Candida albicans P450s

 

D. Nelson

 

August 7, 2009

 

>CYP51F1 Candida albicans X13296, orf19_922

MAIVETVIDGINYFLSLSVTQQISILLGVPFVYNLVWQYLYSLR

KDRAPLVFYWIPWFGSAASYGQQPYEFFESCRQKYGDVFSFMLLGKIMTVYLGPKGHE

FVFNAKLSDVSAEDAYKHLTTPVFGKGVIYDCPNSRLMEQKKFAKFALTTDSFKRYVP

KIREEILNYFVTDESFKLKEKTHGVANVMKTQPEITIFTASRSLFGDEMRRIFDRSFA

QLYSDLDKGFTPINFVFPNLPLPHYWRRDAAQKKISATYMKEIKSRRERGDIDPNRDL

IDSLLIHSTYKDGVKMTDQEIANLLIGILMGGQHTSASTSAWFLLHLGEKPHLQDVIY

QEVVELLKEKGGDLNDLTYEDLQKLPSVNNTIKETLRMHMPLHSIFRKVTNPLRIPET

NYIVPKGHYVLVSPGYAHTSERYFDNPEDFDPTRWDTAAAKANSVSFNSSDEVDYGFG

KVSKGVSSPYLPFGGGRHRCIGEQFAYVQLGTILTTFVYNLRWTIDGYKVPDPDYSSM

VVLPTEPAEIIWEKRETCMF

 

>CYP52A21 Candida albicans SC5314

putative P450 drug resistance protein

XM_705082, orf19_10

MLEEISFESWYLYLIICGVLYFCTNYLYIQYLNKKLGAKSPGSC

KSDGCFGFRSGFEMLKAKKIGRQVDLLHERFNDLSNPEVNDTFTSYNFGFPMIITKDP

ENIKALLATQFNDFSLGRRYDFFKPLLGKGIFTLDGEGWKHSRSMLRPQFAREQIAHV

KALEPHFQLLKKHITKNKGQFFDIQELFFRFTVDSATEFLFGESVSSLKDESIGYNQD

EFDFAGRKDFPEAFNKSQIYLSTRSLLQNLYWLVNPKDFQNCNAIVHKFSDYYVNKAL

NATPEELEKNSGYVFLYELVKQTRDPQVLRDQALNILLAGRDTTAGLLSFAVFELARN

PQVWKKLREEIIERYADGATEISFETLKQCEYLKAVINETLRLYPSVPRNGRFANKNT

TLPRGGGPDGMSPILIKQGQAVMYSIYSTQRDPKYYGKDADVFRPERWFEPETRKLGW

AFLPFNGGPRICLGQQFALTEASYVLVRLAQCCENLQLTEGIEYPPAKLTHLTMCMFD

GVPIKVD

 

>CYP52A22 Candida albicans SC5314

79% to CYP52A4 orf19_7512

MSPSLVHQILAITHPYVEYLEENITKWYILVPGILIVLNVLTTLHTKYLEYKFNAKPVTNFIQDYTFGVITPLILIYYKS

QGTVMEFANNFWNFKFLIKNPDVGTGELRIFGMHLIETKDPENIKAVLATQFNDFSLGTRHGFLYSLLGDGIFTLDGAGW

KHSRSMLRPQFAREQIAHVKILEPHMQVFFKHIRKNKGKTFDIQELFFRLTVDSSTEFLFGSSVESLRDETIGMSPSVKN

LAGRDEFADAFNYSQTINAYRFLLQQFYWLCNGTKFRKSIAAVHKFSDFYVQKALSLSQDELDEQKGYVFLYELAKQTRD

PKVLRDQLLNILVAGRDTTAGLLSFVFFELARNPEVYAKLKEEIYNKFGSGEDARIDEITFESLKQCEYLKAVINESLRL

YPSVPHNFRTATRNTTLPRGGGPDGMSPIVVKKGQSVMYTVLVTHRDTKTYGADANEFRPERWFEPETRKLGWAYVPFNG

GPRICLGQQFALTEASYVTVRLLQEFEHLTMDAETRYPPKLMNSLTLSLLDGANVEMY

 

