Results from RNAi experiments on 86% of C. elegans genes.  <p>

P450 Genes

 

CYP22 = the daf-9 gene important in development, probable sterol hydroxylase

CYP13A8 had 10% embryonic lethality, clear and sluggish

CYP13A4 and CYP42 are uncoordinated

 

CYP13A1  T10B9.8  chr II

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP13A2  T10B9.7  chr II

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP13A3  T10B9.5  chr II

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP13A4  T10B9.1  chr II

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes Unc (uncoordinated)

 

CYP13A5  T10B9.2  chr II

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP13A6  T10B9.3  chr II

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP13A7  T10B9.10  chr II

No RNAi experiment

 

CYP13A8  T10B9.4  chr II

Maternal Phenotype Normal

Embryonic Lethality Lethal : 10%

Other Phenotypes Clr (clear) Slu (SLUggish)

 

CYP13A9P  T10B9.6  chr II

No RNAi experiment

 

CYP13A10  ZK1320.4  chr II

No RNAi experiment

 

CYP13A11  F14F7.2  chr III

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP13A12  F14F7.3  chr III

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP13B1 F02C12.5 chr X

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP13B2 K06G5.2 chr X

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP14A1 K09A11.2 chr X

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP14A2 K09A11.3 chr X

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP14A3 K09A11.4 chr X

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP14A4 R04D3.1 chr X

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP14A5  F08F3.7 chr V (make correction to F09F3.7 in page)

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP22 T13C5.1 chr X

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

daf-9 mutant This gene may be in the pathway to synthesize a ligand for DAF-12

a nuclear receptor.  Daf-9 has a role in larval development.

DAF comes from abnormal DAuer Formation

 

CYP23  B0304.3  chr II

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP25A1  C36A4.1  chr III

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology; DIC phenotype -- Embryonic development normal)

DIC Phenotype refers to

Nomarski Differential Interference Contrast (DIC) microscopy

 

CYP25A2  C36A4.2  chr III

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP25A3  C36A4.3  chr III

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP25A4  C36A4.6  chr III

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology; DIC phenotype -- Embryonic development normal)

Remarks This RNAi has multiple targets in the genome, see also RNAi: TH:322H7_2 CYP25A5

DIC Phenotype refers to

Nomarski Differential Interference Contrast (DIC) microscopy

 

CYP25A5  F42A6.4  chr IV

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology; DIC phenotype -- Embryonic development normal)

Remarks This RNAi has multiple targets in the genome, see also RNAi: TH:322H7_1 CYP25A5

DIC Phenotype refers to

Nomarski Differential Interference Contrast (DIC) microscopy

 

CYP25A6P  K06B9.1  chr IV

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP29A1 C44C10.2 chr X

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP29A2 T19B10.1 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP29A3  Y38C9B.1  chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

Small differences to CYP29A3 plus one extra exon (blue) probably an assembly error

MSLILPCLLI ILLLFIVSFW KIMKNILKYR KYDDLLPGPP AHPIFGNTKT FSNKTTEEIF QALRDLFSEA VEKGQSLIRH

RILGTFYVWP LDGKTVSCLT DFFSFPEVVV FWELAVLSIT FLRCGFLQKP IIIDFLIFCS LNRYYNNSDD FFKVFFFQKI

LESTTELDKG GPYEFFNDWL GGGTLLEGYG ERWRSHRKML TPTFHFAKLE GYFEVFNTES RVVVDCLDKF AKSGETVDLF

PFFKRCTLDT ICKTAMGAKV DAQLQNSHPY ITAIEQALQL GVLYAMNPHH QIPAIYWALG HQKKKDEYFN IMKTFTRNVI

AERRTARESG EVEKETSKRN MNFLDILLSN EESSVLSPED LRQEVDTFMF AGHDTTTTSV SWVCWNLAHH PDIQQNVYEE

IVSVFGEDPN EDVTTEGIKK LEYTERMLKE SKRICPTVPA VLRQLISDME IGGVLIPAGA NVAIAPMAIH KNANIYQNPD

IFDPDRFLPE ETAKRHAYDF IPFSAGLRNC IGQKFAQLNE KVMVIHLLKN FKIEPMGGYY STKQVFEPVG KPSNGIPVRL VRRL

 

CYP29A4 B0331.1 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP31A1P  C01F6.3  chr IV

No RNAi experiment

Sequence given in Wormbase (below) is not the correct gene assembly

MGVIILAVLL ASATVIAWLL YKHLRMRQAL KHLNQPRSYP IIGHGLITKP DPEGFMNQVI GMGYLYPDPR MCLLWIGPFP

CLMLYSGDLV EAIFSSTKHL NRILVQKLCC LGADERVDVL SVIALCTLDI ICETSMGIAI GAQLAENNEY VWAVHTINKL

ISKRTNNPLM WNSFIYNLYG SFIINKENDY KMEGRLAFLD LLLEMVNSGQ MDETDVQAEG NTFMLEGHDT TSTGLMWAVH

LLGNHPDVQR KVQAELDEVM GDDEDVTIEH LSRMKYLECA LKEALRLFPS VLIITRELSD DQVIGGFNIP KGVTFLLNLY

LVHRDPAQWK DPDVFDPDRF HPENSIGRKS FAFIPFSAGS RNCIGQRFAL MEEKVIMAHL LRNFNIKAVE LMHEVRPKME IIVRPVTPIH MKLTRRRPIA SP

 

