19 Chlorella variabilis sequences from OSAMU GOTOHÕs FamAln analysis

July 17, 2014

 

 

>CYP51G1 Chlovari14.744 Chlovari14 - [1:3118]  ( 746066 - 742949 ) Chlarein2.2519 + 2:498  ( 1 - 498 ) N   2073.27

61% to CYP51G1 Asterochloris species

MELSALSEGLQALPLSLQLASGAAVIFLSLLILRVLSNAFPGAAPPVDEGLPFVGGLIKF

SKGPLPLMTEMYAKHGEAFTIPLLHKKMTFLLGPHVSPHFFNATDDKMSQTEVYNFNVPT

FGYGVVYDVDQRVRSEQFRFVADALRTAKLRTYVPAFKMEADDYFSKWGEEGVVDFMQAF

SDLIILTASRTLLGREIRESMFKEVADLYHDLDDGMRPISVLFPYLPTEFHRRRDVAREA

LRGIFKKVIKARRDSGVKEDDILQVLIDSRYRNVYSGRATTDDEIAGLLIALLFAGQHTS

SVTSSWTGYRMLSNPKWFAAAQEEQRRVVREHGDKLDMDVLNGMDTLHLNIQEALRMNPP

LIMVMRLAKESFPVTTSQGRTYVVPKGHIVAASPTFSHRLPHVFKQPDEYQPDRFLPPRE

EDKPLPFSYLGFGGGRHGCMGQNFAYLQIKTIWSVLLRNFEFELLDPVPEPNYTSMVIMP

KACRVRYRRKKLVA

 

>CYP97A43 Chlovari1.983 Chlovari1 - [1:4963]  ( 985418 - 980456 ) Chlarein2.8722 + 11:700  ( 1 - 700 ) N   1615.34

66% to CYP97A13 Volvox carteri

MRRAIAARRLGCLWPAVAAHAGPRLHTAATAKSDHTRCTQQKTCVLVGTRMCGSLQPLTS

LTAAAASCVQRIASGEFTDAGSTKERLTRPIRRALAKDPVGPGRALSMRLAKIGQRWQRN

AAERMPTATGDIREIVGQPVFVPLFKLYQIYGKVFKLSFGPKQFVIVSDPQLAKHILLHN

ANNYSKGLLSEILEFVMGQGLIPADGEVWKVRRRTILPALHKKYLAAMLDMFGDCALHGA

DMLAVSQRAGKAVEMENFFSRFGLDIIGKAVFNYDFDSLTHDDPVIQAVYTTLREAEYRS

TYPIAYWNFPPLRWLVPRQRRNDEALAVISDTLDELIAKCKKLIDSVIGDRKPSFEEVRQ

LRYCTRVVNEGMRMYPQPPVLIRRALGEDELGGYRVPAGSDIFISVWNLHRWAVRSWSVV

CVWVRAWCVVCGWGVGRVWAWWFSGRQVVGDQFALFEAITALAMLVRRFDFQRAADAPPV

EMTTGATIHTTNGLWLDVKPRQVPADEAEAAAVAAAAAAAAAAAAAAAAAGLVEQREMAL

AFSDAAFSDAANQQQQLNQQQA

 

>CYP97B37 Chlovari20.809 Chlovari20 - [1:5262]  ( 811554 - 806293 ) Chlovulg3.1200 + 5:662  ( 1 - 662 ) N   2375.61

68%to CYP97B36 Asterochloris species

MQALAAAPKLAMPGCRAPLPGRALALAPLRHHPQPRRVQRQRPQQQRLVATQAFLSTDTL

VGLAIFFSPSVAALIYAYIKGKGNLTDGLSRLLTDVSQGYFQPDVGGKNIPVAQGELSDL

AGDEPLFKALYKWFIESGGVFKLEFGPKAFIVISDPLVVRHLLKENYTNYDKGVLAEILE

PIMGKGLIPADLETWKVRRRAIVPGFHKAYLDACVAMFGRCTQHTVDKVEAALAAASPAP

DGSQGAAVLDMETEFLNLGLDIIGLGVFNYEFGSITSESPVIEAVYGVLKEAEHRSTFYI

PYWNLPLTKYLVPRQRQFNADLAVINECLNQLIEQAKSTREAGDIEALQARDYSKVKDAS

LLRFLVDMRDADLEAKQMRDDLMTMLIAGHETTAAVCTWTLFCVVQDERVEGKVLAEIDA

AVGDRVPTWDDFANLPYTRMTIAEAMRLYPQPPILIRRALGEDVLPAGLGGDPNGYPIGK

GADLFISLWNLHRSPHLWKDPDTFRPERFTERFVNAAFGGKWAGYTPGGEGSSLYPNEVS

SDFAFLPFGGGARKCIGDQFAVTEAALILVMLLRRFRFRLQDPQGVGMATGATIHTANGL

KCTVERRVAAATAAAEPALAN

 

