roseus (Madagascar periwinkle, Gentianales)

CYP82D61    Podophyllum species (Ranunculales)
            No accession number
            Joaquim Vogt Marques
            Submitted to nomenclature committee August 3, 2012
            60% to CYP82D3 Coptis japonica (Ranunculales)

CYP82D62     Mentha x piperita (peppermint)
             Anna Berim, David R. Gang
             Submitted to nomenclature committee June 12, 2012
             74% to CYP82D33 basil

82E Subfamily

CYP82E1    Nicotiana tabacum   (tobacco)
           GenEMBL AB015762 (1727bp)
           Takemoto,D., Hayashi,M., Doke,N., Nishimura,M. and Kawakita,K.
           Molecular cloning of a defense-response-related cytochrome P450
           gene from tobacco
           Plant Cell Physiol. 40 (12), 1232-1242 (1999)

CYP82E1    Nicotiana tabacum   (tobacco)
           GenEMBL AF368381
           Ralston,L., Kwon,S.T., Schoenbeck,M., Ralston,J.L., Schenk,D.J.,
           Coates,R. and Chappell,J.
           Cloning, heterologous expression, and functional characterization
           of 5-epi-aristolochene-1,3-hydroxylase from tobacco (Nicotiana

CYP82E2v1  Nicotiana tabacum   (tobacco)
           GenEMBL DQ131887
           Balazs Siminszky
           submitted to nomenclature committee March 30, 2005
           clone name 3D_C12NC
           66% to 82E1 TOBACCO

CYP82E2v2  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D208-AC8
           5 aa diffs to CYP82E2v1

CYP82E2v3  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D103-AH3
           5 aa diffs to CYP82E2v1

CYP82E2v4  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D235-AB1
           5 aa diffs to CYP82E2v1

CYP82E3    Nicotiana tabacum   (tobacco)
           GenEMBL DQ131888
           Balazs Siminszky
           submitted to nomenclature committee March 30, 2005
           clone name 7D_A06NC
           66% to 82E1 TOBACCO 94% TO 82E2

CYP82E4v1  Nicotiana tabacum   (tobacco)
           GenEMBL DQ131886
           Balazs Siminszky
           submitted to nomenclature committee March 30, 2005
           clone name 3D_C12-7
           67% to 82E1 TOBACCO, only 2aa diffs to 82E4v2

CYP82E4v2  Nicotiana tabacum   (tobacco)
           GenEMBL DQ131885
           Balazs Siminszky
           submitted to nomenclature committee March 30, 2005
           clone name 3D_C12-10
           67% to 82E1 TOBACCO

CYP82E4v2  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 14, 2005
           Clone name D121-AA8
           100% to CYP82E4v2 from Siminszky

CYP82E4v3  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D427-AA5
           1 aa diff to CYP82E4v2 

CYP82E4v4  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D425-AC11
           1 aa diff to CYP82E4v2 

CYP82E4v5  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D425-AC9
           1 aa diff to CYP82E4v2 

CYP82E4v6  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D120-ah4
           2 aa diffs to CYP82E4v2 

CYP82E4v7  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D425-AH7
           2 aa diffs to CYP82E4v2 

CYP82E4v8  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D425-AG11
           2 aa diffs to CYP82E4v2 

CYP82E4v9  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D425-AB10
           2 aa diffs to CYP82E4v2 and N-term aa differs (short seq)

CYP82E4v10 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D425-AC10
           3 aa diffs to CYP82E4v2 

CYP82E4v11 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D425-AH11
           4 aa diffs to CYP82E4v2 

CYP82E4v12 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D208-AD9
           4 aa diffs to CYP82E4v2 

CYP82E5    Nicotiana tabacum   (tobacco)
           GenEMBL BP533216 (EST)
           86% to 82E2 TOBACCO
           one aa diff to both 82E5v1 and 82E5v2

CYP82E5v1  Nicotiana tabacum var. 4407 (tobacco)
           GenEMBL DQ350312
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D122-af10
           1 aa diff to CYP82E5 EST seq, 90% to 82E4v2

CYP82E5v2  Nicotiana tabacum (tobacco)
           No accession number
           Balazs Siminszky
           submitted to nomenclature committee May 21, 2007
           only 4 aa diffs to 82E5v1

CYP82E6    Petunia hybrida   (petunia)
           GenEMBL CV300520 (EST)
           85% to 82E2 TOBACCO

CYP82E7    Solanum tuberosum   (potato)
           GenEMBL BF153877 (EST)
           79% to 82E2 TOBACCO

CYP82E8    Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D237-AD1
           93% to CYP82E1

CYP82E9P   Nicotiana tabacum pseudogene
           92% to 82E2

CYP82E10   Nicotiana tabacum (tobacco, Solanales)
           No accession number
           Ralph Dewey
           Submitted to nomenclature committee Nov. 12, 2008
           95% to CYP82E5

CYP82E11   Solanum lycopersicum (tomato)
CYP82E11-de2b  Solanum lycopersicum (tomato)
CYP82E11   Solanum tuberosum  (potato, Solanales)
CYP82E12P  Solanum lycopersicum (tomato)
CYP82E12   Solanum tuberosum  (potato, Solanales)
CYP82E13v1 Solanum tuberosum  (potato, Solanales)
CYP82E13v2 Solanum tuberosum  (potato, Solanales)
CYP82E14P  Solanum tuberosum  (potato, Solanales)

82F Subfamily

CYP82F1           Arabidopsis thaliana
           GenEMBL AL031369
           50% identical to 82C1, 43-44% with other 82C sequences
           gene="F13D4.120" same gene as B29081 GSS fragment

CYP82G1    Arabidopsis thaliana
           GenEMBL AB026647 comp(36473-38300)
           46% identical to 82C1 and less with other subfamilies in CYP82
           Function identified as a producer of plant volatiles
           Converts the C20 compound (E,E) gernayllinalool to TMTT
           And the C-15 compound (E)-nerolidol to DMNT
           CYP82G1 is a DMNT/TMTT homoterpene synthase.
           PNAS 107, 21205-21210 (2010). 

CYP82H1    Ammi majus L. , Apiaceae (Bishops weed)
           GenEMBL AY532373
           Silvia Heubner
           Submitted to nomenclature committee 9/25/2003
           47% to 82A3 47% to 82B1 51% to 82C4 51% to 82D1 
           43% to 82E1 42% to 82F1 44% to 82G1
           clone name sequence 5

CYP82H2P   Vitis vinifera (grape)
           CAAP02000286.1a 2318-2037 (-) strand
           Seq Vitis pages for sequence

CYP82H3P   Vitis vinifera (grape)
           Seq Vitis pages for sequence

CYP82H4P   Vitis vinifera (grape)
           CAAP02000286.1c 16587-16400 (-) strand
           Seq Vitis pages for sequence

CYP82H5    Vitis vinifera (grape)
           CAAP02000286.1d 23084-21191 (-) strand
           Same as old CYP82A15 (renamed)
           Seq Vitis pages for sequence

CYP82H5     Vitis vinifera (Pinot noir grape)
            AM487302.1 same as AY226829, CAN64371.1
            formerly CYP82A15, 60% to 82H1

CYP82H5     Vitis vinifera (core eudicotyledons; Vitales)
            Bezier,A., Lambert,B. and Baillieul,F.
            Molecular cloning of partial cytochrome P450-like protein mRNA from
            59% to 82C4

CYP82H5-de2b  Vitis vinifera (core eudicotyledons; Vitales)
            CAAP02000286.1d-de2b pseudogene fragment C-term

CYP82H6P.a  Vitis vinifera (Pinot noir grape)
            CAAP02000286.1e pseudogene

CYP82H6P.b  Vitis vinifera (Pinot noir grape)
            Pseudogene adjacent to CYP82H5
            67% to CYP82H5
            formerly CYP82A16P 
2534 TCL (0) 2542

CYP82H7P    Vitis vinifera (Pinot noir grape)
            93% to CAAP02007374.1 82H18

CYP82H8.a   Vitis vinifera (Pinot noir grape)
            97% to CAAP02007374.1 82H18, 12 aa diffs

CYP82H8.b   Vitis vinifera (Pinot noir grape)
            only 3 aa diffs to CYP82H8.a

CYP82H9P.a  Vitis vinifera (Pinot noir grape)
            90% to CYP82A.a CAAP02006846.1 pseudogene

CYP82H9P.b  Vitis vinifera (Pinot noir grape)
            96% to CYP82H9P.a CAAP02000286.1h

CYP82H10P   Vitis vinifera (Pinot noir grape)
            94% to CYP82H15P.a-de1b CAAP02006846.1

CYP82H11P.a Vitis vinifera (Pinot noir grape)
            one stop codon, possible pseudogene, 92% to 82H5

CYP82H11P.b Vitis vinifera (Pinot noir grape)
            AM485903.2 (duplicate segment)
            94% to CYP82H11P.a

CYP82H12P.a Vitis vinifera (Pinot noir grape)
            pseudogene 58% to 82H5

CYP82H12P.b Vitis vinifera (Pinot noir grape)
            AM485903.2 (duplicate segment)

CYP82H13P.a Vitis vinifera (Pinot noir grape)
            91% to CAAP02007374.1 82H18

CYP82H13P.b Vitis vinifera (Pinot noir grape)
            AM485903.2 (duplicate segment)

CYP82H14.a  Vitis vinifera (Pinot noir grape)
            96% to 82H14.b on AM485903.2

CYP82H14.b  Vitis vinifera (Pinot noir grape)
            71% to 82H5, 96% to 82H14.a (duplicate segment)
            formerly CYP82A17 
16288  QFSAHDHDHDTIIKATCL (0)  16235

CYP82H14.c  Vitis vinifera (Pinot noir grape)
            CAN65890.1 (protein) from AM467494.2
            Not assembled correctly.  Last part has most of exon 1
            2 aa diffs to AM485903.2

CYP82H15P.a Vitis vinifera (Pinot noir grape)
            CAAP02006846.1 pseudogene
            100% match to end of AM485903.2, 
            this contig continues the AM485903.2 seq.

CYP82H15P.a-de1b Vitis vinifera (Pinot noir grape)
            CAAP02006846.1 pseudogene 84% to CAN81092.1
            also seen on AM485903.2 from 19465-19318

CYP82H15P.b Vitis vinifera (Pinot noir grape)
            gene 1 87% to CYP82H15P.a, 86% to CYP82H9P

CYP82H15P.b-de1b Vitis vinifera (Pinot noir grape)
            Gene 2 N-term fragment identical to CYP82H15P-de1b on AM485903.2

CYP82H16    Vitis vinifera (Pinot noir grape)
            CAAP02006846.1 94% to AAP49697.1 missing N-term

CYP82H17P   Vitis vinifera (Pinot noir grape)
            pseudogene N-term fragment

CYP82H18    Vitis vinifera (Pinot noir grape)

CYP82H19P   Vitis vinifera (Pinot noir grape)

CYP82H20P   Vitis vinifera (Pinot noir grape)
            pseudogene 48% to 82C4 82% TO CAAP02005785.1c
            91% to CYP82H5 runs off the end

CYP82H21P   Vitis vinifera (Pinot noir grape)
            Revised seq pseudogene 46% to 82C2 63% TO CAAP02005785.1c
            81% to CYP82H15P.a

CYP82H21P-de1b  Vitis vinifera (Pinot noir grape)

CYP82H22P-de2d  Vitis vinifera (Pinot noir grape)
            last exon, runs off the end, 76% to 82H5
            457-527 89% to CYP82H6Pv2

CYP82H22P-de2c  Vitis vinifera (Pinot noir grape)

CYP82H22P-de2b  Vitis vinifera (Pinot noir grape)

CYP82H22   Vitis vinifera (Pinot noir grape)
           CAAP02005785.1c = CAN81092.1 (first exon)
           Also CAO47699.1, CAN63328.1
           92% to CYP82H1 Ammi majus

CYP82H23   Panax ginseng (Apiales)
           No accession number
           Yong Eui Choi
           Submitted to nomenclature committee August 12, 2011
           62% to CYP82D5 Vitis

CYP82H24   Panax ginseng (Apiales)
           No accession number
           Yong Eui Choi
           Submitted to nomenclature committee August 14, 2011
           94% to CYP82H23 Panax

CYP82H25    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            85% to CYP82H1 Ammi majus

CYP82H26    Thapsia villosa
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            85% to CYP82H1 Ammi majus

CYP82J1    Populus trichocarpa (black cottonwood)

CYP82J1P   Populus trichocarpa (black cottonwood)

CYP82J2P   Populus trichocarpa (black cottonwood)

CYP82J3    Glycine max (soybean, Fabales)

CYP82J4     Lotus japonicus
            No accession number
            Dale Shelton and Soren Bak
            Submitted to nomenclature committee Feb. 10, 2011
            CYP82CLT_1 chr3.CM0423.10
            77% to CYP82J3 Glycine max, 57% to CYP82J1 Populus
            55% to CYP82S1v1 Vitis, 54% to CYP82S13 Vitis

CYP82K1    Populus trichocarpa (black cottonwood)

CYP82L1    Populus trichocarpa (black cottonwood)

CYP82L2    Populus trichocarpa (black cottonwood)

CYP82L3    Carica papaya
           60% to 82L2 Poplar, 52% to 82G1 

CYP82L4    Glycine max (soybean, Fabales)

CYP82L4-d1b  Glycine max (soybean, Fabales)

CYP82L5    Glycine max (soybean, Fabales)

CYP82L6    Glycine max (soybean, Fabales)

CYP82M1v1  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D268-AE2
           50% to CYP82E4

CYP82M1v2  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D285-AB9
           50% to CYP82E4, 4 aa diffs to CYP82M1v1

CYP82M1v3  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D285-AA8
           50% to CYP82E4, 3 aa diffs to CYP82M1v1

CYP82M1v4  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D244-AB6
           50% to CYP82E4, 3 aa diffs to CYP82M1v1

CYP82M1v5  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D244-AD4
           50% to CYP82E4, 3 aa diffs to CYP82M1v1

CYP82M2    tomato

CYP82M2P   potato 
           (pseudogene ortholog)

CYP82M3    tomato

CYP82M3    potato

CYP82N1    Eschscholzia californica (California poppy, Ranunculales)
           no accession number
           Tobias Kurz
           Submitted to nomenclature committee 2/3/06
           Clone number CYP82-1 (26H09)
           46% to 82C4, 49% to 82C1 soybeans, 52% to 82C5 Populus trichocarpa
           93% to CYP82N2

CYP82N2v1  Eschscholzia californica (California poppy, Ranunculales)
           no accession number
           Tobias Kurz
           Submitted to nomenclature committee 2/3/06
           Clone number CYP82-2 (08B11)
           52% to 82C5 Populus trichocarpa, 93% to CYP82-1

CYP82N2v2  Eschscholzia californica (California poppy, Ranunculales)
           no accession number
           Fumihiko Sato 
           Submitted to nomenclature committee 11/6/2010
           8 amino acid differences to CYP82N2v1

CYP82P1    Eschscholzia californica (California poppy, Ranunculales)
           no accession number
           Tobias Kurz
           Submitted to nomenclature committee 2/3/06
           Clone number CYP82-3 (23D07) 
           49% to 82C1, 41% to CYP82N2, 42% to CYP82N1

CYP82Q1    Stevia rebaudiana (Stevia, Asterales)
           GenEMBL DQ232763
           51% to 82C9, 46% to 82C4, 49% to 82D2, 48% to 82A3
           48% to 82K1, 48% to 82H1, 47% to 82J1, 45% TO 82L1,
           43% TO 82E1, 41% TO 82G1, 385 TO 82F1, 48% TO 82B1

CYP82R1    Coptis japonica (Japanese goldthread, Ranunculales)
           Nobuhiro Ikezawa and Fumihiko Sato
           submitted to nomenclature committee 11/5/07
           clone name CYP82B1 like
           50% to 82N2, 42% to 82B1, 50% to 82C5

CYP82S1    Vitis vinifera (Pinot noir grape)
           CAN65652.1 89% to CAN82345.1
           CAAP02004370.1a 17035-19016

CYP82S2Pv1 Vitis vinifera (Pinot noir grape)
           CAAP02004370.1b pseudogene, 
           89% to CAN64501.1, 90% to CYP82S3

CYP82S2Pv2 Vitis vinifera (Pinot noir grape)
           CAN65653.1 = AM459398.2
           81% to CAN82345.1, 91% to CYP82S3
           97% to CYP82S2Pv1

CYP82S3    Vitis vinifera (Pinot noir grape)
           CAAP02003017.1c 2760-4887 (+) strand
           89% to CYP82S5Pv2 CAN82345.1

CYP82S3-de2b  Vitis vinifera (Pinot noir grape)
           C-term pseudogene

CYP82S3-de2c  Vitis vinifera (Pinot noir grape)
           CAAP02003017.1a C-term pseudogene = CAN65652.1

CYP82S4P   Vitis vinifera (Pinot noir grape)
           CAN82329.1 = AM429883.2 
           79% to CYP82S5Pv2 CAN82345.1

CYP82S5Pv1  Vitis vinifera (Pinot noir grape)
           Also CAN65592.1 = AM457484.2 RUNS OFF THE END

CYP82S5Pv2  Vitis vinifera (Pinot noir grape)
            CAN82345.1 = AM430157.2
            97% TO CAAP02003017.1d

CYP82S6    Vitis vinifera (Pinot noir grape)
           CAN81014.1 = AM454711.2
           CAAP02002284.1 45127-42934 (-) strand
           65% to CYP82S5Pv2 CAN82345.1

CYP82S7    Vitis vinifera (Pinot noir grape)
           CAAP02002284.1 95% to CAN81014.1

CYP82S8    Vitis vinifera (Pinot noir grape)
           CAN77159.1, 63% to CYP82S5Pv2 CAN82345.1
           CAAP02012210.1 1 aa diff
           CAAP02009734.1  4380-3760 exon 2 only (2 aa diffs)

CYP82S9    Vitis vinifera (Pinot noir grape)
           90% to CAN77159.1, one frameshift

CYP82S10   Vitis vinifera (Pinot noir grape)
           CAAP02009192.1 72% to CAN77159.1
           CAAP02004896.1 100% match

CYP82S11   Vitis vinifera (Pinot noir grape)
           75% to CAN82345.1

CYP82S12   Vitis vinifera (Pinot noir grape)
           AM440067.2, 2 aa diffs to CAO45058.1
           CAAP02004690.1a 95% to CAN75482.1,

