84 P450 genes from D. pseudoobscura (RED) and all P450s from D. melanogaster (BLUE)

Many of the genes were assembled by students in the MSCI814 bioinformatics class

as assignment no. 2. The RED genes have been assembled or checked by D. Nelson

<a HREF="http://drnelson.utmem.edu/msci814.module2.html">Class Notes</a>

Other modules can be found by changing the module number to 1 or 3

All D. melanogaster P450s have been searched.

Note CYP49 N-terminal revised based on comparison to D. pseudoobscura.

CYP12B2 and CYP12E1 N-terminals also revised. CYP318A1 revised

<A HREF="drosophila.aln.htm">172 sequence alignment and intron map</A>

Last modified Feb. 11, 2004.

 

>4C3 AC014779 73845-80196 also AC008219

MSSKVITSLMAESILLSKVGQVISGYSPITVFLLGSILIFLVVYNKRRSRLVKYIEKIPG

PAAMPFLGNAIEMNVDHD (1)

ELFNRVIGMQKLWGTRIGINRVWQGTAPRVLLFEPETVE (0)

PILNSQKFVNKSHDYDYLHPWLGEGLLTSTDRKWHSRRKI (0)

LTPAFHFKILDDFIDVFNEQSAV

LARKLAVEVGSEAFNLFPYVTLCTLDIVC (1)

ETAMGRRIYAQSNSESEYVKAVYG (2)

IGSIVQSRQAKIWLQSDFIFSLTAEYKLHQSYINTLHGFSNMVIRERKAELAILQENNNNNNNNAPD

AYDDVGKKKRLAFLDLLIDASKEGTVLSN (0)

EDIREEVDTFMFEGHDTTSAAISWTLFLLGC

HPEYQERVVEELDSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNI (1)

GGKIVPAGTQAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRN

CIGQKFAILEEKAVISTVLRKYKIEAVDRREDLTLLGELILRPKDGLRVKITPRD

 

>CYP4C3 D. pseudoobscura ortholog of Cyp4c3 94% intron 3 missing

MSSKVISSLMAESILLTKMAQVISGYSPITIFLLASIALFLVVYNKRRSRLVKHIEKIPG

PAAMPFLGNAIEMNVDHD (1)

ELFNRVIGMQKLWGTRLGINRVWQGTSPRVLLFEPETVE (0)

PILNSQKFVNKSHDYDYLHPWLGTGLLTSTDRKWHSRRKILTPAFHFKILDDFVDVFNEQSAV

LARKLAVEVGSEAFNLFPYVTLCTLDIVC (1)

ETAMGRRIYAQSDSESEYVKAVYG (2)

IGSIVQSRQSKIWLQSDLIFRLTADYKLHQSYINTLHGFSNMVIRERKSELALLQDNNNNNNNTPDA

YDDVGKKKRLAFLDLLIDASKDGTVLTN (0)

EDIREEVDTFMFEGHDTTSAAISWTLFLLGCH

PEYQEQVAEELDSIFGNDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNI (1)

GGKLVPAGTQAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRNC

IGQKFAILEEKAVISTVLRKYKIEAVDRREDLTLLGELILRPKDGLRVKITPRD

 

>4d1 AC017770 49988-51720

MFLVIGAILASALFVGLLLYHLKFKRLIDLISYMPGPPVLPLVGHGHHFIGKPPHEMVKK

IFEFMETYSKDQVLKVWLGPELNVLMGNPKDVEVVLGTLRFNDKAGEYKALEPWLKEGLL

VSRGRKWHKRRKIITPAFHFKILDQFVEVFEKGSRDLLRNMEQDRLKHGDSGFSLYDWIN

LCTMDTIC (1)

ETAMGVSINAQSNADSEYVQAVKTISMVLHKRMFNILYRFDLTYMLTPLARA

EKKALNVLHQFTEKIIVQRREELIREGSSQESSNDDADVGAKRKMAFLDILLQSTVDERP

LSNLDIREEVDTFMFEGHDTTSSALMFFFYNIATHPEAQKKCFEEIRSVVGNDKSTPVSY

ELLNQLHYVDLCVKETLRMYPSVPLLGRKVLEDCEI (1)

NGKLIPAGTNIGISPLYLGRREEL

FSEPNIFKPERFDVVTTAEKLNPYAYIPFSAGPRNCIGQKFAMLEIKAIVANVLRHYEVD

FVGDSSEPPVLIAELILRTKEPLMFKVRERVY

 

>CYP4D1 ortholog with one N-terminal exon found by Michael Mohler 86%

MFLLLGALLA SGLFVALLVY QLKFKRVIEV ISYMPGPPVL PLVGHGHHFI GKPPHELVKQ

ITEFMSKYAK DETLKVWLGP ELNVLMANPK DVEVVLGTMR FNDKAGEYKA LEPWLKEGLL

VSRGRKWHKR RKIITPAFHF KILDQFVDVF ENGSRDLLRN MEMDRLRQGQ TGFNLYDWIN

LCTMDTIC (1)

ET AMGVSINAQT NADSEYVQAV KTISMVLHKR MFNIFYRFDL TYMLTPLARA

EKRALHVLHE FTEKIIVQRR EELIRGGSKD AAAASDDADA DVGAKRKMAF LDILLQSTID

EKPLTNLDIR EEVDTFMFEG HDTTSSALMF FFYNVATHPE AQKKCFEEIS SVIGQDKSTP

VTYELLNKLH YVDLCIKETL RMYPSVPLLG RRVVEECEI (1)

N GKRIPAGTNI GISPLYLGRR

EELFSEPNSF KPERFDVVTS AEKLNPYAYI PFSAGPRNCI GQKFAMLEIK AIVANVLRHY

HIDFVGDTTE PPVLIAELIL RTKDPLLFKL QDRVY

 

>4d1 alt. splice AC017770 48817-51720

MWLLLSLVLLLAIIALEMRRFLRNMRTIPGPLPLPLLGNAHIFLGLTPAEACLKIGELAE

RHGDTFGLFLGPSYSVMLFNPRDVERVLGSSQLLTKSQEYSFLGRWLNEGLLVSNGRKWH

RRRKIITPAFHFRILEPYVEIFDRQSLRLVEELALRISRGQERINLGEAIHLCALDAIC (1)

ETAMGVSINAQSNADSEYVQAVKTISMVLHKRMFNILYRFDLTYMLTPLARAEKKALNVLH

QFTEKIIVQRREELIREGSSQESSNDDADVGAKRKMAFLDILLQSTVDERPLSNLDIREE

VDTFMFEGHDTTSSALMFFFYNIATHPEAQKKCFEEIRSVVGNDKSTPVSYELLNQLHYV

DLCVKETLRMYPSVPLLGRKVLEDCEI (1)

NGKLIPAGTNIGISPLYLGRREELFSEPNIFKP

ERFDVVTTAEKLNPYAYIPFSAGPRNCIGQKFAMLEIKAIVANVLRHYEVDFVGDSSEPP

VLIAELILRTKEPLMFKVRERVY

 

>CYP4D1 ortholog with alternative splice exon 1 found by Michael Mohler 80%

upstream exon 1

MWLSLVFGAVGTVLVLGLFSWLPFCRRRRRISELAELLPGPKPW

PLLGDAHLFFGLSPAEACLMMGQLAEKY

GDTFKLRLGPCFSVMFFHPSDVEQVLSSTQLVDKADEYDFLARWLNEGLLVSTGRKWHKR

RKIITPAFHFRILEQYVEIFDRQTHQFLSNLDLARGKDDNLVNLGHAVHLCALDVIC (1)

ETAMGVSIN AQTNADSEYV QAVKTISMVL

HKRMFNIFYR FDLTYMLTPL ARAEKRALHV LHEFTEKIIV QRREELIRGG SKDAAAASDD

ADADVGAKRKMAFLDILLQSTIDEKPLTNLDIREEVDTFMFEGHDTTSSALMFFFYNVAT

HPEAQKKCFE EISSVIGQDK STPVTYELLN KLHYVDLCIK ETLRMYPSVP LLGRRVVEEC

EI (1)

NGKRIPAG TNIGISPLYL GRREELFSEP NSFKPERFDV VTSAEKLNPY AYIPFSAGPR

NCIGQKFAML EIKAIVANVL RHYHIDFVGD TTEPPVLIAE LILRTKDPLL FKLQDRVY

 

>4d2 AC017770 comp(32267-34028)

MLGVVGVLLLVAFATLLLWDFLWRRRGNGILPGPRPLPFLGNLLMYRGLDPE (1)

QIMDFVKKNQRKYGRLYRVWILHQLAVFSTDPRDIEFVLSSQQHITKNNLYKLLNCWLGDGLLMSTGR

KWHGRRKIITPTFHFKILEQFVEIFDQQSAVMVEQLQSRADGMTPINIFPVICLTALDIIA (1)

ETAMGTKINAQKNPNLPYVQAVND (2)

VTNILIKRFIHAWQRVDWIFRLTQPTEAKRQDKAI

KVMHDFTENIIRERRETLVNNSKETTPEEEVNFLGQKRRMALLDVLLQSTIDGAPLSDED

IREEVDTFMFEGHDTTTSAISFCLYEISRHPEVQQRLQQEIRDVLGEDRKSPVTLRDLGE

LKFMENVIKESLRLHPPVPMIGRWFAEDVEI (1)

RGKHIPAGTNFTMGIFVLLRDPEYFESPD

EFRPERFDADVPQIHPYAYIPFSAGPRNCIGQKFAMLEMKSTVSKLLRHFELLPLGPEPR

HSMNIVLRSANGVHLGLKPRA

 

>4D2 ORTHOLOG 79% TO 4D2

MLALVVFLVALTTVLVWDYFWRKRRNDILHYMPGPRGLPLVGNALMYRGLDAE (1)

QIMGFVSKNRNKYGPLYKVWVLNQLAVFSTDPHDIEFILSSQQHITKNNLYELLHCWLGTGLLMSTG

KKWHSRRKIITPTFHFKILEQFVEIFDQQSAVMVGQLQQRADGKTAINIFSVVCLLALDIIA (1)

ETAMGTKIQAQMSPNLPYVQAVTD (2)

VTNIMTTRFIHAWQRIDWLFRLVHPGMAKRQDSAIKVMHDFTENIIKQRRQALVSAGKQEKEKEEIK

EDDDLGQKRRMALLDVLLQSTIDGASLSNDDIREEVDTFMFEGHDTTTSAISFCLYEISRH

PQVQQLLVEEIHEVLGVDRHRPVTLRDLGELKYLENVIKESLRLHPPVPMIGRWFNEDVEI (1)

RGKRIPAGTNYTVGIFVLLRDPEYFESPDEFKPDRFDSTSPQTHPYAYIPFSAGPRNCIG

QKFALLEMKSTISKLLRNFELLPLGPEPRPAMNIVLRSANGVHLGLQPRSVLAS*

 

>4d8 AC017388 comp(37292-39859) also AC010557 AC010112 AC010113

MLLFLLVVLLFGAGWIIHLGQADRRRKVANLPGPICPPLIGAMQLMLRLNPK (1)

TFIKVGREYVLKFGHLQRVWIFNRLLIMSGDAELNEQLLSSQEHLVKHPVYKVLGQWLGNGLLLSDGK

VWHQRRKIITPTFHFSILEQFVEVFDQQSNICVQRLAQKANGNTFDVYRSICAAALDIIA

ETAMGTKIYAQANESTPYAEAVNE (2)

CTALLSWRFMSVYLQVELLFTLTHPHLKWRQTQLIR

TMQEFTIKVIEKRRQALEDQQSKLMDTADEDVGSKRRMALLDVLLMSTVDGRPLTNDEIR

EEVDTFMFEGHDTTTSALSFCLHELSRHPEVQAKMLEEIVQVLGTDRSRPVSIRDLGELK

YMECVIKESLRMYPPVPIVGRKLQTDFKY (1)

THSVHGDGVIPAGSEIIIGIFGVHRQPETFP

NPDEFIPERHENGSRVAPFKMIPFSAGPRNCIGQKFAQLEMKMMLAKIVREYELLPMGQR

VECIVNIVLRSETGFQLGMRKRKHN

 

>4d8 orth  D. pseudoobscura Van Alstine and We Liu 79%

MLLLVLVLLLVAVGWLVHRGQAERRRAVSNLPGPMCPPLLGALHIMSSMNPK (1)

TFIKVSGENMRKYG

PLQRVWILNRLLIMSADSEINEQLLSSQEHLVKHPVYRVLGKWLGNGLLLSDGKV

WHQRRKIITPTFHFSILEQFVEVFDQQSNVCVERLAPRANGQTFDVYRPVCMAALD

IIAETAMGTKIHAQAAESTPYAEAVNE (2)

CTALLSWRFISVYLQVELLFTLTHPYMKWRQTQLIRTMHDFTTKVIEERRRTLEEQQ

GSKLSPSPDDDVGRKRRMALLDVLLLATVDGRPLTNDEIREEVDTFMFEGHD

TTTSALSFCLHVLARHPQVQEKMLEEILRVIGTDRKRPVTIRDLNEMKYLECVIKESLRL

YPPVPLVGRKLQTDFKY (1)

SHSKYGDGVIPAGSEFLIGIYGMQRNKNEFAQSEEFIPERHENGERFSPFTFIPFSA

GPRNCIGQKFAQLEMKMMLAKIVREYELLPLGEPVECVINIVLRSD

TGFQLGMRRRNDTQ*

 

>4d14 AC017770 35699-37438 missing intron 3

MYLELFAILLATALAWDYMRKRRHNKMYAEAGIRGPKSYPLVGNAPLLINESPK (1)

TIFDMQFRLIAEFGKNIKTQMLGESGFMTADSKMIEAIMSSQQTIQKNNLYSLLVNWLGDGLLISQ

GKKWFRRRKIITPAFHFKILEDFVEVFDQQSATMVQKLYDRADGKTVINMFPVACLCAMD

IIAETAMGVKINAQLQPQFTYVQSVTT (2)

ASAMLAERFMNPLQRLDFTMKLFYPKLLDKLND

AVKNMHDFTNSVITERRELLQKAIADGGDADAALLNDVGQKRRMALLDVLLKSTIDGAPL

SNDDIREEVDTFMFEGHDTTTSSIAFTCYLLARHPEVQARVFQEVRDVIGDDKSAPVTMK

LLGELKYLECVIKESLRLFPSVPIIGRYISQDTVLDGKLIPADSNVIILIYHAQRDPDYF

PDPEKFIPDRFSMERKGEISPFAYTPFSAGPRNCIGQKFAMLEMKSTISKMVRHFELLPL

GEEVQPVLNVILRSTTGINCGLKPRVY

 

>4d14 D. Pseudoobscura K. Earhart 79%

MFVELLVLLLTVALVWDYLVGRKHKRLFDRAGITGPKAWPLVGNAPLMINESPK (1)

TVFDLQWRLIQTHGKNVRCQILQDRGFMTADPKMIEAIMSSQQTIQKNNLYGLLVNWLGDGLLLSK

GKKWFRRRKIITPAFHFKILEQFVEVFDQQSAIMAKNLYDRADGKTVINMFPVACLCAMD

IIAETAMGVKINAQLQPNFPYVQSVKT (2)

ASGMLAERFVNPAQRLDISMRLFFPSAFAKLSA

NIKAMQDFTNNVISERRDLLQKSISDGTYETTNASPLDDVGQKRRMALLDVLLQSSIDGA

PLSNEDIREEVDTFMFEGHDTTTSSIAFTCYLLARHPEVQARVFQEVRDVLGDEKDAPVN

IQLLGELKYLECVIKESLRLFPSVPIIGRHIVEDTLL (1)

DGKLIPAKTDVMILIYHSQRDPDYFPEPNKFVPERFSPERKGEINPFAYTPFSAGPRNCIG

QKFAMLEMKSTISKMVRHFELLPLGEDVQLVLNLILRSTTGINVGLKPRVY

 

>4d20 AC019509 comp(19731-21636)