>CYP97C31 Chlovari6.422 Chlovari6 + [1:4860]  ( 419623 - 424482 ) Astespec00146.377 + 6:618  ( 1 - 618 ) N   2192.25

71% to CYP97C30 Asterochloris species

MQAATAVSTAPVAGSRNGAFPAPSKRHAPPRRRLEARAATEEKEEYDLNQKIDTGKLIDA

AGAGRSMFSPGWLTQLNQLWGGKSNVPVANAKPEDIQDLLGGALFKALFKWMVESGPVYL

LPTGPISSFLVISDPECAKHVLRASDNPSRPIYEKGLVAEVSQFLFGEGFAITGGEQWRV

RRKAVGPALHRGYLEVMLDRVFGESALHLNKKLEVAAASGEPIDMEACFSQLTLDVIGKA

VFNYDFDALNNNTPVIQAVYTALKETETRATDLLPYWKYPLINLFVPRQRKAAAAVELIR

QTTEELIAKCKAMVDAEEAASFEEGYINDADPSVLRFLIASREEVGSQQLRDDLLSMLVA

GHETTGSVLTWTLDLLARNPEQMKKAQEEVDRVLAGKSKPNMEDYMALKYCMRCVNESMR

LYPHPPVLLRRAMVPDELPGGLTVPQGQDVMISVYNIHRSPAVWDRPDDFLPERFPLDGP

VPNEQNTDYKYIPFSGGPRKCVGDQFALMEAVVALAVMIREFDFAPQPGHDPGMTTGATI

HTKNGLYMTVAKRRPGGGSSCSGGAGAAAAAAAVGAA

 

>CYP710B1 Chlovari5.232 Chlovari5 + [1:3601]  ( 230637 - 234237 ) Chlarein11.42 + 5:533  ( 1 - 533 ) N   1812.55

57% to CYP710B1 Asterochloris species

MCRRLQGSGVATGLPLLDSLVGLGAGAGLSTSSLLLYASAATGAYAVWEQLRFHMARRRK

DGKLVPGPSRVTPFLGGLIEMVLDPYSFWERQKDAANVTSPGYSYNSLAGKMILTVTDAD

KCRELMAVNDASRMLMVLHPSGKTILGANNLAFMHGPEHKAIRKSFLCLFTRKALSTYTQ

LQDGIIRRHLAEWMKRPETREIRESVRDMNQATSQDVFLGPYLDDPQVRANFSRGYSAMT

DGFLAFPICLPGTTVWKAXXXXXXXXXXXXXXXXLKMAATRAREHIKAGGEPRCLMDFWA

QKCLEEIGEAEAEGLPPPSHTTVARMGDAMIDFLFASQDASTASLVWCLTLMADNPHMLA

RVREEQQRLRPDPSQTITAEVLGEMAYTRQVVKEILRYRAPAPMVPQMAYADYPLTEQYD

IPRGTLVFPSINAANMQGFPDAERFDPDRMGPERKEDIVHAKNFLTFGYGPHYCVGKEYA

INQLVLFLAITSLGADWTRTRTPDSDKMKYLPTIYPHDSLISLRPRAQ

 

>CYP745C2 Chlovari24.143 Chlovari24 + [1:3309]  ( 141946 - 145254 ) Chlarein5.207 + 10:576  ( 1 - 576 ) N   1712.35

