The Caenorhabditis briggsae genome is sequenced and it has been assembled.  
The Genome is in 578 sequences of 108Mb total length.

The blast server for the C. briggsae data is at Briggsae Blast Server

A paper describing the genome is in the Public Library of Science/Biology
Stein LD, Bao Z, Blasiar D, Blumenthal T, Brent MR, et al. (2003) 
The Genome Sequence of Caenorhabditis briggsae: A
Platform for Comparative Genomics. 
PLoS Biol 1(2): e45 DOI:10.1371/journal.pbio.0000045.
November 2003

I am going through the genome now and assembling the P450 genes.  This is not complete yet.

The sequences I have assembled so far are given below.  They are not named yet, except to
identify the family and subfamily.  

You may blast these protein sequences along with the C.elegans P450s at the P450 blast 
server.  Currently they are in the same file as the C. elegans sequences.  When I am finished
assembling them, I may make a separate file for each speices as well as the combined file.

D. Nelson Nov. 21, 2003

>CYP13A.a cb25.fpc0022 5 exons Minus Strand
1361701 MLISAILLGVFTYSVWIWSYFIRKGIKGPRGFPGIGMLLQTLDHENPPFLKYRQWTK 1361531
1361527 QYGPVWGFTEGPQQTMVISEPEMVNEIFNKQFDNFYGRKLRPIIGDPEKDKRV 1361327
1361326 NMFAAQGKRWKRLRTMSSPSFSNNSLRKVKSTVQECGSEILWNIERKVATGEEIDMLL (2) 1361153
1361103 FYQEYTLGVISRIALGQSESKMFQNPLLLKVKS (0)
1360959 IFNGSWHLFLLTGLFPPLASVIRKMSKSLPADFVPAFKIFDLIETAVEARMAQRESDIKNGIEPGE 1360762
1360761 PQDFIDLFLDARTDADFLGEKNEDFSKTAVMKVNKELTFDEIVGQCFVFLAAGFDTTAL 1360585
1360584 SLSYATFLLATHPDVQKRLQEEVDNECPDPEISFDQLSKLKYMECVMKEALRLYPLGVT (2) 1360402
1360356 ANTRKCMRETVIDGVIFEEGMNIQVDTWTLHHNKSIWGDDVEDFKPER (2) 1360213
1360137 WENSACEHLEHNGSYIPFGSGPRQCIGMRLAQIEQKIILAQILKEYSFRTCKNTQIPLK 1359961
1359960 LVGKLTLSPENVIVKLEPRKDHL* 1359889

>CYP13A.b cb25.fpc0022 6 exons Minus Strand
1363792 MFFFLIFVAISTYYIYHWTFWKRRGVPGPWGIPILGKSGVMLDDRSAPPLLIQEWTKKYGK 1363610
1363609 VYGFTEGMQKVMVISDPDMVQEVFVKQYDNFFGRKVNPIQGDPDKDKDVPLVGAQGFRWK 1363430
1363429 RLRTISAPAFTNSSIKKVMPRIENSVQEFLKHLEQNGENGKPVNMHL (2) 1363295
1363274 YFQEYTMDVIMRIAMGQPESRMFKNPMLYDCKG (0) 1363140
1363093 FFENSRWPVWMFSGAFPFAVKGLRYLFLKLGKFGAGPFIRVQKQVTDAVNDRIAQREADRQQEMEPGEPQDFID 1362872
1362871 FFLDAQADVDFFGETNDEYQKSTIY (0) 1362797
1362747 NNRKLTMQEIITNCFLFVVAGFDTTAISLSYVAYFLSLNPRVQRKLQEEVDRECRDSEITF 1362565
1362564 EQLSKLKYMENTIKEALRVFPMAAF (2) 1362490
1362447 ANSRRCMRTTKIGDTVVEEGVDILVDTWTLHHDKKVWGEDADEFKPER (2) 1362304
1362250 WESPLNPHQSFMAFGAGPRVCLGVRLAYLEQKVLLAHVLRKYSFVANTQTQV 1362095
1362094 PMKLVGRATSRPQSLILSVEPRLPDPRV* 1362008

