Coccidioides immitis P450s

 

D. Nelson

 

August 9, 2009

 

41 sequences + 1 related species CYP5241A1 Coccidioides posadasii Silveira

 

>CYP51F1 Coccidioides immitis

89% to CYP51F1 Uncinocarpus reesii

CIMG_07469.2

MGLLANVLTGVSKACSGQSPWTLVLLGICAFLTLSVFVNVLKQVFFKNPNEPPVVFHWFPIIGSTISYGIDPYKFFFSCQ

KKYGDIFTFILLGKKTTVFLGTKGNDFILNGKLKDVCAEEVYSPLTTPVFGRHVVYDCPNAKLMEQKKFVKFGLTSEALR

SYVTLITREVESYLENSPAFQGDSGVFNVAKSVAEITIYTASRSLQGKEVRDKFDSSFAELYADLDMGFAAINFMFPWAP

LPHNRKRDRAQQKMTQVYTDIIRERRKAGGKKDSEDMVWNLMSSVYKDGTPVPDVEVAHMMIALLMAGQHSSASTGSWIV

LRLASRPDILEELYQEQLRVLGPDLPPLTYESLQRLELHSNVIKETLRLHAPIHSILRAVKSPMPVDGTKYVVPTSHNLL

AAPGVPSRMADYFPEPMLWDPHRWEKGGGVNATGVQDEAAEEKVDYGYGLVSKGANSPYLPFGSGRHRCIGEQFAYVQLG

TITAALVRALKLRKLDGDKEVPDTDYSSLFSKPLGNPKVAWEKRKPSSKQ

 

>CYP53A18 Coccidioides immitis

90% to CYP53A17

CIMG_09108.2

MLLSFLFNPYVLAGIFIFVFYIVPYLRLSYLRDIPSPFAAGFSNLWLLYQCRRGKRYQAVHDAHKKYGKLVRIQPDHVSV

ADADAIQTIYGHGNGFLKSEYYDAFVSIRRGLFNTRSRAEHTRKRKTVSHTFSAKSVGQFEQYIHANLQLFFQQWTNISE

VQRNPKSGYASIDALNWFNYLAFDIIGDLAFGAPFGMLSKGRDVAEMRKSPDSPASYVPAIQVLNRRGEVSATLGCFPAL

KPFAKYLPDKFFRDGLEAVEHLAGIAVARVSERLRPEVMAKNTRVDLLSRLMEGRDETGAKLGREELTAEALTQLIAGSD

TTSNTSCAMLYWVLRTPGVIEKLQEALDEAVPAHVNVPSFSMVRDIPYLQWVIWETMRIHSTSSLGLPREIPPNSPPVTI

EGHVFHPGTILSVPAYTIHHSPEIWGPDVEEFVPTRWDPARLTPRQKAAFIPFSYGPRACVGRNVAEMELHCIAATVFKN

FEFRLEQDGPMETSEGFLRKPLGLMVGIRRRQPNLN

 

>CYP56B3 Coccidioides immitis

80% to CYP56B2   Uncinocarpus reesii

CIMG_00523.2

MAGLLSSLSSVTLVAVAAITVILFLALVYFFIPPASFPRNIPAIPFYYALLPLVKDGDQEALYHTYLEPLFEQHGAAKIF

FGGRWNILVQRPSYIAEVFKYEDTYAKSGNQKKIPYSVLAEYTGDNIISSHGENWKLYRSILQPPLQQDQDPGPIWRNSR

LLISLLLEEQKTSPHGSVLLPQLLQRFTLANLSEGLLGTSFQTLQQKDAALHKFQMMLKPLIFDPVFLNFPFLDHFNFPS

RQRARRLARQFANELCQTVQRGHQHAHTDKSTSNVGCSVIGAFEQGILSEKQFRNNMVSVFLAGHENPQLLLVSMMFLLG

EHQEIQERVREEVLSLGEDELPYSVLQSAPFLTSVIYETLRMYPPISQLINRRTTKPVLLGGKIPLPAGTYIGYNAYATN

RDKQSWGADADEFKPERWGRTVDEINVTFRKANAKGAFISFHGGRRACLGQKFAMFEARIAMAEILRSLRWKIDPTWPRR

MTPVSGLNQNHDAMDEN

 

>CYP61A1 Coccidioides immitis

90% to CYP61A1   Uncinocarpus reesii

CIMG_05009.2

MASVAGNMASPSADASLASMASDPSSFVMGIYSRFTGWSALLALFMFLVAYDQIKYIWLKGSIVGPRFKIPFMGPFLESV

NPKFTEYKAKWASGELSCVSVFHKFVVIASTRDMARKVFNSPAYVKPCVVDSAHKLLGKTNWVFLDGKEHVEYRKGLNGL

FTRSALSVYMPQLDDVYEKYFKLFLEESKKNNFKPIPWMPYLRELMCALSCRTFVGHYMTEAAVKKIADDYYLITAALEL

VNFPIILPFTKSWYGKKAADMVLDEFSKCAAKSKVRMAAGGEVTCIMDAWIKQMLDSAKYREKIAKGIQVDDSEKPSHIL

RDFSDYEIAQTVFTFLFASQDATSSASTWLFQLMANRPDVLDKVREENLAVRNGDRNGKITMDLLDQLQYTRAVVRETLR

YRPPVIMVPYMTKKDFPITPNYTLPKGCMIVPSVWPATHDPDAYPNPETFDPDRWISGDADKAAKNFLVFGTGPHYCLGQ

TYAQLNLMAMIGKASMMMDWEHHATPISEDIKVFATIFPQREPIRDIPTFVALL

 

>CYP65AU1 Coccidioides immitis

47% to CYP65X1

CIMG_09823.2 revised

MELLSSILLFLGLAAVLGVLKIGYNVIYNLWLSPLAQFPGPKLWAISAIPSQLSIVRGTIHFDITALHERYGPVVRIRPN

ELAFNTAQGFKDIYGFRPGGCFPKDRSRYMTPINGADHLVSAIDDGVHARHRKLLSYAFSNRALREQENVIRGFTDTMITKVRGEVHAGRPTVDMKNWLNYTTFDITG

DLMFGESFNCLRDTK

LHPWIAMIFDSMKALAIMGAAGQFPLVQPWLDKLIPAYLKKQEFDHFNLSAGKADRRLESGVSPRGDFMSAFIQNGFVEK

QEQFYEGKKILRRDEIHSNSFILMLAGSETSATLLAGCIYFLCKSPETMQKLSDEVRSAFTSDSDITFDKAATLPYLGAV

LEEAMRCYPPVAAFLARVVPPGGASVDGYFIPENTIVACHHYASYHSSSNFSRPNDFIPERWLGDPRFESDKRDAMQAFS

LGPRNCIGKNMAYAEMRMILCKLLYHFDMELTPETTDWTNQKVYFLWAKKPLMVTMKDRLSSDY

 

>CYP503B3 Coccidioides immitis

74% to CYP503B2   Uncinocarpus reesii

CIMG_03089.2

MFSLDPVFLNNAHILFHNAL

FTLSSNKPAIFVISAAVLLLWRLLKDILFSVKAPYVGYESSWEPTWLISRRFSREAPGLIEYGYQR (0)