MWLTLITGALILLLTWDFGRKRQRVLAFEKSAIPGPISIPILGCGLQALHLGAE (1)

NIIGWVGEKFDKYGKTFRFWILGESLIYTKDLQYFETILSSTTLLEKGQLYEYLRPFLNDGLLVST

GRKWHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTAVDMLKYVSLAALDVIT (1)

EAAMGVQVNAQNDPDFPYIKALKS (2)

VVYIQPDRMFRFSRRYNWLFPLAAPLLHRQLLSDIRVMHDFTDKVISERRETVRRAKADGTYRPL (1)

SLGDAEIGSKSQMALLDILLQSSINNQP

LSDADIREEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASAPVTQ

AQLQDLKYLDCVIKETMRLYPPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHRDANY

FPDPLSFRPERFLEDQEQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYELLP

LGEELKPMLNFILRSASGINVGLRPRKALR

 

>4D20 ORTHOLOG 74% TO 4D20 same as below Contig1058_Contig8213.5

MLLLTLAFGALAVLLTWDFVRKRQRAATLERSKISGPLSLPVLGNGLQALDLGAE (1)

NIVDWVEESFRLYGKTFRMWILGESLIYTKDLKYFEAILGSTTLLQKGQLYKFLRPFLNDGLLLSV

GKKWHARRKVFTNAFHFNVLGHYVDIMDRQAAVMVEKLRQVADGETTVDMLPYVSLAALDVIT (1)

EAAMGVQVNAQSDSEFPYVQALKS (2)

VVYIQSDRMFRFLQRYDWLFRLTCPVLRSKLLKDVRVMHDFTDKVIRERRAAVEQAKADGSYRPL (1)

SLGDPEVGRKSQMALLDILLQATIEGQP

LSDADIREEVDTFMFEGDDTTSSGVSFALYAIARHPQVQARIYRELLQVLGRDPSTPVTQ

AKLQELKYLDCVIRETLRLYPAVPAVGRYTSKEIQIGGQTIPANTSIYLVLYFAHREAEF

FPDPLAFKPERFLDRADSEDRETFAYLPFSAGPKNCIGQKFAMLEMKALVSKVLRCYELL

PRGPEVKPMMNFILRSSTGMNVGLRPRRSP*

 

>4d21 AC020004 55466-57280

MWILLGIAVLIMTLVWDNSRKQWRVNTFEKSRILGPFTIPIVGNGLQALTLRPE (1)

NFIQRFGDYFNKYGKTFRLWILGECLIYTKDLKYFESILSSSTLLKKAHLYRFLRDFLGDGLLLST

GNKWTSRRKVLAPAFHFKCLENFVEIMDRNSGIMVEKLKNYADGKTCVDLFKFVSLEALDVTT (1)

ETAMGVQVNAQNEPNFPYTKALKS (2)

VVYIESKRLASVSMRYNWLFPLAAPLVYRRLQK

DIAIMQDFTDKVIRERRAILERARADGTYKPL (1)

IMGDDDIGGKAKMTLLDILLQATIDNKP

LSDVDIREEVDVFIFAGDDTTTSGVSHALHAISRHPKVQECIYEELVSVLGPDPDASVTQ

TKLLELKYLDCVIKETMRLHPPVPILGRYIPEDLKIGEITIPGNTSILLMPYYVYRDPEY

FPDPLVFKPERWMDMKTTSNTPPLAYIPFSSGPKNCIGQKFANLQMKALISKVIRHYELL

PLGADLKATYTFILSSSTGNNVGLKPRTRVK

 

>Contig1058_Contig8213.5 74% to 4D20 same seq as 4D20 ortholog aligned

with 4d21 in melanogaster/pseudoobscura alignment.  Probably no ortholog to 4d21.

 

>4e1 AC020402 44580-46698

MWIVLCAFLALPLFLVTYFELGLLRRKRMLNKFQGPSMLPLVGNAHQMGNTPT (1)

EILNRFFGWWHEYGKDNFRYWIGYYSNIMVTNPKYME (0)

FILSSQTLISKSDVYDLTHPWLGLGLLTSTGSKWHKHRKMITPAFHFNILQDFHEVMNENST

KFIDQLKKVADGGNIFDFQEEAHYLTLDVICDTAMGVSINAMENRSSSVVQAFKD (2)

ITYTIKMRAFSPWKRNKYLFHFAPEYPEYSKTLKTLQDFTNEIIAKRIEVRKSGLEVGIKADEFSR

KKMAFLDTLLSSKVDGRPLTSQELYEEVSTFMFEGHDTTTSGVGFAVYLLSRHPDEQ (0)

EKLFNEQCDVMGASGLGRDATFQEISTMKHLDLFIKEAQRLYPSVPFIGRFTEKDYVI (1)

DGDIVPKGTTLNLGLLMLGYNDRVFKDPHKFQ

PERFDREKPGPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFEVLPALDELVSKDGY

ISTTLGLQPAEKKSRDAHNHKYDPILSASMTLKSENGLHLRMKQRLVCDST

 

>4e1 D. pseudoobscura ortholog of 4e1 T. Liu INTRON 4 MISSING 73% to 4e1

MWFALYLVLALPLLWLAYLELKSLRRRRVLNKFKGPKVLPVVGNAHQLGRTPP (1)

EILGQMFEWWYQHDKDNFRYWIGYYPNLMVTRTKYFE (0)

FILSSQTLISKAEVYSLMQPWLGLGLLTSTGSKWHKHRKMITPSFHFNVLQDFHEVMNEKS

TKFIKHLKNVSGGGSIVDFQEQAHFLTLDIICETAMGVSINAMENQDSELVQAFKD (2)

MCYNIKVRTFSSWKRNPTLYQFASDYPAYCKTL

KTLQDFTHDVIEKRLNAHKEGTVLASHGDEFSRKKMVFLDTLLSATVDGRPLTSQELYEE

VSTFIFAGHDTTTSAISFTLYLVSRHQDDEQR

KLFEEQRDVMGDSGLDREATFQEISEMKYLDLFIKEAQRVYPSVPFVGRYTEKDYVI (1)

DGDLVPKGTTLHMGIFMLGYDDRVFKEPHKFRPQRFEEEKPGPFEYVPFSAGPRNCIGQKFAL

LEIKTVVSKIIRHFEVLPALDELASKDGYIRTTLGLPPTEKRKRDLQQHKYDPILLVAMS

LKSENGIYLRLKERF*

 

>4e2 AC020402 41848-44099

MWFVLYIFLALPLLLVAYLELSTFRRRRVLNKFNGPRGLPLMGNAHQMGKNPS (1)

EILDTVFSWWHQYGKDNFVFWIGTYSNVLVTSSKYLE (0)

FILSSQTLITKSDIYQLTHPWLGLGLLTST

GSKWHKHRKMITPAFHFNILQDFHEVMNENSTKFIKHLKTVAAGDNIFDFQEQAHYLTLD

VICDTAMGVSINAMENRSSSIVQAFKD (2)

MCYNINMRAFHPLKRNELLYRLAPDYPAYSRTL

KTLQDFTNEIIAKRIEAHKSGAVSTNAGDEFTRKKMAFLDTLLSSTIDGRPLNSKELYEE

VSTFMFEGHDTTTSGVSFAVYLLSRHQDEQ (0)

RKLFKEQREVMGNSELGRDATFQEISQMKY

LDLFIKEAQRVYPSVPFIGRFTEKDYVI (1)

DGDLVPKGTTLNLGLVMLGYNEKVFKDPHKFRPERFELEKPGPFEYVPFSAGPRNCIGQKFALLE

IKTVVSKIIRNFEVLPALDELVSKDGYISTTIGLPDAERKKRDPYRHKYDPILSAVLTLKSENGLYIRLKERH

 

>4e2 pseudoobscura Ajit Narang INTRON 4 MISSING 86% to 4e2

MWFVLYLFLALPLLLVAYLELSTFRRRRALNKFKGPSRLPIVGNAHQAGKNPT (1)

EILDQVFSWWHQYGKDNFRFWIGSYSNLIITNHKYLE (0)

FILSSQTLITKSDIYNLTHPWLGLGLLTST

GSKWHKHRKMITPSFHFNILQDFHEVMNENSTKFIKQLKQVAAGDSIFDFQNETHYLTLD

VICDTAMGVSVNAMENRSSSIVQAFKD (2)

MCYCINMRAFHPFKRNDLFFRLAPDYPAYCKTL

KTLQDFTNNIIEKRIKAHKDGTVSASQGDEFSRKKMAFLDTLLSSTIDGRPLTTQELYEE

VSTFMFEGHDTTTSGVSFAVFLLSRHKDEQRKLFDEQREVMGDSGMDRDATFQEISEMKY

LDLFIKEAQRVYPSVPFIGRYTEKDYII (1)

EGDLVPKGTTLNLALVMLGYNDRVFKDPHKFR

PERFELEKPGPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRHFEVLPALDELASKDGY

ISTSLGYPPEERKKRDLLRHKYDPLLSAVLTLKAENGLFIRLKERH

 

>4e3 AC020324 73117-75125

MWLAVLALLVLPLITLVYFERKASQRRQLLKEFNGPTPVPILGNANRIGKNPA (1)

EILSTFFDWWYDYGKDNFLFWIGYSSHIVMTNPKQLE (0)

YILNSQQLIQKSTIYDLLHPWLGHGLLTSF

GSKWHKHRKMITPSFHFNILQDFHEVMNENSAKFMTQLKKASAGDTIIDFQEHANYLTLD

VICDTAMGVPINAMEQRDSSIVQAFRD (2)

MCYNINMRAFHPFKRSNRVFSLTPEFSAYQKTL

KTLQDFTYDIIEKRVYALQNGGSKEDHDPSLPRKKMAFLDTLLSSTIDGRPLTRQEIYEE

VSTFMFEGHDTTTSGVSFSVYLLSRHPDVQ (0)

RKLYREQCEVMGHDMNRSVSFQEIAKMKYL

DLFIKEAQRVYPSVPFIGRYCDKDYDI (1)

NGSIVPKGTTLNLALILLGYNDRIFKDPHHFRP

ERFEEEKPAPFEYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEVLPAVDELVSTDGRL

NTYLGLAPDEKLKREAGRHKYDPILSAVLTLKSDNGLHLRLRERRS*

 

>D. pseudoobscura ortholog of Cyp 4e3 M. Nooh 81%

MWLAVLALLALPLLVLVYFELRASRRRRMLKVFNGPAPVPVLGNANRVGNTPA(1)

EILATIFDWWQEYGKDNFVFWIGYTPHLAVTNPKYLE(0)

YILNSQSLIQKSTIYELLHPWLGYGLLTSH

GSKWHKHRKMITPSFHFNILQDFHEVMNENSTKFIAQLRRDAAGDSIIDFQDHAHYLTLD

VICDTAMGVPINAMEHRNSAIVQAFKD(2)

MCLSVNMRAFHPFKRSNRIYSLSPEYAAYQRTL

KTLQDFTYDIIEKRVETLQAGQNSSSADSSSPRKKMAFLDTLLSSTVDGRPLTRQEIYEE

VSTFMFEGHDTTTSGVAFAGYLLSRHPEAQ (0)

QRMYQEQCNVMGSELDRDATFQEIAQMKYLDLFIKEAQRVYPSVPMIGRYADKDYMI (1)

NGTLVPKGTTINLALVLLGYNDRIFKDPHHFRP

ERFEEEKPGPFEYVPFSAGPRNCIGQKFALLELKTVISKLVRSFEVLPAVDELLSTDGQL

NTYLGLSPAEKQKREAGRHKYDPILSAVLTLKSDNGLHLRLRERRH

 

>4g1 AC020093 comp(33262-34932) no introns

MAVEVVQETLQQAASSSSTTVLGFSPMLTTLVGTLVAMALYEYWRRNSREYRMVANIPSP

PELPILGQAHVAAGLSNAEILAVGLGYLNKYGETMKAWLGNVLLVFLTNPSDIELILSGH

QHLTKAEEYRYFKPWFGDGLLISNGHHWRHHRKMIAPTFHQSILKSFVPTFVDHSKAVVA

RMGLEAGKSFDVHDYMSQTTVDILLSTAMGVKKLPEGNKSFEYAQAVVDMCDIIHKRQVK

LLYRLDSIYKFTKLREKGDRMMNIILGMTSKVVKDRKENFQEESRAIVEEISTPVASTPA

SKKEGLRDDLDDIDENDVGAKRRLALLDAMVEMAKNPDIEWNEKDIMDEVNTIMFEGHDT

TSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDCTFADTMEMKYLERVILETLRLY

PPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYCVHRRPDIYPNPTKFDPDNFLPERMA

NRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNYIVHSTDTEADFKLQADIILKLE

NGFNVSLEKRQYATVA

 

>4G1 ortholog NO INTRONS 93% IDENTICAL TO 4G1

MTVDTVQETLQHAATSTSGLGFSPMLTTLVGTIVALGLYEYWRRNTREYRMVANIPSPPG

LPLLGQAHMVAGLSNAEILNVGLGYLNKYGETMKAWLGNVLLVFLTNPNDIELILSGHQH

LTKAEEYRYFKPWFGDGLLISNGHHWRHHRKMIAPTFHQSILKSFVPTFVDHSKSVVGRM

GLETGKSFDVHDYMSTTTVDILLSTAMGVKKLPEGNKSFEYAQAVVDMCDIIHKRQVKLL

YRLDSIYKFTKLREKGDRMMNIILGMTSKVVKDRKQNFQEESRAIVDEVQAVSTPATKKE

GLRDDLDDIDENDVGAKRRLALLDAMVEMAKNPDIEWNEKDIIDEVNTIMFEGHDTTSAG

SSFALCMMGIHKDIQEKVFAEQKAIFGDNMLRDCTFADTNEMKYLERVILETLRLYPPVP

LIARRLDYDLKLASGPYTVPKGTTVIVLQYCVHRRADIYPNPTKFDPDNFLPERMANRHY

YSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNYIVHSTDTEADFKLQADIILKLENGFN

ISLEKRKYATVA

 

>4g15 AC013897 comp(8972-10574 and 5306-6643) two pieces

MEVLKKDAALGSPSSVFYFLLLPTLVLWYIYWRLSRAHLYRLAGRLPGPRGLPIVGHLFDVIGPAS (1)

SVFRTVIRKSAPFEHIAKMWIGPKLVVFIYDPRDVELLLSSHVYIDKASEYKFFKPWLGDGLLIST (1)

GQKWRSHRKLIAPTFHLNVLKSFIELFNENSRNVVRKLRAEDGRTFDCHDYMSEATVEILL (1)

ETAMGVSKKTQDKSGFEYAMAVMRMCDILHARHRSIFLRNEFVFTLT

RYYKEQGRLLNIIHGLTTKVIRSKKAAFEQGTRGSLAQCELKAAALERER

EQNGGVDQTPSTAGSDEKDREKDKEKAS

PVAGLSYGQSAGLKDDLDVEDNDIGEKKRLAFLDLMLESAQN

GALITDTEIKEQVDTIMFEGHDTTAAGSSFFLSLMGIHQDIQDRVLAELDSIFGDSQRPATFQ (0)

DTLEMKYLERCLMETLRMYPPVPLIARELQEDLKLNSGNYVIPRGATVTVATVLLHR

NPKVYANPNVFDPDNFLPERQANRHYYAFVPFSAGPRSCV (1)

GRKYAMLKLKILLSTILRNYRVYSDLTESDFKLQADIILKREEGFRVRLQPRTS

 

>4G15 ortholog (94%) intron #4 missing, black region does not match

MEVLKKDAAMGSPSSVFYFLLLPTLVLWYIYWRLSRAHLYRLAGRLPGPRGLPIVGHLFDVIGPAS (1)

SVFKTVIRKSAPFEHIAKMWIGPKLVVFIYDPRDVELLLSSHVYIDKASEYKFFKPWLGDGLLIST (1)

GQKWRSHRKLIAPTFHLNVLKSFIELFNENSRNVVRKLRAEDGRTFDCHDYMSEATVEILL (1)