>CYP13A.c cb25.fpc0022 81% to 13A12 5 exons Plus Strand
1365401 MACIFSFLIFSYYLWTWTYWRRRGISGPPGYPLIGCALEMLDSENPPYLQLKEWTKEYG 1365577
1365578 KVYGITEGMMKILVISDPALVEEVFVKQYDNFYGRKLYPIQGDPNKDKLVNLFASQGHRW 1365757
1365758 KRLRTISSPTFSNNSLR (2) 1365808
1365856 KLKTTVEDCALELLRHIETQTAGGKPIDLL (2) 1365945
1365993 TFYQEFTLDVIGRIAMGQTDSQMFQNPM 1366076
1366077 LKYVKAVFGEPRKFIFLSGAIVPWTGPLLRKFFMSLPNIFKNPAIHIIRQVAQAVE 1366244
1366245 NRIAQRATDEKAGIEPGEPQDFIDLFLDAK 1366334
1366335 SDDVEIENNEDFTKAGIKVTRQLTKDEIVGQCFVFLIAGFDTTALSLSYSSFLLATHP 1366508
1366509 EVQKKLQEEIDRECPDPEITFDQLSKLKYLECVVKETLRKYPLGAM (2) 1366646
1366692 ANARRCMRSTKIGNYEIEEGIDILCDTWTLHADKNIWGEDAKEFKPER (2) 1366835
1366880 WESGDEQFFQKGGYIPFGLGPRQCIGMRLAYMEEKLLLCHILRKYTLETCSKTQIPLK 1367053
1367054 LIGSRTTSPETVWLNLKPREDI* 1367122

>CYP13A.d cb25.fpc0022 8 exons Plus Strand
        MVFFLFHWFIIVFVAVF (2)
1370232 SYYLWQWTYWVRRGVPGPLGYPVIGSFLNSLDHSFPGPLQVKEWTK (0) 1370369
1370425 KYGSTFGFTEGLMKTLVISDPELVDEVFVKQYDNFYGRKRNPISGDSEKEKRTNIFSAQG 1370604
1370605 FRWKRLRTISSPTFSNNNLRKLNLTVEECALEIIKHTEEKTAGGAQIDMLR (2) 1370757
1370800 FYQEFTLDVIGRISMGQSESLMFNNPIFPIVRK (0) 1370898
1370942 LFQGSGYYFRLMLIGGVLPPFLVEIVRQIVRRLKMGTFGKINGITLEAVQKRIKQREEDE 1371121
1371122 KAGVEPGEPEDFIDLFLDAKAGDVEHFEEDNGDFKKSTSY (0) 1371238
1371295 TNRQLTTDEIVGQCTVFLIAGFDTTALSLSYSTYLLATHPEVQKKLQEEVDRECPGSGITFDQL 1371486
1371487 SKLKYLECVMKETLRLYPLGTF (2) 1371552
1371597 ANSRKCMRTTKLGDIEVEAGTMVQVDTWTLQTNSKIWGEDAGEFKPER (2) 1371737
1371777 WENGDEQFIQKGAYIPFGLGPRQCIGMRLAYMEEKMLLAHILRRYTFQTGTKTEIPLM 1371956
1371957 LIGTTTTQPASVWMHLTPRL* 1372019

>CYP13A.e cb25.fpc0022 6 exons Minus Strand
1378847 MFLLFSKLFTLAVLGIIGVVTYYLWIWTYWMRRGVKGPRGKPFVGVLNVLLDHEKPGLLKLGEWTE (0)1378650
1378011 EYGKVYGYTDGNQRTLVVSDPSMVHEIFVKQFDNFYGRKLNPIQGNPDQDERVHLLSAQG 1377832
1377831 FRWKRLRTISSVSFSNGSLRKIMSTVEDSALDFMKHMEEKSANGEIDMLD (2) 1377682
1377636 AYQEYTMDVIARVAIGQRDNKMFSDQNELLKIVRQ (0) 1377532
1377484 IFGGSRKYLMLICQVFPVVGQAIRSLTFKYPKIAPFK LYLMIKKAVMERKEQRDRE 1377317
1377316 LENGVEPGEPQDFIDMFLDAKSDDVDFSKEAREDFSKRNMKITKELSADEA (2) 1377164
1377164 VGQCFVFVIGGFDTTALALSYVTYLLTVNPEVQKKVREEVDAEFGDSEIEFEKLGRLKYM 1376985
1376984 DCVIKEALRLYPLASI (2) 1376940
1376794 SNSRKCMHTTTVNGVEIEAGVYVQMDTWTLQRDPAIWGDDAMDFKPERWESAKQSEYKG 1376618
1376617 AYIPFGLGPRQCIGMRLAVMEQKVLLTHILKKYSFETGPSTSIPLKLVGSATTSPENVFV 1376438
1376437 QLKPRNQ* 1376414