YRDSIYKLSRRDSDILVIPHKFVDELRSLPEEHICA

MEAHIQTLLGPITGTDILLDGDLHTKVLQTKLTPNLGHLIGPLKEELEFAMSMELPDCKDEWVEIQMHGIIRRFVARLSA

RAFTGPIACRNEEWVAANTAYPTNIFTTIGPLRMFPSFMRSSVAPFLSSYWRIRSNIATAKRVIVPIINQRRRDEASGDP

NYEKPKDLLQWMLDTAKPKDAAPASLAHRLLALSLGSLNTTTTAAVQTLYDICNHPEYFEPLREELLDSLTANGGWDKAT

LSKLHGFDSFMKESQRVNPPSYLSFNRVVRKPLTLSDGTRFPKGTHFGMPAYSILQDPSIVENPTEFDGFRYKKIRQQPK

EANKHQYASTDSNNIHFGHGKYACPGRFYASHVVKLIVGHLILEYDFKFPEGKCRPQN

LNIDENVYPDPSATLLIRRRQMA

 

>CYP504A12  Coccidioides immitis RS

           XP_001243121.1 also CIMG_07017.2

           71% to 504A3

  1 MGYQTIAIAV VAVVYFVIKQ LNKTDIPKIK NLPEIPGVPM FGNLIQLGDS HAKKAQDWVK

 61 KYGEVFQVRL GNKRIIFANT FDSVKHFWIT HQSSLISRPT LHTFHTVVSS SQGFTIGTSP

121 WDESCKRRRK AAATALNRPA VQSYMPIIDL ESTVSIKELL NDSKDGTVDV DPNPYFQRFA

181 LNTSLTLNYG IRIDGSIEDE LLKEICHVER VVSNFRSTSN NWQDYIPLLR LWPSRNNEAK

241 EFRERRDRYL SLLLDMLRDR IAKGTDKPCI TGNILKDPEA KLNEAELKSI CLTMVSAGLD

301 TVPGNLIMGI AYLASAHGQE IQERAYQEIM KVYPDGDAWE RCLVEEKVPY ITAFVKEVLR

361 FWTVIPICLP RVSIKDIEYK GATIPAGTTF FMNAYAADYD ENHFKNPYEF RPERYLNVSD

421 GAGTPHYAYG AGSRMCAGSH LANRELYTAF LRLISAFRIV PAKNRADDPI LDCLEAGINK

481 CALTLDPKQF KVGFKVRDRA KLDAWIQGSD ERTKDL

 

>CYP504B9 Coccidioides immitis

91% to CYP504B8

CIMG_07204.2

MALSSFISALNSQAIAHPFHALGVLALLIPGIYVIANEFVRAAARVPGFKGPKGFPLIGNLAQIRVNAAEQYRRWSKKYG

PVYQIQLGNIPVIVVNSAAAAKVLFGQNAQALSSRPEFYTFHKVVSNTAGTTIGTSPFSESLKRRRKGAASALNRPSVQT

YVSHLDLESKDFVAELMKYGKAGRAAVDPMPMIQRLSLSLALTLNWGVRMASQEEELFAEITHVEDEISRFRSTTGNLQD

YIPLLRLNPFSVGSKKAAEMRDRRDKYLNYLNRGLEERMAKNEHKPCIQANVMLDKEARLNNVELTSISLTMLSGGLDTI

TTLVAWSIGMLAERPDIQDKAAAAIKQYHSIDKPLCDPTDDQSCEYIVALVRECLRYYTVLRLALPRTSIKDITYQGKVI

PKGSVFFLNAWACNMDPEVWSDPEIFRPERWLEQPDAPMFTYGVGYRMCAGSLLANRELYLVFLRMLNCFRIEPEGRIEW

DPIKGNSDPTSLVAIPKKYSVRFVPKKEKLLTEALENFIPLAA

 

>CYP530A10 Coccidioides immitis

88% to CYP530A9 Uncinocarpus reesii

CIMG_04939.2

MLRLSVLLGLTAAAIAVARLLSIGRRPKNYPPGPPTLPLLGNIHQMPKRDAHLQFAKWAKEYGPVYSLILGTQCLIVLSS

DEAVKALLDKKSGIYSHRQEMYIGQEVCSGGLRLLMM

GYGPKWRG (0)

FRKMVHGLLNVTTSKSYVVYQTLENKQMLYEFLTEPDRFLYHI

RRYSNALTTTMVFGWRTPTYEDAKMKQLFDGFSEFAEINQTGAAALIDFFPWLRNLPDFLLPLHKKAKDLHKHEKALYLG

HWLKAKDDIRRGTIKPCFCVGMAEAQKSEGFDDDQAAYISGTLLEAGSDTTSSTLYAFVQAMLLYPEIQRRAQKEIDEVV

GADRMPNMDDQDSLQYIRAIMKETLRWMPTTILGAVPHAVTQDDHYMGYLIPKGAGVMNNVWGIHHDEKRHPSPRVFNPE

RYINDHQSLGESAANPDGTKRDQFTFGAGRRICPGIHVAERSLFLGMSRILWAFNIEPASDSQGRPIIPDPDRLTQGFVC

MPEEFPAKITPRSKARADFVTREWKEAEKACLDPQSKQWLLHPLE

 

>CYP539D5 Coccidioides immitis

85% to CYP539D4 Uncinocarpus reesii

CIMG_01103.2

MLEELVTAVSPGQAVLIAFGLFATFLFILDLKIDWRIQKLGPQAPRVRTYLPLGADFIYRAMKAAGKQKDLEFWTKMTEV

PKYTGPGRLSTFEVKFSCYSRSLFTIDPDNIKAVLTGQFADYGKGRRFHEEWRDFLGDSIFATDGELWSKSRQLIRPMFS

RDRIVDTEIFEKHIHKLIPLLGGGANQDGSKVVDVGPLFFRFTLDAATDYLLGQSVDSLDNPKTTFAESFQYVLHRQSVI

FRSGPLSPLLSRKLFHENLKKMDDFMQPFIEQVRALTPEELDHKLSKKDTFLHALARFTRDPTVLRDQLVAILLAGRDTT

AATLSFCIFELSRHPAVVQRLRNEIETVCGNRKPTYSELKEMKYLNAVLNETMRLYPVVPFNVRHALVDTTLPRGGGSDG

QSTIGVPADTRIVYSTMAMQRRRDLYPPPPVPGEKTLQPYFDPLLFHPERWLSGWQPKPWHFIPFNGGPRICLGQQFATI

EMGYTVTRILQHYPEIIGVGAPKPGTDPKFKFDVTLSPGQRLDCVFVKKEE

 

>CYP548D5 Coccidioides immitis

87% to 548D4

CIMG_01401.2

MLLQPLVAHLSLLSVGVGFTALTALLTFGYCVYNKFFHPLRKYPGPFLASVTPWVQLFHGLKGDRHLWLYKLHLKYGPHV

RVAPNFLSINSAQGLHDIYGHGKKVKKGDFYNAFPAIKGVYNTHNVIDKHIHGRKRRVLSQAFSDNALKGMEGVMLVNIR

QFCAIMAGDEPSLDAGAQRTQKGFVVRNMADWFGYLTYDVMGELCFGKSFGMLIERGKREVIGLVDRAAYRHYVCGLWMP

LDNWHLDQIFIRKLTNDRWNFIQKSRVEANQRAKERTQAGHEAKKDFFYYLLNAKDPESGRGLSTPELWGESNVLMIAGS

DTTSTSLAATIFYLVRTPDALAKLKKEVRDTFNDVEEIVTGPKLNELVYLRACMDEAMRLCPAVPGAMPREVLPGGIEVD

GLYLPGGIDIGTPCYAIHRKPEYYREPHTYIPERWIEGALCQSENGMWTSSKANVDLARRAFCPFSIGPRGCIGKGMALM

EMRLTLARMMFLFDIELADRVGEDATGHLHMVDHFTSQKNGPNIIIKKRQFA

 

>CYP548Q1 Coccidioides immitis

43% to CYP548H2

CIMG_05501.2 gc boundary at QAHQ?