ETAMGVSKKTQDKSGFEYAMAVMRMCDILHARHRSIFLRNEFVFTLT

RYYKEQGRLLSIIHGLTTKVIRSKKAAFEQGTRGSLAQCELKAAALERER

GQEQKQEQKQEQAEMGSAGGGKAAGEGT

PVAGLSYGQSAGLKDDLDVEDNDIGEKKRLAFLDLMLESAQN

GALITDTEIKEQVDTIMFEGHDTTAAGSSFFLSLMGIHQEIQDRVIAELDGIFGDSQRPATFQ

DTLEMKYLERCLMETLRMYPPVPLIARELQEDLKLNSGDYVIPRGATVTVATVLLHR

NPKVYTNPNVFDPDNFLSERQANRHYYAFVPFSAGPRSCV (1)

GRKYAMLKLKILLSTILRNYRVYSDLSESDFKLQADIILKREEGFRVRLQA

 

>4p1 AC018129 comp(67703-69662)

MIILWLILALSALLYWLHRANKDYHILSFFTKRIRLKDGTPVEIIAPIAKGKTIFGNTLDLYGRDH (1)

AGVFNYSRERAKEMGTSYIEYVFGKAIYNIIDADSAENVLNHPNLITKGLVYNFLHPFLRTGLLTST (1)

GKKWHARRKMLTPTFHFNILNQFQEIFK (2)

TESQKFLLQFEGQDEVTITLHDVIPRFTLNSIC (1)

ETAMGVKLDEMAEKGDRYRENFSQIEECFIRRLSNPLLWGDKLFEM

FAAKDFASALDVVHRFSSEIIAKRRDLLKDELDKSSSTADDDG (2)

FVSKKRFAMLDTLIYAE

KDGLIDHIGICEEVDTLMFEGYDTTSIGLIFGLMNMSLNPDKQELCYQEIQEHID (1)

DDLSNLDVGQLNKLKYLEYFMKETTRLFPSVPIMGREAVQETELANGLILPKGAQITIHVFDIHR

NAKYWDSPEEFRPERFLPENVQDRHTYAYVPFSAGQRNCI (1)

GKKYAMQEMKTLMVVLLKQFKVLKAIDPQKIVFHTGITLRTQDKIRVKLVRRT

 

>D. pseudoobscura ortholog of Cyp4p1 Jie Shen 72% to 4P1

MIVFLLTVALCALVLWLYRINKDYYILAFFSRRVRTKDGRPVESILPSPKGRTIFANCFDMYGKDL (1)

AGVFSYSRELSQRLGESYLEYGMGVPLLNIIDAENAENILNHPKLITKSLVYDFLQPALRTGLLTST (1)

EKKWHARRKMLTPTFHFNILGQFQEIFR (2)

AESLKFVQQFQSQDESIVSLSDLIPRFTLNSIC (1)

ETAMGVKLDEMAEKGDRYREGIHMIEMSFIRRLSNPLLWNKTIYNW

FAAKTYDAFLKTVHEFSSEIIAKRRILLEEELEHRRSTQTADDDI (2)

FGSRKKRFAMLDTLICAEKDGLIDHAGICEEVDTLMFEGYDTTSIGLIFSLMNMSLYPEKQELCYKEIEEHID (1)

DSFDNLDNNQLSKLKYLEYFIKETMRLFPSVPIMARQTIQETELANGLILPERSQITIHVFD

VHRNPKYWDSPNEFRPERFLPENCQNRHTYAYIPFSAGQRNCI (1)

GQKFAMQEMKTLIVVLLKKFRILPLIDPKTIVFNVGITLRTQNNIQVKLVRRK

 

>4p2 AC018129 comp(70087-72192) revised 9/11/2000

MMICLLWISVAILVVIHWIYKVNKDYNILAFFARRVQTKDGKPLDSLVPMIKGRTVFANCFDLLGKDT (1)

DQVFTHLRQLAKNSGDSYLQYSMGFSNFNVIDAHNAANILNHPNLITKGVIYNFLHPFLRTGVLTAT (1)

EKKWHTRRSMLTRTFHLDILNQFQEIFI (2)

AESLKFVSQFQGQNEVVVSLKDRISRFTLNSIC (1)

ETAMGIKLDEMAEKGDRYRANFHIIDEGLTRRIVNPLYWDDCVY

NMFTGHKYNAALKVVHEFSREIIAKRRVLLEEELENRRATQTADDDI (2)

CVIRKKRFAMLDTLICAEKDGLIDDIGISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAAEQELCYQEIQEHIL (1)

DDLSNLNLSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELENGLILPKRSQINIHV

FDIHRNPKYWESPEEFRPERFLPQNCLKRHPYAYIPFSAGQRNCI (1)

GQKYAMQEMKTLMVVILKHFKILPVIDPKSIVFQVGITLRFKNKIKVKLVRRNCV

 

>CYP4P2 ORTHOLOG FOUND BY B. WU 78% to 4p2

TMIVVLWLTVALCVIVHWLYRVNKDYYIMAFFSRRVRTKDGRPVESIVPMIKGRTVFANCFDLLGKDT (1)

DQVFTHLRQLAKNSGDSYLQYSMGFSNFNVIDAHNAANILNHPNLITKGVIYNFLHPFLRTGVLTAT (1)

EKKWHARRKMLTRTFHFNILEQFQEIFQ (2)

AESLKFVQQFQSQDESIVSLSDLIPRFTLNSIC (1)

ETAMGVKLDEMAEKGDRYREGIHMIEMSFIRRLSNPLLWNKTIY

NWFAAKTYDAFLKTVHEFSSEIIAKRRILLEEELEHRRLTQTADDDI (2)

FVSRKKRFAMLDTLICAEKDGLIDHAGICEEVDTLMFEGFDTTSIGLIFSLMNMSLYPEKQELCYKELEEHID (1)

DNFDNLDHNQLSKLKYLEYFIKETMRLFPSVPIMARQTIQETELANGLILPERSQIT

IHIFDVHRNPKYWDSPNEFRPERFLPENCQNRHTYAYIPFSAGQRNCI (1)

GQKFAMQEMKTLIVVLLKKFRILPLIDPKTIVFNVGITLRTQNNIQVKLVRRN*

 

>4p3 AC018129 comp(65426-67385) revised 9/11/2000

MLILWLVGAFIVLIQWIYRLNRDYCILGFFAKRIRTKNGQNPESIAPLVKGSTIFANSFDLYGKDH (1)

SGVFEHSRDCAKKLGKSYAEYAMGTAIYNVIDADSAERVLNDPNLINKGTIYDFLHPFLRTGLLTST (1)

GKKWHARRKMLSPTFHFNILNQFQEIFI (2)

TESLKFLEQFKGNDEAIISLNEVIPRFTLNSIC (1)

ETAMGVKLDEMAEKGDRYRENFRQIEECFIRRMSNPLLWSDTLFKM

FAEKDYASALDVVHGFSSEIIAKRRDQLNDEIDSRGNTQTAEDEL (2)

FTSKKRFAMLDTLILAEKDGLIDHIGICEEVDTLMFEGYDTTSIGLMFGLMNMSLYPEEQEKCYQEIQANID (1)

DELNILNIGQLNKLKNLEYFIKETMRLFPSVPAMGRETTRETELSNGLILPKGSQIFVHVFDI

HRNPEYWDSPEEFRPERFLPENSQNRHTYAYIPFSAGQRNCI (1)

GQKFAMQEMKTLMVALLKQFQILPEIDPKTIVFQTGLTLRTKNQIHVNS

 

>CYP4P3 L. Hunt 66% to 4p3

MITLWLTVALCVVIHWLYQVNKDYYILAFFSRRVYTRDDRPVESLVPSPKGRTIFAHCFDLYGKDN (1)

AGVFKFTRDLSKTLGKSYVRYVVGMPIYNVIDAETAEMILTDQKSLIGKGCVYNFLHPALKTGLLTSQ (1)

GDKWHARRRMLTPTFHFNILGQFQEIFQ (2)

AESLKFVQQFQSQDENIVSLSELIPRFTLNTIC (1)

ETAMGVKLDEMADKGDRYRESFHMIEKSFVRRLSNPFLRSTTIYN

LFVAKEYAPFLKVVHDFSSEIIAKRRILLEEELEHRRSTQTADDDI (2)

FVSRHKRFAMLDTLICAEKDGMIDHAGICEEVDTLMFEGYDVSSITLIFTLMNMSLYPDKQELCFKEIQEHIE (1)

DDFSNLDINQMSKLKYLEYFIKETMRLFPPIPLMGRQAVQETELANGLILPSGTQIHIHTF

DIHRNPKHWDSPNEFRPERFLPENSQNRSVYAYIPFSAGQRNCI (1)

AQKFAMQEMKTLMTVILKKFEIQPLVDPNSIVFHVGITLRIKNHIRV

 

>4s3 AC018488 comp(98620-101060) also AC015418 AC018487

MSTLALVAFVLWAAFLRYLPKILNFLRLQRFAKTLPGPTIGELIANVKKG (1)

EILNWLKELREKHGPVFRIWFGKDLMVMFTDPEDIKQLLGNNQLLTKSRNYELLEPWLGKGLLTNGGESW

HRRRKLLTPGFHFRILSEFKEPMEENCRILVRRLRTKANGESFDIYPYITLFALDAICET

AMGIKKHAQLQSDSEYVQAVQS (2)

ICRVMHKQSFSFWQRLNVFFKHTKPGKEREAALKVLHD

ETNRVIRLRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIREE

VDTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAFEEASELEGREKESMPYLEAVIKETLR

IYPSVPFFSRKVLEDLEVGKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRFLVNEKQ

MHPFAFAAFSAGPRNCI (1)

GQKFAMLELKTSLAMLLRSYRFLPDKDHQPKPLAELVTKSGNG

IRLRILPRDENGTTA

 

>D. pseudoobscura ortholog of Cyp4s3 L. Yang

MNTWALMAFALWALFLRYLPQILTFLRLQRFAKTLPGPSVSELIANVKKG (1)

EILNWLKELRERHGPVFRIWFGKDLMVMFSDPEDIRQLLGNNSLLYKSRNYALLEPWLGKGLLTNGGESW

HRRRKLLTPGFHFRILSEFKEPMEENCRILVSQLKERANGEAFDIYPYITLFALDAICET

AMGIKKHAQLQSESEYVKAVQT (2)

ICRVMHKQSFSFWQRLNIFFKYTQAGQERDGALRVLHD

ETNRVIRLRREQLVKERQLQQRTEAAQDDVGSKRRLAFLDMLLLTQLEGGDELSDRDIRE

EVDTFMFEGHDTTSSAIAFALSLLSKHSEVQQRAYEEARDLEGREKESMPYLEAIIKETL

RLYPSVPFFSRKVFEDIQVGKHTIPKGASVNCLIYMLHRDCNNFPDPERFDPDRFYLNEK

QMHPFAFAAFSAGPRNCI (1)

GQKFAMLELKCSLSSLLRSFQFMPDEDHQPIPLAELVMKSGNGVRLRIQPRSQH*

 

>4aa1 AC020355 comp(15477-16779) and AC007579 comp(38212-38842)

MHLRLLSPPQLERTTNLELCSILILLVISLSIYTFYATLNTYLRSVLLSLRLTGPPSLPFLGNCMLVTDKD (1)

LMRRCAGKAFDLYGSLVRIWVLLFPFFAVLEPEDLQVILSSKKHTNKVF

FYRLMHNFLGDGLITSSGSKWSNHRRLIQPAFHHNLLEKFIDTFVDASQSLYENLDAEAV

GTEINIAKYVNNCVLDILN (1)

EAVLGVPIKKRGQDVAMMEDSPFRQGKIMMPARFTQPWLLL

DGIYHWTKMANDELNQKKRLNDFTRKMIQRRRQIQNNNNGNSERKCLLDHMIEISESNRD

FTEEDIVNEACTFMLAGQDSVGAAVAFTLFLLTQNPECQDRCVLELATIFEDSNRAPTMT

DLHEMRYMEMCIKEALRLYPSVPLIARKLGEEVRLAKHTLPAGSNVFICPYATHRLAHIY

PDPEKFQPERFSPENSENRHPYAFLPFSAGPRYCIGNRFAIMEIKTIVSRLLRSYQLLPV

TGKTTIAATFRITLRASGGLWVRLKERDHPLIAH

 

>4aa1  S. Yu 79%

MQFYTRMTV (frameshift)

PQLERATRTELCSILALLVISLSIYLFYAHLDTYLRSVILSLRLSGPPTLPILGNCLLIKDKD (1)

LMRNQAAKAFDLYGSLVRIWVLFFPFFVVLQPEDLQVILSSQKHTNKVFIYQLMHNFL

GDGLITSSGLKWSTHRRLIQPAFHLSLLEKFIGTFVDASQSLYESVGASAVGTDINIVSI

VNNCVVDILN (1)

EAVLGVPIKKKGLDLVKIDESPFRQGKLMIPTRFSHPWLLFDGIYHWTKL

ANDELNQKKRLHDFTRQMIKIRREILANTGNNNAERKCLLDYMIEISESNPDFTEQDIVN

EACTFMLAGQDSVGGAVAFTIFLLAQNAECQEQCHEELERIFDYSDRAPTMSDLREMRYL

EMCIKEALRLYPTVPLIARKLGEEVRLSDHTLPAGSNIFICPYATHRLNNIYPEPEKFNP

ERFSPENSKDRHPYAFIPFSAGPRYCIGNRFAIMEMKTIVSRLLRSFQLLPVAGKTTFDV

SYRITLRASGGLWVRLKPRDHPISQTRDSDCFGL*

 

>4ac1 AC017771 comp(24745-26507)

MWIALLGIPILLAVLTLLLKHINKTYFILSLTKRVRTEDGSPLESKVAIMPGKTRFGNNLDILNFTP (1)

ASVFNFVRESTAKAKGQNYLWYFLYAPMYNVVRPEEAEEVFQSTKLITKNVVYELIRPFLGDGLLIST (1)

DHKWHSRRKALTPAFHFNVLQSFLGIFK (2)

EECKKFLNVLEKNLDAELELNQVIPPFTLNNIC (1)

ETALGVKLDDMSEGNEYRKAIHAIEEVLIQRVCNPLMYYNWYFF

VYGDYRKHLQNLRIVHDFSSRIIERKRQQFQQKQLGEVDEFGRKQRYAMLDTLLAAEADG

QIDHQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYEEVENLPEDSDDISMF

QFNKLVYLECVIKESLRMFPSVPFIGRQCVEETVVNGMVMPKDTQISIHIYDIMRDPRHF

PKPDLFQPDRFLPENTVNRHPFAYVPFSAGQRNCIGQKFAILEMKVLLAAVIRNFKLLPA

TQLEDLTFENGIVLRTQENIKVKLSKRVK*

 

>4AC1 D. pseudoobscura Y. Zhuang deletion at heme 82%

MLIALLGTPLLLLGVWLLLQRLNRTYFILSLTRRVRTEDGSPLESKVAVMPGTTRFGNNLDVLNCTP (1)

SSLFNFLRDSAAKAQGRNFLWYFLFAPMYNVIRAEEAEEIFQSTKLITKNVIYELLRPFLGEGLLIST(1)

DQKWHSRRKALTPAFHFNVLQSFLAIFK(2)

EECNKLIKVLDKKVDGELDLNQVIPQFTLNNIC (1)

ETALGVKLDDMSEGNQYRRAIHAIEEVLIQRVCNPLMFYNW

YFFLIGDYRKQVQNLRIVHDFSSRIIERKRQQFKRKQLGVVDDFGKKQRYAMLDTLLAAE

AEGQIDHQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEEVQERCLEEVSTLPEDTDSI

SVFQFNELVFLECVIKESLRMFPSVPFIGRTCVEECVVNGLILPKDTQISIHIYDIMRDP

RHFPNPHEFQPERFLPENTVDRHPFAFVP

16 aa deletion of heme signature region

EIKVLLAAVLRNFRILPVTRLEDLTFENGIVMRTQQNVKVKLVRR*

 