CYP82S12-de2b  Vitis vinifera (Pinot noir grape)
           pseudogene 94% to CYP82S11 CAN75482.1

CYP82S13   Vitis vinifera (Pinot noir grape)
           95% TO CAN61061.1, one stop codon possible pseudogene

CYP82S14P  Vitis vinifera (Pinot noir grape)
           CAAP02002685.1a  pseudogene, 
           76% to CAAP02004690.1a

CYP82S15v1 Vitis vinifera (Pinot noir grape)
           CAAP02002221.1b = CAN61061.1, 
           65% to CAN82345.1

CYP82S15v2 Vitis vinifera (Pinot noir grape)
           CAN66023.1 = AM471158.2
           63% to CAN82345.1
           NEARLY IDENTICAL TO CAAP02002221.1b 51754-46565 (-) STRAND

CYP82S16P  Vitis vinifera (Pinot noir grape)
           pseudogene 62% to CAN61061.1

CYP82S17P  Vitis vinifera (Pinot noir grape)
           AM455390.1 pseudogene
           This seq is the corrected seq of CAN67787.1 and CAN67788.1

CYP82S     Eucalyptus gunnii (Myrtales)
           CU403759.1 69% to 82S9, 55% to 82C4

CYP82T1     Bupleurum chinense DC (Chinese medicinal plant chaihu, Apiaceae)
            No accession number
            Sui Chun
            Submitted to nomenclature committee Nov. 2, 2010
            Clone name BcCYP82
            52% to CYP82K1, 49% to CYP82S1

CYP82T2     Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            54% to CYP82K1 Populus trichocarpa
            71% to CYP82T1 Bupleurum chinense DC (Apiaceae)

CYP82T3     Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            49% to CYP82K1 Populus trichocarpa
            62% to CYP82T1 Bupleurum chinense DC (Apiaceae)

CYP82U1     Solanum esculentum (tomato)
CYP82U1     Solanum tuberosum  (potato, Solanales)
CYP82U2     Solanum tuberosum  (potato, Solanales)

CYP82U3     Catharanthus roseus
            No accesion number
            Vonny Salim
            Submitted to nomenclature committee Jan. 30, 2013
            59% to CYP82U1 tomato

CYP82V1P    Solanum esculentum (tomato)
CYP82V1     Solanum tuberosum  (potato, Solanales)
CYP82W1     Solanum esculentum (tomato)
CYP82W1     Solanum tuberosum  (potato, Solanales)

CYP82X1     Papaver somniferum (opium poppy, Ranunculales)
            No accession number
            Thilo Winzer
            Clone name Pscyp1
            48% to CYP82R1 Coptis japonica
            48% to CYP82D14 Vitis vinifera
            46% to CYP82D30 Glycine max
CYP82X2     Papaver somniferum (opium poppy, Ranunculales)
            No accession number
            Thilo Winzer
            Clone name Pscyp3
            59% to CYP82X1 
            48% to CYP82R1 Coptis japonica
            48% to CYP82D14 Vitis vinifera
            46% to CYP82D30 Glycine max
CYP82Y1     Papaver somniferum (opium poppy, Ranunculales)
            No accession number
            Thilo Winzer
            Clone name Pscyp4
            52% to CYP82X1 Papaver somniferum
            48% to CYP82X2 Papaver somniferum

CYP82       Gossypium raimondii (Malvales)
            GenEMBL CO088910.1  EST
            58% to 82A1

83A Subfamily

Note: The CYP83 family has overlap with the CYP71 family 
At the low 40% range.  83C1 is 44% identical to 71A1, 43% to 71G1
44% to 71N1 and 45% to 71A9.  This family is only found in the core eudicots
It is probably more like a CYP71 subfamily than a true family.

CYP83A1     Arabidopsis thaliana
            GenEMBL U18929 (1551bp)
            Clint Chappel
            A cDNA encoding a novel cytochrome p450-dependent monooxygenase 
            from Arabidopsis thaliana.
            Plant Physiol. 108, 875-876 (1995)
            clone pCC19
            Additional EST fragment: T88085

CYP83A1     Arabidopsis thaliana
            D78599 (502 amino acids)
            Mizutani,M., Ward,E. and Ohta,D.
            Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
            cDNAs, differential expression, and RFLP mapping of multiple
            cytochromes P450
            Plant Mol. Biol. 37, 39-52 (1998)

CYP83A1     Arabidopsis thaliana
            GenEMBL U69134
            Pierre Bilodeau
            genomic sequence (one intron)

CYP83A1     Arabidopsis thaliana
            GenEMBL AL161537    
            CDS complement(join(82790..83413,83506..84390))

CYP83A2X    Arabidopsis thaliana
            D78598 (500 amino acids) also AL080238
            Mizutani,M., Ward,E. and Ohta,D.
            Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
            cDNAs, differential expression, and RFLP mapping of multiple
            cytochromes P450
            Plant Mol. Biol. 37, 39-52 (1998)
            ESTs R86798, T76397, T44634, R30228, T88645, N65459
            T46080, T75944, Z33831, Z34720, AA404945, T20600
            This sequence was renamed as CYP83A2 due to an improved sequence
            alignment.  The old name was CYP83B1.  83A1 and 83A2 are greater than 58% 
            identical.  Due to use of 83B1 in at least four publications, the name of this sequence 
            will continue to be CYP83B1 even though it should be 83A2 based on the revised sequence.
            The use of the old less accurate name CYP83B1 is to prevent confusion in the literature.

83B Subfamily

CYP83B1     Arabidopsis thaliana
            GENEMBL D78598 (500 amino acids)
            Mizutani M, Ward E, Ohta D
            Cytochrome P450 superfamily in Arabidopsis thaliana: isolation of
            cDNAs, differential expression, and RFLP mapping of multiple
            cytochromes P450.
            Plant Mol Biol 1998 May;37(1):39-52 
            ESTs R86798, T76397, T44634, R30228, T88645, N65459
            T46080, T75944, Z33831, Z34720, AA404945, T20600
            This sequence was renamed as CYP83A2 due to an improved sequence
            alignment.  However, 83B1 has appeared in at least four publications, 
            so CYP83B1 is preferred for historical reasons.

CYP83B1     Arabidopsis thaliana
            GenEMBL AL161579 
            CDS complement(join(39621..40238,40334..41215))

CYP83A2/83B1  Brassica rapa subsp. pekinensis (Chinese cabbage)
            Park,Y.S., Jeon,M.H., Lee,S.H., Moon,J.S., Cha,J.S., Kim,H.Y. and
            Activation of defense responses in Chinese cabbage by a nonhost
            pathogen, Pseudomonas syringae pv. tomato
            J. Biochem. Mol. Biol. 38 (6), 748-754 (2005)
            P450 monooxygenases of the CYP79 family
            96% to 83A2/83B1

CYP83B1    Carica papaya
           67% to 83A2/83B1

83C Subfamily

CYP83C1     Petroselinum crispum (parsley)
            no accession number
            Imre Somssich
            submitted to nomenclature committee
            formerly 83B2, but given its own subfamily
            47.3% identical to 83A2

CYP83       Ocimum basilicum (sweet basil, Lamiales)
            57% to 83C1, 53% to 83A2/83B1, 53% to 71B37 C-term

CYP83       Mesembryanthemum crystallinum (Ice plant, Caryophyllales)
            62% to 83C1, 50% to 83A2/83B1, 54% to 71B9 C-term

CYP83       Coffea canephora (Gentianales)
            DV706406 DV665110 DV705853 DV712350
            49% to CYP83C1, 44% to 83A2/83B1

CYP83       Helianthus petiolaris (plains sunflower, Asterales)
            53% to 83C1

83D Subfamily

CYP83D1     Glycine max (soybean)
            GenEMBL AF022460 (1657bp)
            Siminszky,B., Dewey,R.E. and Corbin,F.T.
            clone name 7/16
            this sequence is a best match to 71A1 45.7% identity, but is a poor match to 
            some 71B sequences (35%).  This makes the tree program cluster it with CYP83,  
            because it is consistently similar to 83 sequences.  The 83 family is the next family 
            after 71 and they sort of run together.  This sequence may belong in the 71 family,  
            but it is hard to tell.  The CYP71 and 83 cluster is one of the most populated and
            difficult clusters to classify on the plant P450 tree.

CYP83D2X    Medicago sativa (alfalfa)
            no accession number
            Chris Steele
            clone B36
            submitted to nomenclature committee
            sequence below released directly from Chris Steele
            This sequence is not in Genbank (1/19/01)
            Renamed CYP83E1 since the sequence is only 48% identical to 83D1

CYP83D3     Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC174315.4c

CYP83D4     Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC174315.4b

CYP83D5     Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC174315.4a

CYP83E1     Medicago sativa (alfalfa)
            no accession number
            Chris Steele
            clone B36
            submitted to nomenclature committee
            sequence below released directly from Chris Steele
            This sequence is not in Genbank (1/19/01)
            Formerly 83D2, renamed CYP83E1 since the sequence is only 48% 
            identical to 83D1, 76% to 83E8

>31 C Steele, July 30, 1997 13:47. B36 83D2 Medicago sativa (alfalfa)


CYP83E2     Lotus japonicus
            No accession number 
            Soren Bak and Susanne Paquette
            Submitted to nomenclature committee 4/10/2003
            71% to 83E1 93% TO 83E3
            clone name CYP83LT2

CYP83E3     Lotus japonicus
            No accession number 
            Soren Bak and Susanne Paquette
            Submitted to nomenclature committee 4/10/2003
            71% to 83E1 83% to 83E5
            clone name CYP83LT4

CYP83E4     Lotus japonicus
            No accession number 
            Soren Bak and Susanne Paquette
            Submitted to nomenclature committee 4/10/2003
            71% to 83E1 82% to 83E5
            clone name CYP83LT5

CYP83E5     Lotus japonicus
            No accession number 
            Soren Bak and Susanne Paquette
            Submitted to nomenclature committee 4/10/2003
            70% to 83E1 51% to 83D1 83% to 83E3
            clone name CYP83LT6

CYP83E6     Lotus japonicus
            No accession number 
            Soren Bak and Susanne Paquette
            Submitted to nomenclature committee 4/10/2003
            55% to 83E1 45% to 83D1 94% TO 83E7
            clone name CYP83LT3

CYP83E7     Lotus japonicus
            No accession number 
            Soren Bak and Susanne Paquette
            Submitted to nomenclature committee 4/10/2003
            54% to 83E1 alfalfa 94% TO 83E6 56% TO 83E4
            clone name CYP83LT

CYP83E8     Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ335787 GenPept ABC59082

CYP83E9     Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ335788 GenPept ABC59083

CYP83E10    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC119411.16

CYP83E11    Medicago truncatula (barrel medic, Fabales)
            GenEMBL CT027664.2

CYP83E12    Glycine max (soybeans, Fabales)
            Li,L.Y. and Yu,D.Y.
            Comprehensive analysis of putative P450 genes superfamily in
            Glycine max and Medicago truncatula
            65% to 83E8, 65% to 83E11 Called CYP83E8
            JGI Glyma0 assembly scaffold_199:263570..266120 (+ strand)

CYP83E13    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 9/26/2008
            Clone A5, partial seqs. C-term half, also C23, C58
            77% to 83E9, 62% to 83E12

CYP83E14    Glycine max (soybean, Fabales)
            BM892323.1 EST joins partial seqs.
            Muhammad Azam Chattha
            Submitted to nomenclature committee 9/26/2008
            Clone A6 and A12, partial seq. C-term half, also C57
            70% to 83E9

CYP83E14    Glycine max (soybean, Fabales)
            JGI Glyma0 assembly scaffold_199:57754..62313 (+ strand)
            note: large gene cluster on this scaffold, 10 genes

CYP83E15P   Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 9/26/2008
            Clone A11 partial C-term
            70% to 83E8, 78% to 83E14

CYP83E15P   Glycine max (soybean, Fabales)
            JGI Glyma0 assembly scaffold_199:85275-82936 (-) strand

CYP83E16P   Glycine max (soybean, Fabales)
            JGI Glyma0 assembly scaffold_199
            Gm0199x00008:peptide pseudogene

CYP83E17   Glycine max (soybean, Fabales)
           JGI Glyma0 assembly scaffold_199:104403..101806 (- strand)
           Gm0199x00009:peptide 95% to 83E15P, 85% to 83E14, 
           EST BQ628050
VLM (0)

CYP83E18   Glycine max (soybean, Fabales)
           JGI Glyma0 assembly scaffold_199
           Gm0199x00011:peptide 75% to 83E12 
           on scaffold_199:127825..130233 (+ strand)

CYP83E19   Glycine max (soybean, Fabales)
           JGI Glyma0 assembly scaffold_199:134607..132717 (- strand)
           Gm0199x00012:peptide 75% to 83E12 

CYP83E20   Glycine max (soybean, Fabales)
           JGI Glyma0 assembly scaffold_199:165948..164013 (- strand)
           Gm0199x00014:peptide 73% to 83E12 

CYP83E21   Glycine max (soybean, Fabales)
           JGI Glyma0 assembly scaffold_199:220119..218107 (- strand)
           Gm0199x00016:peptide  71% to 83E12  

CYP83E22P   Glycine max (soybean, Fabales)
            JGI Glyma0 assembly scaffold_199:242959..244944 (+ strand)
            Gm0199x00020:peptide pseudogene 73% to 83E12 

CYP83E23    Glycine max (soybean, Fabales)

CYP83E24P   Glycine max (soybean, Fabales)

CYP83E25P   Glycine max (soybean, Fabales)

CYP83E26P   Glycine max (soybean, Fabales)

CYP83E27P   Glycine max (soybean, Fabales)

CYP83E28P   Glycine max (soybean, Fabales)

CYP83E29P   Glycine max (soybean, Fabales)

CYP83E30P   Glycine max (soybean, Fabales)

CYP83E31P   Glycine max (soybean, Fabales)

CYP83F1        Populus trichocarpa (black cottonwood)
CYP83F1-se1[1] Populus trichocarpa (black cottonwood)
CYP82F1-se2[1] Populus trichocarpa (black cottonwood)
CYP83F2        Populus trichocarpa (black cottonwood)
CYP82F2-se1[1] Populus trichocarpa (black cottonwood)
CYP83F2-se2[2] Populus trichocarpa (black cottonwood)
CYP83F2-se3[2] Populus trichocarpa (black cottonwood)
CYP83F2-se4[1] Populus trichocarpa (black cottonwood)
CYP83F2-se5[1] Populus trichocarpa (black cottonwood)
CYP83F3v1      Populus trichocarpa (black cottonwood)
CYP83F3v1-de1b Populus trichocarpa (black cottonwood)
CYP83F3v2      Populus trichocarpa (black cottonwood)
CYP83F3v3      Populus trichocarpa (black cottonwood)
CYP83F3-se1[2] Populus trichocarpa (black cottonwood)
CYP83F3-se2[2] Populus trichocarpa (black cottonwood)
CYP83F3-se3[2] Populus trichocarpa (black cottonwood)
CYP83F4        Populus trichocarpa (black cottonwood)
CYP83F4-de2b   Populus trichocarpa (black cottonwood)
CYP83F5        Populus trichocarpa (black cottonwood)
CYP83F5-de2bv1 Populus trichocarpa (black cottonwood)
CYP83F5-de2bv2 Populus trichocarpa (black cottonwood)

CYP83F6     Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            56% to CYP83F1v1 Populus trichocarpus (cottonwood)
            51% to CYP71AT12 Thapsia garganica

CYP83F7     Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            55% to CYP83F1v1 Populus trichocarpa
            51% to CYP71AT12 Thapsia garganica

CYP83G1v1   Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ335789, CT033764.1 GenPept ABC59084

CYP83G1v2   Medicago truncatula (barrel medic, Fabales)
            TIGR contig TC100504 1 aa diff to CYP83G1v1, probable allele

CYP83G2     Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ394575 GenPept ABD97102

CYP83G3     Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C21, C28
            69% to 83G2

CYP83G4     Glycine max (soybean, Fabales)

CYP83-like fragments  tomato

CYP71AT17   Tomato EST SGN-E398231 [TUS-14-O6]
94% to potato ESTs BG889261.1 BG351645.1

CYP71AT17   Tomato EST SGN-E398207 [TUS-14-O6] Length = 648
92% to potato ESTs BI407108.1 BQ510884.2

CYP71AT21 (96% identical)
tomato EST SGN-E210874 [cLEC-69-G11], BQ517784, BI422120.1
55% to 83B1 , 54% to 71B10

CYP83-frags  potato

CYP83       Solanum tuberosum (potato)
            GenEMBL BG889261.1 BG351645.1 mRNA sequence.
            Unigene SGN-U270130
            45% to N-term of CYP83C1, 48% to 83A2/83B1

CYP83C      Solanum tuberosum (potato)
            GenEMBL BI407108.1 BQ510884.2 mRNA sequence.
            63% to 83C1 C-term

CYP83     Solanum tuberosum (potato)
          47% to 83A2, 49% to 83C1

SGN-U270131 Solanum tuberosum (potato) [3 ESTs aligned] 
47% to 83A2/83B1

CYP83G frag.  Cicer arietinum
            Dopico,B. and Labrador,E.
            A second cytochrome P450 monooxygenase is 
            expressed in chickpea epicotyls
            83% to 83G2

CYP83       Citrus x paradisi (Star Ruby grapefruit, Sapindales)
            GenEMBL DN959456.1 
            60% to Medicago truncatula CYP83G2

CYP83       Gossypium raimondii (Malvales)
            GenMEBL CO107315.1 
            58% to 83D1, 60% to Medicago truncatula CYP83E8

84A Subfamily

CYP84A1     Arabidopsis thaliana
            GenEMBL U38416 (1838bp)
            Meyer, K., Cusumano, J.C., Somerville, C. and Chappel, C.C.
            Ferulate-5-hydroxylase from Arabidopsis thaliana defines a new
            family of cytochrome P450-dependent monoxygenases.
            Proc. Natl. Acad. Sci. USA 93, 6869-6874 (1996)
            clone pCC30

            Meyer, K., Shirley, A.M., Cusumano, J.C., Bell-Lelong, D.A. and 
            Chapple, C.
            Lignin monomer composition is determined by the expression of a cytochrome 
            P450-dependent monooxygenase in Arabidopsis 
            PNAS 95, 6619-6623 (1998)
            functional characterization of CYP84A1

CYP84A1     Arabidopsis thaliana
            GenEMBL AL022141  F23E13.110
            (see note to CYP84A3 about function)

CYP84A2    Solanum lycopersicum(tomato) (also Solanum lycopersicum)
           GenEMBL AF150881
           G. Paul Bolwell, Jonathan Rees
           Ferulate-5-Hydroxylase (see note to CYP84A3)
           69% identical to 84A1

CYP84A3     Liquidambar styraciflua (sweetgum)
            GenEMBL AF139532
            Osakabe,K., Tsao,C.C., Li,L., Popko,J.L., Umezawa,T.,
            Carraway,D.T., Smeltzer,R.H., Joshi,C.P. and Chiang,V.L.
            Coniferyl aldehyde 5-hydroxylation and methylation direct syringyl
            lignin biosynthesis in angiosperms
            Proc. Natl. Acad. Sci. U.S.A. 96, 8955-8960 (1999)
            75% identical to CYP84A1
            Note: This paper shows coniferyl aldehyde 5-hydroxylation as the primary 
            function of the CYP84A P450s and not ferulate-5-hydroxylation.  When both 
            coniferyl aldehyde and ferulate are present, coniferyl aldehyde is a noncompetitive 
            inhibitor of ferulate-5-hydroxylation and shuts down this potential pathway.