>CYP13A.f cb25.fpc0022 6 exons Minus Strand
1382628 MSFSLLLISTIFIGFLSYYVWIWSYWIRKGVKGPRGIPFSGIMHRFQDYDYPFWRVMMDWTK (0) 1382443
1382309 EYGPIYGITEGVEKTLVVSDPEFVHEVFVTQFDNFYGRKLNPLQGDPNKNKRAHLVSTQ 1382133
1382132 GHRWKRLRTLSSPTFSNKNLKKIMKTVDDSVAELMRHLEKGCAGGKTVDMLE (2) 1381980
1381930 YYQEFTIDIIGKIAMGQTQSLMFENPMLPKVKS (0) 1381832
        IFVDGRKHAFFASAMFPFLGAMLRLNV 
1381698 FPSIQPASDIMNIIEKAVKARIDQRKTDEKLGIEVSGEPQDFIDLFLDARADVDFFEQEAKDDFGKTQ 1381495
1381494 ITKVDKHLTFDETVGQLFVFLLAGYDTTALSLSYSSFLLATHPEVQRKCQEEVDRECSDP 1381315
1381314 EVTFDHLSKLKYMDWVIKEALRFYPLASI (2) 1381228
1380725 VHNRKCMKATTVCGVEIEEGTNVQVDTWTMHKDPNIWGDDVNEFKPER (2) 1380582
1380529 WESGDEQFIQKGGYLPFGMGPRICIGMRLALMEEKMLLTQILKKYTFETTSETVI 1380365
1380364 PLKLVGRSTTAPSSVNLKLRPRHSD* 1380287

>CYP13A.g cb25.fpc0022 8 exons Plus Strand
        MSIILLVITALLFGVL (2)
1484515 SYYLWIWIYWRRRGVPGPLGYPVVGSFLSTIEHTNPQYLQIREWTKQYGSVYGYTEGTM 1484691
1484692 KTLIVSEMDLVHQLFVTQYDNFYGRKLNPIQGDPEKDDRANLFSAQGYRWKRLRAIASPT 1484871
1484872 FSNNSLR (2) 1484892
1484945 KINLTVEDCAIELLRHIEEQTTGGEPINMLQ (2) 1485037
1485081 FYQEFTMDVIGRIAMGQIDSQMFRNPLLNFVKA (0) 1485185
1485224 IFADNRKHIPLIGGVFPVLAQIFRYFMLKFPFLGAANFIHVHKTM
1485359 VSAVHNRIAQREEDKNNGIEPGEPQDFIDLFLDARAEDVEHFGESNADFSKSSSY (0) 1485523
1485573 NNRQLTTMEVVGQCTVFLIAGFDTTALSLSYSTFLLATHPEIQKKLQEEVDIECPDSVITFDQL 1485764
1485765 SKLKYMDCVIKETLRLYPLGTL (2) 1485824
1485875 ANSRRCMRATKLGNVEVEVGTMVQVDTWSLHTDTKVWGDDAKEFKPER (2) 1486018
1486064 WLLPETDKISQKGGYIPFGLGPRQCIGMRLANMEEKILLSHILRKYTFKTGKKTDIP 1486234
1486235 LKLHGRATTQPESVWMHLVSRN* 1486303