>4ac2 AC017771 comp(22220-24109) revised 9/8/2000

MFLEVLFAAPLVIFIFRKLWAHLNRTYFILSLCKRIRTEDGSLLESKIYVAPSKTRFGNNFDLVNFTS (1)

ESIFNFMRDASAKAKGRNYLWYFFHAPMYNIVRAEEAEEILQSSKLITKNMIYELLKPFLGEGLLIST (1)

DQKWHSRRKALTPAFHFKVLQSFLIIFK (2)

EECNKLVKVLHQSVNMELELNQVIPQFTLNNVC (1)

ETALGVKLDDLSEGIRYRQSIHAIEEVMQQRLCNPFFYNIVYF

FLFGDYRKQVNNLKIAHEFSSNIIEKRRSLFKSNQLGQEDEFGKKQRYAMLDTLLAAEAD

GQIDHQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYEEIKYLPDDSDDISV

FQFNELVYMECVIKESLRLFPSVPFIGRRCVEEGVVNGLIMPKNTQINIHLYEIMRDARH

FSNPKMFQPDRFFPENTVNRHPFAFVPFSAGQRNCIGQKFAILEIKVLLAAVIRNFKILP

VTLLDDLTFENGIVLRTKQNIKVKLVHRENK

 

>Contig3635_Contig7816.24 75% to 4ac2 74% to 4ac1

MFELLLGVPLIVLLCCVLLRRLNRKYFVLSLCKRLQAEDGSPLESKIAVMPGRTRFGNNFDLLNFTP (1)

STVFNFMRDSCANARGRNYLWYFFGSPMYNVIRAEEAEEIFQSTKLLTKNVVYDLLRPFLGEGLLTST (1)

DQKWHARRKALTPAFHFNVLQSFLAIFK (2)

EECHKLVKVLHESVESEALVLNQVIPQFTLNNIC (1)

ETALGVKLDDMAEGFQYRESIHAIEAVILQRICNPFLYNSLYFYLY

GDYRKHIDSLKIAHDFSSSIIERRRRDIKRKELGVVDDFGKKQRYAMLDT

LLAAEADGQIDHQGICDEVNTFMFEGYDTTSTCLIFTLLMLSLHKDVQER

CLEEVSALPEDTDSISVFQFNELVFLECVIKESLRMFPSVPFIGRQCTEE

CVVNGLVMPKDTHINIHIYDIMRDPRHFPNPNAFQPERFLPENTVDRHPF

AFVPFSAGQRNCIGQKFAILEIKVLLAAVLRNFKILPDTRFEDLTIENGI

VLRTQQKVKVKLVQRVG*

 

>4ac3 FROM DROSOPHILA

MWIALLGSSLLIGALWLLLRQLNKTYFILSLCKRVRTADGSPLESKVFVVPGKTRFGNNLDLLNLTP (1)

ANIFSYIRESTAKANGQNYIWNFLFAPEYNIVRAEDAEEIFQSTKITTKNMSYELIRPFLGDGLLISI (1)

DQKWHTRRKTLTPAFHFNILQSFLSIFK (2)

EESKKFIKILDKNVGFELELNQIIPQFTLNNIC (1)

ETALGVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFF

LFGDYKKYSRILRTIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAEG

KIDHQGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDEVSMF

QFNELIHLECVIKESLRLFPSAPIIGRTCIEESVMNGLVLPKNAQISIHIYDIMRDARHF

PKPNQFLPERFLPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLPA

TQLEDLTFENGIVLRTQQNIKVKFEARVK

 

>NO 4AC3 ORTHOLOG FOUND.  This fragment most like last half of CYP4P exon 1

YIMAFFSRRVRTKDGRPVESIVPVPKGRTIFANCLDLYGKDH (1)

 

>4ad1 AC020402 comp(36565-39829)

MFLIAIAIILATILVFKGVRIFNYIDHMAGIMEMIPGPTPYPFVGNLFQFGLKPA (1)

EYPKKVLQYCRKYDFQGFRSLVFLQYHMMLSDPAEIQ (0)

NILSSSSLLYKEHLYSFLRPWLGDGLLTSSGARWLKHQKLYAPAFERS

AIEGYLRVVHRTGGQFVQKLDVLSDTQEVFDAQELVAKCTLDIVC (1)

ENATGQDSSSLNGETSDLHGAIKD (2)

LCDVVQERTFSIVKRFDALFRLTSYYMKQRRALSLLRSELNR (0)

IISQRRHQLAAENTCQQGQPINKPFLDVLLTAKLDGKVLKEREIIEEVSTFIFT (0)

GHDPIAAAISFTLYTLSRHSEIQQKAAEEQRRIFGENFAGEADLARLDQMHYLELIIRETLRLYPSVPLIARTNRNPIDI (1)

NGTKVAKCTTVIMCLIAMGYNEKYFDDPCTFRPERFENPTGNVGIEAFKSVPFSAGPRRCI (1)

AEKFAMYQMKALLSQLLRRFEILPAVDGLPPGINDHSREDCVPQSEYDPVLNIRVTLKSENGIQIRLRKR

 

>4AD1 of D. pseudoobscura R. Aziz 87%

MFLIAIAIILATILVFKGVKIFNYIDHMAGIMEMIPGPTPYPFVGNIFQFGLKPA (1)

EYPKKVLQYCRKYDFQGFRSLVFLQYHMMLSDPAEIQ (0)

NILSSSSLLYKEHLYSFLRPWLGDGLLTSSGARWLKHQKLYMPAFERSAIEGYLRVVHR

TGGKFVQKLNELTETLEVFDAQELVAKCTLDIVC (1)

ENATGLVSNSLNDEPSDLHGAIKD (2)

LCDVVQERTFSIVKRFDALFRLTSYYMKQRRALSLLRREIYR (0)

IITQRRQQLADENTCGERTKKINKPFLDVLLAAKLDGRALKEREIIEEISTFIFA (0)

GHDPVAAAISFTLYTLSRHTEIQQRVFEEQQRIFGQDLTAEADIGRLDQM

RYLELVIRETLRLYPSVPLIARTNRKPIDI (1)

NGTKVAKRTTVIMCLIAMGYNEKYFEEPCVFRPERFETAGADVGIEAFKSVPFSAGPRRCI (1)

AERFAMYQLKALLSQLLRNFEILPPVNGLSSGINDHSQVECVPQSEYDPVLNIRVTLKSENGIQIRLGKRAFVE*

 

>4ae1 old 4e4 AL009194 16210-17867

MLVVLLVALLVTRLVASLFRLALKELRHPLQGVVPSVSRVPLLGAAWQMRSFQPD (1)

NLHDKFAEYVKRFGRSFMGTVLGHVVMVTAEPRHIDALLQGQHQLKKGTMYFALRGWLGDGLLLS

RGKEWHTMRKIITPTFHFSILEQFVEVFDRQSSILVERLRTLSYGNEVVNIYPLVGLAAL

DIITETAMGVNVDAQGADSEVVHAVKD (2)

LTNILATRFMRPHLLFPHLFRLCWPSGFRKQQA

GVICLHEFTNGIIEQRRRLLAREANQDKPTKPHALLDTLLRATVDGQPLTDKQIRDEVNT

FIFEGHDTTTSAVSFCLYLLSRHEAVQQKLFEELRMHYGQDLFRGVILSDFATLPYLSCV

VKESLRLYPPIPAVARCLEKDLVI (1)

DEGYIPVGTNVVVLLWQLLRDEAIFTDPLVFQPERHLGEEAPRLSPYSYIPFSAGPRNCIG

QKFALLEMKTMVTKVIRHYQLLPMGADVEPSIKIVLRSKSGVNVGLRPRLY*

 

>4AE1 ortholog Stephanie Nance 71%

MLMALLLTMALTLIVAWLLQLALREMRHPLRGFVPSVSRVPLVGAAWQMRSFQPD (1)

NLHEKFAEYVERFGRSFMASVCGQVIMVTAEPSHVDALLHSQKQLRKSSIYGALRGWLGNGLLLS

QGEQWHGMRKIITPTFHFSILEEFVEVFDKQSQLLVERLQPLSNGGMVAINIYPYVGLAA

LDIITETAMGVCVNAQLDADSAVVQAVKA (2)

VTNTLATRFMRPHLLPPLLFRLCWPSGFRKQ

QEGIKCLHLFTNSIIEQRRQLLRRENAPGEPVARDRRNALLDTLLRATVDGQPLTDKQIR

DEVNTFIFEGHDTTTSAISFCLYLLSRHAAVQERLFDEVKGHFGRELDRCVVYSDFAALP

FLNCVVREALRLYPPIPALGRCLETDLAV (1)

EGGRIPAGTNVILLLWQLLRDEMLFADPLIFRPERHLSNKATSKKGAYSNIPFSAGPRNCIG

QKFAMFEVKTMIIKMLRNFILLPIGPDVEPSIKIVLRSRNGVHFGLRPRVY*

 

>6a2 AC007549 comp(100072-101661)

MFVLIYLLIAISSLLAYLYHRNFNYWNRRGVPHDAPHPLYGNMVGFRKNRVMHDFFYDYY

NKYRKSGFPFVGFYFLHKPAAFIVDTQLAKNILIKDFSNFADRGQFHNGRDDPLTQHLFN

LDGKKWKDMRQRLTPTFTSGKMKFMFPTVIKVSEEFVKVITEQVPAAQNGAVLEIKELMA

RFTTDVIGTCAFGIECNTLRTPVSDFRTMGQKVFTDMRHGKLLTMFVFSFPKLASRLRMR

MMPEDVHQFFMRLVNDTIALRERENFKRNDFMNLLIELKQKGRVTLDNGEVIEGMDIGEL

AAQVFVFYVAGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTVLEEQEGQLTYESIKAMTYLNQVIS (1)

ETLRLYTLVPHLERKALNDYVVPGHEKLVIEKGTQVIIPACAYHRDEDLYPNP

ETFDPERFSPEKVAARESVEWLPFGDGPRNCIGMRFGQMQARIGLAQIISRFRVSVCDTT

EIPLKYSPMSIVLGTVGGIYLRVERI

 

>6a2 orth found byu F. Cao

MLILIYLVIAVGSLVAYLLHRNFQYWKRKGVPHDPPHPFYGNLVGFRKNRVIHDIFYDYY

NKFRTSGSPFVGFFFLQKPAAFIVDTKLAKNILIKDFSNFADRGQFHNERDDPLTQHLFN

LDGKRWKELRQRLSPTFTSGKMKLMFPTVIKVSEEFASVMEEQVPPTQGGAIIEIKEMMA

RFTTDVIGTCAFGIECNTLRTPVTDFRTMGQKAFTELRHGQLLTFFIFSFPKLARRLRMR

IMPEDVHQFFMRLVNDTVAVREKENFKRHDFMDMLIEIKQKGSVTLENGEVMKAMDIGEL

AAQVFVFYLAGFETSSSTMSYCFYELAQHQDIQDKLRS EVLTVLAEHDGKLTYECVKEMRYLDQVFS (1)

ETLRLYTLVPHLERRALSDYVVPGHPDLVIEKDTQIIIPACAYHRDENLYPDP

LRFDPDRFSAEQVAARDSVEWLPFGDGPRNCIGMRFGQMQARIGMAQLLSRFKLSLCDKT

EIPLKYEPKSFVLGSIGGIYLRLERI

 

>6a8 AC020447 comp(122688-124264)

MALTYILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQ

DHYNKFRESKAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDPISAH

LFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRDLVA

RFTVDVIGTCAFGIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGFMRSYPKLARKLGMV

RTAPHIQEFYSRIVTETVAVREKEHIKRNDFMDMLIELKNQKEMTLENGDVVRGLTMEEV

LAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHDQNFTYECTKDLKYLNQVLD (1)

ETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEP

FEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSKT

PNPLVYDPKSFVLGVKDGIYLKVETV

 

>D. pseudoobscura ortholog of 6a8 found by K. Cheng

MGVTYVLLQVAVALLAIVTYYVYRRLSYFKSRGIPHDTPHLILGNMQGVFTKRNVHEILK

KYYEKYRESKVPFVGFYFFQKPSAFILDLDLAKHILIKDFSNFSDKGLFYNEKDDPISAH

LFNLDGPQWKVLRNKLTSTFTAGKMKFMYPTVVSVAEEFIDVMHEKMKQNSVLEIRELMA

RFTVDVIGTCAFGIKCNSLRDENAEFLRFGKRTFVDKRHGSFLTGFMTSYPKLARRLRLV

RTPTHIRNFYERIVHETVAMREKENIKRNDFMDLLIDMKNQKVKLENGDLVDGLTIDEIL

AQAFVFLIAGFETSSSTMGYALYELAKQPHIQDKVRAEVEEVLEQHEQKFTYESTKDLKYLEQVIF (1)

ETLRLHTIVPHLDRMAHKRYVVPGHPNFVIEAGQSVIIPASAIHVDPNIYPDPY

KFRPERFSPEESAKRNSLAWLPFGDGPRNCIGLRFGKMQTTIGLALLIKNFKFSTCPKTP

DTLSYSPKSFVLAVDGIHLKVEAV*

 

>6a9 AC020447 comp(115043-116610)

MGVYSVLLAIVVVLVGYLLLKWRRALHYWQNLDIPCEEPHILMGSLTGVQTSRSFSAIWM

DYYNKFRGTGPFAGFYWFQRPGILVLDISLAKLILIKEFNKFTDRGFYHNTEDDPLSGQL

FLLDGQKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQAMEKSPIVEVRDILAR

FTTDVIGTCAFGIECSSLKDPEAEFRVMGRRAIFEQRHGPIGIAFINSFQNLARRLHMKI

TLEEAEHFFLRIVRETVAFREKNNIRRNDFMDQLIDLKNSPLTKSESGESVNLTIEEMAA

QAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKECQEVIGKYNGEITYESMKDMVYLDQVIS (1)

ETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNT

FNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRFKFSVCEQTTI

PIVYSKKTFLISSETGIFLKVERV

 

>78% TO 6A21

MAVGVGALLLWTLVALVVYLLLKWLLGRQYWQNLGIPCEEPHWLLGS

MWGLRTTRTFNDVWTDYYKKYRLSGPFAGFYWFQRPAVFVLEPSLAKLILIKEFNKFTDR

GFFHNPEDDPLSGQLFLLDGHKWKSMRHKLSSTFTSGKMKYMFPTVVKVSHEFTEVFGQM

ADKSPIVEVRELLARFTTDVIGTCAFGIDCSSLKDPDAEFRKMGRRALTENRHGSLGIAF

LNSFPKLSRKLHLKMTAEPIEQFFMRIVKETVKFREQNQIRRNDFMDQLIDLKNNQIIKT

ESGDNINLTIEEIAAQAFVFFAAGFETSSTTMGFALYELAQHPDIQQRVREECQEVIQKY

GGELTYESMKELVYLDQVIS (1)

ETLRLYTVLPVLNRECLEDFVVPDNPKYVIKKGMPILIPA

GAMHRDERFYPNPDAFNPDNFSPERVKNRDSVEWLPFGDGPRNCIGMRFGQMQARIGMAM

LLKDFKFSVCDETAFPMKYDLESFLIASKTGISLRVERV

 

>6a13 AC020451 3757-5238 also AC007085 126189-124714 no introns

MLTLLVLVFTVGLLLYVKLRWHYSYWSRRGVAGERPVYFRGNMSGLGRDLHWTDINLRIY

RKFRGVERYCGYFTFMTKSLFIMDLELIRDIMIRDFSSFADRGLFHNVRDDPLTGNLLFL

DGPEWRWLRQNLTQVFTSGKMKFMFPNMVEVGEKLTQACRLQVGEIEAKDLCARFTTDVI

GSCAFGLECNSLQDPESQFRRMGRSVTQEPLHSVLVQAFMFAQPELARKLRFRLFRPEVS

EFFLDTVRQTLDYRRRENIHRNDLIQLLMELGEEGVKDALSFEQIAAQALVFFLAGFDTS

STTMSFCLYELALNPDVQERLRVEVLAVLKRNNQKLTYDSVQEMPYLDQVVAETLRKYPI

LPHLLRRSTKEYQIPNSNLILEPGSKIIIPVHSIHHDPELYPDPEKFDPSRFEPEEIKAR

HPFAYLPFGEGPRNCIGERFGKLQVKVGLVYLLRDFKFSRSEKTQIPLKFSSRNFLISTQ

EGVHLRMEGLERP

 