MLSGRNR (1)

AVIIYELWLHPLAKYPGPLIAKFTHAHAGYHGWKGDIAHDIWRCHQKYGDYVRYAPNALLINTAQAHQ (1)

DIYGFGGKVVKAANYSILAQRAPSILTLRDAKEHRRRRHRVALALGEDNVRFYEPQMLNHIRTFCA

KMVEGVKNVDGWSALRNMAPWCNYLLFDIMMSMVFSSDSKLLTHPKYRHIPNAIHQSSVLQGVLVQDKTLAILGLHKYLF

KTAVRERVKFVHFIRTVLGIRLNKSASYTADSDPCHDVFAYLRNNLSSADLAQLSPKELSAECATLIIA (1)

GSDTSTMGLAGALFYLSRYRSA

YDRLVQEIREKFNDASDIRLGKTLYSCSYLKSCIQETLRISPPVGTALWREVEPENGATIDGAVIPKGTHVGVGIYSIHH

KPNHFSDPFTFRPE RWLSEARPADLVNHE TRAYGPFSIGPRSCVGKGIAMQELMLSLA

HIFWSLDFEALAPDGNRVTIEGSVLHPSPGWTEFPMKEYIIAVGDGPMLRFRRRAVE

 

>CYP551C1 Coccidioides immitis

51% to CYP551A2    Aspergillus oryzae

48% to CYP551B1 Fusarium graminearum

CIMG_09088.2 shortened at N-term

MEAYLPKNLGLRATVAILVISVFYILSLVIYRLFFSPIAKFPGPKLAAVTGWYEL

YYDVVKKGKYLFEIEKMHDKYGPIVRINPHELSIRDPEYYDELYVAGSVRPTERYKGFVDGIVDFDGSHLATIGHDLHRK

RRKPLDPYFSRAGVTKLEPMVAELCEKLIIERFEGFKGTGKVVRLDHAFTAFSGDVINRICIDDPPNLVDDPEFAPWWFE

LFHSGIVSLPLFMGLPWLIHFIRLIPESILAKLDARSQTFNKFKLMCDEHLRVAKREKAALGSKDTTAMGGRLTLFRHMV

SSDLPPSELTDERLSKEAQVLIGSGTITTAGTMGFLCYHIMANPAIRKRLEEELKPVMEGYPQRKPTWAQLEKVAYLQAL

VKEGLRLSYGTMHRRPRVSPKQALRFKEWVIPAGVPVGMSAYFAHRNPHFFPRPLEFIPERWLENVTPEMNRNFIPFSKG

SRHCLGMNLAYCELNHILAALFRPGGAGFSLYETDESDVMPAHDLIVPLPKLDTKGVRVMFH

 

>CYP578C8 Coccidioides immitis

78% to CYP578C7   Uncinocarpus reesii

CIMG_04972.2 revised

MALLSPATLAIITVSALAAGVYKFIIYPALLSPLSKIPNAHFTSSISPLWILWNRFRMRG

NRTIHEAHNKYGPIVRLAPGEISVNCVDGGIRTVYAGGFEKHDWYPRVFGAFG

TISMFSMVGSRPHSVRKRMMSNIYSKSYLQGSPQLAAASRKILFQRLFPILERHVERADQ

VEIHELNNAIT

MDFITAYIFGLSAATNFLEDAQTRKQWLEAYQCRKPFEFYHQEVPSLVAWAETVKLPLIPSWCQKANDYMESWGLEICDN

ADKYLLTTVVESEPTVYKQLKMSMVKQLPSDGVKSLDEETSKKLKLEIACELYDQLTAGHETSAVALTYLYWELSKDPEL

QCELREELRGLSPSIDIPANADIMPDLPSSKDIDSLPLLNAVVMETLRLHAPIPGIQPRVTPSPTCSLGGYDGIPPGTRA

VSAQAYSLHQNPNIFPEPESWLPRRWLKQNDVSEMES

MRRWFWAFGSGGRMCVGSNFALQ

EMKLVVAAIYSNYTTSIVNDDGIEAIDAYTVRPTSNRLILKFGRA*

 

>CYP578H2 Coccidioides immitis

81% to CYP578H1   Uncinocarpus reesii

CIMG_06188.2 revised

MLLLAGTLFTLAFVIYKKILYPLFFSPLAKIPSAHPLASVSSLWIQWKRLTNKEFDAVVSGFRQKGPYIRLAPKEVAVNT

MECGVKNIYGIGNDNFDKAPWYNFFQNHGFRNTFCALGSEHALYRRRISGVYSKSFLQSSPHIRAILDAVIQQRILPILA

RTAEKEEPIDILALNLAYGLDFVSAFIFGLPRGVRFLENTASREDWLDLYDQTHPSKNMFWLTEHPVLSQVASLFGIPLI

PRNFLKAKRELENWAMKRIKLSEDVLSNNPTDETISPGHMPLLYHALKTGIELEQGEKRNGRFEPNNIQRHELASECLDH

LVATRDTFGITFSYVILNLSRNLEIQEQLRQELLSISQPFRYHNEKRTELPTPQTLEALPFLNAVIKESLRLRNTAPTLN

PRITPTGRKVTIGPCDNVPAGTRVGAFAWCLHRNEEGYPNPRTWDPMRWIVDSSDPKAGARERWWWAFGSGSRQCLGQNL

AFELMRFAVTAIYTNFRTSIIDDSAFAGDETFVTGDGSEQLILKIERVET

 

>CYP584K2 Coccidioides immitis

80% to CYP584K1

CIMG_00331.2

MLNLTNVLLIPPAAGALHVGYRYLQSYLEAERVRKLENTEDPPKAPNQGIFGINVYRDMARHKEEHVFLQKNLERYDELG

DTYTSDMFGRTYIDTRDPENIKAILSTQFEQFSLGDSRLDAFYPMLGEGIFTHVYGGGPKGEPWRHSRAVLRPQFARHQI

QDLAKLEEFVQNLISRIPRNETCDLQELFFRLTLDT (1)

ATDFLFGESVNS

LLPDSPPKETQFYHDFTRGTEICMLRTLLGDLYFLQKDSSEFKRVSAFVQEYIDRFTHKALELHAAGKPTSY

DSNGKYVFLEEISKSIRDPVRLRSELLNILLAGRDTTASLLSACFHQLARHKDVWDELRKEIMDNVGDRLPTYEDIKSLR

YLRYVLNETLRLFPVVPWNGRQAVVTTTLPRGGGPDGKNKILVKKGTFVLYSTWGLHRSKFYGEDTNEFRPSRWETIRPG

WNYIPFNGGPRICLGQQYALVEASYVITRLLQVFKDIENRDPVLPFVEHTTLTLSSEHGAKVALTPA

 