>CYP13A.h cb25.fpc0023 5 exons  Plus Strand
       MITISLAFLTLFVGVFS (2)
864459 YYLWTWTYWKRRGIPGPMGYPIFGSSLELFDSENPPPAQLEKWTKKYGKVYGMTQGLSK 864635
864636 TLVISNADLVQEVLVNQYDNFYGRNLNPIQGNPNQEKRVHLFAAQGHRWKRLRTISSPTFSNNSLR (2) 864833
864944 KLKTTVEDSCVELLRHMEEQTAGGKPIELLN (2) 865036
865751 FYQEFTLDVIGRIALGQTDSQIFKNPMLPYVRAVFGEPRKALFMSGFLVPWIAPILRKIM 865930
865931 FSFPSILKNPAVHIIRQTADAVEKRIAQRVADERVGIEPGEPQDFIDLFLDAKSDDVDIQ 866110
866111 RNEEFSKTEKVTKKLTTDEVVGQCFVFLVGGFDTTALSLSFSSYLLATHPDVQKKLQEE 866287
866288 VDRECKDPEITFDKLSKLKYMECVIKETLRLYPLAAL (2) 866398
866442 ANARRCMRPTTIGGVEIEKGVDILCDTWTIHKDPKIWGVDAEEFKPERWESGDDHILSKG 866621
866622 SFISFGLGPRQCIGMRLAYMEEKLLLCHILRKYTLKTCKKTQIPMKLVGVRTTQPESVWM 866801
866802 NLEPREDN* 866828

>CYP14A.a cb25.fpc0023 6 exons 
953860 MSVFIVAFFSFIAAYIVHFYWKVSKYPKGPLPLPFVGNLLQ (0) 953982
954025 FPATHIQTFYDDLAKTYGPCFTLWTPTPSVVITDYDHLKEAFVTQ (1) 954159
954220 GDAFITRGLRPPETLLHPDVDTGIVFSNADTWRVQRRTSLKILRDFGLGRNLMEEQ 954387
954388 VTRSVHEMLQQLDNIKDKTDVDMYWPIQLCVGNVINESLFGYHYSYKDTEKFQKFVMIVD 954567
954568 RHLKNLSGRPQLLIAAWPWLRHVPIIGEMGYHSIKRNIKT (2) 
954733 (0) YHKFIEDEVASQIKEYDEHSEPENFVHAYMKQINQAGNPELN (2) 954858
954923 MTQLCASVLDFWIAGMETTSNSLRWHLTYMMKYPEIQDKVRKEIFDVVGTNQLPSMSDKP 955102
955103 NMPYTQAVIHEVQRHSNMIPMLGTHF (1) 955180
955225 NTKEINIKGYKVPTGTNCIGQLWSIQRNDPVFIESHKFNPSRYFQADGRTMDKAVLEKTIPF 955410
955411 SIGKRNCLGEGLARMELFLIFSALIQKYEFVPKSSIDLSPVWGGVLTSKPYRCQLVPQTA* 955593

>CYP14A.h pseudogene solo exon cb25.fpc0023
958034 AVLEKIIPFTIGKRNCFGEGLARMELFLIFSALIQKYEFCA 958156

>CYP14A.b cb25.fpc0106 7 exons 
251869 MSVFILAVLVFLVLYVVHFYWKVSKYPKGPFPLPLIGNIHQ (0) 251747
251700 FPPDHVQLYFDEMSKIYGPCFTVWIPYPAIVLNDYEHVKEAFVTQ (1) 251560
251510 GDTFTYRAHRSPETLLPVHDHTGILASDGDHWRLQRRTSLKILRDFGLGRNLMEEQVVRS 251331
251330 VQEMMVQIENITDKNKVDMFWPIQLCVGNVINETLFGFHYKYEDSEKFKTFVRIVDKHLR 251151
251150 HLQGTMPLLVSAFPWLRHLPIIGDIGYHNIKNNISS (0) 251043
250767 YQTFIEEEVTTQVKQYDGVSEPENFVHAYMQQMKQTGNPGLE (2) 250642
250594 IKNLCASVLDFWLAGMETTSNSLRWHLAYMMKYPEIQDKVRKEIFEVVGTSRLPSMSDKP 250415
250414 NMPYTQAVIHEVQRCSNMLPFLGSHQ (1) 250337
250282 CVEETSIKGKHVPAGTLVFAQIWSVMKNDPVFKDASEFNPDRYLQSDGKTFDK (0) 250124
250078 AVLEKTIPFSIGKRNCVGEGLARMELFLIFSALIQKYEFVPTSNIDLSPDWGVV 249917
249916 MTSKPYTCQLLPQY* 249872