>CYP52A23 Candida albicans SC5314

78% to CYP52A5 orf19_7513

MSVSDIVQEYITKWYVVIPTLFVVYQVVDFFYVRSLRSRLGAKAPTNNESDGYWGFHLPFLLVSKKAEGTIIDFAGERFK

SIAHPEVPTFQFPIFTVKVISTVDPENIKAVLATQFNDFSLGTRHNQFAPLLGDGIFTLDGAGWKHSRSMLRPQFAREQV

AHVKALEPHMQVLFKHIRKSGGRTFDLQELFFRFTVDSATEFLFGESVESLRDESIGMALEAVDFDGKKEFAEAFNFSQN

YLASRAVMQQMYWLLNSSEFKSCNSKVHKFAEYYVNKALELSHEELEKQQGYVFLYELAKQTRDTKVLRDQLLNILVAGR

DTTAGLLSFVFFELARNPRVFAKLREEVEEKFGVGEDARVEEISFESLKSCEYLKAVLNECLRLYPSVPQNFRVATKNTT

LPRGGGSDGMSPILVRKGQTVMYSVYVTHRDTKVYGKDADEFRPERWFEPETRKLGWSFVPFNGGPRICLGQQFALTEAS

YVTVRLLQEFGHLTMDPNTDYPPKKMSHLTMSLYDGTNVEMY

 

>CYP52A24 Candida albicans SC5314

78% to CYP52A3 orf19_5728 partial sequence

MSSTTFNDIIDSVLPYLTKWYTILIGAGLIFVLSTNLKNAYYSYKLGCKNPVHLKRAGWTGIPALIDAIKAKNSGKLAEF

GGDTFDELNSKNFYLNVAGVLKIIFTIEPENIKAVLATQFNDFSLGTRHAHFYPLLGDGIFTLDGEGWKHSRAMLRPQFA

REQIAHVKSLEPHIQILAKQIKLNKGETFDLQELFFRFTVDTATEFLFGESVHSLYDDKLGIPPPNDIPGRDNFATAFNT

SQHYLATRSYSQTFYWLTNNKEFRDCNAKVHHLAKYFVDKALNSTEKEIEEKSQGGYVFLYELVKQTKNPKVLQDQLLNI

MVAGRDTTAGLLSFAMFELARNPKVWNKLREELEANYGVGEEARVEDITFENLKKM

 