CYP84A4     Arabidopsis thaliana
            GenEMBL AF267140 partial seq
            Rees J.D., Bolwell, G.P.
            59% identical to 84A1

CYP84A5     Oryza sativa (rice)
CYP84A5     Brachypodium distachyon
CYP84A6     Oryza sativa (rice)
CYP84A7     Oryza sativa (rice)
CYP84A8P    Oryza sativa (rice)

CYP84A9     Centaurium erythraea (Common Centaury) a plant in Gentianales
            GenEMBL AY596978
            Schwarz,H. and Beerhues,L.
            Molecular cloning of coniferylalcohol 5-hydroxylase from Centaurium
            coniferylalcohol 5-hydroxylase mRNA, complete cds.
            62% to CYP84A5

CYP84A10        Populus trichocarpa (black cottonwood)
CYP84A10  Populus trichocarpa cv trichobel 
          GenEMBL AJ010324 (3 aa diffs to CYP84A10 Populus trichocarpa (black 
          Van Doorsselaere,J., Ardiles-Diaz,W., Van Montagu,M. and Boerjan,W.
          Nucleotide sequence of a cDNA encoding ferulate-5-hydroxylase (f5h)
          from poplar (Populus trichocarpa)
          mRNA for ferulate-5-hydroxylase f5h gene 
          Populus balsamifera subsp. trichocarpa.
          78% identical to 84A3

CYP84A11        Populus trichocarpa (black cottonwood)
CYP84A12        Populus trichocarpa (black cottonwood)
CYP84A13P       Populus trichocarpa (black cottonwood)

CYP84A14v1 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D104A-AE8
           70% to CYP84A1

CYP84A14v2 Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D129-ad10
           70% to CYP84A1, 3 aa diffs to CYP84A14v1

CYP84A15    Camptotheca acuminata  (Cornales)
            GenEMBL AY621153
            ferulate 5-hydroxylase (F5H) gene, complete
            75% to 84A1

CYP84A16    Broussonetia papyrifera (Common Papermulberry, Rosales) 
            GenEMBL AY850933 mRNA AY850934 gene
            ferulate-5-hydroxylase (F5H) mRNA, complete
            71% to 84A1

CYP84A17    Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ335806 GenPept ABC59101

CYP84A18    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC174351.5, AC146720.23 GenPept ABE89624

CYP84A19    Medicago sativa (alfalfa, Fabales)
            ferulate 5hydroxylase
            97% TO 84A17, 77% TO 84A18

CYP84A20   Medicago sativa (alfalfa, Fabales)
           ferulate 5hydroxylase
           97% TO 84A19

CYP84A21    Glycine max (soybeans, Fabales)
            Li,L.Y. and Yu,D.Y.
            Comprehensive analysis of putative P450 genes superfamily in
            Glycine max and Medicago truncatula
            84% to 84A17, 84A19 and 84A20, Called CYP84A16

CYP84A22X  Solanum lycopersicum  (tomato, Solanales)
           ESTs BI923123.1, BE450858.1, AW622275.1,
           BE450755.1, BE450750.1, AI895344.1, AW616986.1
           64% to 84A1 
           same sequence as CYP84A2

CYP84A23    Brassica napus 
            Nair,R.B., Joy,R.W. IV, Kurylo,E., Shi,X., Schnaider,J.,
            Datla,R.S., Keller,W.A. and Selvaraj,G.
            Identification of a CYP84 family of cytochrome P450-dependent
            mono-oxygenase genes in Brassica napus and perturbation of their
            expression for engineering sinapine reduction in the seeds
            Plant Physiol. 123 (4), 1623-1634 (2000)
            BNF5H1 93% to 84A1, introns of 84A23 and 84A24 are different

CYP84A24v1  Brassica napus 
            Nair,R.B., Joy,R.W. IV, Kurylo,E., Shi,X., Schnaider,J.,
            Datla,R.S., Keller,W.A. and Selvaraj,G.
            Identification of a CYP84 family of cytochrome P450-dependent
            mono-oxygenase genes in Brassica napus and perturbation of their
            expression for engineering sinapine reduction in the seeds
            Plant Physiol. 123 (4), 1623-1634 (2000)
            BNF5H2 93% to 84A1

CYP84A24v2  Brassica napus
            Shi,Z., Liu,G. and Shen,J.
            Modified lignin composition in transgenic plants by down-regulation
            of F5H
            ferulate-5-hydroxylase (F5H) mRNA, complete cds
            93% to 84A1, 5 aa diffs to 84A24v1

CYP84A25    Brassica napus
            Nair,R.B., Joy,R.W. IV, Kurylo,E., Shi,X., Schnaider,J.,
            Datla,R.S., Keller,W.A. and Selvaraj,G.
            Identification of a CYP84 family of cytochrome P450-dependent
            mono-oxygenase genes in Brassica napus and perturbation of their
            expression for engineering sinapine reduction in the seeds
            Plant Physiol. 123 (4), 1623-1634 (2000)
            BNF5H3 93% to 84A1

CYP84A26   Carica papaya
           77% to 84A1

CYP84A27   Carica papaya
           78% to 84A1

CYP84A28   Carica papaya
           72% to CYP84A1

CYP84A29   Carica papaya
           71% to 84A1

CYP84A30   Vitis vinifera (grapevine)
           60% to 84A5

CYP84A30   Vitis vinifera (grapevine)
           2 aa diffs with CAN74838.1

CYP84A31   Vitis vinifera (grapevine)
           CAAP02000429.1 CAN73481.1, 1 aa diff
           72% to CYP84A30 

CYP84A32v1 Vitis vinifera (grapevine)
           97% to CYP84A30, 96% to CYP84A32v2
           there seem to be three genes in each genome 
           project this one matches up with 
           CYP84A32v2 by default, since the other two pair 
           are obvious best matches.

CYP84A32v2 Vitis vinifera (grapevine)
           66% to 84A1

CYP84A33v1 Zea mays (maize)
           82% to CYP84A5

CYP84A33v2 Zea mays (maize)
           98% to CYP84A33v1 

CYP84A34   Zea mays (maize)
           82% to CYP84A5, 91% to CYP84A33

CYP84A35P  Glycine max (soybean, Fabales)

CYP84A36P  Glycine max (soybean, Fabales)

CYP84A37P  Glycine max (soybean, Fabales)

CYP84A38   Glycine max (soybean, Fabales)

CYP84A39   Glycine max (soybean, Fabales)

CYP84A40   Leucaena leucocephala (white popinac)
           Yadav,A.K., Arha,M., Gupta,S.K., Shaik,N.M., Srivastava,S.,
           Kulkarni,P.S., Abhilash,O.U., Khan,B.M. and Rawal,S.K.
           Isolation of the Cald5H gene from Leucaena leucocephala
           Cald5H mRNA, complete cds.
           83% to CYP84A20 Medicago sativa

CYP84A41   Brachypodium distachyon
CYP84A42   Brachypodium distachyon
CYP84A43P  Brachypodium distachyon

CYP84A44    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            70% to CYP84A1 Arabidopsis thaliana

CYP84A45    Nelumbo nucifera (sacred lotus, Proteales)
CYP84A46P   Nelumbo nucifera (sacred lotus, Proteales)
CYP84A47P   Nelumbo nucifera (sacred lotus, Proteales)
CYP84A48    Nelumbo nucifera (sacred lotus, Proteales)
CYP84A49P   Nelumbo nucifera (sacred lotus, Proteales)
CYP84A50    Jatropha curcas  (Malpighiales)
CYP84A51    Jatropha curcas  (Malpighiales)

CYP84A52    Podophyllum species (Ranunculales)
            No accession number
            Joaquim Vogt Marques
            Submitted to nomenclature committee August 3, 2012
            73% to CYP84A21 Glycine max

CYP84A     Solanum lycopersicum (tomato)
           GenEMBL AI772808
           75% identical to 84A1 from amino acids 382-520

CYP84A     Solanum lycopersicum (tomato)
           GenEMBL AI894552
           78% identical to 84A1 from amino acids 297-418

CYP84A     Actinidia deliciosa (Kiwifruit, Ericales)
           FG445937.1 75% to CYP84A Eucalyptus grandis
           57% to CYP736A26

CYP84A    Populus balsamifera subsp. trichocarpa
          GenEMBL AI166384 xylem.est.221
          94% identical to 84A3 

CYP84A    Glycyrrhiza echinata (licorice)
          GenEMBL D89434
          Akashi,T., Aoki, T., Takahashi,T., Kameya,N., Nakamura, I. and Ayabe, S.
          Cloning of cytochrome P450 cDNAs from cultured Glycyrrhiza echinata L. cells 
          and their transcriptional activation by elicitor treatment.
          Plant Science 126, 39-47 (1997)
          Ge-6 C-terminal PCR fragment 

CYP84A     Glycyrrhiza echinata (licorice)
           GenEMBL D89435
           Akashi,T., Aoki, T., Takahashi,T., Kameya,N., Nakamura, I. and Ayabe, S.
           Cloning of cytochrome P450 cDNAs from cultured Glycyrrhiza echinata L. cells 
           and their transcriptional activation by elicitor treatment.
           Plant Science 126, 39-47 (1997)
           Ge-7 C-terminal PCR fragment 

CYP84A     Glycine max
           GenEMBL AI495616
           78% identical to 84A1 from amino acids 375-516

CYP84A     Populus tremula x Populus tremuloides
           GenEMBL AI166206 
           81% identical to 84A1 from amino acids 274-368

CYP84A      Citrus clementina (Sapindales)
            GenEMBL DY263383.1  EST
            78% to 84A1

CYP84A      Gossypium hirsutum (cotton, Malvales)
            GenEMBL DW226834.1 EST
            80% to 84A1

CYP84A      Aquilegia formosa x Aquilegia Pubescens (Ranunculales)
            67% to 84A2

CYP84A      Beta vulgaris (sugar beet, Caryophyllales)
            70% to 84A1

CYP84A     Persea americana (avocado, Laurales)
           73% to 84A1

CYP84A     Ocimum basilicum (sweet basil, Lamiales)
           79% to 84A2

CYP84A     Lactuca perennis (lettuce perennis, Asterales)
           67% to 87A2

CYP84A     Diospyros kaki (Ericales)
           DC584427.1 68% to 84A5

CYP84A     Eucalyptus globulus (Myrtales)
           ES593193.1 72% to 84A1 N-term

CYP84A     Eucalyptus grandis (Myrtales)
           EW688240.1 81% to 84A1 C-term

CYP84      Quercus petraea (Fagales)
           CU657458.1 84% to 84A9

85A Subfamily

CYP85 sequences from dicots

CYP85A1     Solanum lycopersicum(tomato) (also Solanum lycopersicum)
            GenEMBL U54770 (1395bp)
            Bishop,G.J., Harrison,K. and Jones,J.J.G.D.
            The tomato dwarf gene isolated by heterologous transposon tagging
            encodes the first member of a new family of cytochrome P450
            Plant Cell 8, 959-969 (1996)

CYP85A1     Solanum tuberosum (potato)
            TC102044 TIGR I-helix to EXXR
            GenEMBL BQ111950 C-term
            96% to tomato 85A1
208-338 TC102044 TIGR

BQ111950 89% to tomato 85A1

CYP85A1    Solanum lycopersicum cultivar Micro-Tom
           Marti,E., Gisbert,C., Bishop,G.J., Dixon,M.S. and
           Genetic and physiological characterization of tomato cv. Micro-Tom
           J. Exp. Bot. 57 (9), 2037-2047 (2006)
           68% to 85A2
           6-deoxocastasterone oxidase
           Micro-Tom has a mutation in the DWARF gene (d) that leads to mis-splicing

CYP85A1    Solanum lycopersicum cultivar madrigal
           Marti,E., Gisbert,C., Bishop,G.J., Dixon,M.S. and
           Genetic and physiological characterization of tomato cv. Micro-Tom
           J. Exp. Bot. 57 (9), 2037-2047 (2006)

CYP85A1    Solanum lycopersicum cultivar Micro-Tom
           Marti,E., Gisbert,C., Bishop,G.J., Dixon,M.S. and
           Genetic and physiological characterization of tomato cv. Micro-Tom
           J. Exp. Bot. 57 (9), 2037-2047 (2006)
           Frameshift mutant

CYP85A1    Solanum lycopersicum cultivar moneymaker

CYP85A1    Solanum lycopersicum cultivar madrigal

CYP85A     Solanum chacoense (Chaco potato)
           GenEMBL DN983451.1
           N-term EST

CYP85A1     Arabidopsis thaliana (Thale cress)
            GenEMBL AB009048
            ESTs: N65267, T76590, AA394869, AA404883, AA713019, GSS: B09951
            This protein seems short, but the ESTs confirm the intron exon 
            67% to tomato CYP85A1

CYP85A1     Populus trichocarpa (black cottonwood)
CYP85A1P    Populus trichocarpa (black cottonwood)

CYP85A1     Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            67% to CYP85A1   Arabidopsis thaliana

CYP85A1    Zinnia elegans
           No accesion number
           Yamamoto,R., Fujioka,S., Demura,T., Takatsuto,S., Yoshida,S. and
           Co-regulation of brassinosteroid biosynthesis-related genes during
           xylem cell differentiation
           Clone name ZeDWARF1
           mRNA for brassinosteroid-6-oxidase
           76% to CYP85A1 tomato, 68% to CYP85A2, 67% to 85A3

CYP85A1    Vitis vinifera (grapevine)
           GenEMBL DQ235273.1 
           Symons,G.M., Davies,C., Shavrukov,Y., Dry,I.B., Reid,J.B. and
           Grapes on Steroids. Brassinosteroids Are Involved in Grape Berry
           Plant Physiol. 140 (1), 150-158 (2006)
           brassinosteroid-6-oxidase (BR6OX1)
           77% to 85A1 Zinnia (partial seq), 71% to 85A2, 
           78% to 85A1 tomato, 69% to 85A3 tomato

CYP85A1    Vitis vinifera (grapevine)
           100% to DQ235273.1
           CAAP02001155.1 53071-55904 

CYP85A1    Vitis vinifera (grapevine)
           97% to CYP85A1, translation differs at one intron
           same gene as DQ235273.1, bad translation

CYP85A1     Medicago truncatula (barrel medic, Fabales)
            GenEMBL CG945080

CYP85A1     Phaseolus vulgaris 
            GenEMBL AY341443.1 
            one exon is incorrect in Genbank annotation, seq is too long
            54364..54685 is two exons with one intron not removed
            between PWRWL and GNSL 54578-54489
            seq below is corrected
57428..57618)) 70% to 85A2 68% to 85A1 Arabidopsis

CYP85A1     Pisum sativum (pea)
            GenEMBL AB218759 
            Takahito Nomura 
            Submitted to nomenclature committee August 26, 2004
            72% to 85A2 Arab. and 70% to 85A1 Arab.

CYP85A1    Panax ginseng (Apiales)
           No accession number
           Yong Eui Choi
           Submitted to nomenclature committee August 12, 2011
           79% to CYP85A1 tomato
           97% to CYP85A fragment DV554354.1

CYP85A fragment  Panax ginseng (Apiales)
             GenEMBL DV554354.1  EST
             83% to CYP85A1 Populus

CYP85A2     Arabidopsis thaliana (Thale cress)
            GenEMBL AP002060
            82% to Arabidopsis CYP85A1, 68% to tomato CYP85A1
            note: This appears to be a recent duplication in Arabidopsis
            this second 85A gene may not exist in other plants outside the 

CYP85A3     Solanum lycopersicum (tomato) 
            GenEMBL AB190445
            Nomura T, Kushiro T, Yokota T, Kamiya Y, Bishop GJ, Yamaguchi S. 
            The last reaction producing brassinolide is catalyzed by cytochrome 
            P-450s, CYP85A3 in tomato and CYP85A2 in Arabidopsis.
            J Biol Chem. 280, 17873-9 2005.
            Three step oxidation converts deoxocastasterone to brassinolide

CYP85A4     Populus trichocarpa (black cottonwood)
LG_X (-) 14547286-14543918
gene model correct
85A like 55% to 85A1 Arab. 61% to tomato 85A1
14547136 FLKHGPDFMKKQRAR 14547092 (2)

CYP85A5     Populus trichocarpa (black cottonwood)
Scaffold_155 (+) 207254-210369
gene model correct
68% to 85A1 or 85A2 Arab. (9 exons, 8 introns)
207404 LKQGPNFMKNQRAR 207445 (2)
208252 TKIIDIQQMTKE 208290 (0)
210170 YFVTRYR 210190 (2)

CYP85A6     Pisum sativum (pea)
            GenEMBL AB218760 
            Takahito Nomura 
            Submitted to nomenclature committee July 20, 2005
            79% to 85A1 pea and 70% to 85A1 Arab.