>CYP14A.c pseudogene cb25.fpc0106 exon 2 and part of exon 3
270521 FPGQNIHIYFDDLSKTYGPCFTLWTPLPAVVITDYDYLKGAFVNQ (1) 270381
270314 GEAFIMRAERPPETLLQAHLNTGILQSSGENWRL*RRTSLKILRDFGLGRNLMEEQVMRS 270135
270134 VHEMLYQIGNITDKKKV 270084

>CYP14A.d cb25.fpc0106 7 exons
272501 MSVLIVAFLVFVITYIAHFYWKVSKYPKGPFPLPLIGNVLQ (0) 272379
272332 FPDKNIHIYFDELAKTYGPCFTLWTPLPAVVITDYDYLKDAFVTQ (1) 272198
272131 GEAFIMRAERPPETLLQPHINTGVLASSGENWRLQRRTSLKILRDFGLGRNLMEEQVMRS 271952
271951 VHEMLHQIENITDKKKVDMFWPIQLCVGNVINESLFGYHYKYEDADRFKTFVQVVDRHLR 271772
271771 AITGKIPLLMGAFPWLRHVPIIGEHGYHKIARNIKQ (?) 271664 
271628 (0) YQGFIEEEVASQIKEYDGESEPDNFVHAYMQQMKQTGNPGLEF (2) 
271445 MPNLCASVLDFWLAGMETTSNSLRWHLAYMMKYPEIQDNVRKEIFEVVGASRLPSMSDKPNMP 271257
271256 YTQSVIHEVQRHSNMIPMLGSHT (1) 271191
271143 NTEDIIVKGQNVPTGTVIFAQVWSILKNDSVFDESHKFNPSRYLQADGKTLNK (0) 270985
270937 AVLERTIPFSIGKRNCVGEGLARMELFLIFSALIQKYEFVPN 270812
270811 DNVDLTPVWGGVLTSKPYTCQLIPQAV* 270728

>CYP14A.e pseudogene cb25.fpc0106
253655 KVDMFWPIQLCVGNQ 
       INESLFGYHHKY
       CDADRFKTFVQDLDRHLRLIQARLPLLMGAFPWL 253479
253478 RQVPIIGELGYHKIERNVKQ 253419
253372 YHKFIEEEVTSQMKEYDGESEPDNFVHA*QHIKQTGNPGXXXXX 253256
253200 NLCASVLDFWLAGMETTSNSLRWHLAYMMKYPEIQDNXXXXXXX 
       VVGTSRLP*MSDKPNMPYTQSVIHEVQRQSDMIPLLGTHK
       XXXXXXXXXXXXXXXXXXXXX
252852 QIWSIMNDDSVFEENHKFNPSRYLQADGKMLNK 252754
252712 ALLERTIPFSIGKRNCVGEGLARMELFLIFSAVIQTYAFIPNSNIDLSPDWGAVLTSKP 252530
252529 YTYQLIPQTLYYFVK* 252484

>CYP14A.f pseudogene cb25.fpc0106
275213 MSVLIIAFLVFIIAYIAHFYWKVSKYPKEPFPLPFIGNFLQ (0) 275091
       XXXXXXXXXXXXXX
275020 KMYGLCFTLWAPLPAIVITHYDYLKDAFVTQ (1) 274928
274860 GDAFITRINRPPETLPQAHNNTGVLVSSRENWRLQRRTSLKILRDFGLSRNLMEEQVMRS 274681
274680 VHEMLQQIENINDKKKVDMFWPIRLCVGNVINESLFGYHYKYDDADRFKNFVQIADRHLR 274501
274500 AALGKLQLLMTAFPWLRHVPIIRELGYHKIGTXXXX (0?)
       YQGFIEKEVANQIKEYDGESEPENFVHAYXX
       QMKQTGNPGLE (2?) 274228
       XMPNLCS
274172 SVLDFWLAGMETTSNSLLWHIAYMM*YPEIQDKVREKIFEVVGTSRLPSMSDKPNMPYTQ 273993
273992 AVIHEVQRHSNMIPVMLFHT (1?) 273933
273882 XXEDVVVKGQNVPTGTLVFGQIWSIMKNDSMFDESQKFNPSRYLQADGKTLNN (0) 273730
273682 AVIEKKIPFGIGKKACAGEGLARMELFLIFSAFIQKYEFIANSNIDL 273542
273541 SPDWGGVLTSKSYTCQLIPQTV* 273473