CYP31A2  H02I12.8  chr IV

No RNAi experiment

 

CYP31A3  Y17G9B.3  chr IV

No RNAi experiment

 

CYP31A4P Note this detritus exon is inside an intron of CYP31A3

 

CYP31A5P  Y62E10A.15  chr IV

No RNAi experiment

A new CYP pseudogene not named before

MGVIIPAVLLASATVIAWLIYKHLRMRQVLKHLNQPRSYPIVGHGLITKPDPEGFMNQVI 60

GMGYLYPDPRMCLLWIGPFPCLMLYSADLVEPIFSSTKHLNKGFAYVLLEPWLGISILTS 120

QKEQWRPKRKLLTPTFHYDILKDFLPIFNEQSKILIQKLCCLGVADEEVDVLSVITLCTL 180

DIICETSMGKAIGAQLAENNEYVWAVHTINKLISKRTNNPLMWNSFIYNLTEDGRTHEKC 240

LHILHDFTKK up to aa 250

gap

VRPKMEIIVRPVTPIHMKLTRRRPIVSP C-term fragment

 

CYP32 C26F1.2 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP33A1  C12D5.7 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP33B1 C25E10.2 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP33C1  C45H4.2  chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP33C2  C45H4.17  chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP33C3  F41B5.4 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP33C4  F44C8.1  chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP33C5  F41B5.3 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP33C6  F41B5.7 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP33C7  F41B5.2 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP33C8  R08F11.3 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP33C9  C50H11.15 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP33C10P  F41B5.5 N-term part  chr V

No RNAi experiment

 

CYP33C11 Y49C4A.9 chr V

No RNAi experiment

 

CYP33C12P  F41B5.5 middle part  of gene chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

From 134-332 of CYP33C like genes, not named before

Note: F41B5.5 is shown in wormbase as including F41B5.6 inside it.

This seems unlikely, so I have it as two different pseudogenes

  ARLAEWKK NFMGFFDSQI KHHKQKFDYD CEENQDSAEA YLKEQRRQED QGELELFSDK QLSNTCTDLW

IAGLSITNST LSWAICYLMN PPGVQEQIHA ELDNENIV

 

CYP33D1 K05D4.4 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP33D3 Y17D7A.4 chr V some small differences

No RNAi experiment

 

CYP33E1  C49C8.4  chr IV

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP33E2  F42A9.5  chr IV

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP33E3P F42A9.4  chr IV

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

9483    MILALSLALLFLYLFHFIYWKRRNLPPG

9610    GPAPLPFVGNLLMLTEKVKPGYKLWDSLT

9743    QQYGSVFTFWMAGLPMVFVTDWKLIKQYFIKDGGSYVGRPEFPLNTEVK

9928    QIPEGPYGIIDAHGNRWIQQRRFALHVLRDFGLGKNIMEEKILTEVTVMIERLRKTIACV

        DMQNVFDTSIGSIINSLIFGYRFDESEFGWKFEKSRRACSIFNWKTTVSRRRTCQNGIIS

        VFCKLVQYIRYSTS 10330

 

CYP34A1 T10H4.10 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP34A2 T10H4.11 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP34A3 C41G6.1 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP34A4  T09H2.1 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP34A5  B0213.10 chr V

No RNAi experiment

 

CYP34A6  B0213.11 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP34A7  B0213.12 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP34A8  B0213.14 chr V

No RNAi experiment

 

CYP34A9  B0213.15 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP34A10  B0213.16 chr V

No RNAi experiment

 

CYP35A1  C03G6.14 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP35A2  C03G6.15 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP35A3  K09D9.2 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP35A4  C49G7.8 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP35A5  K07C6.5 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP35B1  K07C6.4 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP35B2  K07C6.3 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP35B3  K07C6.2 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP35C1  C06B3.3 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP35D1 F14H3.10 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP35D2P not annotated at Wormbase

Lies between F14H3.7 and F14H3.8

14503   MILIALFFTIFTVITVRLYRKVLRFPPGPFPLPFIGNAHQIVYQAWSRGGTLPALDYYR 14561

14730   KNGNAYTLWLGPKAPVSLTDFETSQEVFVKQGKKCYNRQLAPILEHVTG 14762

14963   GVGLLTANGENWAEMRRFTLR 14933

 

CYP36A1  C34B7.3  chr I

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP37A1  F01D5.9  chr II

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP37B1 F28G4.1 chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP42 Y80D3A.5 Chr V

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes Unc (uncoordinated)

 

CYP43 E03E2.1 chr X

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)

 

CYP44  ZK177.5  chr II (only mitochondrial P450 in C. elegans)

Maternal Phenotype Normal

Embryonic Lethality Normal

Other Phenotypes WT (wild type morphology)