55% to CYP745C1 Asterochloris species

53% to CYP745A1 Chlamydomonas reinhardtii

MELLQHLGLERRPEWLPEQVVLLGVPLLLASVMVAAARLTAAIIKGAARWLRVAWGCRGV

PAAPGGGLLGLGHTLQLALAPCPWEKMLEWARASGTLTRFNILQRTGLIVNDPEGAKRVF

QTRQRLYEKDLDFSYKPFLSILGTGLVTADGPHWQKQRLLMAPALRIDMLDAIIPITKNA

VDRLCKNLESFRGTGTPVNMEEEFRLLTLQIIGEAILSLPPDECDRVFPQLYLPVMEESN

RRVLEPWRQLYPLTAYQYNQRVSQLNKYIISIIRARRAAHAANSGKPPAKPDILDRVLAA

AEESGEKWTAASEVQLCYEIKTFLLAGHETSAAMLCWTMYELSQSKEALEKVRAEAAGVF

GGKRKSMPSREEVDGMEYTLATLKESLRKYSVVPVVTRNLVQEDELLGHKLPRGSWLIVH

LQGIHHQYNDPLAWRPERYMPGGEYDQFDESIRPYMFLPFIQGPRNCLGQYFALLENRVL

LSVLNQQFTFTPVNPKESGVTHPKVIPVAPLHGMKMYVS

 

>CYP746C1 Chlovari6.753 Chlovari6 - [1:5244]  ( 757062 - 751819 ) Micrrcc204.243 + 7:629  ( 1 - 629 ) N    994.59

46% to CYP746A1 Asterochloris species

MDRGRRSLAAEVLRRRGAPPAQPAGPRFTQLTLDGFLHQPASRPAAGAASSGGGTQDPPP

PPLEPAAPGPAAPQPAATPLEAARPLALPTPFSSLPAAAFGSAPLLFLPLLDRQSAPLAL

PRLSPDCALLTPFLVSVFPLAHLLPACPVPAALLPRCSPAVPACIRLPVRCRLLPGCGAP

WLAIAPCEAMLASTTRMLRASWRDGFCRDLYADFNSLTLAITLEALFGARMAAGEDAAGR

GITDAIREAFRFFAARGASALALPEWLPTPGNLRFAAAVARLDAAVLGLIAQRRRELAAA

PRPPGDLLDSLLLAADEAGQGMGDRAARDEAMTLLVAGQETSAIVLGWACAYLAHHPEAQ

AAAAAEVAARVGARPLQAADAGRLPWVEAVVLEAMRLSPPAYLVGRCAAEATNLGGYHLP

RGTTVLVSPHLLHRDPQHWGPDAAAFRPERWLELQRAQLEQGQPGTQQGVGGSQQPPAGC

PHAAAAGNGGSGGGGGVSGGGELGGSGMAFLTGMGPHGAYIPFGAGQRNCIGTGFAMLEA

VLVVASILQQYRLEPLPGAPFPAARPQITLRPDSVRLLLRRR

 

>CYP747A1 Chlovari16.769 Chlovari16 + [1:4186]  ( 767605 - 771790 ) Selamoel24.919 + 4:611  ( 1 - 611 ) N    921.65

100% to CYP747A1 Chlorella sp. NC64A EST GE267841.1, GE268359.1, GE268359.1

MLATTPSPASSLWQPTCRCLPAPAVRPRPQANGRGAKLRGSAAAGPAEGATASCPFAAAS

AALQGWQQGAAQQQEEGDGAMQTPGPSPFSLQSLMDVSLIFTEGLHEAMLRFSARYGPVS

RFANPSALNGAAGWVFLNSPGDIAHVCAANPKNYAERFLPDIYKFVTHEKGLLGSGGDYN

RRHRRLCGPPFRSGELLRKFGEVVVDRVSRVADTFVSQPGPFATNVAVQTQRLTLDVVGL

TAFSHDFGECQAIARDVGGRAQPSESDQDRLLWAVNAFGQVLGEVFITPMPLLRLMDAVG

LRQLRTLREAVGVMRSSMLGVIAERRQHLAAAAGSDGAGAAGGAAEAEAADLLDMLLQAT

DDNGVPMTDEELWEDVHDVMGAGHETTATTAAAAIYAISAHPEVEARLVQELESVLGGRP

ATYDDVQSGRLPYLEAVIKEVLRLYPAIPIFPRQAAEADTLPSGHRILKGDVVFMSTYAL

HRSPDVWEEPLRFDPDRFLGERGAALHRFQWLPFGSGPRMCLGAAFAQMSVSLMVATLLQ

RCRFTPLHPTTQLIPAAYDITLNFDRTNGLRMEVAPR

 