>CYP14A.g cb25.fpc0106 77% to 14A4
278391 MSLLIISFVLITVVYIINFYWEVRKYPKGPFPLPLIGNIHQ (0) 
278209 IPDDKLEVWFDDLSKTYGPIFTVWSPLPCVVITDYAHIKDAFVTQ (1) 278075
277628 GETYTYRAHRPPESLLQPHDNTGILNSSGENWRLQRRTSLKILRDFGMGRNLMEEQIVKS 277449
277448 IQEMMEQLAKSMDKKKAEIFWPIQLCVGNVINEFLFGFHYKYDECERFKKFVNVVDYHLR 277269
277268 ILLGKCSLSVSAFPWLRHVPIIGELGYHRIKRNIKT (0)
277115 YQSFIEEEVEKQLEKFDTESEPENFVHAYLQQMKQTGHPGLD (2) 276990
276932 MKNLCACVLDFWLAGMETTSNALRWHIAYMMKHPVIQENVRKEILDVVGTSRLPS 276768
276767 MSDKPKMPYTQAVIHEVQRHSNMVPFLGTHQ (1) 276675
276624 SVQETEILGKKIPAGTNVIAQTWSVMKNDPIFVNHLEFNPSRYLLADGKTFDK (0) 276466
276420 VVLERTIPFSVGKRSCVGEGLARMELFLIFTALIQKYEFIANGPVDMSYNAGAV 276259
276258 LTIKPYTCEMRKVF* 276214

>CYP33C.a cb25.fpc0023 minus strand 4 exons 
688955 MIFILVLLSTLLLIYLFHLLYWKRRNLPPGPTPLPKFGNWLSMVFPLSGYECFRRWTKKYGDVYTFWL (1) 688752
688326 ESEPYIIIGSYERMKETFIRDGDTYVNKKFNEVIASFRDGQYGVVDTNGEFWSTHRRFTLSNF 688138
688137 RDLGFGKDLMQQKILIEVQEIIRKFDENVGEEQNVPKVFNKAVANVINQLIFGNRFDDEK 687958
687957 EKEFQKLMDLLEYQQKAFTSWKIIVECVVPFLSRFMPKPTVADL (2) 687826
687783 IEEYKTSFYGFFNRQIEEHRLKIDFDSEENESYAESYLKEQRKREADGDKETFSTQQLSNMC 687598
687597 MDLWLAGLGTTTLTLGWSMAYVMNTPGVQEKMHEELDRVIGSDRLISTSDKNDLPYMQAV 687418
687417 INECQRCANIVPINLFHETTRDTVIAGYPIEKGTGVIAQISTVMLDETIFPDPYKFNPDR 687238
687237 FIDEHGKLKKVEELCPFSVGKRQCLGEGLARMELFLMLANFFHRYE (0) 687100
687052 ISPSSTGPPSIDKTQALRVTPREFDAVLTKRH* 686954