>CYP52C3 Candida albicans SC5314

60% to CYP52C2 orf19_6574

MLILLPIAVIAASIYYIAEYWKRESIKRKYDCQPVKQAPLVTWYDIFGIKALVDNSNLTKSGYFYQDIQRKLDNLDTTTM

KTTALGKNQIITIEPENFRTMCSSADLNNWTIGTRPIALKPLLGNGIFSSEGESWKHSRIMLRPIFAKEHIKQITAMESY

IQSLIKVIKLQQQGEGEFDLQHLFHCFTIDYATDFLFGESCDCLKSILGETSISTMSEEEKSKFAPNFDVMQYHMTKRLV

FGYFSFLVNPPEFKNAVKHLHEFVFHFVDRAINFTDEELNDPSKNYVFLYQLAKQTKDRKVILDELLSVLLAGRNTTASL

LSFMFFELAQNKPVWNKLKKEITEHFPDVESITFETIHNCEYLRWCIHESLRINPPVPINTRTANRDTVLPKGGGKGNNY

PIFVRKGEQVIFPLFSSNRQERFFGPEPEKYIPERWANLPRNGGVAFGPFGTGPRLCLGQQLALVEASYVTIRLLQTFSQ

LDSNHTECRRSVGATMRLMDGCQVTLK

>CYP56E2 Candida albicans SC5314

AACQ01000054.1 chromosome R Ctg19-20053, whole genome

45% to CYP56A1 missing N-term runs off the end of the contig

whole seq on orf19_554

MFQLLKYIFIGGFTYLLYLILEIVFPPFNFPRNIPTIPFYVSFLGACTNLDQE

DIYKLYLREKLEKYGAVKMYFASRWNILITKP

151305  DFLLEMFKNEDVFAKSGNHVKIPNSVLATYTGDNIISAHGELWKLYRDVVAQSIQFPDLK  151126

151125  PISKNTQKLLRFLDNEMGSANQATISVTDILQKYSLANVCESVLGVNFNVLDDKQSLMHE  150946

150945  KIKYVKSQIFNPIFLNFPYFDNFPIPSRLKARREVIGFRKWYGQSLIEKYNLQLPN  150778

150777  SAATKLVDSLIKEKLTEKQFLDNAIILMIAGHENPLLLMLSLLYVVSKYPQVQELIRNE  150601

150600  TETTKPYLHSVIYETLRMYPPLGLIINRCTTRITKLGNIVIPKNVYCGYNN  150448

150447  FGTGRDRNVWGSDADIFKPERWGLEIDEINKKFTLAKRSAELPAFHGRKRACLGEKYALF  150268

150267  EVKQFLLAILGEYKVSLDPNWKEQLTPAGPISPLRLKLNFEKLTVS*  150127

 

>CYP61A2 C.albicans AL033396 comp(39932..41485) gene="Ca35A5.10c" 68.9% identical to 61A1

orf19_5178

MNSTEVDNLPFQQQLTSFVELAVAKATGSPITTLFTIIFLILSY

DQLSYQINKGSIAGPRFKFYPIIGPFLESLDPKFEEYKAKWDSGELSCVSIFHKFVVI

ASSRDLARKILSSPKYVKPCVVDVAIKILRPTNWVFLDGKQHTDYRRSLNGLFSSKAL

EIYIPVQEKYMDIYLERFCKYDGPREFFPEFRELLCALSLRTFCGDYITEDQIALVAD

NYYRVTAALELVNFPIIIPYTKTWYGKKIADDTMKIFENCAAMAKKHINENNGTPKCV

MDEWIHLMKEAREKHSEDPDSKLLVREFSNREISEAIFTFLFASQDASSSLACWLFQI

VADRPDIVAKIREEQLRVRNNNPDVRLSLDLINEMTYTNNVVKESLRYRPPVLMVPYV

VKKSFPVTESYTAPKGAMIIPTLYPALHDPEVYDEPDSFIPERWENASGDMYKRNWLV

FGTGPHVCLGKNYVLMLFTGMLGKFVMNSDMIHHKTDLSEEIKVFATIFPKDDLILEW

KKRDPLKSL

 

>CYP501A1v1   Candida albicans

             GenEMBL XM_706447, orf19_1411

             allele of CaO19.8987 XM_706426.1 (5 aa diffs)