>CYP584L2 Coccidioides immitis

76% to CYP584L1, shortened the N-term

CIMG_04399.2

MLSALKDIPPGHLALGAAACFLLYQVYLYLTLGLARRKFIQQNGCRP

PPAYPHKDPILGLDWALKGMKYSRSRTFLQGTQKRFREHGNTHSLNVIGKPAIATCDPENIKATLATKFQDFDLSTVRKR

LFQPLFGKGIFTTDGAEWEHSRAMLRPNFVRSQVADLDMIERHLKNLFKEIPTDGSTVDLQDLFFDLTLDTATEFLFGES

AYTLTKKDMGSGERFSDIFTYCTAVIGQWARLGIFLGIPDRRYHRYAAGVHEFADRYVQKALENYRAQQSGMITSDKTSN

RYIFLDELVKSTQDPVELRSEALNILLAGRDTTASLLACLWNVLSKRPDVWSKLLNEVDALNKKRPSFEELKNMKFLRYC

VNEALRLYPVVPGNTRVAVRDTFVPVGGGPDGKSPVFVPKGTLLNYSVYTMHRREDIYGPDAAEFKPERWEKLRPGWEYL

PFNGGPRICLGQQLALTEASYTTVRLMQEFRHVESRDPNPWEELLTVTCASAHGAKVALRP

 

>CYP657C2 Coccidioides immitis

66% TO CYP657C1P, HEME SIGNATURE IS MISSING

note C is found adjacent to the AG pair in the I-helix

This may sub for a Thr that points to the heme.  Cys on the other side of the heme?

CIMG_02482.2

BOTTOM PART IS SEPB, A CHROMOSOME SEGREGATION PROTEIN, NOT P450

MAAALLKQSSSLSTEPATDYILKNAFGAGRSVGTLNRSDFYGDSGPIQ

FLNKEPWLTDITSAIARQVQQAMPNLLSFSPSVVDQSTWERVSDVSISHENGEPICEVYLFALVRNFIGTISTTALMGSA

FTETFPYALNELWNFDGNFNAILSSIPRWIPFPGLVSSYSSRRRLLLAMKVFHDAFAATEIGVDPGFDWRDMDDVSEVVK

ARSRALIEAGCSAEAAASEHLAFFWAMNTITNTLVFWNLVHILSDEELHEKILEEIAPYSNAARPDWRESGFNIPEPPRL

RLDANALVSSCPILKATYYESLRLYSLPLSYGQVTKDVSLAEPTVVDSPSSTYKCEAGTYVAIPHFIHNMNTDSFHEPTK

FDPQRIFPHDLEKD

(heme region is missing )

SDTPDNYESSENEKLISN

DSISQKVNDIWPSEASPVLGFSRE

FAEGQALVFTAAFLTMWDIQRASGRRWTVPRQKAGSAVCVPRNDVMVRMKLRV*

 

>CYP660E1 Coccidioides immitis

41% to CYP660B1, 38% to CYP660C1, 38% to CYP660A2, 36% to 660D1

CIMG_02364.2

MEQFYLHLLVLLVLSILLRFLIAPGHAPEEPPLVSSRIPFIGHLIGLARYGNRYYVRLR (2)

AQSQLPAITINIFRQKIYLIYSPGLLAAAQRHAKYISFEPFAALAIRRAAGIKGNGPIVSSSSEKGRSSFDKQMK

DAVHSVLLGEAMVGITRASVAAIKKSVDDLRSTEVDLLTWCRHVLTMATTDSIYGPMNPYRNREAEAAIWEFDSGLGKLT

LNFAQRFIAREAYQAREKLVKRLLEYFEKCGYINASSFVQRRLEVERKAGATLEDIARLETLMVLPLLSNSAPSTFWVLF

DIFSRLDLLEEIRKEIVQNALQFKPCDDSMGKPKQMCTLNMNNIRDKCPLLVATWQETLRLRANTASVRFVSKDTKLNDT

YLLKANSIVQTPANVLNVDPNIWGPDAHLYNPRRFLDTRASPGAGGDRKRDRKWNGFMTFGASPWTCPGRHFATAQILAL

VSLLVMKFDISPVAGDWVSPRINHRSMALAISIPAEGLMVNVVTRKEVKGIDWEFQMMEGKA

 

>CYP664A3 Coccidioides immitis

66% to CYP664A2

CIMG_02812.2

MALTHRVLPFSAGTLASVAVSAALGYLIYRLLRLGRRPAYLPPGPQTQAIWGNLKQ (0)

CDPSFPQHQYADWALTHGPVYTVMQGDTPQIIVNRAAEARDVFVKQGAYTQNRPPFRSIMLLRDGY

FPSLMNGSKWQNARKMWQVVLSSSAIKNYIPYQELESEQLLLDTLNEPLLWYDHLERFANSVGMVMVNGYRITSSSDPIV

KETVEDLYDLSRVGFSGNMLDFWPFLERVVWTLPIYKVGRRMAKKHKDYIWKNYFGVKQRAEQGTRLPSFNRTIQERLQ

EGWTEVSELEGAEIGQHLLSGSTDTVVSTLTTCIAALCLFPDVQRKAQE (1)

VVGPDRLPRGEDEINLPYIQQLLLE (2)

AQRWCPAMPLCVARVTSGPVSWGKYNFPENTGLTINTYAIHNDPELYPEPH

IFMPERWEGRIKAAHGENQLLFTFGAGRRFCPGKSLAEKSLFIAIARWLWAFNTSHATDEEGNKIPIDPKDLRPGNIVRI

KRFSADVQPRNPQRAGVIRRVWREKCDTLLDENHQWKTNPERIAESMKMECDI

 

>CYP670A2 Coccidioides immitis

85% to CYP670A1

CIMG_04862.2

MDCTFMTPCAVAGGVGVLSHLLYFIRGEHHKYAHRWITRIFAGITVLAVSVLRVTEYQFLRTLILTILLSTSYFVGLYGS

IGIYRIFFHPLRKFKGPFWARASNLYHMCMIRKSDNYLVMKKLHKQYGPIIRTGPANLSINDPAAIPIVLSDRAKCFKGP

WYDRSLPLVNLHTVRDKKVHDARRKVFSKAFTPTALREYEERVVVHCEEFVRQMSRLSGKPFDASEWFKYFAFDVMGDLG

LGKEFHMMTTETNRWIPTLLETSMKHVGPTSPVPWMAPILHKMPWAGKGARAWLEFVGSQVKQRTQKKSDKRDILSHLID

AYDQTEKKDIDYQWLRGDTRLTIVGGSDTTAATLTFLFYHLAKDPSQVEKLRAELEPLLNGKPQLDPKDVSKAQHLNGVI

QETLRLHPAIPSGFPRVTPPEGVTISGTYIPGGTTIVIPLYAMQHDEANYANAEEFIPERWYSKPELIKNRDAFLTWNIG

TNGCIGRALALTEMRNLITYFIRNFSTVRFAPGEDGTKLVTETKDHFTVGVKPLHLIFE

 

>CYP677A2 AAEC02000027.1 Coccidioides immitis RS

64% to 677A1

CIMG_06137.2

1175231  MKPFVLTEFGFQSHWILLAALYLAGWAVYQGIK

1175330  TLYWHPLAKFPGPRIGALTRLYKTYVECVAQGSFVHLLEEHHARY (1)

         GDIVRVGPNE (0)