>CYP33C.b cb25.fpc0023 4 exons
723577 MILLLLFTTLSLWLFHELYWKRRNYPNGPLPLPVIGNMVPIMKAKPGYEAFRQWTK 723744
723745 EFGDVFTFWL (1) 723774
724349 GTKPYIVVSSYKRLKETFILDGDTYADKAYQP 724444
724445 FQEQFRGGQYGVIDTNGHVWSTHRRFALTTFRDFGLGKDLMQQKILIEVDEIFRKFDENI 724624
724625 GKEQEIPGVFYNAGANVINQLIFGYRFDEEKQEELKKLKALMEFQETAFTTFKVQVQFFA 724804
724805 PIVGRMLPGKSVEEL (2) 724849
724904 LAEFTVDFYKFFDHQIEEHRSKIDFDSEENLDYAEA 725009
725010 YLKEQKKKESEGDMELFGNRQLSNMCFDLWVAGLSTTHTTLSWIIAYVLNHSEVQKTMQI 725189
725190 ELDEVIGSDRLISTGDKNNLPFMNAVINESQRCANIVPLNQIHCVSKDTMINGVLVKKGT 725369
725370 GIIPQISTVLLDETTFPDPYKFNPERFIDEHGKLKKVEELCAFSVGKRQCLGEGLARMEM 725549
725550 FLFISNFFNRYQ (0) 725585
725633 VTPGSSGPPSLEKETMFNATPRKIRAVLTKRYL* 725734

>CYP33C.c cb25.fpc0023 possible pseudogene
723082 MIFLLLFTTFGSWLFHELYWKRRTLPPGPTPLPLFGNILALSAEKPGYEAFRK 722924
722923 WTKVYGDVFTFWM (1) 722885
722211 GTKPYIIISSYSRLKETFIRDGETYMNKVQLHFQEFIRDGYYGV (Frameshift) 722080
722078 IAETNGEFWSTHRRFALSTLRNFGMGRDLIQEKILIEVEDMFKKLDEDIEKEQEINPVFN 721899
721898 NAVANINNQLIFGYRFEKEKLKELEK*TELMEYQEKFFTTFRTNFQIFVPQLAWLIPGKT 721719
721718 LEEGLVDWKTDFFDFFHKQIKAHREKIDLDSDESQDYAEAYLKEQKRRIKDGDKETFSDK 721539
721538 QLSNMCLDLWFAGLSTTSITLTWTITYILHNPDVQKKLHEELDRVVGNNRLISTSDKPEL 721359
721358 QYMNAVINESHQCVNLVPVNLFHCTSRDTVLNGYQVPKDTGVIAQISTVMLDEEVFPDPY 721179
721178 KFNPDRFIDENGKLKKVEVLCPFSVGKRQCLGEGLASMELFLLVANFVNRYK (0) 721023
720979 IKPYVHGLPSLDKSKNVTVVPRKVVAKLIRRHVQIDGLFVKNYFE* 720842

>CYP34A.a cb25.fpc0023
1168376 MLFLLIFVTTLAIWTVYLWRATQRLPK (1) 1168456
1168506 GPFPLPLIGNFHQLAYTCWKAGGTVAGFHEFKKQYGKVFTIWLGPQPTVHITDIEIAQET 1168685
1168686 HVKRANVFGHRYSNGGTDYIREGRGIVASNGEFWQEHRRFALKTLRDFGLGRNLMEEKIMEEYRYR (2) 1168883
1168934 FQDFKKTNFKNGGIEVHSDSCFNLLVGSIINTLLVSERFEQNDADFEKLLETGTVALE 1169107
1169108 KMSVLDSFVPLWLMKSRAWQWRTKKVFGPFEFVHGLVERKIQQR (2)
1169417 RVKEIESGEHTMSETGEDFVDAFLIKMEKDKKDGVKDSTFT (2) 1169539
1169589 LENLAIDLYDLWLAGQETTSTTMVWACACLLNHPEVVGELKRELVGVTGGTRALSLTDKP 1169768
1169769 NTPFLNATIN (0) 1169798
1169844 EVQRIASILNSNLFRQLEEDTVIDGQPVSAGALVT 1169948
1169949 VQLSALHTDEAVFKNHTKFDPKSLMKNRNLEKNLIPFGIGKRSCPGESLARAELYL (0) 1170116
1170246 ITGNLILDFDLEPVGPAPEIKTTAPFGLMKRPPSYDIRFVPIEK* 1170380
 