>CYP6A13 ortholog Contig3531_Contig5436.180 77% to 6A13 no introns

MWTLLALVLVAGALIYSRLLEHYDYWRRKGVAGEKPVLFLGNMSGLGKGL

HWTDINRRIYEKFSKTERFCGYFTFFSKAFFVMDLELIKKITISDFSSFA

DRGLFHNVKDDPLTGNLLFLDGPEWRWLRQNLTQVFTSGKMKFMFPTMLS

VGEKLTQACELQVGEIEAKDLCARFSTDVIGSCAFGLECNSLNDPNSEFR

RMGRSVTTNPLHTGMVQGFMFAQPKLARMLHMRLFRPEVSEFFLETVRQT

LAYRKRENVQRSDLIQLLMDLGEEGTKDGLSFEQIAAQAMVFFLAGFDTS

STTMSFCLYELALNPDVQDRLRSEILEVLAKNNHQLTYESIQEMPYLDQV

VAETLRKYPILPHIVRQTTKKYDVPDSRLTLEPGMRVMIPVHSIQHDPEL

YPEPENFDPSRFEPDQVKARHPMAYLPFGEGPRNCIGERFGKMQVKIGIA

YILRDFQFRQSERTQIPLKFSSRTFLIGTQEGIHLIMEKLAAP*

 

>6a14 AC007085 33266-34850 frameshift at amino acid 73 possible pseudogene

MLFTIALVGVVLGLAYSLHIKIFSYWKRKGVPHETPLPIVGNMRGIVKKYHFRDINQRIY

KKFKGQGPIAGMY (frameshift)

TFFKRTALITDLDFIKQVMIKDFSYFQDRGAFTNPRDDPLTGHLFAL

EGEEWRAMRHKLTPVFTSGKIKQMSKVIVDVGLRLGDAMDKAVKEAKVEEGNVEIKDLCA

RFTTDVIGSCAFGLECNSLQDPSAEFRQKGREIFTRRRHSTLVQSFIFTNARLARKLRIK

VLPDDLTQFFMSTVKNTVDYRLKNGIKRNDFIEQMIELRAEDQEAAKKGQGIDLSHGLTL

EQMAAQAFVFFVAGFETSSSTMSLCLYELALQPDIQQRLREEIESVLANVDGGELNYDVL

AQMTYLDQVLS (1)

ETLRKHPLLPHLIRETTKDYQIPNSDIVLDKGILALIPVHNIHHDPEIY

PEPEKFDPSRFDPEEVKNRHPMAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSVS

NRTDVPLIFSKKSFLLTTNDGIYLKVERV

 

>CYP6A14 ortholog Contig3531_Contig5436.179 no frameshift as in D. melanogaster

MALALAYNFYRNTYSYWERKGVPNERPLPLIGNVKGIGTKYHFRDINQRI

YDKFKGVAPFAGMFTFFKRSALIIDLDLIKQVLIKDFQYFQDRGVFNNVR

DDPLTGHLLTLEGDEWRSMRQKLTPVFTSGKIKHMSGVVVEVGHRLAAAM

DKAVSAAKVDDGDVEIKDICARFTTDVIGTCAFGLECHSLSDPKAEFRSK

GRMIFEKPRHSPIVQFFVFTNAKLAKKLRMKLLPDDVSEFFMNAVKNTVD

YRMKNGIKRNDFLDELIELRAENQEAAKHGKVIDLSHGLTIEQMAAQAFV

FFLAGFETSSSTMAYCLYELAQHPDIQRRVREEIDAVLKNVEGGEITYDA

LAEMNYLEKVLA (1)

ETLRKHPIVPQLIREANQNYKVPNTDITIDKGTTVLIP

VHSIHHDPEIYPQPESFAPSRFEADQVKSRHPMAYLPFGDGPRNCIGLRF

GKIQAKIGLVSLLRRFKFGISKRTEIPLILDTRSFPLTTKNGIHLRVERI*

 

>6a15p this is a pseudogene on AC020451 2595-3373 with in frame

stops and frame shifts

AFTVTNSKLAKKLKMKILRDDLTDFFLSVVKPALSGMTLWTSPPSGGRSSRQGGSKFDLS

HNWTLEQMAAQAIVFFLAGFETSSSTMSSCKYELALQPEI*NQIRDEIERVLEGNAITYD

ALAKINYPEQVLS (1)

ETLRKH (frameshift)

QLIKFLLETQESFRVRNTELIVEKGTSLLIPVHSVHYDPHLYPHPKLFDSSR

LKAYKSNSRHPFAYLPFGTFGPRSCIGLRFGKMQAKIGIVSLCQRFKFGDSDLTDIPL

 

>No ortholog of 6a15P.  The aligned seq in the UCSC browser is the 6a14 ortholog.

 

>6a16 AC004721 comp(2956-5070) note 1 extra intron

MDFTLLLLTSLLSFLLGYLRYRFTYWELRGIPQLRPHFLFGHFFRLQSVHYSELLQETYD

AFRGSAKVAGTYVFLRPMAVVLDLDLVKAVLIRDFNNFVDRRSFHGDPLTANLFNLQGEE

WRNLRTKLSPTFTSGKMKYMFGTVSTVAQQLGGTFDELVGSQ (0)

GAVLELHDLMARYTTDVI

GSCAFGTECSSLREPQAEFRQVGRRIFRNSNRSIRWRIFKMTYLSSLAKLGLPVRILHPD

ITKFFNRIVRETVELRERENIRRNDFMDLLLDLRR (frameshift one extra "A" nucleotide)

KGLTMEQMAAQAFVFFVAGFETSSS

NMSYALFELAKNQDVQQKLRMEINDSIGKHGKLTYEAMMEMPYLDQTIT (1)

ETLRKYPALSS

LTRLASEDYEIPSPDGGDPVVLEKGTSVHIPVLAIHYDPEVYPEPHEFRPERFAPDACRE

RHPTAFLGFGDGPRNCIGLRFGRMQVKVGLITLLRRFRFSLPPGSPTQLKVTKRNLILLP

SDGVRLQVDPVESRLM

 

>CYP6A16 ortholog Contig4092_Contig573.216 61% to 6A16

MGFVLILLTSLLSGVLGYLRCKYNYWQINGVKQLRAHFLFGHFFKMKSVR

LTELLQETYDAFKGSALVAGTYVYLRPIAVILDLDLAKTILDKDFDKFVD

RRNFHKEPLMDNLFNAQGEEWCTLRKKLTPMFSSGNVKCIFGTITEVARN

LEESFQELVGTQGGVLDVHDLLDRFSMDASATCAFGIQCSSLKDPQVEFR

VHGRKIFHHSGDGIRWRIFKFLYWSVLAKLKLSVRFYDKIIADFFTRIVR

EKLELRQDLRHNIKRNDFLELLMASKDDNELTLEQLTAHAFDFFVSGYET

SSSTMSCALFELAKHPSVQQKLRNEITGILHKHAPNLTYEAVQEMRYLDQTIT (1)

ETLRKYPALASLTRIAAEDYTVPTASGDIPLVLDKGTIVHIPVRAIH

YDSEIYPEPTIFRPERFETSTCLQRHSMAFLGFGDGPRHCIGQQFGRMQI

KIGLIALLTKYQFSSVPGFPDELPISKGNVILRPRQGVLLKVHRVPE

 

>6a17 AC020447 109264-110826

MLLLALIVVILSLLVFAARRRHGYWQRRGIPHDEVHPLFGNIKDWPNKRHIAEIFRDYYF

KYKNSDYPFAGFFFFFTRTAVVTDMELLKRVLIKDFNHFENRGVFYNEIDDPLSATLFSI

EGQKWRHLRHKLTPTFTSGKMKNMFPIVVKVGEEMDKVFRSKTAADRGQVLEVVDLVARY

TADVIGNCAFGLNCNSLYDPKAEFVSIGKRAITEHRYGNMLDIFLFGFPKLSRRLRLKLN

IQEAEDFYTKIVRETIDYRLRTKEKRNDFMDSLIEMYKNEQSGNSEDGLTFNELLAQAFI

FFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVFGKHNKEFTYEGIKEMKYLEQVVM (1)

ETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYPEPEIFKPER

FTDEEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPETQIPMKIV

VKNILISAENGIHLKVEKLAK

 

>6A17 Ortholog of D. pseudoobscura JUN SHEN

MSLVLALIAIVVSLVLFAARRRHGYWQRRGIPHDVPHPLFGNIGDWPKKRQIAVIFRDYY

RKYKNANYPFAGFYFFFTRSAVVTDLDLVKRVLIKDFNHFENRGIFYNEIDDPLSATVFS

IEGQKWRHLRHKLTPTFTSGKMKHMFPIVVKVGEEMDKVFSNKVGDGKVLEIVDLVARYT

ADVIGNCAFGLNCNSQQNPNADFVTFGKRALRERRYKGLLDFFIFGFPKLSRSLRLKLNV

QEVEDFYTKIVRDTIDYRLKTKEKRNDFMDSLIEMYQKEQEGNSDEGLTFNEILAQAFIF

FVAGFETSSTTMGFALYELAQNQDTQDKLRNEINDVLAKHNNQFTYEGIKEMKYLEQVVM (1)

ETLRKYPALGHLTRKTRLDFSPEDPKNFIAKGTTVVIPALGIHYDPDIYPEPEKFKPERF

TEEAIASRPACAWLPFGEGPRNCIGLRFGLMQTCVGLAYLIKGYRFSVAPETQIPIKFVL

KSFLLSAENGIYLKVETVSK*

 

>6a18 AC008285 85740-87319

MQLTYFLFQVAVALLAIVTYILHRKLTYFKRRGIPYDKPHPLRGNMEGYKKTRTVHEIHQ

EYYNKYRNSKAPFVGFYLFQKPAAFVIDLELAKQILIKNFSNFTDKGIYYNEKDDPMSAH

LFNLDGPQWRLLRSKLSSTFTSGKMKFMYPTVVSVAEEFMAVMHEKVSENSILDVRDLVA

RFTVDVIGTCAFGIKCNSLRDEKAEFLHFGRRALLDSRHGNLVSGLMRSYPNLARRLGLC

RNTAQIQEFYQRIVKETVTLREKENIKRNDFMDMLIGLKNQKNMTLENGEVVKGLTMDEI

VAQAFVFFIAGFDTSSSTMGFALYELAKNPSIQDKVRAELGQVLEQHDQKFTYECIKDLKYLDQVIN (1)

ETLRHYTIVPNVDRVAAKRFVVPGNPKFVIEAGQSVIIPSSAIHHDPSIYPEP

NEFRPERFSPEESAKRPSVAWLPFGEGPRNCIGLRFGQMQARIGLAMLIKNFTFSPCSAT

PDPLTFDPHSAILLGIKGGIQLKVEAI

 

>6A18 ortholog D. pseudoobscura ortholog Marie van der Merwe

MGVTYVLLQVAVALLAIVTYYVYRRLSYFKSRGIPHDTPHLILGNMQGVFTKRNVHEILK

KYYEKYRESKVPFVGFYFFQKPSAFILDLDLAKHILIKDFSNFSDKGLFYNEKDDPISAH

LFNLDGPQWKVLRNKLTSTFTAGKMKFMYPTVVSVAEEFIDVMHEKMKQNSVLEIRELMA

RFTVDVIGTCAFGIKCNSLRDENAEFLRFGKRTFVDKRHGSFLTGFMTSYPKLARRLRLV

RTPTHIRNFYERIVHETVAMREKENIKRNDFMDLLIDMKNQKVKLENGDLVDGLTIDEIL

AQAFVFLIAGFETSSSTMGYALYELAKQPHIQDKVRAEVEEVLEQHEQKFTYESTKDLKY

LEQVIF (1)

ETLRLHTIVPHLDRMAHKRYVVPGHPNFVIEAGQSVIIPASAIHVDPNIYPDPY

KFRPERFSPEESAKRNSLAWLPFGDGPRNCIGLRFGKMQTTIGLALLIKNFKFSTCPKTP

DTLSYSPKSFVLAVDGIHLKVEAV*

 

>6a19 AC020447 113084-114646

MAILLGLVVGVLTLVAWWVLQNYTYWKRRGIPHDPPNIPLGNTGELWRTMPLAGILKRTY

LKFRKQTDGPFAGFYLYAMKYIVITDVDFVKTVLIRDFDKFHDRGVYHNEKDDPLTNNLA

TIEGQKWKNLRQKLTHTFTSAKMKSMFSTVLNVGDEMIRVVDEKISSSSQTLEVTDIVSR

FTSDVIGICAFGLKCNSLRDPKAEFVQMGYSALRERRHGWLVDLLIFGMPKLAVKLGFQF

LLPSVQKFYMKIVQDTIDYRMKRKVTRNDFMDTLIDMKQQYDKGDKENGLAFNEVAAQAF

VFFLAGFEAGSTTMGFTLYELACNQDVQDKLRAEIDSVLERYNGKLEYDSMQDLFYMEKVIN (1)

ESLRKHPVVAHLARIATKPYQHSNPKYFIEAGTGVLVSTLGIHHDPEFYPEPEKFIPE

RFDEEQVKKRPTCAFLPFGAGPRNCIGLRFGRMQVIIGLALLIHNFRFELHPKTPVPMKY

TINNLLLGSEGGIHLNITKVVRD*

 

>Contig3531_Contig5436.184 71% to 6A20 65% to 6A19

Probable ortholog of 6a20.  6a19 may not have an ortholog

MAIIIVLLVGVISLAVWWVHQNFSYWKRRGIPHDPPNIPKGNTSELMKTR

QIADLFRETYFKYKGKTDGPFVGFYLYLKKIAIVTDIDFVKTVLIREFDK

FHDRGLFHNEKDDPLTNHLVAIEGQKWRQLRQKMTPTFTSGKMKIMFPTV

LEIGNEMIRVFAEKIGPQPLNVADLVSRFSADVIGSCAFGLECNSLRNPN

AEFVTMGKAAITERRYGKTADLFFFGAPKLAAKLRMKETVQKVEDFYMKI

VRETVDYRLKNNVKRNDFMDMLIDMKINYDKGNKQDGISFNELAAQAFIF

FLAGFDTSSTSLGFALHELAVNQDIQDKLRTEIDTVMAKHNGQLNYDSMR

ELTYLDKVID (1)

ETFRKNPVVGHLIRICTQRYEHPNGKYFIEPGTGVVIPTL

GIHHDPEFYPEPEKFKPERFDEDQVLQRPPCTFLPFGDGPRTCIGLRFGR

MQIVVGLALLIHNFKFEVHPTKTTVPLKFKVTDVLLCSEGGVHLNVSKVPR*

 

>6a20 AC020447 117416-119045 this seq has a frame shift at NKLR-NKTD

MAVMIVLLIGVITFVAWYVHQHFNYWKRRGIPHDEPKIPYGNTSELMKTVHFADIFKRTY

NKLR (frameshift)

NKTDGPFVGFYMYFKRMVVVTDIDFAKTVLIREFDKFHDRGVFHNERDDPLSANLV

NIDGQKWKTLRQKLTPTFTSGKMKTMFPTILTVGDELIRVFGETASADSDSMEITNVVAR

FTADVIGSCAFGLDCHSLSDPKAKFVQMGTTAITERRHGKSMDLLLFGAPELAAKLRMKA

TVQEVEDFYMNIIRDTVDYRVKNNVKRHDFVDMLIEMKLKFDNGDKENGLTFNEIAAQAF

IFFLAGFETSSTTMGFALYELACHQDIQDKLRTEINTVLKQHNGKLDYDSMREMTYLEKVID (1)