         LHFSNPATYLEIYNPSNRWDK  1175686

1175687  EESLYHSFGEDRSSFGFLTYKEAKERKDVLNRMLSRKAILGSQGIVQEK   (0)1175833

1175898  VVELCKSFERKKNSTVNLFYAFRCMSIDVIT (1)

         YLCFGSSVDAIN  1176077

1176078  APDHQAPIIIAMDASLPVFVRFKHSAFYKSMIVNCPPAISKIVSPLTAGLVDLQQ (0)  1176242

1176296  LLKGQIKEMTEDPSTLEKLPHSRTVFHELLRPEAYKSRTVPCADSLYEEAQALMFGGADT  1176475

1176476  TGTTLMHGTFYILKQPEVYRRLKEEIHAVWPNLNTLPDLTDLEKLPYL (0)

1176476  TAALKESLRMSPGVASALPRIVPPSGAKISGQFIPGG (0) 1176790

1176862  TVVGMSSHFVHRSETVFEKPNEFIPDRWLGDKGSQ  1176966

1176967  LDKWLFSFSHGPRSCLGQN  (2) 1177023

1177088  LAWAELYFCFAHLYRKFDIEMDPSS (2)

         PRDLQWRDRFL  1177267

1177268  PEYIGPHLKAKITPVAS*  1177321

 

>CYP682A2 Coccidioides immitis

64% to CYP682A1   Aspergillus nidulans

CIMG_09899.2

MSYVVDTLTYGGLIWAAYLAGLVIYRLYFHPLAKFPGPRYAALSRWHEIYYDVYLGGKFIFHIEDLHKKYGPIVRIAPDE

LHVIDSDFFDTIFTKAGRVDKYEWLSNRFGNATSTLTTAPDSLHKLRRGALNPFFSRKRIINLQELVREKIAILVGKINE

YKESGAPMTISRGYMALVEDIIMQYCFARDYNHLETPNWKPIFHDPLMAISMSGNAALHFPLVPKIMECLPQSWVVKLNP

LYVPIFRLQNDLSQQIRNLKEDKVDAKDGRATVFFELIHGDLPASEKEDRRVRDEAQLIIGAGLVTTSWALSVGTFFLLS

NPEALAKLRRELGEAIREDKYSKTLLQWAELEKLPYLTAVIKESIRLSYGTSSRNVRLSPNSLKYKDWVIPARTPVSMTI

PFLNHDEEIFPDSHAFNPERWLNSPKTSNGSNLDRYFVGFGKGTRSCLGSNLAWCELYLIFATIFRYFDFELYKTDKSDV

ELVHDYFLPFPKLDTKGIRVRVKQ

 

>CYP682B4 Coccidioides immitis

70% TO CYP682B3

CIMG_08088.2

MALLAEIVQFIPQHPFAVLCLLVVFALSGLSVYRLFLHPLAKFPGPKLAALTLWYEYYHDGIRGGQYTFEIQRMHERYGP

IVRISPHELHINDPAFIDTLYAGGGKRRDKYVFYASQFGLPKSLFGTADHYHHRLRRSALRRFFSKASVTQLEPLITKKI

DTLCSLIQATAGSGRPVSLSDAYSAITSDVATEYAFGTCTNFVCPSNPYFERNFRVTLVKGLMVATHSKQFPWIRTISKM

IPMC (0)

EISKQVKDVMDGVSNGNEKGHNTIFHELLTGSLPPQEKTFTRLKQEGQLIVGAGTETVG

WSLSVITFYILAHPAVLEKLRKELEEAIPDPSILPSVTTLENLPYLSAVVAEGLRLSYGVISRSQRISPYEPLIFEPASD

QENHIKHVIPAGTPVGMTSYLIHHNPEIFPDSSKFIPERWLDQDGKRHRHLDPYLMTFSKGSRQCIGINLAYAELYLIIS

SLIRRFGGRIELFETTVRDVVPKKDYFLPVPDGDAVVQVLVRED

 

>CYP682D4 Coccidioides immitis

81% to CYP682D3   Uncinocarpus reesii

CIMG_00083.2

MSSFFILRLTVKSFWSVWWSREMEALPLIKEHPFLTATAAYLVYVTAVVVYRLWLSPLSKFPGPKLAAATRWYEFYYDAI

CHGKYTFEIIKMHEKYGPIVRISPHELHINDPEYYDVLYSRDSPRDKYSYYTGQFGTPMAAISTISHAHHRLRRSNMNPY

FSMARIRKLEPAIQILVDKLCNRLKEFKGTGVPIVVQYPYTCFSTDVISDYTMGTGFHYLDEPDFIPHWSETLSAIAKAT

VFFKPYPWLLYWLKALPEGLVGRVDPGMNLFFVFQRRCKVLINSVIREHSEPDYEEKRKSYDHPTFFHDILDSNLPPEEK

GPERLAQEIQGVIGAGSETVAKTLTWLTYYLLENKDKMDKLLEELNRLDPDRTATVVDLEKMPYLTSVMLEALRISYGVS

SRLQRICPDRDLQYKEWSIPAGTPVGMTSVMMHHNEDIFPDSYNFVPERWLDPDRRKYLERYLVAFSKGSRQCVGINLAR

AELLLAISKIFRELKFELFGTTREDVTLKHDLFLPFPKVGSKGVRVLVVD

 

>CYP682J2 Coccidioides immitis

85% to CYP682J1   Uncinocarpus reesii

CIMG_01197.2 revised

METPSWAFLSLGFTLLTAYIGWLVLSR

LFWSPLARFPGPRLAALTNWYEFYYDVILQGKFTEHIQDLHKQYGRIVRITP

SELHVDDPEFYEQLYSRNGRRDKYAYFSGRFGYASDCFSTIHHDLHRLRRKPLGPMFSTQKISEFQPVIRAKVDKLCQKL

SEYSDGKVITLNRAWMALTTDIITEYAFAKSYDQLDSPGFRETLHEALVAIYVTGHFALHFPVVFPILDALPEWLVLKMQ

PDLVSVVGMRKDLARRVNNIRNGVNDSYKTVKHRTIFHEVLNSDLPDDQKSDARLGDEAQLIVAAGLITTSWALSVASFH

IITDSSVSKRLRDEVNLAQSRSEGPLDWRTLEQLPYLNGCIREAIRLAHGITTRNPRLVPDSELVYGEWVIPRNTPVSMT

NVDTLMNPEIFPDPEKFVPERWIEDPTLDRYFVAFGKGSRQCMGIN (2)

LAMAELYTAIAIVFSRFTFELHETSHSDIVMKHAYLVPYPRWDSKGVRAIVHSVNQP*

 

>CYP682K2 Coccidioides immitis

68% to CYP682K1

CIMG_09894.2 revised

MAYTFTVARMSIIGYIVGTLVYRLYFSPLSKIPGSKLAAATLWYEFYYDVILGGQYTFKIKELHQKH (1)

GPIIRISPYEVHIDDPEYYHTLYSHRCPRDKCDYHVKPFNLPKSSFGTESARVHRLRR

GAMNPFFSRGFVLKHESLVQDLVQKFCRRVEEFARDEEIVPLSLGFTCLT ()