>CYP35B.a cb25.fpc0023 5 exons plus strand
1165597 MIFILLLTTFLAILIVRQYQKAKKFPPGPTSLPFIGNIHQLIYYCWKHKGVVPAFDYFRQ (0) 1165776
1165823 YGDVFTLWLGPIPHVSICDYETSQEVFVKNGNKYKDRFLPPIFEHVS (1) 1165963
1166015 ENLGLVSANGESWAEMRRFALGAFRTMGVGRDLMEERILAELDAR (2) 1166149
1166196 CAKIDADAVNGKTIVHTTEFFDLTVGSVINSVLIGKRFDSHNKDEFLKLKGLIDSAADL 1166372
1166373 FTIFDLTVPIWLLKKLCPERYAKIVESQVEIINFVSREANERYEKVKSGEFTINSEDPQD 1166552
1166553 FVEAYLAKMEQEKEKGTTNLYTMECLKHVIGDLWLAGQDTTATTLVSGFNQFVNHPEVVK 1166732
1166733 KCREELMKLTDNGSRPLSLKDRAESHYLNATIAEIQRHASILNVNFWRYNHEATTIKGYP 1166912
1166913 VDSGSVITAQLGALHVNNDIFKNAEKFYPERFIEDPKLLNQVIPFGIGKRSCVGENIARSEIYL (0) 1167104
1167154 MIGNLLLRYDIKPFGDVPSTEDKLPYSAGKLPDKTVKLEFCKL* 1167285

>CYP35A.b cb25.fpc0023
1162983 MFFILVISFVLTWLVVRQYQKVSRLPPGPVSLPLIGNLPQIVYYLWSTGSVVSTLDLFRK (0) 1163162
1163209 RYGNIFTLWVGPIPHVSIADYETAHEVFVKNGNKYADKFHAPLFQEIK (1) 1163352
1163396 NDRGVVVTNGDHWQELRRFALQTLRNMGVGKDVMELKIVEELNAR (2) 1163521
1163607 CADIDEAAVNGVTTTQASEFFDLTVGSIINNILFGKRFDKNTKGEFLKIKNALDSAFEL 1163786
1163787 FTPFDMTVPIWVLKTFFSKRYNNLITMTDETTSFVAKEAETR (2)
1163953 YAQTKSGQYFIDENNIQDYTDAFLLKIQKDGENKDFN (2) 
1164109 IETLKTMIIDLWITGQETTTTTLISGFNQLLLHPEVMEKARAELMNITENESRDLSLSDRPKTPYLN 1164309
1164310 AMIAEIQRHASILNINFWRINHEPTYMGGHMVDSGTFVTAQLSALHINETVFENPQKFDP 1164489
1164490 ERFIRDESLLQKVIPFGVGKRACLGESLARSELYL (0)
1164643 IFGNLLLRYNFKPHGKLSTVEVLPYSFVKRPFKLEMQFVKI* 1164768

>CYP35A.c cb25.fpc0023 
1184170 MFLILLVSVFLAWLVVRQYQKVSRLPPGPVSLPLIGNLPQIVYYLWSTGGIVPTFDLFRK (0) 1184349
1184393 RYGNIFTLWLGPIPYVSIADYDTAHEVFVKNSNKYADKFIAPLFQAIR (1) 
1184585 NDKGVAGTNGEHWQEMKRFVLQTFRNMGVGKDVMELKIIEELDAR (2) 1184710
1184807 CADIDKAAVNGVTITQASDFFDLTVGSIINNILVGRRFDEDNKEEFFKVKHSADSAIEI 1184983
1184984 VSLFDMMLPVWVLKTFFKAHYDTVINSNEETRDFVGKEAEIR (2) 
1185152 DNQIKSGKYSIDENNVKDYTDAFLLKIQKDGENKDFN (2)
1185318 IETLKTMIVDLWTTGQETTTTTLISGFNQLLLHPEVMHKARSELMEITENGSRNLSLTDRPKT 1185496
1185497 PYLNAMIGEIQRLASILNINFWRINHEPTYMGGHMVDSGALVAAQLSALHINETVFENPE 1185676
1185677 KFDPERYIRDEPLLQKIIPFGVGKRACLGESLARAELYL (0) 1185793
1185842 IFGNLLLRYNFKPHGKLSTADVFPYSFAKRPFKLEMQFVKIRS* 1185973