>CYP845A1 Chlovari7.680 Chlovari7 - [1:3282]  ( 681940 - 678659 ) Chlarein7.1611 + 8:608  ( 1 - 608 ) N    945.92

35% to CYP842A2 Asterochloris species

66% to Chlovari10.1487

66% to Chlovari10.1494

76% to Chlovari7.683

MLLFLFAVTLMAAAAATFVLCGGCRIGNSGNAIPSPFPFWSDLIIETRKRGFPDFVKLHA

QHGPLFYWRFLGPRKLFVGSFEAVKQVLHGEGDTVKAYYSRSTRKLLGPWGMVNISGKQH

ARVKRLAQAAFTPRAIRGYLPRMQTIAEQAVQKWAADGDILVYEEMKWFTFRIAVEIIVG

FDDGWTSPRQFPTISAEFKTWLEGLFSFPLPIPGTAFARGMKMRAALMRRIHASLDLLEE

RNAAAAAGSPGEASGHNGDAGSPAAEQRTTLDFLKSSRDENGNTLTREQIADTVLTLLFA

GHDTSSSSLTRIFHHLHNHPEAAERLRREQADVVAKHGSVITEAALHDMPYADGVVRETL

RITPIVVGFSRVALQDFELCGYTVPAGTGMTCSLAQPLLTDARWQGEEQPLAFKPERWLA

GAALKQGAWIPFGGGQRLCLGWLLAMTEMKVLLAAIFRGHAMELRQPDEPWVSFPLARPK

CSMPARFVAVKDAE

>CYP845A2 Chlovari7.683 Chlovari7 - [1:3241]  ( 685162 - 681922 ) Chlarein7.1611 + 8:598  ( 1 - 598 ) N    964.41

33% to CYP842A2 Asterochloris species

MELCMVVAAALMAAAIGVVLLVGREASGGSATVPAPFPCWSEIIVYMGLTGRFPDVVQLH

AQHGPLFWWRFLGRRMIMVGTVEAVKQLLNAEGSLVKADYPPSVHKLLGPWGTVNISGKH

HIRIKRLAQAAFTPRAIRGYLPRMQAIAEQAVQKWAADGDILVHEEMKWFTFRIAVETIV

GFDDGWTNANHFPTISEEFEIWLKGLFSIPLPIPGTAFARGMNMRAALMRRIHASLDLLE

ERNAAAAAAAGATGGNSGSGEGGKAATGRDEDAAGAEQPAALDLLMASRDEDGNRLTREQ

IADTVLTLLFAGHDTSSSSLTRIFHHLHNHPEAAERLRREQADVVAKHGSVITEAALHDM

PYADGVVRETLRITPIINATLRVALQDFELCGYNVQKGTSLQVSLTQPLLTDARWQGEEQ

PLAFKPERWLAGAALKQGAWIPFGGGQRLCLGWLLAMTEMKVLLAVIFRGHAVELRQPDE

PWVFFPIARPKRGMPARFVVVE

 

>CYP845A3a Chlovari10.1487 Chlovari10 + [1:3205]  ( 1485550 - 1488754 ) Chlarein7.1611 + 8:608  ( 1 - 608 ) N    976.86

33% to CYP842A2 Asterochloris species

MCGVPDWFVAAVLAAVALAAALLATRRCGIPSPMGPWYSDMMMPVLRTGRFPGCAPAAAY

LCCRSRSPGALLRLPLPATTAVPADMVKLHAQHGPLFWWSFLGRRMLMVGTLEAVTRVHL

GEGVIVRADYPTSVRKLLGPWGTLNTHGKAHIRIKRLAQPAFTPKAIRGYLPRMQAIAEQ

AVQKWAAEGDILVHQEMKWFTFRVVVETIVGCDDGWTSPENFPAVSSDFEVWVAGLFSIP

LAIPGTAFARGLKKRTALMRRIHASLDLAEAAGQHGPGAGGGRNPASHDDGGAAGAEQPS

ALDLLMRSRDEEGVGLTRDQIADTVLTLLFAGHDTSSSTLTRIFQHLHRHPEAVQRLRQE

QAEVVAKHGSPVTEAALQDMKYAEGVVRETMRITPIINATLRVALQDFELCGYTIKKGTA

LQCSLTQPIKTDSRWQDEDDVQAFKPERWLHGAAQKQGAWIPFGGGQRLCLGWLLAMTEM

KVLLASIFRRYALELRLPEEPWVEFPIARPKHGMPARFVATMDAS

 