CYP85A7X  Vitis vinifera 
          GenEMBL DQ235273.1
          brassinosteroid-6-oxidase (BR6OX1)
          71% to CYP85A10 Vitis vinifera
          Note this is actually the same seq as CYP85A1 Vitis named above

CYP85A8    Carica papaya
           61% to CYP85A2

CYP85A9    Carica papaya
           supercontig_14 :2298666,2301477
           70% to 85A2, 86% TO 85A7 Vitis vinifera, TOP GENBANK HIT
           original model missing  N-term

CYP85A10    Vitis vinifera (Pinot noir grape)
            AM431608 same as CAN73647.1 and CAAP02000704.1 (70874-67788)
            71% to CYP85Aa, 70% to 85Ab
            71% to CYP85A1 Vitis, 63% to 85A2 Arab., 62% to 85A1 Arab. 
            68% to 85A1 tomato, 64% to 85A3 tomoato
            72% to 85A5 Populus and 68% to 85A4 Populus
            note: this sequence was named CYP85A6 by mistake.
            CYP85A6 was already assigned to a pea sequence.

CYP85A11P    Vitis vinifera (Pinot noir grape)
             CAAP02000704.1 also CAO41841
             67% to 85A10 probable pseudogene
52684  DGKTIDIQDKTNEV  52643
52209  KYLHDNPKALQQLR  52168

J Biol Chem. 2005 Feb 14; [Epub ahead of print] 
The last reaction producing brassinolide is catalyzed by cytochrome P450s, CYP85A3 in tomato and CYP85A2 in arabidopsis.
Nomura T, Kushiro T, Yokota T, Kamiya Y, Bishop GJ, Yamaguchi S.

CYP85A fragments Brassica oleracea (kale, cauliflower, Brussel sprouts, etc.)
            GenEMBL multiple entries (see below)
            There are at least two different CYP85 sequences
            The fragments below cover the whole CYP85 gene sequence
            but it is not possible to tell which pieces
            belong together, so they are not assembled yet.

>BZ429753.1 Brassica oleracea genomic clone 83% to 85A1 80% to 85A2

>BH667110.1 Brassica oleracea genomic 91% to 85A2 81% to 85A1
>BZ470303.1 Brassica oleracea genomic 87% to 85A2  80% to 85A1

>BH943147.1 BZ429748.1 Brassica oleracea genomic

>BZ470309.1 CC962197.1 Brassica oleracea genomic 85% to 85A2 75% to 85A1

CYP85A1     Oryza sativa (rice)

CYP85A1     Medicago truncatula (barrel medic)
            GenEMBL CG945080.1 CR315678.1
            genomic 84% to Phaseolus 85A1


CYP85A1      Antirrhinum majus (snapdragon)
             GenEMBL AJ789504.1

CYP85A1 Citrus sinensis (L.) Osbeck (Valencia Sweet Orange)
             GenEMBL CF507320.1 
262-468 C-term

CYP85A fragments Allium cepa (onion)

onion|CF441865 TIGR
64-188 52% to 85A1 54% to 85A2

onion|TC3459 TIGR 83% to CF439355 TIGR
62% to 85A2 60% to 85A1

onion|CF439355 TIGR

CYP85A fragment Capsicum annuum (pepper)
            GenEMBL CA520769 

CYP85A12 Glycine max (soybean, Fabales)
         JGI Glyma0 assembly scaffold_2, 96% to scaffold_7 CYP85A, 
         possible homeolog due to recent genome duplication

CYP85A13 Glycine max (soybean)
         JGI Glyma0 assembly scaffold_7 
         only 4 aa diffs with sequence assembled from ESTs etc.
         TTEFLKQGPNFMKTQRSR (2) 1247930 
1247386  NWDDKVINIQEKTKE (0)  1247342

CYP85A13 fragments Glycine max (soybean)
         GenEMBL multiple, see below
         There are 5 different sequences of CYP85A in soybean
         85% to Phaseolus vulgaris CYP85
         BM093001.1 Glycine max N-term CZ522697 CG814178
         BM887025.1 CD397229 CD404292.1 CD395201.1 
         EI303224.1 ED749253.1 GSS seq, EST FK600164.1
         there are some small differences between the overlapping parts of these            
         fragments, so this whole sequence might be made of several alleles of 
         this gene

CYP85A14 Glycine max (soybean)
         JGI Glyma0 assembly scaffold_21
         Gm0021x00640:peptide, 2 aa diffs to CD418550.1, 
         84% to scaffold_2 and scaffold_7

CYP85A14 Glycine max (soybean)
         8 aa diffs to first CYP85A13
         295-467 97% to phaseolus only 4 aa diffs
         95% to BE824097.1 seq (8 aa diffs) might be an allele

CYP85A15 Glycine max (soybean)
         JGI Glyma0 assembly 
         scaffold_18:7640982..7644580 (+ strand) missing middle part
         83% to scaffold_7, 95% to Gm0021x00640
         possible homeolog to Gm0021x00640 due to recent genome duplication
         both scaffold_21 and scaffold_18 may be homeologs of scaf2 and 7 from the      
         older genome duplication

CYP85A15 Glycine max (soybean)
         BE824097.1 AW568691.1 AZ221478.1 Glycine max CYP85A
         216-464 93% to phaseolus, 82% to other soybean CYP85

CYP85A16 Glycine max (soybean)
         JGI Glyma0 assembly scaffold_212:578581..572850 (- strand)
         58% to scaffold_2 and scaffold_7

CYP85A17P   Glycine max (soybean, Fabales)

CYP85A18P   Glycine max (soybean, Fabales)

CYP85A19P   Glycine max (soybean, Fabales)

CYP85A20P   Glycine max (soybean, Fabales)

CYP85A21P   Glycine max (soybean, Fabales)

CYP85A22    Lotus japonicus
            No accession number
            Dale Shelton and Soren Bak
            Submitted to nomenclature committee Feb. 10, 2011
            57% to CYP85A1 Vitis

CYP85-un1   Glycine max (soybean, Fabales)

CYP85-un2   Glycine max (soybean, Fabales)

CYP85A      Populus tremuloides (Aspen tree, root)
            GenEMBL CA926973.1 
279-467 89% to citrus

CYP85A1     Mesembryanthemum crystallinum (ice plant)
            GenEMBL AI943419.1 
            cDNA 73% to citrus 85A
266-467 with four in frame stop codons and defective heme signature (pseudogene?)

CYP85A1     Vitis vinifera (Green Grape)
            GenEMBL CD800698.1 CD799136.1 CF403161.1 CD798572.1 CF403677.1 
312-467 88% to citrus 85A

CYP85A1     Beta vulgaris
            GenEMBL BQ585998.1 
            85% to pea

CYP85A1     Linum usitatissimum (flaxseed)
            GenEMBL CA483273.1 
            56% to Phaseolus, 53% to 85A2, 51% to 85A1 Arab.
            46% to 85A1 rice

CYP85A1     Persea americana (avocado)
            GenEMBL CK746547.1 
345-467 82% to soybean third

CYP85A1     Stevia rebaudiana (Stevia)
            GenEMBL BG521759.1 
1-146 67% to soybean N-term

CYP85 sequences from monocots

CYP85A1     Oryza sative (rice) 
            GenEBL AC092778.2 
            chromosome 3 clone OSJNBa0015G17, 59% to 85A2
107126 VVDIQAKTKE (0)
108110 NLPGTNYYQGFK (0) 108145 

CYP85A1      Zea mays (maize) 
             GenEMBL CF635715.1 EST, 
             CG038863 CG138778 BZ963702 CC745597 Zea mays genomic 
             gnl|ti|535828351 APSZ32363.g2 = exon 2

CYP85A1      Zea mays (maize) 
             4 aa diffs

CYP85A1      Sorghum bicolor (sorghum)
             GenEMBL CD226410.1 CD223205.1 CD227311.1 CW376997.1
1-176 96% to Saccharum officinarum
CD226314.1 CW202771.1 CW471726.1 CW176456.1 
EST, BZ347091.1 BZ366685.1 genomic Sorghum bicolor
221-467 96% to zea

CYP85A1      Hordeum vulgare (barley)
             GenEMBL multiple, see below
CB883392 Hordeum vulgare 76% to Saccharum officinarum
64 aa gap
Hordeum vulgare BU996739.1 AJ463650.1 DN182144.1
BQ461420 Hordeum vulgare slightly different from above

24aa gap found in two ESTs before I-helix may be a real deletion

CYP85A1       Saccharum officinarum (sugar cane)
              GenEMBL CA134640.1 CA099627.1 N-term
              CA254656.1 C-term

CA254656.1 Saccharum officinarum 

CYP85A1       Triticum aestivum (wheat)
              GenEMBL mutiple, see below
BQ241757.1 N-term 75% to rice 85A1

BQ238671 Triticum aestivum C-term 379-469

CYP85 sequences from gymnosperms

CYP85A1     Picea glauca (white spruce)
            GenEMBL CO473935.1 CO234959.1 CO485829.1 CO255197.1 
            36-467 note 100% identical to Picea sitchensis
            missing about 37 aa at N-TERM

CYP85A1     Picea glauca (white spruce)
            No accession number
            Bjoern Hamberger and Joerg Bohlmann
            Submitted to nomenclature committee 9/30/2008
            Clone name PgP450-6
            87% to CYP85A1 Pinus taeda (ortholog)

CYP85A1     Picea sitchensis (Sitka spruce)
            GenEMBL CO216269.1 DR513460.1 DR531627.1
            72% to soybean third seq.
            missing about 30 aa at N-TERM

CYP85A1     Picea sitchensis (Sitka spruce)
            No accession number
            Bjoern Hamberger and Joerg Bohlmann
            Submitted to nomenclature committee 9/30/2008
            Clone name PsP450-6
            88% to CYP85A1 Pinus taeda (ortholog)

CYP85A1     Pinus taeda (Loblolly pine)
            TC30191 TC29332 TIGR, DR011758.1 DR014147.1
            GenEMBL BQ655449.1 BM158833.1
            69% to pea 85A1 88% to Picea 

CYP85A1     Pinus taeda (Loblolly pine)
            No accession number
            Bjoern Hamberger and Joerg Bohlmann
            Submitted to nomenclature committee 9/30/2008
            Clone name PtP450-6
            55% to 85A2 Arab., 56% to 85A1 rice, 62% to CYP85A1 Vitis

CYP85        Ginkgo biloba
             GenEMBL DR073964
             66% to 85A2

CYP85A       Malus x domestica (apple, Rosales)
             GenEMBL EB137324.1 
             84% to CYP85A1 Populus N-term

CYP85A       Malus x domestica (apple, Rosales)
             GenEMBL EB137446.1
             80% to CYP85A1 Populus C-term

CYP85A       Citrus sinensis (Sapindales) 
             GenEMBL CF507320
             91% to CYP85A1 Populus

CYP85A       Cucumis melo (Cucurbitales) 
             GenEMBL DV633412.1 
             80% to CYP85A1 Populus

CYP85A       Gossypium hirsutum (Malvales) 
             GenEMBL DR463838.1 
             76% to CYP85A1 Populus

CYP85A      Mesembryanthemum crystallinum (Caryophyllales)
            GenEMBL AI943419.1  EST
            68% to CYP85A1 Populus

CYP85A       Lactuca saligna (lettuce, ASTERALES)
             GenEMBL DW062984.1  
             72% to CYP85A1 Populus

CYP85A       Aegiceras corniculatum (Ericales)
             GenEMBL EE678383.1 EST 
             84% to CYP85A1 Populus

CYP85A       Aquilegia formosa x Aquilegia pubescens (Ranunculales)
             GenEMBL DR941135.1  EST
             67% to CYP85A1 Populus

CYP85A       Persea americana (avocado, Laurales)
             GenEMBL CK746547.1 EST
             81% to CYP85A1 Populus 

CYP85A       Antirrhinum majus (Lamiales)
             GenEMBL AJ789504.1   EST
             80% to CYP85A1 Populus

CYP85        Catharanthus roseus (Gentianales)
             AM232287.1 87% to CYP85A1 tomato

CYP85        Mesembryanthemum crystallinum (Caryophylalles)
             AI943419.1 69% to CYP85A1 tomato

CYP85        Saruma henryi (magnoliids)
             DT594474.1 68% to CYP85A1 tomato

86A Subfamily

CYP86A1     Arabidopsis thaliana (Thale cress)
            GenEMBL X90458 (1728bp) AB016885
            Benveniste,I. and Durst,F.
            Cloning, sequencing and expression of CYP86, a new cytochrome P450
            from Arabidopsis thaliana
            Additional EST fragments: T45669, R90073, Z26357, Z26358 and Z35025

CYP86A2     Arabidopsis thaliana
            GenEMBL AF013293 AF195115
            ESTs T04172 (310bp) H76762 (492bp) C-helix region
            Additional ESTs T46372, T46373, N95869, Z25705

CYP86A3     Brassica campestris (field mustard) EST
            L35832 (310bp)
            90% identical to 86A2, 71% identical to 86A1

CYP86A4     Arabidopsis thaliana (Thale cress)
            GenEMBL Y09581(region of ~11000-12678)(512 amino acids)
            Quentin J. Groom
            submitted to nomenclature committee

CYP86A5    Triticum aestivum (wheat)
           GenEMBL AF123609
           Francis Durst
           submitted to nomenclature committee
           clone B11

CYP86A6    Triticum aestivum (wheat)
           no accession number
           Francis Durst
           submitted to nomenclature committee
           only 8 differences with 86A5, clone F11

CYP86A7    Arabidopsis thaliana
           GenEMBL AC011622 43171-44742 clone F24D7
           78% identical to 86A2
           EST F14165 

CYP86A8    Arabidopsis thaliana
           GenEMBL AC004665 61000-63000 region
           GenEMBL AC005397 (109407..110149) gene = T3F17.38
           GenEMBL AC005861
           GenEMBL Z17399 genomic sequence of another gene has C-terminal of 86A8 on 
           minus strand at the end
           77% identical to CYP86A2

CYP86A9     Oryza sativa (rice)
CYP86A10    Oryza sativa (rice)
CYP86A11    Oryza sativa (rice)
CYP86A12P   Oryza sativa (rice)
CYP86A13P   Oryza sativa (rice)
CYP86A14P   Oryza sativa (rice)
CYP86A15P   Oryza sativa (rice)
CYP86A16P   Oryza sativa (rice)
CYP86A17P   Oryza sativa (rice)

CYP86A18     Populus trichocarpa (black cottonwood)
CYP86A19     Populus trichocarpa (black cottonwood)
CYP86A20     Populus trichocarpa (black cottonwood)
CYP86A21     Populus trichocarpa (black cottonwood)

CYP86A22    Petunia hybrida (petunia)
            No accession number
            Jixiang han
            Submitted to nomenclature committee June 16, 2005
            Clone name PH1_Pehy
            70% to 86A2 or 86A8

CYP86A23    Medicago truncatula (barrel medic)
            GenEMBL BG585890.1, AW980708.1, CA922386.1
            AJ845856.1, AL381933.1 TIGR contig TC103601
            73% to 86A1

CYP86A24    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC146341.10 GenPept ABE91393

CYP86A24    Glycine max (soybeans, Fabales)
            Li,L.Y. and Yu,D.Y.
            Comprehensive analysis of putative P450 genes superfamily in
            Glycine max and Medicago truncatula
            77% to 86A24 (probable ortholog), 60% to 86A23

CYP86A25    Carica papaya
            81% to 86A2

CYP86A26    Carica papaya
            78% to 86A1

CYP86A27    Carica papaya
            supercontig_214:277338..282851 (+ strand)
            GS_ORF_26_from_ supercontig_214 
            72% to 86A2

CYP86A28    Vitis vinifera
            GenPept CAN80156.1 
            WGS section CAAP02001291.1 81120-79537 (-) strand 
            100% match to CAN80156.1, 79% to 86A8

CYP86A29    Vitis vinifera
            GenPept CAN80040.1 
            WGS section CAAP02000797.1 107620-105983 (-) strand 
            83% to CYP86A28, end is wrong, revised

CYP86A30    Vitis vinifera
            WGS section CAAP02004642.1 
            67% to CYP86A29, 79% to 86A1 Arab. 