DVITSFVVNRSYRYLEASDW

HPHWGQTLKDASKLSVITKQVAWTLPIPKCFPQSWAKALNPGLALFFDLTQRTHRRILEVLKEREQERGVSGPGRRKTLI

DQLLDSKLPQEEKSMERLAAEIRSAIGAGTETTSNSMTYHLLANPQKLQRLRDELLKLGPGREANLCELEQLPYL (0)

SSCILEGLR

LSYGISTRLQRKSDHTEIVYKAYRISPG

TAVGM

TSVLQHHDEAIFPDSYGYVPERWLNTEERKRLEKYLVTFSKGPQRCIGMS (2)

LALAELYLTVTNIFRKFNLELHNTGRNDIDIRYDLFIPRPKNLKTAGVQVRVKGLDN*

 

>CYP682L1P Coccidioides immitis

pseudogene

44% to CYP682A1   Aspergillus nidulans

45% to CYP5095A2 A. niger

CIMG_08072.2

MALQHWYHSCSETHREGVIAAALAIW

ILYLVSLAVYRLYFSPLAKFPGPKLAALTRWYEAYYEIVKIGQYSFKVDELHDKF

GPIVRVTPDEVHIRDAQFYDQM

YAKNPRVSKPG*NKIFGTEAAAFSTIDSATHRRRRGALNPM

FSRRAILVLEPVVREYVALLCKRVAEYATKSKPLAITVAHSAYTGDVIV

EYSFGFSYRHLENPNFESFHDALMVMGLSAHLASQFSWFLP (0)

QLVNSLPDWFVEKIQPDPASLLRLRR (0)

DHWDLIGQIIRGEEAVSKVKLHPTIFHEILRSSLPPEEKSQQRLLDEAQIVVAAG VGTTAYTL &

DVGTFHILNTPHIYQRLHKEVADAFPDKNVIPSLLELEKLPYMKTCIQESLRLSYGLSG*N

PRAHDKPLQYGKWTIPANTTITMSIVDVHHDEAI &

FPDSHSFIPERWLDNPKTSDGTPLERYLVAFGRGPRACLGLS (2)

LARAELNYAFGTVFRRFEFELYETDITDVKYKHDFFNPPVKMDSKGVRLLVSEVSD

 

>CYP5077A2 Coccidioides immitis

56% to CYP5077A1   Aspergillus nidulans

CIMG_04681.2

MDHSLFSEFAGRAAKWSGSFAIAAVIFIVFHS

MVSYFKLRHIPGPPIAAFTNVVRRAWVGRGDLHEKHTRLHRKYGTVVRVGPRAVLISQPKAIEKIYGFKAKFLKSEFYDS

IIPRIKGGKIPDVFATRDEDLHRQMRKPIANLYSIANLISFEPLVFSTMRCFFSRLDELFTDKNKDFDLGQWLQLFTFDV

MGEVTFSRRLGFLEKGGDIENVMENNWQYFQAAAPMPWLDYFWKDNPLLPTVSKRNPLADFGAARIKERLDMTEKERSSI

NQRDFLSCFIEEAHKNPGLPKLALPTWTNSNIQAGGDTTAIMASVILYYLLKNPSTLDVLQREIDKAAHEGRISEFVTWK

ESQTLPYLDACVKEASRLHPPIGFPLERIVPESGLQVDGYHIPPGTRVSMNPWAVHREISLYGDGAEIWKPERWMCSEME

KKAMYHSLLTFGAGHRVCLGKNLSYFEVYKLVPSLLQKYQLELVDPQREWSLETKWFTMPSGFRVRIKSRNSTKRNPDNP

NIG

 

>CYP5080J1 Coccidioides immitis

52% to CYP5080B2 Aspergillus oryzae

CIMG_04922.2 added N-term

MLGLSSMILGAFIALRFLLSITSALFSRNRSIPGPFLARFTRFWYLREIHRGHFEKVNIELHRRH (1)

GKIVRIAPNEYSVDDPEAVRTVYGPGSKFRKADWYAGWAHPDPSRFTLFTD

RNSKRHAAERRKVSAAYSLSTLVSYEGFVDDCVG

IFDQRLRGFA DQKLGINFGHWLQCFAFDVIGEITFSKRFGFLDAGEDVGEIMESINNKMAYSTMVGVYPKIHPPLFRLLS

FFRGSKATGEEYNVRFALDNISERKTRFTTVPSNGPTDFLTKFLEAHSADPEKFTNYNILMGCLTNIVAGSDTTSISLSS

IMYNLCRNYDALAKLRSEIDTMTAEGRLSNPVTFKETQNMPYLQAVIKEGLRMHPATGLPLARVVPDGGVTLTGRYFEAG

TVVGINSWVAHMNTSVFGADAHLFRPDRWLTTDTAQLSKMDHYFLPFGLGSRTCLGKNISLLEMSKLVPQLVRNFDFELV

NPEKELATRNMWELHELDQGYFLR

 

>CYP5104B2 Coccidioides immitis

53% to CYP5104B1

CIMG_00153.2

MAEGFIYAVSNSRREDVLSNALVIGIALILAITFWVHSRDPLRSIPGPLWAKWTPFWLVHYARSGNMHRQMIATHKKYGR

LVRVGPNEVSTANPEALKAIYGGDFRKSDWYSVWQGLRKWDLFGERNESIHRAQRRLVSQIYSLSNMKKLEPYVDKAVVL

FMTKMSEMQGQQVNMSKWAQLFAFDVIGEVTFSKRFGFMDAGKDDGAFSLIDKSLRCAAWVGYVPWVYWTNLRLSPIIGS

HLAVTARQGSLLTFAAKAIAERKKRGSDHQDILGQLFDVQREKPELDDICVTSMVASNIFAGSDSTALSISSLLYHVVKN

EQCKKRLVEEIDATARANNIGHGDIFSLETANNMPYLQACMWEALRCHPAVGMNLGRVVPPQGVKIDGQYLPGGTVVGAN

AWVIHQDKDTFGEDAHKFRPERWIEEPDRVSQMRRVFFTFGGGSRFCIGKNIGWLEMSKFVPTLFHDFEIALADADQKLK

ELAW

 

>CYP5171A2P Coccidioides immitis

pseudogene fragment (C-term)

54% to CYP5171A1

CIMG_10420.2

VLEPQQLNNSTTGTQHLLTPP

MDIYVSQLSIHLDPAHWGPNAAEFNPSRWIDTSSSSDQIITPAKGTYVSWSGGPQICPGVKMSQVEFVATMATLFRSARC

EPLPTVGIEDAEMLRERLRQLAWDSVSKLTLQMRDPGRVQLRWVPMED*

 

>CYP5234A2  Coccidioides immitis

69% to CYP5234A1

CIMG_00783.2 MAFVTLFTALSLPKWQLLALGLGIWVALDICRGIFRVVTSPFPGPRIAKFTRWWMRWKQWKGNDKHEILLLHRKYGPTVQ

LGPREVSFCHADALPQIYSGPRGLDAGESLLAFQNYASENVVTTLDADLHAVRRKMVVGLYTGPAVAAPAFQAGFKIYIE

QFMRIIEERAVAAPCRTVDVSSWLRWLVADIIIHHIYGEKDHPNMLTNEESRKIYKGLLITTADILCQPFVTFLGWFPRI

STLFQRLFGPDEIGTFGMKRVEAVLSANSETKEPSITHLQHLTSTLKKNGPSRVLPGKNFIASDCLDHFIAGYFAPGDLL

AALMWELSAPENRIYQDKLRHELHDAGILPGKYPDPSLVQRLPYLDCVLREVLRLHLPLPFGLPRTVKQGQNVVVLGTKI

PAGTTIHSQGYCLHRDPGAFQEPERWNPERWNIPITSPKYREMQRMFWPFGSGARMCSGKNVAWAELRLITARVYSTYQT

ALDEVFVDKDGALLPEEKRKAYFPFRITLPIRFLKI

 