ETMRKRPVVGHLIRVATQHYQHTNPKYNIEKGTGVIVPTLAIHHDPEFYPEPEKFIPE

RFDEDQVQQRPACTFLPFGDGPRNCIGLRFGRMQVIVGMALLIHNFKFEFHPTKTVVPLE

YRTDDFLLSSKGGIHLKVTRV

 

>Contig3531_Contig5436.184 Note same as 6A19 match. better match to 6A20

MAIIIVLLVGVISLAVWWVHQNFSYWKRRGIPHDPPNIPKGNTSELMKTR

QIADLFRETYFKYKGKTDGPFVGFYLYLKKIAIVTDIDFVKTVLIREFDK

FHDRGLFHNEKDDPLTNHLVAIEGQKWRQLRQKMTPTFTSGKMKIMFPTV

LEIGNEMIRVFAEKIGPQPLNVADLVSRFSADVIGSCAFGLECNSLRNPN

AEFVTMGKAAITERRYGKTADLFFFGAPKLAAKLRMKETVQKVEDFYMKI

VRETVDYRLKNNVKRNDFMDMLIDMKINYDKGNKQDGISFNELAAQAFIF

FLAGFDTSSTSLGFALHELAVNQDIQDKLRTEIDTVMAKHNGQLNYDSMR

ELTYLDKVID (1)

ETFRKNPVVGHLIRICTQRYEHPNGKYFIEPGTGVVIPTL

GIHHDPEFYPEPEKFKPERFDEDQVLQRPPCTFLPFGDGPRTCIGLRFGR

MQIVVGLALLIHNFKFEVHPTKTTVPLKFKVTDVLLCSEGGVHLNVSKVPR*

 

>6a21 AC020447 comp(120585-122149)

MSVGTVLLTALLALVGYLLMKWRSTMRHWQDLGIPCEEPHILMGSMKGVRTARSFNEIWT

SYYNKFRGSGPFAGFYWFRRPAVFVLETSLAKQILIKEFNKFTDRGFFHNPEDDPLSGQL

FLLDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAKSPVVEVRELLAR

FTTDVIGTCAFGIECSSLKDPDAEFREMGRRSLTEQRLGPVGIGFVNSFPNLARRLHMKM

TAEPIERFFMRIVRETVAFREQNNIRRNDFMDQLIDLKNKPLMVSQSGESVNLTIEEIAA

QAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGELNYESMKDLVYL

DQVVS (1)

ETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNT

FNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTI

PMTYNKEMFLIASNSGIYLKAERV

 

>Contig3531_Contig5436.185 78% TO 6A21

MAVGVGALLLWTLVALVVYLLLKWLLGRQYWQNLGIPCEEPHWLLGSMWG

LRTTRTFNDVWTDYYKKYRLSGPFAGFYWFQRPAVFVLEPSLAKLILIKE

FNKFTDRGFFHNPEDDPLSGQLFLLDGHKWKSMRHKLSSTFTSGKMKYMF

PTVVKVSHEFTEVFGQMADKSPIVEVRELLARFTTDVIGTCAFGIDCSSL

KDPDAEFRKMGRRALTENRHGSLGIAFLNSFPKLSRKLHLKMTAEPIEQF

FMRIVKETVKFREQNQIRRNDFMDQLIDLKNNQIIKTESGDNINLTIEEI

AAQAFVFFAAGFETSSTTMGFALYELAQHPDIQQRVREECQEVIQKYGGE

LTYESMKELVYLDQVIS (1)

ETLRLYTVLPVLNRECLEDFVVPDNPKYVIKKG

MPILIPAGAMHRDERFYPNPDAFNPDNFSPERVKNRDSVEWLPFGDGPRN

CIGMRFGQMQARIGMAMLLKDFKFSVCDETAFPMKYDLESFLIASKTGIS

LRVERV

 

>6a22 AC020447 106987-108653

MLDVVALLLIALAVGFWFVRTRYSYWTRRGIGSEPARFPVGNMEGFRKNKHFIDIVTPIY

EKFKGNGAPFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNERDDPLTGHLFR

IDGPKWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAMCGILEIGDLMAR

YTSDVIGRCAFGVECNGLRNPEAEFAIMGRRAFSERRHCKLVDGFIESFPEVARFLRMRQ

IHQDITDFYVGIVRETVKQREEQGIVRSDFMNLLIEMKQRGELTIEEMAAQAFIFFAAGF

DTSASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDSMQELRYMELVIA (1)

ETLRKYPILPQLTRISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQ

LAQRPTAAWLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDPKIEFLKSNIL

LCPANGIYLKVQQLSQMSS

 

>CYP6A22 ortholog Contig3531_Contig5436.181 82% to 6A22

MLDVIALLLITLAIGFWYVRTRLSYWARRGIGHVRPTFPMGNMDGLRRTK

HFKDIVTPLYERFKDSGAPFAGIYMMLRPVVLVLDLDLAKEVLIRDFANF

EDRGMYHNERDDPLTGHLFRIDGPKWRPLRHKMSPTFTSGKMKFMFPTIC

EVGVDLAEVCGELAANAICGILEISDIMGRYTSDVIGRCVFGLECNGLRN

PEAQFAVMGRRAFTERRHNQLIDGFIESFPDLARRLRMCQIHQDITDFYL

GIVKETVKLREEQGIVRNDFMNLLIEMKHRGELTLEEMAAQAFIFFAAGF

DTSASTLGFALFELARQPQLQDKLRQEIDAALQLHQGQFTYDSMQELRYMELVIA (1)

ETLRKYPPLPHLTRISKNLYTAKGNRHFYIEPGQMLLIPVYGIHH

DPAIYPEPHKFIPERFMGDQLAQRPTAAWLPFGDGPRNCIGMRFGKMQTS

IALVNLLRRFHFSVCPRTESKIEFVKSNLLLCPANGIYLKVQEISKLK

 

>6a23 AC020447 111145-112718

MSLLLTLIALLVSLLLFMARRRH GYWQRRGIPHDVPHPIYGNMKDWPKKRHIAMIFRDYY

TKYKRSVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNEIDDPLS ATLFS

IEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTT GEGQVLEIVDLVAR

YTADVIGNCAFGLNCNSLQNPNAEFVTIGKRAIIERRYGGLLDFLIFGFPKLSRRLRLKL

NVQDVEDFYTSIVRNTIDYRLRTNEKRHDFMDSLIEMYEKEQAGNTEDGLSFNEILAQAF

IFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLEQVVM (1)

ETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPEPEKFKPE

RFTDEAIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTETQIPMKF

VVKSILLSAENGIHLKVEKLSK

 

>CYP6A23 ortholog Contig3531_Contig5436.183 76% to 6A23

MSLVLALIAIVVSLVLFAARRRHE

YWQNLGIPCEEPHWLLGSMWGLRTTRTFNDVWTDYYKKYRLSGPFAGFYWFQRPAVFVLE

PSLAKLILIKEFNKFTDRGFFHNPEDDPLS

ATVFSMKGQKWRHLRHKLTPTFTSGKMKHMFPIVVKVGEEMDKVFSNKV

GDGKVLEIVDLVARYTADVIGNCAFGL

NCNSQQNPNADFVTFGKRAIGERRYWGLLDFFIFGFPKLSRSLRLKLNVQ

EVEDFYTKIVRDTIDYRLKTKEKRNDFMDSLIEMYQKEQEGNSDEGLTFN

EILAQAFIFFVAGFETSSTTMGFALYELAQNQDTQDKLRNEINDVLAKHN

NQFTYEGIKEMKYLEQVVM (1)

ETLRKYPVLAHLTRKTQADFSPEDPKTFIAK

GTVVVIPALGIHYDPDIYPEPEKFKPERFTEEAIASRPACTWLPFGEGPR

NCIGLRFGIMQTCVGLAYLIKGYRFSVAPETQIPMKLILKSILLSAENGI

YLKVKKVSK*

 

>6d2 AC020206 comp(66328-68065) also AC008350

MWTILLTILIAGLLYRYVKRHYTHWQRLGVDEEPAKIPFGVMDTVMKQERSLGMALADIY

ARHEGKIVGIYMLNKRSILIRDAQLARQIMTSDFASFHDRGVYVDEDKDPLSANLFNLRG

ASWRNLRQKLTPSFSSGKIKGMFGTIDDVGDKLVQHLEGALDQSDEVEIKDVMTTYAVDI

IGSVIFGLEIDSFRNPKNEFREISSSTSRDESLLLKIHNMSMFICPP (2)

IAKLMNRLGYESR

ILTSLRDMMKRTIEFREEHNVVRKDMLQLLIRLRNTGKIGEDDDQVWDMETAQEQLKSMS

IEKIAAQAFLFYVAGSESTAAASAFTLYELSMYPELLKEAQEEVDAVLMKHNLKPKDRFT

YEAVQDLKFLDICIM (1)

ETIRKYPGLPFLNRECTEDYPVPGTNHIIAKGTPILISLFGMQRD

PVYFPNPNGYDPHRFDSNNMNYDQAAYMPFGEGPRHCI (1)

ALRMGKVNSKVAVAKILANFDL

VQSPRKEVEFRFDAAPVLVTKEPLKLRLTKRK

 

>Drosophila pseudoobscura ortholog of 6d2 Nawazi 80%

MWAILTLLTLALGLLYQFVRRHYSSWQRLGVDEETPKIPMGILDTVMKQEMSLGMVLSDI

YKRHKGKIVGIYMMNKRSILVRDAQLARQIMTSDFASFHDRGVYVDEKNDPLSANLFNLR

GASWRNLRKKMTPSFSSGKIKGMFGTIDDVGDKMVQHLKGVLERAGADNEIDIKEMMTTY

AVDIIGSVIFGLEIDSFANPNNEFRAISNEEARSKSLLLKIHNMAMFICPP (2)

IAKLMNRLGFESAILTALRDMMKRTIEFRESNNVVRKDLLQLLIRLRNTGRIGEDDDEVWDMETVQEEL

KAMSIEKIAAQAFLFYVAGSESTAAAAAFTLYELAMYPELLKEARDELDTVLQRHNLEGT

GKLTYEAVHDLKFLDLCLK (1)

ETLRKYPGLPFLNRECTEDYLVPGTRHTITKGTPILISLFG

IHRDPVYFPNPEGYDPHRFDADKMNYDQAAYMPFGEGPRHCI (1)

ALRMGEVNTKVAVAKILANFDLVQAPHKEVGSASMLLPSWCPKRV

 

>6d4 AC017250 37993-39657 also AC008197 AC009846

MFSLILLAVTLLTLAWFYLKRHYEYWERRGFPFEKHSGIPFGCLDSVWRQEKSMGLAIYD

VYVKSKERVLGIYLLFRPAVLIRDADLARRVLAQDFASFHDRGVYVDEERDPLSANIFSL

RGQSWRSMRHMLSPCFTSGKLKSMFSTSEDIGDKMVAHLQKELPEEGFKEVDIKKVMQNY

AIDIIASTIFGLDVNSFENPDNKFRKLVSLARANNRFNAMFGMMIFLVPS (2)

IAQFLFRIGFKNPVGLAMLQIVKETVEYREKHGIVRKDLLQLLIQLRNTGKIDENDEKSFSIQKTPD (1)

GHIKTISLEAITAQAFIFYIAGQETTGSTAAFTIYELAQYPELLKRLQDEVDETLAKNDGKIT

YDSLNKMEFLDLCVQETIRKYPGLPILNRECTQDYTVPDTNHVIPKGTPVVISLYGIHHD

AEYFPDPETYDPERFSEESRNYNPTAFMPFGEGPRICIAQRMGRINSKLAIIKILQNFNV

EVMSRSEIEFENSGIALIPKHGVRVRLSKRVPKLS

 

>6d4 ortholog found by Yi Jin

MFSLIVLAGTLLALGWFYLKHHYQYWERRGFPFDRQSTIPFGCLDSVWRREKGMGMAIYD

AYQKSKERFLGIYLLFRPAVLVRDAALARRVLAQDFASFHDRGVYVDEVNDPLSGSIFAL

RGQSWRSMRHKLSPCFTSGKLKGMFSTSEEIANNMVNHLQKTLPEQGSQEVDLKTVMQTY

AIDIIASTIFGLEMNSYLTPDNKFRNLVTIARRNTRFTTMFGMMIFLVPS (2)

VAKFLFSLGFKNQVALAMLEIVKETIEYREKHGIVRKDLLQLLMELRNTGAVDESDENIWKIQKSAT (1)

DQIKCISLESITAQAFIFYIAGQETTGSTAAFVLFELAQYPELLERLQTEVDETLAKNDGHIT

YDALQKMEFLDLCVQESLRKYPGLPMLNRECTQDYTVPDTDHVIPKGTPVVISLYGIHHD

AEYFPEPETYDPDRYSEENRNFSPTAFMPFGEGPRICIAQRMGLLNAKLAIINVLKNFNV

EVMSKRQLEFENSGIALLPKNGVKVRLSKRLPK*

 

>6d5 AC018176 comp(132649-134791)

MIGIYLLIAAVTLLYVYLKWTFSYWDRKGFPSTGVSIPFGALESVTKGKRSFGMAIYDMY

KSTKEPVIGLYLTLRPALLVRDAQLAHDVLVKDFASFHDRGVYVDEKNDPMSASLFQMEG

ASWRALRNKLTPSFTSGKLKAMFETSDSVGDKLVDSIRKQLPANGAKELELKKLMAT (2)

YAIDIIATTIFGLDVDSFADPNNEFQIISKKVNRNNIEDIIRGTSSFLYPG (2)

LEKFFVKIGWKQEATERMRELSNRTVDLREQNNIVRKDLLQLLLQLRNQGKINTDDNIWSAESTKNGVKSMS

KDLIAGQLFLFYVAGYETTASTTSFTLYELTQNPEVMEKAKEDVRSAIEKHGGKLTYDAISDMKYLEACIL (1)

ETARKYPALPLLNRICTKDYPVPDSKLVIQKGTPIIISLIGMHRDEEYF

PDPLAYKPERYLENGKDYTQAAYLPFGEGPRMCI (1)

GARMGKVNVKIAIAKVLSNFDLEIRKEKCEIEFGVYGIPLMPKSGVPVRLSLKK

 

>CYP6D5 ortholog Contig7891_Contig7492A.fa.196 75% to 6D5

MIGILLLVAAVSLLYVYLKWTFSYWDRQGFPSAGVTIPFGALDSVRRGKR

SFGMAIYDMYNATKEPVMGMYLTLRPALLVRDPQLAHDILVKDFASFHDR

GIYVDEKNDPMSATIFAMEGSNWRNLRAKLTPSFTSGKLKAMFSTSEAIG

DKMVAHLNGKLPKEGSQEIEMKELLLT (2)

YAVDIIASTIFGLDVDSFADPNN

EFLSITKTINQNTFTDILRGTTSFLFPG (2)

LEKIFVRLGWSQEGPERIRELS

NRTVDLREEKNIERRDLLQLLLQLRNTGKISNDDNMWSAQNDNKGLKSVS

KDLIAGQLFLFFVAGYETTASTAAYTIYELTQNPEVMARALEDVRSTLEK

HDGKLSYDAIQDMKYLEACVL (1)

ETARKYPALPLLNRVCTKEYQIPNSKLIV

KKGTPIIISLIGMHRDAENFPDPLAYKPERYLDENKNFNPTAYMPFGEGPHNCI (1)

GLRMGKVNVKIAVAKILSNFSLEMSKE

KREIEFSVHGIPLMPKGGVPVRISRKK

 

>6g1 AC015208 comp(21239-22935) also AC007440

MVLTEVLFVVVAALVALYTWFQRNHSYWQRKGIPYIPPTPIIGNTKVVFKMENSFGMHLS

EIYNDPRLKDEAVVGIYSMNKPGLIIRDIELIKSILIKDFNRFHNRYARCDPHGDPLGYN

NLFFVRDAHWKGIRTKLTPVFTSGKVKQMYTLMQE (0)