>CYP845A3b Chlovari10.1494 Chlovari10 + [1:3205]  ( 1492420 - 1495624 ) Chlarein7.1611 + 8:608  ( 1 - 608 ) N    975.95

33% to CYP842A2 Asterochloris species

100% to Chlovari10.1487 duplicate sequence

67% to Chlovari7.683

70% to Chlovari7.680

MCGVPDWFVAAVLAAVALAAALLATRRCGIPSPMGPWYSDMMMPVLRTGRFPGCAPAAAY

LCCRSRSPGALLRLPLPATTAVPADMVKLHAQHGPLFWWSFLGRRMLMVGTLEAVTRVHL

GEGVIVRADYPTSVRKLLGPWGTLNTHGKAHIRIKRLAQPAFTPKAIRGYLPRMQAIAEQ

AVQKWAAEGDILVHQEMKWFTFRVVVETIVGCDDGWTSPENFPAVSSDFEVWVAGLFSIP

LAIPGTAFARGLKKRTALMRRIHASLDLAEAAGQHGPGAGGGRNPASHDDGGAAGAEQPS

ALDLLMRSRDEEGVGLTRDQIADTVLTLLFAGHDTSSSTLTRIFQHLHRHPEAVQRLRQE

QAEVVAKHGSPVTEAALQDMKYAEGVVRETMRITPIINATLRVALQDFELCGYTIKKGTA

LQCSLTQPIKTDSRWQDEDDVQAFKPERWLHGAAQKQGAWIPFGGGQRLCLGWLLAMTEM

KVLLASIFRRYALELRLPEEPWVEFPIARPKHGMPARFVATMDAS

 

 

>CYP846A1 Chlovari1.576 Chlovari1 - [1:4107]  ( 577612 - 573506 ) Coccsube10.898 + 24:661  ( 1 - 661 ) N    952.39

39% to CYP839A1 Asterochloris species

49% to Chlovari5.1245

MADPDHISHVNPPPPASRRRVQPLHLELPNPDRRLTPPTFIVLRPQHPVQTFTRFANELG

DIFYVRVLHVPMVIVADPALWQAALAPGIDLPKGRSVYGIIDQMTSPGGRHPNLLGHHTH

TGYWRLVRKGVAPAFNPRNIRGVFPHVLDLTEQLTAVLYRAGPQQYLDVDNLLQRESLDV

IARIGFATNFGAIQSFQMPGESAQQQQQQQQQQQQQQQGQGGGGGGGVTTAGCRKGEANL

REMQARMRALLGDIKARGAPQEGDTSIAAHLLRLRDPGTGQPLPDERLAAEIGLFFFAGF

ETTGHSMGWTLFCVAQHPEVEGKICAELDGLGLLVTPSRPRPRQLEYADLSQLKYLGMVV

KEAMRLVPVSGGTVRVSPDRPLRLGGHTIPAGVEILLAVHALMNCERYWDRPSEFLPERW

EEDQAEYWLGDAPGKGPAKQQAGVAAAAGAAADGFQLVDDEEALRVDAARPPKRFLPFSA

GFRNCIGQNLAKMNLHATLAVLLSRFSFQLGGCDPGAPATWHCALPRLWVAAHLRGPGAL

WEIHANRLTMQPKDGLPMRCIPRARGDGPAV

 

>CYP846B1 Chlovari5.1245 Chlovari5 - [1:3204]  ( 1246829 - 1243626 ) Coccsube10.898 + 24:661  ( 1 - 661 ) N    966.75