CYP86A31P   Vitis vinifera
            WGS section  CAAP02001116.1 pseudogene 
            2 aa diffs to CYP86A29

CYP86A32    Quercus suber (cork oak)
            No accession number 
            Olga Serra Figueras
            Submitted to nomenclature committee Nov 26, 2007
            78% to CYP86A1 Arab., only 63% to CYP86A8 Arab.
            71% to CYP86A9 rice, only 61% to CYP86A10 rice
            ortholog of CYP86A1 and CYP86A9 

CYP86A33    Solanum tuberosum (potato)
            No accession number 
            Olga Serra Figueras
            Submitted to nomenclature committee Nov 26, 2007
            76% toCYP86A1 Arab., only 63% to CYP86A2 Arab.
            70% to CYP86A9 rice, only 59% to CYP86A10 rice
            ortholog of CYP86A1 and CYP86A9

CYP86A34    Zea mays (maize) 
            89% to CYP86A9, 95% TO 86A36, 66% TO 86A35 

CYP86A35    Zea mays (maize) 
            90% to CYP86A10, 68% TO 86A34, 67% TO 86A36

CYP86A36    Zea mays (maize) 
            89% to CYP86A9 

CYP86A37     Glycine max (soybeans, Fabales)

CYP86A38     Glycine max (soybeans, Fabales)

CYP86A39P    Glycine max (soybeans, Fabales)

CYP86A40P    Glycine max (soybeans, Fabales)

CYP86A41P    Glycine max (soybeans, Fabales)

CYP86A42P    Glycine max (soybeans, Fabales)

CYP86A43P    Glycine max (soybeans, Fabales)

CYP86A44P    Glycine max (soybeans, Fabales)

CYP86A45P    Glycine max (soybeans, Fabales)

CYP86A46P    Glycine max (soybeans, Fabales)

CYP86A47P    Glycine max (soybeans, Fabales)

CYP86A48P    Glycine max (soybeans, Fabales)

CYP86A49P    Glycine max (soybeans, Fabales)

CYP86A50P    Glycine max (soybeans, Fabales)

CYP86A51P    Glycine max (soybeans, Fabales)

CYP86A52P    Glycine max (soybeans, Fabales)

CYP86A53P    Glycine max (soybeans, Fabales)

CYP86A54P    Glycine max (soybeans, Fabales)

CYP86A55P    Glycine max (soybeans, Fabales)

CYP86A56P    Glycine max (soybeans, Fabales)

CYP86A57P    Glycine max (soybeans, Fabales)

CYP86A58P    Glycine max (soybeans, Fabales)

CYP86A59P    Glycine max (soybeans, Fabales)

CYP86A60P    Glycine max (soybeans, Fabales)

CYP86A61P    Glycine max (soybeans, Fabales)

CYP86A62P    Glycine max (soybeans, Fabales)

CYP86A63P    Glycine max (soybeans, Fabales)

CYP86A64P    Glycine max (soybeans, Fabales)

CYP86A65     Glycine max (soybeans, Fabales)

CYP86A66     Glycine max (soybeans, Fabales)

CYP86A67     Glycine max (soybeans, Fabales)

CYP86A68   Solanum lycopersicum (tomato, Solanales)
CYP86A68   Solanum tuberosum (potato)
CYP86A69   Solanum lycopersicum (tomato, Solanales)
CYP86A69   Solanum tuberosum (potato)

CYP86A70    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            75% to CYP86A1 Arabidopsis thaliana

CYP86A       Fragaria vesca (wild strawberry, Rosales)
             GenEMBL DY673234.1 EST
             80% to CYP86A18 

CYP86      Cucumis sativus (cucumber, Cucurbitales)
           78% to 86A7 64% to 86A11

CYP86A     Citrus clementina (Sapindales)
           78% to 86A8

CYP86A     Gossypium hirsutum (cotton, Malvales)
           74% to 86A23

CYP86A      Lactuca saligna (lettuce saligna, Asterales)
            74% to 86A1

CYP86A      Aquilegia formosa x Aquilegia Pubescens (Ranunculales)
            77% to 86A2

CYP86A      Coffea canephora (Gentianales)
            77% to 86A8

CYP86A     Ocimum basilicum (sweet basil, Lamiales)
           77% to 86A2

CYP86      Tamarix hispida (Caryophylalles)
           EH051518.1 68% to CYP86A23

CYP86      Amborella trichopoda
           DT593464.1 64% to CYP86A23 Medicago truncatula N-term

CYP86A      Brassica rapa
            Xu,Z.R. and Li,Y.H.
            93% to 86A8 probable ortholog

CYP86       Actinidia deliciosa (Kiwifruit, Ericales)
            FG527871.1 67% to 86A23 79% to 86A8

CYP86B1      Arabidopsis thaliana (Thale cress)
            GenEMBL AB007648 (comp. 14676-16659)
            Complete sequence 

CYP86B2      Arabidopsis thaliana (Thale cress)
            GenEMBL AL357612.1 complement(join(80435..80836,81200..82450))
            Also on overlapping clone F8L15 AL392174.1
            Complete sequence 78% identical to 86B1
            Gene = T22D6_190

CYP86B3     Oryza sativa (rice)
CYP86B3     Brachypodium distachyon

CYP86B4     Populus trichocarpa (black cottonwood)
CYP86B5     Populus trichocarpa (black cottonwood)

CYP86B6     Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC146777.27 GenPept ABE89065

CYP86B7     Vitis vinifera (Pinot noir grape)
            GenEMBL AM486428.2, CAN75428.1
            CAAP02000522.1 33550-35827
            75% to 86B1
            corrected N-term seq. 

CYP86B8     Carica papaya
            73% to 86B1, 79% to Vitis CYP86B7 (best blast hit) 
            missing N-term in a seq gap

CYP86B9     Glycine max (soybeans, Fabales)

CYP86B10    Glycine max (soybeans, Fabales)

CYP86B11    Glycine max (soybeans, Fabales)

CYP86B12   Solanum lycopersicum (tomato, Solanales)
CYP86B12   Solanum tuberosum (potato)

CYP86B       Ginkgo biloba
             GenEMBL CB094584
             68% to 86B1 

CYP86B       Ginkgo biloba
             GenEMBL DR074866
             59% to 86B1 

CYP86B     Persea americana (avocado, Laurales)
           DT578253.1 DT577605.1
           76% to 86B2

CYP86B     Juglans hindsii x Juglans regia (walnut, Fagales)
           EL899498 79% to 86B1 Arab

CYP86C1      Arabidopsis thaliana (Thale cress)
            GenEMBL AC000103 F21J9.9
            Complete sequence 

CYP86C2    Arabidopsis thaliana
           GenEMBL AB024038 1-1074
           missing N-terminal, but Z26058 matches C-term
           and Z26059 codes for the N-terminal of this same clone 
           so there is only a small piece missing just beyond the C-helix
           GenEMBL AP000601 provides the missing 38 internal 
           amino acids for CYP86C2

CYP86C3    Arabidopsis thaliana
           GenEMBL AC007357 comp(51369-52951)

CYP86C4    Arabidopsis thaliana
           GenEMBL AC007357 comp(54696-56285)

CYP86C5v1   Populus trichocarpa (black cottonwood)
CYP86C5v2   Populus trichocarpa (black cottonwood)
CYP86C6     Populus trichocarpa (black cottonwood)

CYP86C7    Brassica rapa subsp. Pekinensis (Chinese Cabbage)
           Ye,W., Cao,J. and Jin,W.
           Cloning of mf-CYP450 Gene from Chinese Cabbage
           85% to 86C4

CYP86C8    Vitis vinifera (Pinot noir grape)
           GenEMBL AM462286.2, CAN63571.1
           CAAP02000152.1  120976-122535 (+) strand, 4 aa diffs
           59% to 86C1 

CYP86C9    Carica papaya
           supercontig_33:656880..658433 (- strand)
           59% to 86C1 Arab., 64% to Vitis CYP86C8 (best blast hit) 

CYP86C10   Vitis vinifera (grapevine)
           CAAP02000057.1 64019-65599 
           no introns, identical to CAN77648.1
           79% to 86C8

CYP86D1X   Arabidopsis thaliana
           GenEMBL AC023279 comp(55362-56858) 
           March 6, 2000 renamed CYP94D1

CYP86D2PX  Arabidopsis thaliana
           GenEMBL AC024226 comp(6890-7005) 
           numerous deletions and frameshifts
           GSSs AL080732, AQ010792 renamed CYP94D3P

CYP86E1     Oryza sativa (rice)
CYP86E1     Brachypodium distachyon

CYP86E2     Zea mays (maize) 
            73% to CYP86E1 

CYP86F1    Physcomitrella patens (moss)
           GenEMBL BJ183632.1 BJ976817 BJ584415 BJ585375 
           Trace archive 710546622 831723548 complete
           839341101 830649952 774610095
           48% to 86A8 Arab., 48% to 86B3 rice

CYP86F2    Physcomitrella patens (moss)
           GenEMBL BJ183632 BJ180038 
           Trace archive 755797498 1000171656 774610095 759454272
           49% to 86A8 91% to 86F1

CYP86F3   Selaginella moellendorffii (lycopod moss)

CYP86G1P  Solanum lycopersicum (tomato, Solanales)
CYP86G1   Solanum tuberosum (potato)
CYP86G2P  Solanum lycopersicum (tomato, Solanales)

87A Subfamily

CYP87A1     Helianthus annuus (sunflower)
            Andre Steinmetz and Francis Durst
            submitted to nomenclature committee 4/11/95

CYP87A1     Helianthus annuus (sunflower)
            Dr. V.Tabidze
            submitted to nomenclature committee 5/20/99

CYP87A1     Helianthus annuus (sunflower)
            GenEMBL AF216313
            Tabidze,V., Durst,F. and Steinmetz,A.A.
            Partial nucleotide sequence of a sunflower cytochrome P450 mRNA

CYP87A2     Arabidopsis thaliana
            GenEMBL AC025417 67020-68647 75% to 87A1 partial seq
            ESTs H77048 and N37614 
            Still missing N-terminal 145 amino acids

CYP87A3P    Arabidopsis thaliana
            GenEMBL AC010926

CYP87A4     Oryza sativa (rice)
CYP87A4     Brachypodium distachyon
CYP87A5     Oryza sativa (rice)
CYP87A5     Brachypodium distachyon
CYP87A6     Oryza sativa (rice)
CYP87A6     Brachypodium distachyon
CYP87A7     Populus trichocarpa (black cottonwood)
CYP87A8     Populus trichocarpa (black cottonwood)

CYP87A9     Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC146573.21 SAME AS FRAG AA660764 GenPept ABE90564
            74% to 87A2

CYP87A9      Glycine max (soybeans, Fabales)
             76% to 87A2, 84% to 87A9 Medicago ortholog
             JGI Glyma0 assembly Scaffold_13
         FSPNTNSGIPPFIKQRMKR (2) 9043119

CYP87A10    Carica papaya
            supercontig_74:792423..794514 (- strand)
            76% to CYP87A2

CYP87A11    Carica papaya
            supercontig_18: 2454585-2456443, 
            50% to 87A2, 56% to 87A7 Populus
            C-term  in a seq gap

CYP87A12    Vitis vinifera (grapevine)
            57% to 87A2

CYP87A13    Vitis vinifera (grapevine)
            51% to 87A2, 71% to 87A12

CYP87A14    Vitis vinifera (grapevine)
            60% to CYP87A12

CYP87A15    Zea mays (maize) 
            79% to CYP87A4 

CYP87A16P   Glycine max (soybeans, Fabales)

CYP87A17    Glycine max (soybeans, Fabales)

CYP87A18P   Glycine max (soybeans, Fabales)

CYP87A19   Solanum lycopersicum (tomato, Solanales)
CYP87A19   Solanum tuberosum (potato)
CYP87A20   Solanum lycopersicum (tomato, Solanales)
CYP87A20   Solanum tuberosum (potato)
CYP87A21   Solanum lycopersicum (tomato, Solanales)
CYP87A21   Solanum tuberosum (potato)
CYP87A22P  Solanum lycopersicum (tomato, Solanales)

CYP87A      Beta vulgaris (Sugar Beet, Caryophyllales)
            75% to 87A9

CYP87A      Triphysaria versicolor (parasitic plant, Lamiales)
            78% to 87A9

CYP87       Citrus sinensis (Sapindales)
            57% to 87A6

CYP87       Coffea canephora (Gentianales)
            54% to 87A9

CYP87       Aquilegia formosa x Aquilegia pubescens  (Ranunculales)
            GenEMBL DT731077.1 EST 
            50% to CYP87D1 Populus N-term, 52% to 87A2 Arab. 52% to 87C2 rice

CYP87        Gossypium hirsutum  (cotton, Malvales)
             GenEMBL CO498325.1 EST
             53% to 87A2, 49% to CYP87D1 Populus

CYP87       Taraxacum officinale (dandelion, Asterales)
            GenEMBL DY812590.1 EST  
            58% to 87A2, 46% to CYP87D1 Populus N-term

CYP87       Juglans hindsii x Juglans regia (walnut, Fagales)
            EL895553.1 61% to 708A2, 60% to 87A2, 58% to 87A5 rice
            65% to 87A1 Helianthus annuus

CYP87A      Cucumis melo subsp. agrestis (Cucurbitales)
            AM714336.2 77% to 87A9 C-term

CYP87B1     Oryza sativa (rice)
CYP87B2     Oryza sativa (rice)
CYP87B3     Oryza sativa (rice)
CYP87B4     Oryza sativa (rice)
CYP87B5     Oryza sativa (rice)

CYP87B6     Vitis vinifera (grapevine)
            45% to 87A12, 47% to 87A2 same as AM471735.2 seq mixed below
            same as CAAP02008583.1 4186-6219 4 aa diffs

CYP87B7     Vitis vinifera (grapevine)
            CAAP02008092.1 73% to CYP87B6

CYP87B8     Vitis vinifera (grapevine)
            73% to CYP87B6, 44% to 87A2

CYP87B9     Vitis vinifera (grapevine)
            53% to CYP87B7, 49% to 87A2, 55% to 87B6

CYP87B10P   Brachypodium distachyon
CYP87B11P   Brachypodium distachyon
CYP87B12P   Brachypodium distachyon
CYP87B13    Brachypodium distachyon

CYP87C1P    Oryza sativa (rice)
CYP87C2     Oryza sativa (rice)
CYP87C3     Oryza sativa (rice)
CYP87C4     Oryza sativa (rice)
CYP87C5P    Oryza sativa (rice)

CYP87C6     Sorghum bicolor
            Swigonova,Z., Lai,J., Ma,J., Ramakrishna,W., Llaca,V.,
            Bennetzen,J.L. and Messing,J.
            Close split of sorghum and maize genome progenitors
            Genome Res. 14 (10), 1916-1923 (2004)
            64% to 87C2 rice

CYP87C7    Brachypodium distachyon
CYP87C8    Brachypodium distachyon

CYP87D1             Populus trichocarpa (black cottonwood)
CYP87D1P            Populus trichocarpa (black cottonwood)
CYP87D2v1           Populus trichocarpa (black cottonwood)
CYP87D2v2           Populus trichocarpa (black cottonwood)
CYP87D3             Populus trichocarpa (black cottonwood)
CYP87D4             Populus trichocarpa (black cottonwood)
CYP87D5             Populus trichocarpa (black cottonwood)
CYP87D6P            Populus trichocarpa (black cottonwood)
CYP87D7P            Populus trichocarpa (black cottonwood)
CYP87D8             Populus trichocarpa (black cottonwood)
CYP87D9             Populus trichocarpa (black cottonwood)
CYP87D10            Populus trichocarpa (black cottonwood)
CYP87D11            Populus trichocarpa (black cottonwood)
CYP87D12            Populus trichocarpa (black cottonwood)
CYP87D12-de1b       Populus trichocarpa (black cottonwood)
CYP87D13P           Populus trichocarpa (black cottonwood)
CYP87D-se1[4:5:6:7] Populus trichocarpa (black cottonwood)
CYP87D-se2[6:7]     Populus trichocarpa (black cottonwood)

CYP87D      Fragaria vesca (WILD STRAWBERRY, ROSALES)
            GenEMBL DY667902.1 EST  
            56% to CYP87D1 Populus N-term

CYP87E1v1   Bupleurum chinense DC (Chinese medicinal plant chaihu, Apiaceae)
            No accession number
            Sui Chun
            Submitted to nomenclature committee Nov. 2, 2010
            Clone name BcCYP87-1
            45% to CYP87A2 Arabidopsis, 44% to CYP87D1 Populus trichocarpa
            3 amino acid diffs to CYP87E1v2, 96% to CYP87E2

CYP87E1v2   Bupleurum chinense DC (Chinese medicinal plant chaihu, Apiaceae)
            No accession number
            Sui Chun
            Submitted to nomenclature committee Nov. 2, 2010
            Clone name BcCYP87-3
            45% to CYP87A2 Arabidopsis, 44% to CYP87D1 Populus trichocarpa
            3 amino acid diffs to CYP87E1v1, 96% to CYP87E2

CYP87E2     Bupleurum chinense DC (Chinese medicinal plant chaihu, Apiaceae)
            No accession number
            Sui Chun
            Submitted to nomenclature committee Nov. 2, 2010
            Clone name BcCYP87-2
            96% to CYP87E1v1

CYP87E3     Solanum lycopersicum (tomato, Solanales)
CYP87E3     Solanum tuberosum (potato)

CYP87 frag. Coffea arabica (Gentianales)
            Fernandez,D., Santos,P., Agostini,C., Bon,M.C., Petitot,A.S., Silva
            ,M.C., Guerra-Guimaraes,L., Ribeiro,A., Argout,X. and Nicole,M.
            Coffee (Coffea arabica L.) genes early expressed during infection
            by the rust fungus (Hemileia vastatrix)
            Mol. Plant Pathol. 5 (6), 527-536 (2004)
            45% to 87A2 mid region

CYP87 frag. Coffea arabica (Gentianales)
            Fernandez,D., Santos,P., Agostini,C., Bon,M.C., Petitot,A.S., Silva
            ,M.C., Guerra-Guimaraes,L., Ribeiro,A., Argout,X. and Nicole,M.
            Coffee (Coffea arabica L.) genes early expressed during infection
            by the rust fungus (Hemileia vastatrix)
            Mol. Plant Pathol. 5 (6), 527-536 (2004)
            42% to 87A2

88A Subfamily

CYP88A1     Zea mays
            GenEMBL U32579 (1724bp) EE170745.1 EST
            Winkler,R.G. and Helentjaris,T.
            The maize dwarf3 gene encodes a cytochrome P450-mediated early step
            in gibberellin biosynthesis
            Plant Cell 7, 1307-1317 (1995)
            This was later shown to be the ent-kaurenoic acid oxidase KAO

CYP88A2     Cucurbita maxima (pumpkin)
            GenEMBL AF212991
            Helliwell,C.A., Olive,M.R., Gebbie,L., Forster,R., Peacock,W.J. and
            Isolation of an ent-kaurene oxidase cDNA from Cucurbita maxima
            Aust. J. Plant Physiol. 27, 1141-1149 (2000)
            This sequence is an ent-kaurenoic acid oxidase (KAO)
            Don't let the title of the article fool you.
            CYP701 is the ent-kaurene oxidase (KO) gene

CYP88A3     Arabidopsis thaliana (Thale cress)
            GenEMBL AC000098
            ESTs: T43711

CYP88A4     Arabidopsis thaliana
            GenEMBL AC005700
            56% identical to 88A1 no ESTs GSS: AL088126 BAC end T1G2

CYP88A5   Oryza sativa (rice)
GenEMBL   AP000616 Oryza sativa genomic DNA, chromosome 6, clone:P0514G12
              Length = 138739
              M + WA   +     AV     ++    +  ++W+  A LG +RR  LPPG++GWP++G+

              M  FLRAFKS NP+ FI  ++ R

              +G+TGVY+  +F +P+++  TPE C++VL DDE F  GWP+A V LIG KSF+ M  ++

              H+R+R+LT+AP+NGF+AL+ Y+ +I++ V+ SL +WS  + G +EFLT+LR++TF +I+ 

              IF+S   +  ME LE+ YT LNYG+R M INLPGFAY++AL+AR+ LV+ L+G++  RR 

                   +      DMMD+LI+  DE GR+L D+EI+D+LIMYLNAGHESSGH  MWAT+ L

               ++P++  +A+ EQE I+R+ PA 

Query: 343    QTGLTLKECRDMEYLS 358
              Q GLTL++ + M +LS
Sbjct: 128892 QNGLTLRDFKKMHFLS 128939

              KVVDETLR V+ S V FR+A  D+ +NG



              L+   P C + YLPH RP DNC+A ITK S

81% to 88A1 54% to 88A2

CYP88A6 pisum sativum (pea)
        GenEMBL AF537321
        The pea gene NA encodes ent-kaurenoic acid oxidase
        Sandra E. Davidson, Robert C. Elliott, Chris A. Helliwell, Andrew
        Poole, and James B. Reid (2003) Plant Physiology, 131 (1), 335-344.
        Submitted to nomenclature committee August 13, 2002
        Clone name PsKAO1 ent-kaurenoic acid oxidase
        66% to 88A4, 75% to 88A7

CYP88A7 pisum sativum (pea)
        GenEMBL AF537322
        The pea gene NA encodes ent-kaurenoic acid oxidase
        Sandra E. Davidson, Robert C. Elliott, Chris A. Helliwell, Andrew
        Poole, and James B. Reid (2003) Plant Physiology, 131 (1), 335-344.
        Submitted to nomenclature committee August 13, 2002
        Clone name PsKAO2 ent-kaurenoic acid oxidase
        63% to 88A4, 75% to 88A6

CYP88A8          Populus trichocarpa (black cottonwood)
CYP88A9          Populus trichocarpa (black cottonwood)
CYP88A10P        Populus trichocarpa (black cottonwood)
CYP88A-se1[1:2]  Populus trichocarpa (black cottonwood)

CYP88A11    Glycine max (soybean, Fabales)
            GenEMBL BU761462.1, BM307972.1, CX711236.1, BF598035.1
            This might be a hybrid seq. There appear to be 3 CYP88A seqs.