>CYP5235A2 Coccidioides immitis

74% to CYP5235A1 Uncinocarpus reesii

CIMG_02277.2 revised C-term

MVLLSSTILVIGGVGLFIYSVI

TRFVSWYRLRHIPGPPGVGWSRLWLLRHLFSGRLCNKLKDVCDEY

GPLVRIGPDWVVC

SDASEIRRIWGVRSGYYRSPWYKAIRIDPTRDSILTFCENKTHHRTRSYLLPGYAAKGIENQEQVIDEQVGKLVALIRSR

YISTRNALRPWNMGQSMQYLTQDVITAIGFGKAVGYLEADTDIFGFFKTFRSAILPFHCLALLPTVVDILQIFIMKPFVP

KATDKRGAGWLMGIVKTHVDKRYGPEKVRNNDVLQSFVDSGLSQSEVEVEALVQLLSGTDTTATALRNIIFYIATHPRAY

RLLQEEIDAAAQAVTRPVIADQEAKQLPYLQACIKETLRLWPPIMGMMGKISDEDDIICGIRVPAKTQVAWAPLALMKDR

VVFGEDARTFEPQRWIDADPVQLKRMEGTHGLVFAVGTRWECLGKRLAYMEMEKTIFE

LFRRFDFVMLDPVEPFKWKNYGLTIQHDMNVKITSRGIACNE*

 

>CYP5236A2 Coccidioides immitis

77% to CYP5236A1   Uncinocarpus reesii

CIMG_06187.2 model is long at N-term (deleted some seq)

METLAEQHPSENFRVLPLFVILTLLVYIIVVHPLFLGPYS

HIPGPKLGKISWYYI

AWYDFWLQRNDKIAKWHQKYGSIICFRPGEISFASPELMREIYGTAGKYTKSDLFENFMVYDQKPLFSIGSYWEHRKKRM

LISSFYHNTNITRPVMEKWLRKNIHKLMANIDKKIGQTRGNSDGTMVKGMIDAYPLFNCFAFDNITHVLFGSKYGAKTIE

NDCPERKILLGIKQAQMWGPFKFNFPALAWIASKMMHILPANVAYRLLPETLRLCLKSEDEMAEWNWRSLHAALADLDSV

EDYTLLRRMLACRTKDGNTLTTSYIAAELYDNINAAQETVAVGLIYLIFHLARQKVWRTKIRNELAGLSLTEDGYPGWTD

IDGLPLLDAFMREVLRVNPGASGRQERYIEDPKKYYGGFRLPLRTRVTASTIALHHDPQVFPDPEEFCPERWLHQTAEKL

RQMEKSFIPFGYGARICLGKAFGIMELKMLAAFLLLRYEIETTPEMGDGKTGPMWQCGSIEAVPIGLKGEIVFTRLHSMS

SRSSTKYMERD

 

>CYP5240A2 Coccidioides immitis

71% to CYP5240A1   Uncinocarpus reesii

CIMG_04920.2

MMLAVLADAVGSPVTVYFAIALGLPFLVTWLVSNFNARWPRKGEPPMVPHWIPWLGHAYSFLFDINGFGARIKKRFPKEG

AATSVVGGRHYYTILDPKLASQIYRRPKVFPMEAFIIASHAAFGTPEADLNVLKMGIPGFEHESGYKDDGRRVWQTMSKM

LQQHLSMEGSINMATTFLRKLTENLEKEFPKNTSSTDWISIDLRSFILKQYVMASVASLYGSHLVDSWPTICEDFWAYDE

YTRIHLAQVPEILAPKAYGSRRKILNILLQWEKDARQRKDLEKMLAEDVEWDEYWGARLIHHRVKFATENGMSSVARASM

ALSLIWGQNANAIPIGLWTMIHSLVNPGVQQRVSEAIESCRKPDGGFDMHQVVTHKYLKSVFLESLRYGVAAPMVRVVLE

TTQVGQYTFHKGNVIHIASRILHMDDDVWSRGAAVGASGFWGERFLDVERDANGNIEEKTNAEAAVSKAAADPISLPVGT

RSKEIKDRMLAFRAFGGGNHLCPGRFFALYEIVAGMSTLLTMFDIEVDQEALRTNGMPVVDQRGIGGLLPDRKFMVRMRR

K

 

>CYP5241A1 Coccidioides immitis

CIMG_09641.2, EST GH380914.1, GH380913.1

Very poor match to known P450s, only one intron

MGKAKPPEFGSGRKATLLSTINQSLSFHASPELFLSTAPGAADETRDQSNALPSIVRAKILNRDVAVISSYRHCRDILQA

THGASLSPTEPGSVARDGGDPITPSTFTVGPAYRELMSDFFPLPNLLLLDLPGHSQAKLHWEEHFARVFAQIPNLIRDTV

VHHLTTWSHGSTVDLYEQMKDLSWKVLCAVFLGLSPGDDQYRTIISLQEDLMRGQFSLFPVSINTPLWRSPRCKGIEARK

KLQVVLGEMITTRTTDSNPTCPFAQPSDSDGGLNSEELAGNTLLFTSSIAIKALASLLTASLLNLFLFPSQPPLASLVRR

KHAHGKTHEDGDLLRSILLETERLSPPVIGVMRRVEHDVVLTECATDPALQHQVVVPAGWDAWLYFVGASRDASIYQNAS

QFIPDRFLSQLEPSPPLAFGAGAKACLGREVTRTVVKTVASAMLETGIDLVGSIDRKGVRGWLGWDDNVPVDIIAKELKQ

LPCQRPREPIRVRVVRGE (2)

RLKDAIMQISQLSDQIFKYPFSDPNEQPSCVGGHDNPSAQLALPS

 

>CYP5242A1 Coccidioides immitis

34% to CYP5237A1 Uncinocarpus reesii

EST GH381634.1, GH381633.1

CIMG_06709.2 (n-term), CIMG_06710.2 (C-term) same gene

MNGTAVTHGGPLVSSIEFVLLHPFLQGQNSLIAALIVLVASAFFILNAQAPKIPNHSIYFKNNAGKKLQLMAGDTRFRRF

LNG (2)

KDMSKEGSVKFGQDPFMVKNGRRMELVVSTPEQVRDFLAKDAT ()

DHMKRSDCNLGDYFR (2)

TLGSCVGVKSGEKWRTARHHLEPHFSFPTAAS

MLSNCREMILNWARNLADDPMVTSKTRNGFDFDAVSACRQLPFRLIALALYKDMLTED (0)

MFEQLWALNALHEKVTNIAFFSKWPTKSFYRWLPTEANSLLSEYEREWEKLNLKTIMEARK (0)

TGKSCPAEVMYQGVEAGELTLDT (0)