IGKDLELALQRRGEKNSGSFITEIK

EICAQFSTDSIATIAFGIRANSLENPNAEFRNYGRKMFTFTVARAKDFFVAFFLPKLVSL

MRIQFFTADFSHFMRSTIGHVMEERERSGLLRNDLIDVLVSLRKEAAAEPSKPHYAKNQD

FLVAQAGVFFTAGFETSSSTMSFALYEMAKHPEMQKRLRDEINEALVEGGGSLSYEKIQS

LEYLAMVVDEVLRMYPVLPFLDREYESVEGQPDLSLKPFYDYTLENGTPVFIPIYALHHDPK (0)

YWTNPSQFDPERFSPANRKNIVAMAYQPFGSGPHNCIGSRIGLLQSKLGLVSLLKNHS

VRNCEATMKDMKFDPKGFVLQADGGIHLEIVNDRLYDQSAPSLQ

 

>CYP6G1 ortholog Contig3295_Contig8282.292 80% to 6G1

MALTEALFLIVGALSAVYIWFQRNHSYWQRKGIPYIPPTPIIGNTEPAFK

LKNSFGLHLSEIYSDPKMQDEAVVGVYALNKPCLIIRDPELIKSVMVKDF

NRFHNRYGRCDPHGDPLGSNNLFFVRDTHWKDIRTKLTPVFTSGKVKQMYTLMLE (0)

IAHDLEEHLKKHVQNNSNSGKYITEIKEVCAQFSTDSIATIAFGI

RANSLQNPNAEFRNHGRKLFSFTLSRAKDFFVAFFLPKLVSLLRIQFFTQ

EFAHFLRSTISHVMEERERTGFVRNDLIDVLVGLRKEAAEEPSKPHYARN

FDFLVAQAGVFFTAGFETSSSTMSFALYELAKNSHLQTRLRQEINEALVE

GGGNLSYEKIQSLEYLAMVVDEVLRMYPVLPFLDREYNSIKDQPDLSLKP

YYDFTFEHGTPVFIPIYGLQHDPK (0)

YWPKPEQFDPERFSPENRKSIEAMAYQPFGSGPHNCIGSRIGLLQTKLGL

VHILKNHSVKMCADTIKEMKFDPKGFVLQSLTGIYLEIVNDRLYEESAARVH*

 

>6g2 AC015208 19014-20624

MELVLLILVASLIGIAFLALQQHYSYWRRMGVREIRPKWIVGNLMGLLNMRMSPAEFISQ

LYNHPDAENEPFVGIHVFHKPALLLRDPEMVRNILVKDFAGFSNRYSSSDPKGDPLGSQN

IFFLKNPAWKEVRLKLSPFFTGNRLKQMFPLIEEVGASLDAHLRQQPLHNERMRCFDLEA

KELCALYTTDVIATVAYGVSANSFTDPKCEFRRHGRSVFEFNLLRAAEFTLVFFLPHLVP

FVRFKVVPAEATRFLRKTINYVMSEREKSGQKRNDLIDILIEFRRSTQLAKASGIKDQFV

FEGDILVAQAVLFFTAGFESSSSTMAFAMYELAKDTDVQQRLREEIKDALVESGGQVTLK

MIESLEFMQMILLEVLRMYPPLPFLDRECTSGRDYSLAPFHKKFVVPKGMPVYIPCYALH

MDPQ (0)

YFPQPRKFLPERFSPENRKLHTPYTYMPFGLGPHGCIGERFGYLQAKVGLVNLLRN

HMITTSERTPHRMQLDPKAIITQAKGGIHLRLVRDALGV

 

>CYP6g2 Drosophila pseudoobscura sequence P. Khandelwal

MVLGLFLLVVIFLATICFLLQQHYAYWRRRGVRELRPHWILGNLAGLLSMRDSPADFMGQ

LYNHPDALNQPFVGIHVFHRPALLLRDPDLIKRILIKDFGKFSNRYSNSDYKGDPLGSQN

IFFLKNPAWKEVRFKLSPFFTSNKLKSMFPLIVEVGSNLDAYLREQPLHNERTRCFDLEA

KELCALFTTDVIASVAYGVQANSFTQPNGEFRRHGRAVFEFSLKRAAEFTLVFFLPHLVP

LFGFKVVPSEATRFLRNTINYVMAERERSQQTRNDLIDILIEFRRSTQQARAAGDHGQFV

FEGDILVAQAVLFFTAGFESSSSTMAFAMYELAKDADIQLRVRHEIKEALIASGGQVTLQ

LIDSLEYMQMVLLEVLRMYPPLPFLDRECTAEDEDYSLTPYHGFRVPKGMPIYIPCYALHMDPQ (0)

YFPQPRKFQPERFSPTNRKLQTPYTYMPFGLGPHGCIGERFGLLQAKVGLVNLMRN

HQVTTSERTPRRMKLDPKAIILQAQGGIHLRLVRDPLGI*

 

>6t1 AC012831 comp(42975-44564) no introns

MIAVFSLIAAALAVGSLVLLPVVLRGGCLLVVTIVWLWQILHFWHWRRLGVPFVPAAPFV

GNVWNLLRGACCFGDQFRELYESKEAAGRAFVGIDVLHNHALLLRDPALIKRIMVEDFAQ

FSSRFETTDPTCDTMGSQNLFFSKYETWRETHKIFAPFFAAGKVRNMYGLLENIGQKLEE

HMEQKLSGRDSMELEVKQLCALFTTDIIASLAFGIEAHSLQNPEAEFRRMCIEVNDPRPK

RLLHLFTMFFFPRLSHRVGTHLYSEEYERFMRKSMDYVLSQRAESGENRHDLIDIFLQLK

RTEPAESIIHRPDFFAAQAAFLLLAGFDTSSSTITFALYELAKNTTIQDRLRTELRAALQ

SSQDRQLSCDTVTGLVYLRQVVDEVLRLYPPTAFLDRCCNSRTGYDLSPWNGGSPFKLRA

GTPVYISVLGIHRDAQYWPNPEVFDPERFSAEQRQQHHPMTYLPFGAGPRGCIGTLLGQL

EIKVGLLHILNHFRVEVCERTLPEMRFDPKAFVLTAHNGTYLRFVKNSL

 

>6t1 D. pseudoobscura ortholog 77%  1 intron, found by SunHong Kim

MILVIGVLFIAATVAAIGLLFFVVFPLVCAAGLIIFGIIWLWQRHHFCHWLRLGVPYIRA

TPFVGNVWKLLRGSCCFGDQFRQLYESKEAAGHAYVGIHVLHNHALLLRDPALIKRILVE

DFSQFSSRFETTDPIGDTMGAQNLFFSKHETWRETHKIFAPFFAVSKVRQMYGLLEHIGQ

QLEEHMEDQLNGKSEIELEVKQLCALFTTDIIASLAFGLEAHSLQKPDAEFRRMCVEVND

PRPKRLLHLFTMFFFPRLSRMVRTHLYSDEYERFMRQSMDFVLAQREKSGEKRHDLIDIF

LQLKRTEPPTSIIHRPDFFVAQASFLLLAGFDTSSSTITFALYELAKAPAIQKRLRDELS

DALRTNRHQPLNFDSVNGLSYLRQVVDEVLRLYPPTAFLDRCCNDENGYDLSAWNCGRAL

KLPAGAPVYISVLGLHRDPV (0)

HWPNPNQFDPEHFSPEQREQHHPMTYLPFGAGPRGCIGTLLGQLEIKVGLLHILKNFRVE

LCERTLPEMVFDPKAFVLTAKGGTYLRFVKDTL*

 

>6t2p AC014742 1042-2504 64% to 6t1

MVIAFFIFL*CAALAVGSVVLLPLIALLAVWLWQRRHFRIWRRLGVPYLPAAPVLGNVLNVE (frameshift)

CCFGDQFRELYERKEAAGRAIVGINVLHSHALLLRDPALIRRILVEDFPEFSSSF

KSTDAIRDTMGSGNLLFTKYKTWWETHKIFA (frameshift)

LYGLLERI*QNLEAHMKKK (frameshift)

KLNGAESVELEVKQLCALFTTDI (frameshift)

LQSLQNPEAEFRPMCIEVNDPKPKRLSHHLFT (frameshift)

RVRTHLYSEEYERFMRKSMNYVLAQRAEN*EKRYDLIDMFLQMHRTETAEGIIHRPDFYVAQAAF (frameshift)

LLLAGFDTSSSFALYELAKNPTIEHRLQAELRVDLQSSHNHQLSYDTL

TGLVYLRQVLED (seq. missing EXXR to heme)

LPFGAGPRGCIGTLLGQLGIKVGLLHTLKHFRVELCERTLPEMRFDP*

ASVLTAHNGTFLRFVRNSL*

 

>There is not ortholog of 6t2P.  The sequence that aligns with it in

the USCS browser is the 6t1 ortholog

 

>6t3 AC015208 comp(17123-18689)

MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQ

LYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAGDPMGALTL

PLAKYHHWKESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLPLGRM

CQLYTTDVTGNLFYSLNVGGLRRGRSELITKTKELFNTNPRKVLDFMSVFFLPKWTGVLK

PKVFTEDYARYMRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLA

GFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPYLKMVCLEALR

LYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYISILGLHRDER (0)

FWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVET

CERTVSEIRFNPKSFMLESENEIYLRFCRSSL

 

>D.Pseudoobscura 6t3 found by A. N. West

MVSLWLLMLGILSIYLWLRQRYSYFERHNIVHLPVSAWTPLGHLRKLLLLRISFGDLFHN

IYADPRGGQAKVVGFFLFQTPALMVRDPELIRLVLIKHFNSFLNRYEAADAAGDPMGSLT

LPLAKYHNWRESRQSMAQLFTSGRMRESMYPLMMGVVIDLEQYLQRKLGDRSERMLPLSK

MCQLYTTDVTGNLFYSMDVGGLRRGKSQLLKKTKELFDPDPRKVLDFMSIFFLPQWTNLL

RAKVFSEEYAQFMRGLVGHPRERSKGDLIDQLLHLQSSRPSSHYAQHPDFIASQASIILL

AGFETSSALLGFTLYELAKQPDLQKRLREELAEAFSLAPTLTYETLVTLPFLRKVCLEAL

RLYPAAAFINRECTSSDPNGFSLQPHVDFVVPNGMPAYISILGLHRDEK (0)

YWPEPNRFDPERFDPDRSKDIIPMTYIPFGAGPHGCIGSRLGSLQLKLGLAHILRLCRVE

VCEQTVPQIRFNPKTFMLESKDEIYLRFYRDKL*

 

>6u1 AC017706 15959-17471 also AC008288

MHRTLLTALGALSVVYALVKFSLGYWKRRGILHEKPKFLWGNIKGVVSGKRHAQDALQDI

YTAYKGRAPFVGFYACLKPFILALDLKLVHQIIFTDAGHFTSRGLYSNPSGEPLSHNLLQ

LDGHKWRSLHAKSAEVFTPANMQKLLVRLSQISSRIQRDLGEKSLQTINISELVGAYNTD

VMASMAFGLVGQDNVEFAKWTRNYWADFRMWQAYLALEFPLIARLLQYKSYAEPATAYFQ

KVALSQLQLHRRRDRQPLQTFLQLYSNAEKPLTDIEIAGQAFGFVLAGLGPLNATLAFCL

YELARQPEVQDRTRLEINKALEEHGGQVTPECLRELRYTKQVLN (1)

ETLRLHTPHPFLLRRATKEFEVPGSVFVIAKGNNVLIPTAAIHMDPGIYENPQRFYPERF

EEQARRSRPAAAFLPFGDGLRGCIAARFAEQQLLVGLVALLRQHRYAPSAETSIPVEYDN

RRLLLMPKSDIKLSVERVDKL

 

>D. pseudoobscura ortholog of 6u1 L. WEI

MDLLHRALLTAVGALSLFYALVKVSLGYWKRRGILHEKPKFFWGNIKGVVGGKRHLQDALQVI

YAKYKGRAPFVGFFACLKPFVLVLDLELVRHILVTHAGNFTTRGLYSNDGSEPLSGNLLQ

LDGHKWRALHAQSTGVFTPANINKLLPRIVLISRGVQRSLGKERLQTLNIN

ELVDSYNLDVVASMAFGLSADRTEFRRWTQSYWGKFSLWRAYLALEFPLLAQLLNHKSYA

VSAMTYFQKVVLGQLQEQRRRDRQPLQTFLQLYSNMDQPLDDVQIAAQAFGFVLAGLVPL

NATLSFCLYELARQPELQDRVRAEIRKTLEQHSGQLTTEGLKELLYTKQVLN (1)

ETLRLHTPYPFLLRRATKEFELPGSVFVIARGNNVLIPTAAIHRDPAIYEEPLRFDPDRF

ETEAKRTRPAMSFLPFGDGLRGCIAAQFVEQELLVGLVTLLQYHRYTPCSKTAIPLEYDN

GRLLLMPKTDIHLNVERVDN*

 

>6v1 AC011761 comp(54926-57766) also AC015002

MVYSTNILLAIVTILTGVFIWSRRTYVYWQRRRVKFVQPTHLLGNLSRVLRLEESFALQL

RRFYFDERFRNEPVVGIYLFHQPALLIRDLQLVRTVLVEDFVSFSNRFAKCDGRSDKMGA

LSLFLAKQPEWREIRTRLAPAFAGAKLKQMFSLMEE (0)

IGCDLEWYLKRLTRDLRRGDAERG

AIVSIKDVCDLYNTDMIASIAFGLRSYSLRNTQSEIGSHCQDLFRPNVRRIIDLFVIFYL

PKLVPLLRPKLFTEPHAEFLRRVIQLVIEERERGGDLRNDLIEMLLTLKKEADLQQDKSH

FTHHRDFLAAQAASFEVAGIETCSASMSFALYELAKQPLMQSRLRREIREAFASNPNGRL

TYEAVARMEFLDMVVEETLRKYPIVPLLERECTPINKKRFYSLRPHAECYTRRGMPVFISNLAIHHDPK (0)

YWPDPDRFDPERFSAANKALQAPMSYMPFGAGPRNCIGMQIGLLQIKLGLV

YFLHQHRVEICDRTVERIQFDAKFALLASEQRIYLKVDCL

 

>CYP6v1 ortholog FOUND BY I. Moisini

MVYSTNILLAIVTILTAVFVWSRRTYVYWQRRRVKFVQPAHLLGNLSKVLRLEESFALQL

RRFYFDERFRNEPIVGIYLFHQPALLIRDLSLVRTVLVEDFVSFSNRFAKCDLRHDKMGS

LNLFFAKQPEWREIRTRLSPVFTGAKIKQMFSLMEE(0)

IGCDLEYYLKRLTRDMRRSDASAR

GVIVSIKDVCDLYNTDMIASIAFGLRSYSLRSTQSEIGSHCQDIFRPNVRRIIDFFVIFY

LPKLVPLLRPRLFTEPHAEFLRRVIQLVIEERERGGDLRNDLIEMLLTLKKEADLQKDKS

HFTHHRDFLAAQAASFEVAGIETCSSSLSFALYELAKQPLMQARLRREIRETFEESPAGS

LSYELIGRMQYLEMIVEETHRKYPIVPLLERECTPINKKRFYSLRPHAECYARRGMPIYI

SNLAIHHDPK(0)

YWPDPERFDPERFSAENKSHQAPMSYLPFGAGPKHCIGMQIGQLQIKLGL

IYFLRRHRVELCEKTVERISFDAKFALLASEHRIYLKVADCL*

 

>6w1 AC014226 comp(15025-16689) also AC008257

MLLLLLLGSLTIVFYIWQRRTLSFWERHGVKYIRPFPVVGCTREFLTAKVPFFEQIQKFH

EAPGFENEPFVGVYMTHRPALVIRDLELIKTVMIKKFQYFNNRVLQTDPHNDALGYKNLF

FARSPGWRELRTKISPVFTSGKIKQMYPLMVK (0)