CYP88A11    Glycine max (soybean)
            JGI Glyma0 assembly scaffold_159 (-) strand

CYP88A12    Ginkgo biloba 
            GenEMBL AY601886
            ent-Kaurenoic acid hydroxylase
            64% to CYP88A27v2, 56% to 88A3

CYP88A13    Medicago truncatula (barrel medic, Fabales)
            GenEMBL CR931738.1b

CYP88A14    Medicago truncatula (barrel medic, Fabales)
            GenEMBL CR931738.1a

CYP88A15    Hordeum vulgare (barley)
            GenEMBL AF326277
            Helliwell,C.A., Chandler,P.M., Poole,A., Dennis,E.S. and
            The CYP88A cytochrome P450, ent-kaurenoic acid oxidase, catalyzes
            three steps of the gibberellin biosynthesis pathway
            Proc. Natl. Acad. Sci. U.S.A. 98 (4), 2065-2070 (2001)
            78% to 88A5

CYP88A16    Carica papaya
            supercontig_189:278130,280900  with two seq gaps
            ~80% to CYP88A17

CYP88A17    Carica papaya
            63% to 88A4

CYP88A18    Carica papaya
            supercontig_189 :288437..291784 (+ strand)
            74% to CYP88Ab

CYP88A19    Carica papaya
            61% to 88A4
            52% to CYP88A20
            71% to CYP88A17

CYP88A20    Carica papaya
            50% to 88A4 62% to 88A14 Medicago truncatula

CYP88A21    Carica papaya
            84% to CYP88A20

CYP88A22P   Carica papaya
            supercontig_2914 :8615,9333 (minus strand)
            87% to 88A20

CYP88A23    Vitis vinifera (grapevine)
            66% to CYP88A3
            see Vitis pages for seq

CYP88A24    Vitis vinifera (grapevine)
            69% to 88A4, 70% to 88A23
            see Vitis pages for seq

CYP88A25    Glycine max (soybean)
            JGI Glyma0 assembly scaffold_223 (-) strand
            95% to CYP88A11 probable homeolog due to recent whole genome 
        KEHKAGEFLPF 346618

CYP88A26    Glycine max (soybean)
            scaffold_13 Glyma0 from JGI (-) strand
            53% to 88A11 probable homeolog due to older whole genome duplication
         PTFLRAFKSNPDSFIYDLVSR (2)  7698347

CYP88A27v1  Picea glauca-engelmannii complex (interior spruce)
            No accession number
            Bjoern Hamberger and Joerg Bohlmann
            Submitted to nomenclature committee 9/30/2008
            Clone name PgeP450-18A
            56% to CYP88A4, 64% to CYP88A12 Ginkgo biloba KAO

CYP88A27v2  Picea glauca-engelmannii complex (interior spruce)
            No accession number
            Bjoern Hamberger and Joerg Bohlmann
            Submitted to nomenclature committee 9/30/2008
            Clone name PgeP450-18B
            56% to CYP88A4, 64% to CYP88A12 Ginkgo biloba KAO
            only 2 aa diffs to CYP88A27v1

CYP88A28v1  Picea sitchensis (Sitka spruce)
            No accession number
            Bjoern Hamberger and Joerg Bohlmann
            Submitted to nomenclature committee 9/30/2008
            Clone name PsP450-18A
            3 aa diffs to CYP88A28v2, 98% to CYP88A27v1

CYP88A28v2  Picea sitchensis (Sitka spruce)
            No accession number
            Bjoern Hamberger and Joerg Bohlmann
            Submitted to nomenclature committee 9/30/2008
            Clone name PsP450-18B
            3 aa diffs to CYP88A28v1, 98% to CYP88A27v1

CYP88A29    Pinus taeda (loblolly pine)
            No accession number
            Bjoern Hamberger and Joerg Bohlmann
            Submitted to nomenclature committee 9/30/2008
            Clone name LobpiKAO 
            94% to CYP88A27v1

CYP88A30P   Glycine max (soybean, Fabales)

CYP88A31    Brachypodium distachyon

CYP88A32P   Brachypodium distachyon

CYP88A33    Brachypodium distachyon

CYP88A34    Brachypodium distachyon

CYP88A35    Solanum lycopersicum (tomato, Solanales)
CYP88A35    Solanum tuberosum (potato)

CYP88A36    Poncirus trifoliata
            No accession number
            Li-Xiao Yao
            Submitted to nomenclature committee 9/22/2011
            Seq. 52
            58% to CYP88A21 papaya

CYP88A37    Poncirus trifoliata
            No accession number
            Li-Xiao Yao
            Submitted to nomenclature committee 10/7/2011
            Sequence 56
            58% to CYP88A36 Poncirus trifoliata

CYP88A38    Thapsia villosa
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            69% to CYP88A3 Arabidopsis thaliana

CYP88A      Nicotiana tabacum
            NtKAO mRNA for ent-kaurenoic acid oxidase

CYP88A     Helianthus petiolaris (plains sunflower, Asterales)
           GenEMBL DY934058.1 EST
           56% to 88A5

CYP88      Citrus reshni (Sapindales)
           GenEMBL DY306472.1 EST

CYP88      Gossypium hirsutum (cotton, Malvales)
           GenEMBL DT575111.1 EST

CYP88A     Actinidia deliciosa (Kiwifruit, Ericales)
           FG492762.1 63% to 88A3 N-term

CYP88A     Beta vulgaris (sugar beet, Caryophylalles)
           BQ582763.1 65% to 88A4 N-term

CYP88       Aquilegia formosa x Aquilegia pubescens (Ranunculales)
            GenEMBL DR953870.1 EST

CYP88       Juglans regia (walnut, Fagales)
            GenEMBL CV196173.1 EST

CYP88       Malus x domestica (apple, Rosales)
            GenEMBL EB154488.1 EST

CYP88A      Triphysaria pusilla (Lamiales)
            EY148209 72% to 88A3

CYP88A      Coffea canephora (coffee, Gentianales)
            DV697807.1 68% to 88A4 

CYP88       Picea glauca
            GenEMBL DR580069.1 EST

CYP88B1     tomato
            GenEMBL ESTs only (lots of ESTs)
            40% to 88A4

CYP88B1-de7b7c  tomato

CYP88B1     Solanum pimpinellifolium (wild ancestor of tomato)
            No accession 
            Max Itkin
            Submitted to nomenclature committee Aug. 12, 2012
            100% to CYP88B1 tomato

CYP88B1v1   Solanum tuberosum (potato)

CYP88B1v2   Solanum tuberosum (potato)
            No accession number
            Max Itkin
            Submitted to nomenclature committee Aug. 12, 2012
            99% to CYP88B1v1 potato

CYP88B1     Solanum pinnellii (close wild relative of tomato)
            ESTs AW18484, BG135958
            Max Itkin
            Submitted to nomenclature committee Aug. 12, 2012
            95% to CYP88B1 tomato

CYP88B2     Solanum tuberosum (potato)
            ESTs JG558207, FG550427
            Max Itkin
            Submitted to nomenclature committee Aug. 12, 2012
            97% to CYP88B1
            whole sequence known but confidential

CYP88B3     Solanum melongena (eggplant)
            ESTs FS071103, FS071104
            Max Itkin
            Submitted to nomenclature committee Aug. 12, 2012
            66% to CYP88B1 potato

CYP88C1     Petunia hybrida (petunia)
            No accession number
            Jixiang han
            Submitted to nomenclature committee June 16, 2005
            Clone name PH6_Pehy
            49% to 88B1 

CYP88C2     Solanum lycopersicum (tomato, Solanales)
CYP88C2     Solanum tuberosum (potato)
CYP88C3     Solanum tuberosum (potato)
CYP88C4     Solanum tuberosum (potato)
CYP88C5     Solanum tuberosum (potato)
CYP88C6P    Solanum tuberosum (potato)

CYP88D1     Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC144538.23 GenPept ABE91093
            This sequence was withdrawn from Genbank for unknown reasons

CYP88D2     Medicago truncatula (barrel medic, Fabales)
            ESTs EV261217.1, AL380946.1, AL375640.1
            Hikaru Seki
            Submitted to nomenclature committee March 28, 2008
            71% to CYP88D1

CYP88D3     Medicago truncatula (barrel medic, Fabales)
            ESTs BF639404.1 
            Hikaru Seki
            Submitted to nomenclature committee March 28, 2008
            60% to CYP88D1, 78% to Glycyrrhiza uralensis

CYP88D4     Lotus japonicus
            No accession number
            Hikaru Seki
            Submitted to nomenclature committee March 28, 2008
            58% to CYP88D1

CYP88D5     Lotus japonicus
            No accession number
            Hikaru Seki
            Submitted to nomenclature committee March 28, 2008
            57% to CYP88D1

CYP88D6     Glycyrrhiza uralensis (licorice)
            No accession number
            Hikaru Seki
            Submitted to nomenclature committee March 28, 2008
            61% to CYP88D1

CYP88D7     Astragalus sinicus (Chinese milkvetch, Fabales)
            No accession number
            Hiraku Seki
            Submitted to nomenclature committee Sept. 23, 2012
            Seq 10
            65% to CYP88D6 Glycyrrhiza uralensis

CYP88D8     Astragalus sinicus (Chinese milkvetch, Fabales)
            No accession number
            Hiraku Seki
            Submitted to nomenclature committee Sept. 23, 2012
            Seq 11
            63% to CYP88D6 Glycyrrhiza uralensis

CYP88E1     Selaginella moellendorffii
            traces 720209121, 914912278, 964564232, 915149048, 
            914932586, 724435101, 915047783 
            47% to 88A4, 46% to Ginkgo CYP88A12
            45% to 88A14, 43% to 88A1, 42% to 88A13,
            36% to 88D1, 34% to 88C1, 33% to 88B1

CYP88E2   Selaginella moellendorffii (lycopod moss)

CYP88F1   Selaginella moellendorffii (lycopod moss)

CYP88G1   Solanum lycopersicum (tomato, Solanales)
CYP88G1   Solanum tuberosum (potato)

CYP88H1   Tripterygium wilfordii (leigongteng herb, Celestrales)
          No accession number
          Submitted by Dale Shelton July 14, 2011
          47% to CYP88A23 Vitis, 46% to CYP88G1 potato
          the plant is called the thunder god vine

CYP88     Marchantia polymorpha (liverwort)
          BJ852874.1 47% to 88A4

89A Subfamily

CYP89A1     Vicia sativa
            no accession number
            Francis Durst
            submitted to nomenclature committee

CYP89A2     Arabidopsis thaliana (Thale cress)
            GenEMBL U61231 (1787bp) (PGR-061), AC006193 comp(66014-67477+)
            Courtney, K.J.,   Percival, F.W., Hallahan, D.L. and Christoffersen, R.E.,
            Cloning and sequencing of a cytochrome P450, CYP89, from
            Arabidopsis thaliana .
            Plant Physiol., 1996 in press
            This is probably identical to 89A8 if three frame shifts and a few other 
            sequence differences are due to sequence errors.  The 3 prime and 5 prime  
            untranslated sequences are nearly identical, which is unlikely if they are 
            different genes.

CYP89A3       Arabidopsis thaliana (Thale cress)
            GenEMBL AB010073 comp(25500-27000 region)

CYP89A4      Arabidopsis thaliana (Thale cress)
            GenEMBL AC005897 comp(42064 40565) AC007045 10850-12400
            80% identical to CYP89A2

CYP89A5      Arabidopsis thaliana (Thale cress)
            GenEMBL AC006193 comp(51700-53166+)
            92% identical to CYP89A4
            ESTs H77059

CYP89A6      Arabidopsis thaliana (Thale cress)
            GenEMBL AC006193 comp(55495-56982+)

CYP89A7      Arabidopsis thaliana (Thale cress)
            GenEMBL AC006193 comp(58358-59827+)

CYP89A8X      Arabidopsis thaliana (Thale cress)
            GenEMBL AC006193 comp(66014-67477+)
            This is probably identical to 89A2 if three frame shifts and a few other 
            sequence differences are due to sequence errors.  The 3 prime and 5 prime  
            untranslated sequences are nearly identical, which is unlikely if they are 
            different genes.

CYP89A9     Arabidopsis thaliana
            GenEMBL AC009895 37255-38905 
            clone T21P5 
            54% to 89A4 
            ESTs T76749, T44110, T45663, T14186, T21361, AA394479

CYP89A10    Cucumis melo (cantaloupe melon)
            GenEMBL AY583855 
            62% to 89A5

CYP89A11   Populus trichocarpa (black cottonwood)
CYP89A12   Populus trichocarpa (black cottonwood)
CYP89A13   Populus trichocarpa (black cottonwood)
CYP89A14P  Populus trichocarpa (black cottonwood)
CYP89A15v1 Populus trichocarpa (black cottonwood)
CYP89A15v2 Populus trichocarpa (black cottonwood)
CYP89A15v3 Populus trichocarpa (black cottonwood)
CYP89A16P  Populus trichocarpa (black cottonwood)
CYP89A17   Populus trichocarpa (black cottonwood)
CYP89A18   Populus trichocarpa (black cottonwood)
CYP89A19P  Populus trichocarpa (black cottonwood)
CYP89A20P  Populus trichocarpa (black cottonwood)
CYP89A21P  Populus trichocarpa (black cottonwood)
CYP89A22   Populus trichocarpa (black cottonwood)
CYP89A23   Populus trichocarpa (black cottonwood)
CYP89A24P  Populus trichocarpa (black cottonwood)
CYP89A25   Populus trichocarpa (black cottonwood)
CYP89A26   Populus trichocarpa (black cottonwood)
CYP89A27P  Populus trichocarpa (black cottonwood)

CYP89A28    Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ335796, AC130800.23a GenPept ABC59091, ABE86828

CYP89A29    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC130800.23b GenPept ABE86832

CYP89A30    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC130800.23c GenPept ABE86833

CYP89A31    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC130800.23d GenPept ABE86834, ABE86835

CYP89A32    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC130800.23e GenPept ABE86837

CYP89A33    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC130800.23f GenPept ABE86838

CYP89A31/CYP89A33  HYBRID Medicago truncatula (barrel medic, Fabales)
            GenEMBL DQ335795, AC130800.23d + AC130800.23f GenPept ABC59090

CYP89A34    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC130800.23g GenPept ABE86843

CYP89A35    Capsicum annuum
            59% to 89A5

CYP89A36    Glycine max (soybeans, Fabales)
            DQ340245, EST AW308746.1, BG042073.1
            Li,L.Y. and Yu,D.Y.
            Comprehensive analysis of putative P450 genes superfamily in
            Glycine max and Medicago truncatula
            74% to 89A34 Called CYP89H3

CYP89A37    Cleome spinosa (Brassicales)
            69% to 89A5

CYP89A38   Vitis vinifera (Pinot noir grape)
           64% to papaya 89A42
           CAAP02002218.1j 56953-58518 (+) strand 2 aa diffs
4984  LK*  4976

CYP89A39   Vitis vinifera (Pinot noir grape)
           CAAP02002218.1k 59861-61420 (+) strand 2 aa diffs
           66% to papaya 89A42 (best blast hit)
           61% to 89A5 

CYP89A40   Vitis vinifera (Pinot noir grape)
           CAN69327.1, CAN76114.1 100% match to last 100 aa
           64% to papaya 89A42
5148  LK*  5140

CYP89A41   Vitis vinifera (Pinot noir grape)
           CAAP02002218.1i 48421-50022 (+) strand 100% match
           63% to papaya
1255  HLSPRLK*  1232

CYP89A42    Carica papaya
            64% to 89A5, 66% to CYP89A39 AM423953.2  Vitis vinifera

CYP89A43    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 10/15/2008
            Clone C5
            82% TO 89A36, 66% TO 89A28

CYP89A44   Vitis vinifera (Pinot noir grape)
           CAAP02002218.1a 8838-10388 (+) strand 
           65% to 89A39

CYP89A45   Vitis vinifera (Pinot noir grape)
           CAAP02002218.1b 32945-34474 (+) strand 1 aa diff
           57% to CYP89A5

CYP89A45-de1b  Vitis vinifera (Pinot noir grape)
           CAAP02002218.1c pseudogene

CYP89A45-de1c  Vitis vinifera (Pinot noir grape)
           CAAP02002218.1d pseudogene

CYP89A46   Vitis vinifera (Pinot noir grape)
           CAAP02002218.1e 38596-40194 (+) strand 
           89% to 89A41

CYP89A46-de1b  Vitis vinifera (Pinot noir grape)
           CAAP02002218.1f pseudogene

CYP89A46-de1c  Vitis vinifera (Pinot noir grape)
           CAAP02002218.1g pseudogene

CYP89A47   Vitis vinifera (Pinot noir grape)
           CAAP02002218.1h 45181-43631 (-) strand 100% match
           64% to CAN77555.1, 69% to 89A38

CYP89A48   Vitis vinifera (Pinot noir grape)
           73% to 89A39

CYP89A49P  Vitis vinifera (Pinot noir grape)
           CAAP02001072.1  pseudogene