36% to CYP839A1 Asterochloris species

MLSLLGAAVVGWLGWRAWQQLQQWLAKLRVLSALPHPSTTATLTGSLELIADRDHMHHAL

GRAAAELGGLCYVRILWQPLVVVTDPALCQQLLSAAMDLPKDPGPYHSFNTLTSPGGRTP

NMLGHTASHGYWHLVRKGVAGAFSPRNIRGQFPHVLRLADQIAGILRGAGPAAVLDLDNL

LQREAMDVIGRIGFQTDFGALEAYASGAHGGGPLHVASVFETTKGAALEIAKRWSQPLRT

RVWRLIPDARRGEACLRAAQARMRALLAELKARGPPAEDDASIAAHLLRIRDPATGRPLT

DEQLAGEVGLMFFAGFETTGHTMAWALFLLASHPQAAARVAAELDEHGLLVMPRRPRPRQ

LEYADLSKLKYLGQVLKESMRLVPVVAGGTARRSAKELTLRGHRIPAGTTLIVGGIGLHL

SSHNWERADEFLPERWEEPGAEYWPGDMCPARAGTRPEGSSGSTGASTRPLGGDEEEEEG

DGAGAASASGAWTLVDSDRPPLRFAPFSQGPRICIGQHLAKMNATATLALLLSRFTFELP

PELRGPGALWDLQCNLMTNQPRDGLPMRCIPRPT

 

>CYP847A1 Chlovari4.875 Chlovari4 + [1:2781]  ( 874376 - 877156 ) Phasvulg04.10166 + 48:611  ( 1 - 611 ) N     61.09

29% to CYP705A27 Arabidopsis thaliana

MCFPPPACLRACMPSCLPSLPAAVKAPKSKGLADRITDISFQAFQVTGMLAATSNTPPGP

SAARSLLIAWCVQRLYNMQATAQQFVSFGGLAAAGKSTFSTATISDATDFMRCCTFRVIC

ALAFGITVERLDDRLTLDCVHKVTAYFESVSALQQATKHLMHLGSSTAGNGAAADAAAPG

AKGLHLFLHDVLRAEARGDISHSQAVQCCLEMLLAGTDTSSVTLGYLLLALRDQPLLEAV

LRAEVLQALRAGSAGSASGGCSKGSLRCLGSANLPKMKAALYEAMRFKPVGPVSIRQAAR

GCPAGGFLLPGSDSTGSVRLQAGDTVIVNLAGIHRCPAIFPNPSQFDLANFWPSTAAQLG

ANFFPFGGGPKGCLGSDLAMLEMQVLTACFLLAFQLQSAGPGSGTAASAPSLDALQSEWQ

VANQPTERVP

 

>CYP848A1 Chlovari5.1198 Chlovari5 + [1:4155]  ( 1195783 - 1199937 ) Coccsube10.898 + 24:661  ( 1 - 661 ) N    867.69

31% to CYP839A1 Asterochloris species

36% to CYP741A1 Chlamydomonas reinhardtii

MEASTVLVALCVAAAALLIRRLIGFLRWTAAVRRLPSPPCTDFLAGHVKAMSDARHHRTL

LHWDNQCAPVYSLRAFWMRMVVISDPHYIHQLLRSDRSLGVDKSMNTYQEVDPMSSDKGF

PSLFTASTHSPHWRLVRKGVAPGFSTRCLRSGFRHIQGVCRELLDQLQRIGPGTAFDVDH

LLMRATLDVIGRVAFDIDFRAVQEFNVAASNSQPTSNPEDDEIFTIIRESMNELNSRWAN

PLRGRYMFWLPEVRHAMRYWRALQQHMRGVLREIRSRGPPADGDESIAAHLMRLKDPHTG

QPLADDRLLPEIATFFVAGTDTTAHTMTWTLYLVAQHPEVEARLCAELDALGLLATPQRP

EPRMVEVEDLSRLVYLAAVVKESMRVLPVSADGTAIQAPRDIQLGPHTIPANTIIWVHIF

SCHNSARYWDQPDRFLPERFMQPGAEYAASGPQGKTAGEAAAGQQAAAAAAGGQSAPPSQ

EKLPGDGSSAQGEAEVQHRPDSHGSSSLSPSFSSRAVGSGGGSSQPLRFFPFSQGPRNCV

GQSLAKMDYLAILAVLLGRYTFQLTPEVTAPGGVRDIISLTLQPEHGLPVLAVPRVPQL

 

>CYP849A1 Chlovari5.200 Chlovari5 + [1:4405]  ( 199153 - 203557 ) Chlovulg5.919 + 12:704  ( 1 - 704 ) N   1040.27