YMQSLDEILFTNIDVTSAMMGYALISVAKNLEVQESLRSEILTVGKSAAEIAEYTRKE

DTILHKTYLEVLRNNPT (1)

WYSLPELTAIDKRIGGYLIPAGTAVVLDLQRLNKDSPVWQPDGSEFRPGRWDSISPVAARY

SLHGYGMGPRKCLGKNFANIIIKLLLVTTLEEFTLSAGTDETKLRK

DRFTRTPDDVVSFQVRRSGSK*

 

>CYP5243A1 Coccidioides immitis

31% to CYP590A1   Magnaporthe grisea

CIMG_01179.2 REVISED, EST GH367762.1

MASVSLTNIIFTSIILYIFTILLKLLQNYQRARKIGLPIVFVPVDQSNILWIIISPIVRPLLKRYLPRFIYNRIVICIFG

HEFHEKLEPFKNFVGGQKTYTLITLRGLEIWTCDPDVSMDVLRRPKDFSQLEIANKMMSKFGSNVLTTSGAVWARQRKII

ASVINEKISGVVFDESVRQTAGFIEEFGESKPGDIGSRSTKANRVIDGVTYKTFDMVKKITIHVLSRAGMGVTRHWRDDG

RQIKSSAAKADHDEDSRLKFDRALQMILANLVPATLVPEQILSHWPFFLPGAREMRDLASAVRHLPKMFRDMLGQEAPVT

DSFHGSSDKEPSTKINIISQLIAASELGNNQSVSTDANIKQGWTLSKDEIVGNLFIFNAAGFDTSANALSFALVVLAAYP

HWQEWLFEEIDQIVPEDSDASMEYSTIFPKAIRTLAFMLEVLRLFPPVIHIGKTAFSGNGEAVQLVNPMKKDGESAVTTE

IPSGVVIYINSAALHMAPE (0)

LFRPSRWINHSDNTIFQPPRGS

YLPWSAGPRNCPGQKMAQVEFVG (0)

ETDDEVRQRLERVIDGCRSKLTLEMEVYGVTDAEEEKGGRGVGLRWVRRKAPNRP

 

>CYP5244A1 Coccidioides immitis

37% to CYP596A1

CIMG_03163.2

MSLALDVITDSRVLVRLALLGAIFVLFRIYKSLIAPTKPWPNFPVIKLDGLDAATSWTEHALETIFRGREATNDGFFQII

TGNGPKIVAPNRFLEEIKANKDLDAQKGLDAQKAFSTEHFWTYSGMIGFKAMRNYPEPIRHVVRGKVNAAMLAMTKELAA

EAVAVIDASMPSKDAADDEWHSVSMQPVCEEIVARLSTLLFLGRDACRDREWLDVVRTYTFNAFRTSARLRACSPIWRPL

AHRFWFSESKMVRKQCAHADMMIKPMIEKRQKLIAAGEYKSLKVGDTLGWLLEASQRFGKYIDCVGSQMLLTLGAVHNTT

ETMNVAVLDICKNPDVVQPLRNEIVRVLKEEGGWTKNVFSKLHLMDSFLKESQRMLPLVIMQNNIAPLRRIVTRRTVLSD

GTVLPKGAFVTFAGNNMDPSVYPNPDVFDAYRFLRLRGKHNDGFQYTGLSTDMIQFGYGSWACPGRFLAVTELKLALVLF

LMEFDFCLDETSQEYVRHSAGANMSNRGATIKVRRRKEKEIDLMAMLE

 

>CYP6001A2 Coccidioides immitis RS

fusion with diooxygenase, P450 (C-term) part may act like a hydroperoxide isomerase

XM_001247707.1 linoleate diol synthase (CIMG_01479)

Name revised from CYP6001A6

MVLDSSSRRGVLDDLAKYFPHFGGIANGSLWPITPDSGHHSPSQ

GPTGGLLQDLGSLDVKDVGTVLELIKNTASGAPVEDKRYIMERVIQLASSLPSTSHNR

TTITNTLLAQLWNDLSHPPVSYLGRDVIYRQADGSYNNIYWPQIGKAGSNYARSVQPK

SIQPASRPDPGLLFDGLLARQQFKEHPNKLSSVLFYLAALIIHDLFRTDPTDSSRNMT

SSYLDLSPLYGCNQEEQNQVRTFKDGKLRPDCFSERRVFGFPPGVGVLLIMFNRFHNY

VVQNLAAINENNRFRKPDESDADACAKYDNDLFQTGRLITCGLYINIILKDYVRNILN

INQTDSDWSLDPRSDVKELLSHKPVQEAGGNMVAAEFNLVYRWHSCLSDRDDRWMQEI

FEKALDGKDLDTIGMPEFLGKIRKLQSSIPDDPMLRPFANLERQSNGSYDDNDLVKIL

TESIEDCAGSFGARHVPKVLRSVEILGILQARSWNLSSLNEFRKYFNLAPHTSFEDIN

SDPEVVEQLRHFYGHPDNVELYPGIVVEEGKPRIVPGSGLCASYTISRTVLSDAVALV

RGDRFYTVDYTPQNLTNWGYNEANYDMTVNNGHIFHKLILRAFPRHFKPDSVYAHFPF

VIPSENKKILSDLGLAEKYSWERPGAVPHPTVILSHGACNAILHNKEDFKITWGEKVK

HIMARNSIPYGADFMLSGDEQVHEDSRQMMKKALYIEDWCGQVRAFYERITLELLHSK

SHRISGVSQVDIVRDVANLAAIHFSSNIFLLPLKTEGLPHGVFTDTELYRSMALILNY

IFYDVDPTQSFKLRERSRSESQKLGELVMLNVQAISKTGFIGSIIDKLHGNEALANYG

VHMIRRLLATQMPIDELVWTHILPTAGGMVANQAQLFSQCLDFYLSEQGSRHWPEIRR

LAGLNTKEADDLLLRYFLEGARIRSTVALYRDVSKDCKVQDHGKEVNLHAGQRIICNL

MSACKDPEVFPEPDEVDLTRDLDSYIHLGVGPHECLGKGMVQIGLTTMLKVVGRLDNL

RRAPGPQGQLHSIPGPGGIPLYMSEDESEVSPFPATMKVLWDGELPPLPQ

 

Related sequences

 

>CYP5241A1 Coccidioides posadasii Silveira

GH435524.1, GH435523.1 ESTs, ortholog to immitis seq

96% to CYP5241A1 Coccidioides immitis

SQAKLHWEEHFARVFAQIPNLIRDTVVDHLTTWSHGSTVDLYEQMKDLSWKVLCAVFLGL

SPGDDQYRTIISLQEDLMRGQFSLFPVSINTPLWRSPRCKGIEARKKLQVVLGEMMTTRT

ADGNPTCPFAQPSDSDGGLNSEELAGNTLLFTSSIAIKALASLLTASLLNLFLFPSQPPL

ASMVRRKHAHGKTHEDSDLLRSILLETERMSPPVIGVMRRVERDVILTECATDPALQHQV

VVPAGWDAWLYFVSASRDASIYQNASQFIPDRFLSQLEPS

PPLAFGAGAKACLGREVTRTVVKTV

ASAMLETGIDLVGSIDQKGVRGWLGWDDNVSVDIIAKELKQLPCQ