CYP89A50P  Vitis vinifera (Pinot noir grape)
           pseudogene 94% to 89A44 CAAP02002218.1a

CYP89A51   Vitis vinifera (Pinot noir grape)
           92% to 89A44 CAAP02002218.1a runs off the end

CYP89A52   Vitis vinifera (Pinot noir grape)
           CAAP02006592.1 84% to 89A39
           also CAN74353.1

CYP89A53   Vitis vinifera (Pinot noir grape)
           CAN69345.1, 54% to 89A5

CYP89A54   Vitis vinifera (Pinot noir grape)
           CAN64477.1, 55% to 89A5
           CAAP02004251.1a  27036-28565 (+) strand

CYP89A54-de1c   Vitis vinifera (Pinot noir grape)
           CAAP02004251.1a-de1c  pseudogene 65% to CAN64477.1

CYP89A54-de1b   Vitis vinifera (Pinot noir grape)
           CAAP02004251.1a-de1b  pseudogene 65% to CAN64477.1

CYP89A55P  Vitis vinifera (Pinot noir grape)
           CAN83627.1, AM472886.2
           47% to 89A5, 78% to 89A45

CYP89A56P  Vitis vinifera (Pinot noir grape)
           CAN75215.1 AM479280.2 
           51% to 89A6

CYP89A57P  Vitis vinifera (Pinot noir grape)
           CAN73931.1 AM440380.2
           44% to 89B5, 89% to CYP89A45

CYP89A58   Vitis vinifera (Pinot noir grape)
           CAN63607.1 (revised) 47% to 89C2

CYP89A59P   Glycine max (soybean, Fabales)

CYP89A60    Glycine max (soybean, Fabales)

CYP89A61    Glycine max (soybean, Fabales)

CYP89A62    Glycine max (soybean, Fabales)

CYP89A63    Glycine max (soybean, Fabales)

CYP89A64    Glycine max (soybean, Fabales)

CYP89A65P   Glycine max (soybean, Fabales)

CYP89A66    Glycine max (soybean, Fabales)

CYP89A67P   Glycine max (soybean, Fabales)

CYP89A68P   Glycine max (soybean, Fabales)

CYP89A69    Solanum lycopersicum (tomato, Solanales)
CYP89A69-de1b    Solanum lycopersicum (tomato, Solanales)
CYP89A69    Solanum tuberosum (potato)
CYP89A70P   Solanum lycopersicum (tomato, Solanales)
CYP89A70    Solanum tuberosum (potato)
CYP89A71    Solanum lycopersicum (tomato, Solanales)
CYP89A72    Solanum lycopersicum (tomato, Solanales)
CYP89A73    Solanum lycopersicum (tomato, Solanales)
CYP89A73    Solanum tuberosum (potato)
CYP89A74    Solanum tuberosum (potato)
CYP89A75    Solanum tuberosum (potato)

CYP89A76    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            55% to CYP89A2 Arabidopsis thaliana

CYP89A77    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            51% to CYP89A2 Arabidopsis thaliana
            62% to CYP89A72 potato, 60% to CYP89A39 Vitis

CYP89 frag. Avicennia marina (Lamiales)
            BM497215, BM173154, BM497297
            Parani,M., Mehta,P., Sivaprakash,K.R. and Parida,A.
            Expressed sequence tags from the mangrove species Avicennia marina
            Unpublished (2000)
            61% to 89A2

CYP89A       Fragaria vesca
             GenEMBL DY673158.1  EST
             65% to 89A10 

CYP89        Coffea canephora (Gentianales)
             DV708258 DV685779
             55% to 89A5 N-term

CYP89        Rhododendron catawbiense (Ericales)
             59% to 89A10 N-term

CYP89A      Gerbera hybrid cv. 'Terra Regina' (Asterales)
            63% to 89A5, 89A6 and 89A10

CYP89A-like     Mesembryanthemum crystallinum (ice plant)
            GenEMBL AI026356

CYP89      Mesembryanthemum crystallinum (Ice plant, Caryophyllales)
           BG269753.1 note: Gly rich insert removed
           61% to 89A4 (KYG region to mid)

CYP89A     Aristolochia fimbriata (magnoliids)
           FD758184.1 64% to 89A6

CYP89/77    Pinus taeda (loblolly pine)
            DN454459 DN447573.1 DT626966.1 CV137588.1 DN459178.1
            DN462981.1 CV146146.1 DN450427.1 CO409020.1 DN456357.1
            CO414332.1 DN455785.1 CO414095.1 DN447722.1 CO413551.1 
            DN457407.1 CV137671.1 CV146791.1 
            45% to 89A5, 45% to 77A9, 48% to 77A1
            note CYP77 and CYP89 are neighboring families
            this may be the precursor to both.
            These genes may act in a single pathway

CYP89A-like     Oryza sativa (rice)
          GenEMBL AU062487
          Sasaki,T. and Minobe,Y.
          Rice cDNA from callus
          Unpublished (1994)
          59% identical to 89A2 possible 89A sequence


CYP89A-like     Oryza sativa (rice)
            GenEMBL AA754418
            Nahm,B.H., Kim,J.K., Cheong,J.J., Kim,S.I., Hahn,T.R, Moon,E.P.,
            Kim,W.T., Kim,W.Y., Yang,M.S., Park,R.D., Sohn,U.I., Kang,K.Y.,
            Lee,M.C. and Eun,M.Y.
            Large-scale Sequencing Analysis of ESTs from Rice Immature Seed
            Unpublished (1998)
            74% identical to 89A2 C-term

CYP89B1     Oryza sativa (rice)
CYP89B2     Oryza sativa (rice)
CYP89B3     Oryza sativa (rice)
CYP89B3     Brachypodium distachyon (temperate grass)
CYP89B4     Oryza sativa (rice)
CYP89B4     Brachypodium distachyon (temperate grass)
CYP89B5P    Oryza sativa (rice)
CYP89B6     Oryza sativa (rice)
CYP89B7P    Oryza sativa (rice)
CYP89B8P    Oryza sativa (rice)
CYP89B9     Oryza sativa (rice)
CYP89B10    Oryza sativa (rice)
CYP89B11    Oryza sativa (rice)
CYP899B12P  Oryza sativa (rice)
CYP89B13P   Oryza sativa (rice)
CYP89B14P   Oryza sativa (rice)
CYP89B15P   Oryza sativa (rice)

CYP89B16    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Nov. 12, 2008
            Clone name Eop450-3
            70% to CYP89B9 rice

CYP89B17    Zea mays (maize)
            CO465851.1 N-term 
            CC700600.1 CG231767.1 (GSS seq) extends sequence
            75% to CYP89B4 rice

CYP89B18    Brachypodium distachyon (temperate grass)

CYP89B19    Zea mays (maize)

CYP89B frag Zea mays
            Trace file 559927396 
            69% to 89B11 frameshifted possible pseudogene

CYP89C1     Oryza sativa (rice)
CYP89C2     Oryza sativa (rice)

CYP89C3     Zea mays (maize)
            ESTs EE040602.2  EC900371.2, EE032348.2, EE016095.2, EC900372.2
            N-term = EE291783.2, C-term = CG439660.1 (GSS sequence)
            79% to CYP89C2 rice, 46% to CYP89A9 Arabidopsis

CYP89C4     Brachypodium distachyon (temperate grass)
CYP89C5P    Brachypodium distachyon (temperate grass)

CYP89C like seq  Hordeum vulgare
                 BJ480878 BE558465.1 
                 mid region to I-helix
                 46% to 89C2, only 40% to 723A3 

CYP89D1     Oryza sativa (rice)
CYP89D1     Brachypodium distachyon (temperate grass)

CYP89D frag Zea mays
            Trace file 516807581 
            57% to 89D1 

CYP89E1     Oryza sativa (rice)

CYP89E2     Lolium rigidum (ryegrass)
            Fischer,T.C., Klattig,J.T. and Gierl,A.
            A general cloning strategy for divergent plant cytochrome P450
            genes and its application in Lolium rigidum and Ocimum basilicum
            Theor. Appl. Genet. 103, 1014-1021 (2001)
            clone Lol-2 putative cytochrome P450 mRNA, partial
            65% to 89E1, 45% to 89A3 (Arabidopsis)

CYP89E3     Brachypodium distachyon (temperate grass)
CYP89E4P    Brachypodium distachyon (temperate grass)
CYP89E5     Brachypodium distachyon (temperate grass)
CYP89E6     Brachypodium distachyon (temperate grass)
CYP89E7     Brachypodium distachyon (temperate grass)
CYP89E8     Brachypodium distachyon (temperate grass)
CYP89E9     Brachypodium distachyon (temperate grass)
CYP89E10    Brachypodium distachyon (temperate grass)

CYP89E11v1  Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Feb. 25, 2011
            Clone name Ep14
            77% to CYP89E1 rice, 80% to CYP89E3 Brachypodium distachyon

CYP89E11v2  Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Feb. 25, 2011
            Clone name Ep15
            96% to CYP89E11v1 Echinochloa phyllopogon

CYP89E12    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Feb. 25, 2011
            Clone name Ep21
            67% to CYP89E1 rice, 72% to CYP89E10 Brachypodium distachyon

CYP89E     Zea mays 
           trace file 158115475 
           65% to 89E1

CYP89F1     Oryza sativa (rice)
CYP89G1     Oryza sativa (rice)
CYP89G1     Brachypodium distachyon (temperate grass)

CYP89G2P    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Nov. 12, 2008
            Clone name Eop450-8 pseudogene
            62% to CYP89G1 rice
            note: CYP89G is not found in the current version of the maize genome

CYP89G3P    Echinochloa phyllopogon (late watergrass)
            No accession number
            Satoshi Iwakami
            Submitted to nomenclature committee Jan. 10, 2010
            Clone name EEF6
            51% to CYP89G1, frameshift at & (4 nucleotides deleted)
            95% to CYP89G2P

CYP89H1     Zea mays
            BZ650880.1 CC619056.1, CC433702.1, CC619063.1
            49% to 89A2,  45% to 89B1,  48% to 89C2,  39% to 89D1,
            39% to 89E1,  40% to 89F1,  37% to 89G1,  40% to 89J1
            43% to 723A3

CYP89J1    Triticum monococcum
           AY914081 in HTGS
           39% to 89A4, 41% to 89B3, 42% to 89C2, 39% to 89D1, 
           36% to 89E1, 39% to 89F1, 34% to 89G1, 40% to 89H1
           37% to 723A3, 39% to 723A5

CYP89J2     Brachypodium distachyon (temperate grass)
CYP89J3     Brachypodium distachyon (temperate grass)

CYP89J4P    Setaria italica 
            Scaffold 6 5652006-5652659 (+) strand
            83% to CYP89J5 BT085788.1 Zea mays
            78% to CYP71F3 XM_003572113.1 Brachypodium distachyon

CYP89J5     Zea mays
            BT085788.1, EST FL438340.1 has the C-terminal
            83% to CYP89J4P Setaria italica
            66% to CYP89J2 Brachypodium distachyon

CYP89       Citrus clementina (Sapindales)
            GenEMBL DY281958.1 EST
            56% to 89A9

CYP89       Gossypium arboreum (Malvales)
            GenEMBL BQ404966.1 EST
            63% to 89A9

CYP89      Casuarina glauca (swamp oak, Fagales)
           CO037852 CO037198
           39% TO 89A4

CYP89      Juglans regia (walnut, Fagales)
           50% to 89A4, 53% to Casuarina glauca CO037852 CO037198

CYP89      Papaver somniferum (Opium poppy, Ranunculales)
           FG601388.1 62% to 89A6, 59% to 89C2

CYP89      Cucumis melo subsp. melo Piel de Sapo Pinyonet (Cucurbitales)
           AM720729.2 54% to 89A5, 73% to 89A10

CYP89      Avicennia marina (Lamiales)
           BM497297.1 58% to 89A10, 61% to 89A2

90A Subfamily

CYP90A1      Arabidopsis thaliana
             GenEMBL X87367 mRNA (1608bp) GenEMBL X87368 gene (4937bp)
             Szekeres,M., Nemeth,K., Koncz-Kalman,Z., Mathur,J., Kauschmann,A.,
             Altmann,T., Redei,G.P., Nagy,F., Schell,J. and Koncz,C.
             Brassinosteroids rescue the deficiency of CYP90, a cytochrome P450,
             controlling cell elongation and de-etiolation in Arabidopsis
             Cell 85 (2), 171-182 (1996)
             same as EST Z17988 and EST Z26124
             additional ESTs T41675, N38445, T43151, T43286, T22324, T22325
             Z29017, Z29018

CYP90A1      Arabidopsis thaliana
             GenEMBL AB005237 comp(27500-23500) region

CYP90A2     Vigna radiata (mung bean)
            GenEMBL AF279252
            Yang,M.T. and Chen,Y.M. 
            Cloning and sequencing of a Vigna radiata cDNA 
            encoding cytochrome P450 
            mRNA, complete cds; nuclear gene for chloroplast product. CipCYP
            77% identical to 90A1

CYP90A3     Oryza sativa (rice)
            AC123526.1 $F CYP90A3 chr 11 60% to 90A1 2 diffs with aaaa01015179.1
            4 diffs with aaaa01021848.1 = aaaa01003423.1
            aaaa01090268.1 aaaa01062436.1
            gene = OsCPD1, note OsCPD2 = CYP90A19 98% to 90A3 but unique gene

CYP90A4     Oryza sativa (rice)
aaaa01034672.1 CYP90A4 (indica cultivar-group) 56% to 90A1 89% to 90A3 AC123526.1 
seq removed in new assembly, no match to any japonica or indica seq, nr, WGS, ESTdb

CYP90A5    Solanum lycopersicum (tomato)
           No accession number
           Masaharu Mizutani
           Submitted to nomenclature committee 10/21/2003
           Clone name seq. 5
           74% to 90A1

CYP90A5    Solanum lycopersicum (tomato)
           GenEMBL BT014380
           Kirkness,E.F., Wang,W. and Vazeille,A.
           Only one amino acid difference to 90A5 of Mizutani

CYP90A5    Solanum tuberosum (potato)

CYP90A6    Populus trichocarpa (black cottonwood)
CYP90A6P   Populus trichocarpa (black cottonwood)
CYP90A7    Populus trichocarpa (black cottonwood)

CYP90A8     Citrus sinensis (Washington Navel orange, Ridge pineapple sweet orange)
            GenEMBL CB291543.1 CB291544.1 BQ623112.1 
            84% to 90A1
            note this seq was called CYP90A6 but this was changed
            due to a name conflict with Populus CYP90A6

CYP90A8      Citrus sinensis
             GenEMBL DQ001728.1  
             97% to 90A8 Washington Navel orange, 60% to 90A3

CYP90A9    Pisum sativum (pea)
           No accession number
           Takahito Nomura
           Submitted to nomenclature committee June 1, 2005
           CYP90A homolog1
           75% to 90A1 in Arabidopsis, 

CYP90A10   Pisum sativum (pea)
           No accession number
           Takahito Nomura
           Submitted to nomenclature committee June 1, 2005
           CYP90A homolog2
           77% to 90A1 in Arabidopsis, 59% to 90A3 in rice

CYP90A11   Zinnia elegans
           GenEMBL AB231153
           Yamamoto,R., Fujioka,S., Demura,T., Takatsuto,S., Yoshida,S. and
           Co-regulation of brassinosteroid biosynthesis-related genes during
           xylem cell differentiation
           Clone name ZeCPD1
           84% to 90A13, 76% to 90A12, 69% to 90A1

CYP90A12   Zinnia elegans
           GenEMBL AB231154
           Yamamoto,R., Fujioka,S., Demura,T., Takatsuto,S., Yoshida,S. and
           Co-regulation of brassinosteroid biosynthesis-related genes during
           xylem cell differentiation
           Clone name ZeCPD2
           76% to 9A11, 70% to 90A1

CYP90A13  Artemisia annua
          GenEMBL DQ363132.1 
          Rayhan,M.U., Kim,S.H., Chang,Y.J. and Kim,S.U.
          Cloning and expression of cytochrome P450 genes from Artemisia
          putative steroid 23-alpha-hydroxylase
          84% to 90A11

CYP90A14  Medicago truncatula (barrel medic)
          GenEMBL BF642437.1, CX526586.1, CX520194.1, BI263183.1
          BQ150419.1 CR482185.1 (lower case seq is from Arabidopsis)
          TIGR contig TC109815

CYP90A14    Glycine max (soybeans, Fabales)
            DQ340246, EST BU577443, BQ295944, BQ080340
            Li,L.Y. and Yu,D.Y.
            Comprehensive analysis of putative P450 genes superfamily in
            Glycine max and Medicago truncatula
            85% to 90A14 (probable ortholog) 78% to 90A1 Called CYP90A15
            JGI Glyma0 assembly scaffold_240:164956..170639 (+ strand)

CYP90A14    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 9/26/2008
            Clone A13 partial incorrect assembly

CYP90A15   Nicotiana tabacum 
           87% to 90A5

CYP90A16   Vitis vinifera (Pinot noir grape)
           CAAP02000562.1 62204-65464 (+) strand

CYP90A17    Carica papaya
            82% to 90A1 Arab., 83% to CYP90A16 AM463180 Vitis vinifera, 
            83% to CYP90A8 DQ001728.1  Citrus sinensis

CYP90A18    Picea glauca (white spruce)
            EX411154, EX409235, EX441953, EX408414 
            67% to CYP90A1 

CYP90A19    Oryza sativa (rice)
            gene = OsCPD2, note OsCPD1 = CYP90A3 98% to 90A3 but unique gene

CYP90A20    Glycine max (soybean, Fabales)
            No accession number
            Muhammad Azam Chattha
            Submitted to nomenclature committee 9/26/2008
            Clone A9, missing C-term
            78% to 90A2

CYP90A20    Glycine max (soybean, Fabales)
            EST BU081866, CO979079.1
            78% to 90A2
            JGI Glyma0 assembly scaffold_15:6630251..6636169 (+ strand)

CYP90A21    Zea mays (maize)
            DV169686.1, DV026887.1, EE028995.2, DV523152.1
            chr 4 region 249237520 to 249240111 (+)
            82% to 90A3 rice 88% to Zea 90A22 on chr 2
            complete seq from ESTs

CYP90A22v1  Zea mays (maize)
            EE166033.2, EE157573.2, EE152605.2, FL141773.1
            Chr 2 in region 177663448 to 177665503 (+)
            78% to 90A3 rice 88% to Zea 90A21 on chr 4

CYP90A22v2  Zea mays (maize)
            97% to CYP90A22 6 aa diffs and two indels

CYP90A23    Glycine max (soybean, Fabales)
            JGI Glyma0 assmbly scaffold_121
            Gm0121x00253:peptide  N-term
            93% to 90A14 
            possible homeolog of 90A14 due to a recent genome duplication

CYP90A24    Glycine max (soybean, Fabales)
            JGI Glyma0 assmbly scaffold_252:66122..59954 (- strand)
            96% to CYP90A20 
            possible homeolog of 90A20 due to a recent genome duplication

CYP90A25    Picea glauca (white spruce)
            No accession number
            Bjoern Hamberger and Joerg Bohlmann
            Submitted to nomenclature committee 9/30/2008
            Clone name PgP450-8
            67% to 90A1 Arab., 55% to 90A3 rice

CYP90A25    Picea sitchensis (Sitka spruce)
            No accession number
            Bjoern Hamberger and Joerg Bohlmann
            Submitted to nomenclature committee 9/30/2008
            Clone name PsP450-8
            1 aa diff to CYP90A25 Picea glauca (ortholog)

CYP90A26    Pinus taeda (loblolly pine)
            No accession number
            Bjoern Hamberger and Joerg Bohlmann
            Submitted to nomenclature committee 9/30/2008
            Clone name PtP450-8
            68% to CYP90A1 Arab., 96% to CYP90A25 Picea glauca (ortholog)

CYP90A27P   Glycine max (soybean, Fabales)

CYP90A28   Brachypodium distachyon (temperate grass)

CYP90A29   Panax ginseng (Apiales)
           No accession number
           Yong Eui Choi
           Submitted to nomenclature committee August 14, 2011
           80% to CYP90A5 tomato

CYP90A30    Thapsia villosa
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            76% to CYP90A1 Arabidopsis thaliana

CYP90A      Fragaria vesca (WILD STRAWBERRY, ROSALES)
            GenEMBL DY667353.1 EST  
            79% to CYP90A6 

CYP90A      Cycas rumphii (cycad)
            GenEMBL DR061491 EX922059.1
            60% to 90A1 Arab. 