34% to CYP743A3 Volvox carteri

MVVAGFMSGVGQALGALLVALLIYGLHPLKRWRYRHFPGPFNWPFVGNLVEMLRDGQETA

CARWSRQHPGIWCFWLGGIPVVMTDEPELARRVLVRPARHKIYSLHVGEQGRWDSHNLVF

VNGEKWKVTRNAWQPFFSRDNVSRHGKLMGDSADKLCSQLHAAAAEGRGVDIWREAGRMT

LDVVGTTAFGVDFNTLDQKDGVEGGRRLRSTPTERLVWAVQVFFELFGLGNIYFALFFLV

PELEQGIKWMANRLPNKSFKQELEARRELRQVGTELVQQARQHLGGSGGSGGARPSVVHP

GSFLALILPHVGEAVGAEVLDDSWASNQAATFILAGYETTANSIGFAIYLVSSHPEARLL

AELDAWGRGRLPTLQELEGGALPFAQAVLKESLRLYPAGSTAVREAGGGMTLGGYAVPDL

TAVQVSIYSMHRNERYWRDPHAFRPDRFMPGTPEAAEVIPGSYLPFGDGSRKCIGYRFAL

LEATLTLVKLYQQFTFRLLAGQVPLKVRSILTLGPSDGIKVTVHPR

 

>CYP850A1 Chlovari9.276 Chlovari9 - [1:3712]  ( 278208 - 274497 ) Chlovulg5.919 + 12:704  ( 1 - 704 ) N    743.53

37% to CYP840A1 Asterochloris species

MPLHPIVGMNNVTSPPPVLQLLVVGFRILPRWRLRHIPLVKPLPFLLGHLLVFVRQPLHE

CYKRWAREYGSIFLVFFGKNPCVVLTDPDLIRQVAVKHFAKFHDRPSILSAIGSASSKNK

RLTALRSGLLVSRGGLWGSLRAAMNPLFHTTALHSYSPIMNDSVGRLLERLEGAAGSGTV

PLDIHMLLGRTTLEVIGRTAFGVEFITDGEREDRQAGRPNLVAAVKVIFSAGGFMPGQGI

GILFRIMPDWLEPALFWLFFTMVGGLAKRLEYARTTFMSTADLLIQAAKRAALARGDQVV

LVESDWRWWSLSSVFVQQNPYKNVTPAPNSVIDMLMRATNKETGQGLKDVQVAVQCNTLI

AAGYETSANALAFTIYCLATHPETEARLLDEIDAFGGKEPGLDDLPHFPFVEAVINESLR

LYPPAHTTNRECTAPGGCTLLGAGGQQYHLPQHTWVHFAIFALHRSEQHWVQPAAFRPER

FLDAEEASKRHPNAFMPFGLGPRMCIGYRFALQELQIVLIRIYQRFTFRLAAEQVQPLPL

RAGLTLSPKDGLWVTAHQRADGGTAASGTTPRPSVPMAATAAA

 

>CYP851A1 Chlovari14.45 Chlovari14 + [1:3286]  ( 43667 - 46952 ) Chlovulg17.820 + 7:592  ( 1 - 592 ) N    435.47

33% to CYP767A1 Chlamydomonas reinhardtii

MAASDLSGALLPQAWAGSLPGVSLALLALAISIWFFQASDDWAKLPGPPPASKLLGHLPQ

VRLLHMKVVVVSDPVLIQAIVSRASDLPKAAQLYDTVDELFSPVGHRSFFNTHDNDEWRV

VRKTTAPAFSPAMIRKAFPKLMDVTSELCDALAAKVAAGESSVEMSEAAMRVTLDVIGST

GYGYDFKARTFARCELFEIIPPLLGEFTLRSTNPARAAAHRCLPFLPEARRFRQRVQACH

KWWRILLASVRQTDLAAAAAEGDTSLRVCLAQLPFTDEQLMPNVAAYLIAGFETTAHSIA

WSLYEVASNPAVQRRLEAELCGAGLLGPAARRLEFGDLAALPFLNCVLKEAMRLHPVASN

GSIRKADKEISLGGYRLAPGTLLWIPFIALLTSRHNWERADEFWPERWELEGQAAAATGA

ASGPTPVGNASNPALTYLPFSSGPRDCIGQNLALMEARAVIASIVGRFELGVAPEMGSRE

DVRNDEVMKLTLQCSKGIRLTLKPRQ