             best hits are to CYP504, but only low 30% range

             in CYP64 clan

             putative phenylacetate hydroxylase

MLSSIRWDEALLILLNYLNDYPVTITCFLVLLIIALGIAIDYII

TPKEIANIFPIPGELPFIGHLHLILENPALIYLTWSKLYNQSIFQIRIGNKRVVVVNS

FDDVVGLWVNHSCQNNSRPLSYTFHDLVSAIQGFTIGSTPASLTFQKKKKTISQYLNK

RQIELKSDTINRQINIMIGELWKRDIEFEDINLLPYFQKFVLQTAIFIGYGIELDCYK

EHSQFCQEIIDIENKIIRLRSPISNLQDSIPLLRIMPRWFNNSEIARMCGERRNSYMN

KLYQQLQQGLAEDLPQYKNSILGDLITKTTNTQNNNDDSSDTNCTSHNNCLNEQEIQS

ICLTLISAGLDNTPLSLNYLFGILSHPKIGEHLQNRAIQDILEDSGGNIVLAWEKVSS

LQGQMTTNQQNPMNCQYIEALVLETLRHFTVLPLSLPRLTTKAIRYKDFVIPKETHLF

MNAYSANHDCQIFVNPYKFDPDRWLDPVSNSIKSQFLNFIINNNSKSSSGHGHQFKSL

HSHQHFAFGAGSRMCSGYNLVIKQMYVMIIKMLLIFEIHPPTNIKKLMELNPFKNNSN

PKGTSFEPKTNHINLKFRKLPNYKSLHELVLHQS

 

>CYP501A1v2   Candida albicans

             GenEMBL XM_706426.1

             allele of CaO19.1411 XM_706447 (5 aa diffs)

             Gene sequence has no introns AACQ01000193.1, AACQ01000194.1

             best hits are to CYP504, but only low 30% range

             in CYP64 clan

             putative phenylacetate hydroxylase

MLSSIRWDEALLILLNYLNDYPVTITCFLVLLIIALGIAIDYII

TPKEIANIFPIPGELPFIGHLHLILENPALIYLTWSKLYNQSIFQIRIGNKRVVVVNS

FDDVVGLWVNHSCQNNSRPLSYTFHDLVSAIQGFTIGSTPASLTFQKKKKTISQYLNK

RQIELKSDTINRQINIMIGELWKRDIEFEDINLLPYFQKFVLQTAIFIGYGIELDCYK

EHSQFCQEIIDIENKIIRLRSPISNLQDSIPLLRIMPRWFNNSEIARMCGERRNSYMN

KLYQQLQQGLAEDLPQYKNSILGDLITKTTNTQNNNDDSSDTNCTSHNNCLNEQEIQS

ICLTLISAGLDNTPLSLNYLFGILSHPKIGEHLQNRAIQDILEDSGGNIVLAWEKVSS

LQGQMTTNQQNPMNCQYIEALVLETLRHFTVLPLSLPRLTTKAIRYKDFVIPKETHLF

MNAYSANHDCQIFVNPYKFDPDRWLDPVSNSIKSQFLNFIINNNSKSSSGHGHQFKSL

HSHQHFAFGAGSRMCSGYNLVIKQMYVMIIKMLLIFEIHPPTNIKKLMELNPFKNNSN

PKGTSFEPKTNHINLKFRKLPNYKSLHELVLHQS

 

>CYP5217A1 Candida albicans SC5314

32% TO CYP537A1   N. crassa, orf19_3105

MLKEIAYTLYSYTVAHPVQTQVIVLVALLVYYLVVYPVTSPLWKVPGPYIHRISYIPCYNAQRNGTWIARVHELHKKYGS

VVLLSPNEVSVNGDPKFINDIYVKNFPKSKFYENFRNHGFKDNIFASLENDRHRKYKKLINNLYNKTAIFSKENHTRSVL

LETADKLVETVGKESPSIEVFTLFGALAMDVVSRFELGRTNGTNLLDGFADRRIIVSHREVSSMGFWTTLMPNFLWDYAA

TKTILQAADDICNFQLNLYKFAEKNLTSNGKNLTTLETLKKNGLEGEYAYSFLTDNLFAGHETTAVQLTYLCYELSRPAN

YKMQQKLREELNKAFPDGEIDLETVDNLPYLNALLTENGRVHTSIPGAEPRVVDKPYLVDNMVIPQGTIISCLPYSFHRT

EGVFPEPDKFLPERWIINSEQDKWRVKQQEKYMMPFGKGVRMCLGMNLAMIEMKIAIAKLYWHYSSTIDETWCRVLNDAK

PIKMGGGDDGTTDQDKMRMYDWYTTRPLYDECWLKWERL