CYP90A      Cycas rumphii (cycad)
            65% to CYP90A1 Arab, 88% to DR061491 EX922059 Cycas

CYP90A frag.  Platanus x acerifolia (eudicotyledons; Proteales)
            Pilotti,M., Brunetti,A., Gallelli,A. and Loreti,S.
            NPR1-like genes from cDNA of perennial Rosaceae and of Platanus
            acerifolia: cloning strategy and genetic variation among the
            74% to 90A1

CYP90A      Rhododendron catawbiense (Ericales)
            CV014946.1 68% to 90A3, 76% to 90A1

CYP90A      Ipomopsis aggregata (Ericales)
            DT575655 80% to 90A1

CYP90A    Ribes americanum (American black currant, Saxifragales)
          81% to 90A1

CYP90A      Saccharum sp.(sugar cane)
            GenEMBL AA961302 (626bp)
            Carson,D.L. and Botha,F.C.
            Sugarcane cDNA from mature stalk tissue
            Unpublished (1997)
            73% to CYP90 C-term

CYP90A      Lactuca serriola (lettuce serriola, Asterales) 
            72% to 90A5

CYP90A   Aquilegia formosa x Aquilegia pubescens (Ranunculales)
74% to 90A5

CYP90A Gossypium hirsutum (cotton, Malvales)
72% to 90A5

CYP90A    Antirrhinum majus (snapdragon, Lamiales)
          78% to 90A5

CYP90A    Hedyotis terminalis (Gentianales)
          80% to 90A5

CYP90A    Rhododendron catawbiense (Ericales)
          79% to 90A5

CYP90A    Eucalyptus gunnii (Myrtales)
          78% to 90A5

CYP90A    Beta vulgaris (sugar beet, Caryophyllales)
          69% to 90A5

CYP90A    Cucumis melo subsp. agrestis (Cucurbitales)
          AM715243.1 77% to 90A1

CYP90A    Liriodendron tulipifera (tulip poplar, magnoliids)
          FD497898.1 75% to 90A1 Arab

CYP90A   Adiantum capillus-veneris (maidenhair fern)
         49% to 90A1 (mid region 80-239)

90B Subfamily

CYP90B1     Arabidopsis thaliana
            GenEMBL AF044216 also AL132979
            Sunghwa Choe, Feldmann Lab
            steroid 22 alpha hydroxylase (DWF4 gene)
            42.2% identical to 90A1

CYP90B2     Oryza sativa (rice)
AC104473.1 $F CYP90B2 chromosome 3 clone OJ1626B05, Length = 127982
43% to AL606588.1 85 clan 
same as AQ689106 nbxb0078N12r 77% to 90B1

CYP90B2     Oryza sativa (rice)
aaaa01002757.1 CYP90B2 (indica cultivar-group) orth of AC104473.1 chr 3 77% to 90B
13908 VHR 13900

CYP90B2      Brachypodium distachyon (temperate grass)

CYP90B3      Solanum lycopersicum (tomato)
             No accession number
             Masaharu Mizutani
             Submitted to nomenclature committee 10/21/2003
             Clone name seq. 6
             71% to 90B1 67% to 90B2

CYP90B3    Solanum tuberosum (potato)

CYP90B4      Populus tremula x Populus tremuloides (hybrid aspen)
             GenEMBL EST BU887383 root cDNA library cDNA 
             80% TO 90B1

CYP90B5      Amborella trichopoda (basal angiosperm)
             GenEMBL EST CD483534 cDNA clone
             66% TO 90B2 67% TO 90B1

CYP90B6    Populus trichocarpa (black cottonwood)
CYP90B7    Populus trichocarpa (black cottonwood)
CYP90B7P   Populus trichocarpa (black cottonwood)

CYP90B8    Pisum sativum (pea)
           No accession number
           Takahito Nomura
           Submitted to nomenclature committee June 1, 2005
           CYP90B homolog
           73% to 90B1 in Arabidopsis, 69% to 90B2 in rice

CYP90B9    Zinnia elegans
           GenEMBL AB231155.1
           Yamamoto,R., Fujioka,S., Demura,T., Takatsuto,S., Yoshida,S. and
           Co-regulation of brassinosteroid biosynthesis-related genes during
           xylem cell differentiation
           Clone name ZeDWF4
           mRNA for steroid 22-alpha-hydroxylase
           69% to 90B1, short before the I-helix compared to Arabidopsis

CYP90B10    Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC147964.10  GenPept ABE78866, ABE78867
            ABE78866 seq is short at C-term, ABE78867 = C-term

CYP90B11    Medicago truncatula (barrel medic, Fabales)
            GenEMBL CT033768.1

CYP90B12   Vitis vinifera (Pinot noir grape)
           CAAP02005473.1 5349-1615 (-) strand)

CYP90B13    Carica papaya
            74% to CYP90B1 with a small deletion before the I-helix
            82% to Vitis CYP90B12, 
            82% to Gossypium hirsutum steroid 22-alpha-hydroxylase (DWF4)

CYP90B14v1  Zea mays (maize)
            EE156534.2, CA452603.1, EE156535.2 (ESTs)
            EU956946.1 complete mRNA, AC217909.2 genomic
            Chr 1 40668579 to 40668731 (+)
            89% to 90B2 

CYP90B14v2  Zea mays (maize)
            88% to CYP90B2, 99% to 90B14v1 EU956946

CYP90B15    Glycine max (soybean)
            JGI Glyma0 assembly scaffold_53:3506499..3501913 (- strand)
            85% to 90B11 Medicago truncatula

CYP90B16P   Glycine max (soybean, Fabales)

CYP90B17    Glycine max (soybean, Fabales)

CYP90B18    Glycine max (soybean, Fabales)

CYP90B19P   Glycine max (soybean, Fabales)

CYP85clan    Adiantum capillus-veneris (maidenhair fern)
             Family not identified, 33% to 90C1, 39% to onion 90B frag. 

CYP90B       Allium cepa (onion, Liliopsida)
             57% to 90B1 with a gap after LEEE

CYP90B      Amborella trichopoda
            GenEMBL CD483534  EST
            66% to 90B1 N-term


CYP90B     Amborella trichopoda
           GenEMBL CV011348
           61% to 90B2 C-term

CYP90C1      Arabidopsis thaliana
             GenEMBL Z99708 
             Complete sequence
             ESTs: AA651564, N96214, GSS: AQ011208

CYP90C1      Arabidopsis thaliana
             GenEMBL AL022141 
             F23E13.220 C-terminal sequence
             ESTs: AA651564

CYP90C1      Arabidopsis thaliana
             GenEMBL AB008097
             Kim,G.T., Tsukaya,H. and Uchimiya,H.
             The ROTUNDIFOLIA3 gene of Arabidopsis thaliana encodes a new member
             of the cytochrome P-450 family that is required for the regulated
             polar elongation of leaf cells.
             Genes Dev. 12, 2381-2391 (1998) 
 Plant J. 2005 41, 710-721 CYP90C1 and CYP90D1 are involved in different steps in the brassinosteroid biosynthesis pathway in Arabidopsis thaliana.
Kim GT, Fujioka S, Kozuka T, Tax FE, Takatsuto S, Yoshida S, Tsukaya H.
             ROT3 appears to be required for the conversion of typhasterol to 
             castasterone, an activation step in the Brassinosteroid pathway.

CYP90C2      Solanum lycopersicum (tomato, Solanales)
             No accession number
             Masaharu Mizutani
             Submitted to nomenclature committee 10/21/2003
             Clone name seq. 7
             65% to 90C1 

CYP90C2      Solanum tuberosum (potato)

CYP90C  Ipomoea batatas (Solanales)
        80% to 90C1

CYP90C3     Populus trichocarpa (black cottonwood)

CYP90C4     Medicago truncatula (barrel medic, Fabales)
            GenEMBL AC146720.23  GenPept ABE89648, ABE89647

CYP90C5    Vitis vinifera (Pinot noir grape)
           28045..28369,29691..29896)) revised this model
           CAAP02000181.1 61157-56961

CYP90C6    Carica papaya
           supercontig_6:1503524,1513523 with a short seq. gap
           65% to CYP90C1, 68% to CYP90C5 Vitis vinifera 
           72% without the N-term seq. best GenBank hit 

CYP90C7P   Vitis vinifera (Pinot noir grape)
           CAAP02000141.1 pseudogene
           82% to 90C5

CYP90C8    Glycine max (soybean)
           JGI Glyma0 assembly scaffold_53:3113778..3119234 (+ strand) 
           62% to 90C1 Arab.

CYP90C9    Glycine max (soybean)
           JGI Glyma0 assembly scaffold_13:5087589..5094210 (+ strand) corrected
           95% to 90C on scaffold_53 possible homeolog of 90C8

CYP90C10   Glycine max (soybean, Fabales)

CYP90C11P  Glycine max (soybean, Fabales)
           Glyma16g24430.1 pseudogene 
           89% to CYP90C10 near the N-term
           submitted by Satish Guttikonda

CYP90C12    Thapsia villosa 
            No accession number
            Henrik Toft Simonsen
            Submitted to nomenclature committee Dec. 1, 2011
            63% to CYP90C1   Arabidopsis thaliana

CYP90C    Panax ginseng (ginseng, Apiales)
          68% to 90C1

CYP90D1      Arabidopsis thaliana
             GenEMBL AP001307 comp(43183-45689) 
             51% to 90C ESTs = AI994541, R30379, R30380

CYP90D2     Oryza sativa (rice)
CYP90D2     Brachypodium stachyon (temperate grass)
CYP90D3     Oryza sativa (rice)
            AC130732.1 chromosome 5 
            This seq is revised

CYP90D4P    Oryza sativa (rice)

CYP90D5    Populus trichocarpa (black cottonwood)
CYP90D6    Populus trichocarpa (black cottonwood)

CYP90D7    Pisum sativum (pea, Fabales)
           Takahito Nomura
           Submitted to nomenclature committee 10/9/2006
           66% to 90D1

CYP90D8    Vitis vinifera (Pinot noir grape)
           missing last exon (included in CAAP seq and shown below)
           CAAP02000141.1 35775-31286
17795  SFMERRRRM  17821
19549  NPWRWQ
       DKNISSCSFTPFGG  19728

CYP90D9    Carica papaya
           69% to CYP90D1, 73% to Vitis vinifera CYP90D8
           Frameshift after PHLK

CYP90D10.a  Zea mays (maize)
            Chr 9 23574555-23578579 (-) 
            2 identical P450 sequences 87 kb apart
            74% to 90D3 (revised seq)

CYP90D10.b  Zea mays (maize)
            Chr 9 23665606-23661585 (-) 
            Identical to CYP90D10.a 

CYP90D10.b  Zea mays (maize)
         98% to CYP90D10.a 3 aa diffs and two indels
         99% to CYP90D10.b 4 aa diffs and 1 indel
         There are two nearly identical P450 sequences 87 kb apart
         This one is most like CYP90D10.b, there is a 5 aa indel in 
         CYP90D10.a that is not present here.

CYP90D11  Zea mays (maize)
          DV519605.1, FL052263.1, FL456676.1, EB673391.1 ESTs
          AC209718.1 genomic
          chr 3 7045845 to 7051626 (+)
          81% to 90D2 rice

CYP90D12    Glycine max (soybean)
            JGI Glyma0 assembly scaffold_146:1181331..1185409 (+ strand)
            66% to 90D1 except for N-term peptide, 82% to 90D7 pisum

CYP90D13    Glycine max (soybean)
            JGI Glyma0 assembly scaffold_107:2625813..2621530 (- strand)
            95% to scaffold 146 CYP90D12, possible homeolog of 90D12

CYP90D14   Hordeum vulgare subsp. vulgare 
           brassinosteroid C-3 oxidase
           Identification of the homolog of rice CYP90D gene in Hordeum vulgare

CYP90D15    Picea sitchensis (Sitka spruce)
            No accession number
            Bjoern Hamberger and Joerg Bohlmann
            Submitted to nomenclature committee 9/30/2008
            Clone name PsP450-7
            67% to H. vulgare 90D14, 63% to 90D1 Arab., 
            53% to 90A26 P. taeda, 51% to 90A25 P. glauca

CYP90D16P   Glycine max (soybean, Fabales)

CYP90D17    Brachypodium stachyon (temperate grass)
            this different from CYP90D2 

CYP90D18    Bupleurum chinense DC (Chinese medicinal plant chaihu, Apiaceae)
            No accession number
            Sui Chun
            Submitted to nomenclature committee Nov. 2, 2010
            Clone name BcCYP90D
            75% to CYP90D8 Vitis vinifera, 65% to CYP90D1 Arabidopsis

CYP90D19    Solanum lycopersicum (tomato)
CYP90D19    Solanum tuberosum (potato)

CYP90C/90D precursor   Pinus taeda (loblolly pine) 
           52% to 90C1, 54% to 90D1
           note: CYP90C and 90D may have only one precursor in gymnosperms

CYP90C/90D precursor   Picea glauca
           EX390090.1 mid to PKG motif

CYP90C/90D precursor   Picea sitchensis
           DR541349.1 C-term

CYP90C/90D precursor   Cryptomeria japonica (Japanese cedar)
           BY880850 N-term
           58% to CYP90C and CYP90D
           note: CYP90C and 90D may have only one precursor in gymnosperms

CYP90C/90D precursor   Cryptomeria japonica (Japanese cedar)
           BW996624 C-term

CYP90E1   Selaginella moellendorffii
          Traces 721005955 914792662 1322561598 869252186
          39% to 90A1 Arab. 34% to 763B1

CYP90E2   Selaginella moellendorffii (lycopod moss)

CYP90E3   Selaginella moellendorffii (lycopod moss)

CYP90E4   Selaginella lepidophylla
          74% to 90E1 38% to 90A1, 35% to 90D2 

CYP90F1   Selaginella moellendorffii (lycopod moss)

91A Subfamily

Note: The 81 and 91 families have been joined due to new Arabidpsis sequences that have 
strong sequence identity to both families.  The CYP91 family sequences have been 
renamed with new CYP81 family names.  The old names will still be recognized, but the 
newer names will be preferred.

CYP91A1X    Arabidopsis thaliana
            no accession number (500 amino acids)
            Mizutani, M. 
            unpublished (1995)
            New name CYP81D1

CYP91A2X    Arabidopsis thaliana
            no accession number (500 amino acids)
            Mizutani, M. 
            unpublished (1995)
            new name CYP81F1

CYP91A3X    Arabidopsis thaliana
            GenEMBL H76015 (EST)
            73.3% identical with 91A1 (over 105 amino acids)
            new name CYP81D8

CYP91A4X    Glycyrrhiza echinata_ L. (licorice; Fabaceae)
            GenEMBL AB001379  or D89431
            Shin-ichi Ayabe
            50.1% identical to 91A1
            new name CYP81E1

CYP91A5X    Cicer arietinum (chickpea)
            no accession number
            Stefan Overkamp and Wolfgang Barz
            submitted to nomenclature committee
            52.7% identical to 91A4
            new name CYP81E2

92A Subfamily

CYP92A1     Zea mays
            GenEMBL AY072297.1
            Persans,M.W., Wang,J. and Schuler,M.A.
            Characterization of maize cytochrome p450 monooxygenases induced in
            response to safeners and bacterial pathogens.
            Plant Physiol. 125 (2), 1126-1138 (2001)
            unpublished in 1995 revised sequence Dec 1 1999 
            old clone name PCR3
            note: 92A1 and 92A4 are probably the same seq.

CYP92A2v1  Nicotiana tabacum (tobacco)
           GenEMBL X95342 (1628bp)
           Characterization of hsr201 and hsr215, two tobacco genes 
           preferentially expressed during the hypersensitive reaction 
           provoked by phytopathogenic bacteria.
           Czernic,P., Huang,H.C. and Marco,Y.
           unpublished (1996)
           possible frameshift in region KATECRENSK compared to CYP92A2v2, v3, v4

CYP92A2v2  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D147-AD3
           97% to CYP92A2v1

CYP92A2v3  Nicotiana tabacum var. 4407 (tobacco)
           No accession number
           Dongmei Xu, USSTC
           Submitted to nomenclature committee Sept. 16, 2005
           Clone name D257-AE4