IGKNLQDSAERLGSGTEVQVKDLCSRFT

TDLIATIAFGVEANALQDAKSEFFYHNRAIFSLTLSRGIDFAIIFMIPALASLARVKLFS

RETTKFIRSSVNYVLKERERTGEKRNDLIDILLALKREAAANPGKMSKEVDLDYLVAQAA

VFQTAGFETSASTMTMTLYELAKNEALQDRLRQEIVDFFGDEDHISYERIQEMPYLSQVV

NETLRKYPIVGYIERECSQPAEGERFTLEPFHNMELPHGMSIYMSTVAVHRDPQYWPDPE

KYDPERFNSSNRDNLNMDAYMPFGVGPRNCIGMRLGLLQSKLGLVHILRNHRFHTCDKTI

KKIEWAPTSPVMASKRDIILRVEKVSGKKDFGQK

 

>D. pseudoobscura ortholog of 6w1 V. Lamba

MSTELLFLIATVAIVFYVWHKRRHSFWKRHGVKEIGPLPILGDTVGFLTGRLPFFDQIRK

FHEAPGLENEPIIGVYLAYRPALVIRDLDLVKTVMIKKFSYFTNRKLQTDPHDDALGYNN

LFFVRSPEWKELRNKISPVFTTGKIKQMYPLMVK (0)

IGKNLEANVGREPKDSIVTIKSLCAR

FTTDLIATIAFGLDANALQDPKSEFFRHNQAIFAPSVSRAIDFAIIFMLPALTTLAKVKV

FSKSTSQFIRSSINYVMAERERSGLRRNDLVDVLLALKREAAASPDKNNKAKNMDYLVAQ

AAVFQTAGYETSSSTMTLALYEVAKNEEIQNRLRQEIEEYFGDDDHISYERIQEMPYLSK

VVNETLRLYPIVGYAERECAQPSQGERFTLAPHHDMELPDGTPVYVSAVAIQRDPKHWPE

PEKFDPERFDASNRDKLNMDAYMPFGVGPRNCIGMRLGLLQSKLGLVHLLRNHRVLWCDK

TVKTIEFAPFCGVLASKDEIYLRVERVSS*

 

>9b1 AC019916 10502-12238

MSFVEICLVLATIGLLLFKWSTGTFKAFEGRNLYFEKPYPFLGNMAASALQKASFQKQISEFYNRTRHH (2)

KLVGLFNLRTPMIQINDPQLIKKICVKDFDHFPNHQTLNIPNERLVNDMLN

VMRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMKV

LCNKLSNDVIATTAFGLKVNSFDDPENEFHTIGKTLAFSRGLPFLKFMMCLLAPKVFN (0)

FFKLTIFDSTNVEYFVRLVVDAMQYREKHNITRPDMIQLLMEAKKESKDNWTDDEIVAQCFI

FFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEALKGAPLTYDAAQEMTYMDMV

ISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQR

FDPERFSERRKKDLIPYTYLPFGVGPRSCI (1)

GNRYAVMQAKGMLYNLMLNYKIEASPRTTRDMWESARGFNIIPTTGFWMQLVSRK

 

>There is no 9b1 ortholog. the same seq is aligned for both 9b1 and 9b2.

 

>9b2 AC019916 8190-9903

MALIEICLALVVIGYLIYKWSTATFKTFEERKLYFEKPYPFVGNMAAAALQKSSFQRQLTEFYERTRQH (2)

KLVGFFNMRTPMITLNDPELIKKVCVKDFDHFPNHQPFITSNDRLFNDMLS

VMRDQRWKHMRNTLTPVFTAAKMRNMFTLMNESFAECLQHLDSSSKTLPGRKGFEVDMKV

MCNKLSNDIIATTAFGLKVNSYDNPKNEFYEIGQSLVFSRGLQFFKFMLSTLVPKLFS (0)

LLKLTIFDSAKVDYFARLVVEAMQYREKHNITRPDMIQLLMEAKNESEDKWTDDEIVAQCFI

FFFAAFENNSNLICTTTYELLYNPDVQERLYEEIVETKKALNGAPLTYDAVQKMTYMDMV

ISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFPEPRK

FDPDRFSEERKGDMVPYTYLPFGVGPRNCI (1)

GNRYALMQVKGMLFNLLLHYKIEASPRTIKDLWGSASGFNFTPRSGFWMHLVPRK

 

>9B2 ortholog found by C. Lancaster 73% to 9b2 68% to 9b1

MVCLEICLAILVLGFMIYKWSTATHRAFDERGVYFEEPKPFFGNIGTSMLGLTSFHKVLSAFYNRTRGH (2)

KVVGFFNLRTPMIQLNDPEIIKKICIKDFDHFPNHQLFLESNERLLNDMLS

VMRDQRWKHMRNTLTPVFTAAKMRSMFALMNDSFGECLEHLSRLSDGSKSGEGLEVDMKV

LCNKLSNDLIATTAFGLKVNSFESPDNEFYQIGQSLTFSRGSQLFKFLLATLIPKVFL (0)

FFNMKIFNGQKVEYFVRLVVDAMKYREEHNINRPDMIQLLMESKTESEDNWTDDEIVAQCFI

FFFAAFENNANLICTTSLELLENPDIQQRLYEEAKEVQESLKGSSLTYDAVQKMKYMDMV

ISESLRKWTLAPVTDRICSKDYTLTDDDGTKLFDFKVGDRVNIPIAGLHWDDKYFPEPQK

FDPERFSDERKNEIVPYTYLPFGVGPRNCI (1)

GNRYALMQVKGMLYNLLIRYKIERSPKTVKDLWEEARGFNLAPKAGYWMRLMPRK

 

>9c1 AC019937 comp(1757-3443)

MVFVELSIFVAFIGLLLYKWSVYTFGYFSKRGVAHEKPIPLLGNIPWSVLMGKESYIKHS (2)

IDLHLRLKQHKVYGVFNLRDPLYYLSDPELIRQVGIKNFDTFTNHRKGITEGFNDTSVIS

KSLLSLRDRRWKQMRSTLTPTFTSLKIRQMFELIHFCNVEAVDFVQRQLDAGTSELELKD

FFTRYTNDVIATAAFGIQVNSFKDPNNEFFSIGQRISEFTFWGGLKVMLYILMPKLMK (0)

ALRVPVMDMNNVDYFK KLVFGAMKYRKEQSIVRPDMIHLLMEAQRQFKAEQEGSAESAAQQD

KAEFNDDDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEILAVKEQLGEKP

LDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKDEEGEVVVNLREDDLVHINV

GALHHDPDNFPEPEQFRPERFDEEHKHEIRQFTYLPFGVGQRSCIGNRLALMEVKSLIFQ

LVLRYHLKPTDRTPADMMSSISGFRLLPRELFWCKLESRGPA

 

>9c1 D. Pseudoobscura K. Earhart and T. Liu

MAFEVLLALGALIGFLLYKWAEPPVRFFLKRGVVHEAPVPLLGNIPLAVLMGKASYLKHS (2)

IAVHMRLKQHKVYGVFNLRDPLFFLSDPELIRQVGIKSFDNFANHRKGLGDAGGGANDSV

LSKSLLSLRDRRWKQMRSTLTPTFTSLKIRLMFELIQVCNVEAVAYIERKLAEDGATELE

LKDFFTRYTNDVIATAAFGIQVNSFKDPNNEFFSIGQRISDFSLWAVLKVMLFILLPKLMK (0)

ALRVSVMDMNNVDYFKKLVFGAIQHRKEHNIIRPDMIQQLMEAQRLFRAEQEASQETTT

QEDRAEFNDEDLLAQCLLFFSAGFDTVATCLSFTSHELLMNPEAQDKLYEEIMATEEQLG

GKPLDYDTLMGMKYMDCVVSESLRMWPPAFVLDRMCGSDFELRDEEGKVVLTLKKDELIN

IPVIALHHDPDNFPQPDEFRPERFDDDHKHEIKPFTYLPFGIGQRSCIGNRMALMEVKAL

LYGLVRRFRLEPAERTTTDMMGNIAGFRMMPRELFWCKFVARVDGEAKVQE*

 

>9f2 AC017132 AC017240 AC009741 AC017170 AC007594 PLUS ESTs

MLWEFFALFAIAAALFYRWASANNDFFKDRGIAYEKPVLYFGNMAGMFLRKRAMFDIVCDLYTKGGSKK (2)

FFGIFEQRQPLLMVRDPDLIKQITIKDFDHFINHRNVFATSSDDDPHDMSN

LFGSSLFSMRDARWKDMRSTLSPAFTGSKMRQMFQLMNQVAKEAVDCLKQDDSRVQENEL

DMKDYCTRFTNDVIASTAFGLQVNSFKDRENTFYQMGKKLTTFTFLQSMKFMLFFALKGLNK (0)

ILKVELFDRKSTQYFVRLVLDAMKYRQEHNIVRPDMINMLMEARGIIQTEKTKASAVR

EWSDRDIVAQCFVFFFAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEGKELT

YEAIMGMKYLDQVVNEVLRKWPAAIAVDRECNK

DITFDVDGQKVEVKKGDVIWLPTCGFHRDPKYFENPMKFD

PERFSDENKESIQPFTYFPFGLGQRNCI (1)

GSRFALLEAKAVIYYLLKDYRFAPAKKSCIPLELITSGFQLSPKGGFWIKLVQRN

 

>CYP9F2 ortholog 83% FOUND BY W. JIANG

MLLEFVALLGIAFALFYRWATANNEFFKEKGIPFAKPKLYFGNMAQMFLRQKAMFDIVCDLYNKGGSNK (2)

VYGIFEQRQPLMMIRDPDLLRQITIKD

FDHFINHRNLFGTGTDDDPHDMSNLFGSSLFSMRDARWKDMRSTLSPAFTGLKMRQMFQL

MNQVAKEAVDCLKPDQQGSVQGTELDMKDYCTRFTNDVIASTAFGLQVNSFKERDNDFYS

MGKKLTTFGFLQNLKFMLFFTLKSLNK (0)

YIKVDLFDKKSTE

YFVRLVLDAMKYRQEHNIIRPDMINMLMEARGLFQTEKTKTTVIREWSDRDIVAQCFVFF

FAGFETSAVLMCFTAQELMENEDVQQKLYEEVQQVDIDLDGKELSYEAIMGMKYLDQVVS

EVLRKWPAAIAIDRECNKDITYELDGQTIEIKKGDYIWLPTCGFHRDPKYFENP

NKFDPERFSEENKANIQPFTYYPFGLGQRNCI (1)

GSRFALLEAKAVIYYLLKDYRFAPAKKSCIPMELASNGFQLT

PKSGFWVKFVPRN*

 

>9f3p AC017132 AC017240 AC009741 AC017170 AC007594 PLUS ESTs

revised 9/11/2000

MLWEFLALFAIATALFYRWASANNDFFKDRGIAYEKPVLYLGNMAGMFLRKRAMLDIVCDLYTKGGSGK (2)

FFGIFAQRQPLLMVRDPDLIKQITIKDFDHFINHRNEFDTSSDDDPHDMSN

LFSSSLFSMRDARWKDMRSTLSPAFTGSKMRQMFQLMNQVAKEAVDCLKQDDSRVQENEL

DMKDYCTRFTNDVIASTAFGLQVNSFKDRENTFYQMGKKLTTFTFLQNMKFILLFALKSLNK (0)

ILKVEIFDRKSTQYFVRLVLDAMKYRQEHNIVRPDMINMLMEARGIIQTEKTKASAVR

EWSDRDIVAQCFVFFFAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEGKELK

YLDQVVSEVLRKWPPAIAFDRECNK

(missing sequence here)

EAKAVIYYLLKDYRFAPAKKSCIPLELISSGFQLSPKGGFWIKLVQRN

 

Note D. pseudoobscursa seq from both 9f2 and 9f3p regions is identical

(mapped to two locations).  There is no 9f3p ortholog

 

note Genscan predicts three enzymes fused into one at the 9F2 locus

 

>Contig3323_Contig6140.179 DNA ligase III

MGSKRTENEDNRLDTFRRVCDEIAAESSYLKKVDKLQNFFEKGTSGSGFE

GDTLLWVQFLIPVANQRVYNLQNKALIKLFSRIFNANQQQMHLDLEQDGD

VSETLRKHFADSSKLKPQKQSKLYLHEVEKLLTQLEERTKEDEQTELLQE

LCKKATDLDLRTFIRLVKQDLRINARARHILDAFGPDAYPAYQSSRDLSA

IVEQFSGKGNKTSTLGQVKKTKKVGLSGGGIQVMTPISPMLANACKSVEE

AFKKSPSGLYGEVKYDGERVQIHKQGTEFKFFSRNLKPVMDHKIKALKDH

IPRAFPGAGDMILDSEIILVDTESGAMLPFGTLGAHKKQTFANASVCLFV

FDCILYDGKDLTQLEFHKRRKILEENINPLKSYVQLSESQFLKTKNELAM

MTAKVLHANLEGVVLKSPNGIYQPGKRNWLKVKKDYLFEGKMADTADLVV

LGAWYGSGKKGGVLSIFLMGCYDARDRLWKTVTKVHSGLDDATNEEIHGS

LMKLTERADANKTPNWLLCKKSLVPDVLAKDPASMPVWEITGAEFTKSEA

HTAAGISIRFPRITRLRSDKTAKEANDLAHLENLYDASKKNVNVDLLLAN

CDEDALNGKPNPEKTPQKVTPAINTRSNSNKKLKRSPIESDDDDKAGPPP

TPSKRKIPKKETSPSQKGLKDYFKPSKSEIKTEVKLEEKVTEPVSVESQL

FAGLVAQFDLDQDLGKFRDEFVRHGGSLTTDTKKADLVFYDADRAVDLEK

LRSPNAYTALLRVLRSSK

 

83% to 9F2

MLLEFVALLGIAFALFYRWATANNEFFKEKGI

PFAKPKLYFGNMAQMFLRQKAMFDIVCDLYNKGGSNK VYGIFEQRQPLMM

IRDPDLLRQITIKDFDHFINHRNLFGTGTDDDPHDMSNLFGSSLFSMRDA

RWKDMRSTLSPAFTGLKMRQMFQLMNQVAKEAVDCLKPDQQGSVQGTELD

MKDYCTRFTNDVIASTAFGLQVNSFKERDNDFYSMGKKLTTFGFLQNLKF

MLFFTLKSLNK YIKVDLFDKKSTEYFVRLVLDAMKYRQEHNIIRPDMINM

LMEARGLFQTEKTKTTVIREWSDRDIVAQCFVFFFAGFETSAVLMCFTAQ

ELMENEDVQQKLYEEVQQVDIDLDGKELSYEAIMGMKYLDQVVSEVLRKW

PAAIAIDRECNKDITYELDGQTIEIKKGDYIWLPTCGFHRDPKYFENP NK

FDPERFSEENKANIQPFTYYPFGLGQRNCIGSRFALLEAKAVIYYLLKDY

RFAPAKKSCIPMELASNGFQLTPKSGFW

 

(Acer Gene) Angiotensin converting enzyme

HTSGLAFCKITRKMETEVQRFY

RDKTIFVTGGTGFLGKVIIEKILRATDPKKIYFLVRSKKNEDVRTRVTQW

LSQPIFESLLKIKPTVLQRMTPIVGDCLEPDLGISEADRKMLAKEVQIVI

HGAATVRFNEDMHMALAINTRATRLMLQLAKEMHSLEAFVQISTAYSNCV

IDSINEEFYPQHLTCSADTVLRLRETLSAELLDNMTPALLGKYPNTYTYT

KALAEQVIQEEAGDLPVCIFRPAIIYANYKEPSSGWIDNPYGLVALIYGI

TYGVLHILLCNIKAQAVLVPGDYCANLAVASAWETAKKAKTKSVLTAIKP

KPTIYNFAPCRTNTIDWNDFRNKGMFYGKQVPIRQMIWYPFVHSTTCPWL

FRICSIFYHYIPGYFFDLILRLSGKKPRLVKAYRKAHANVEALYFFNRKT

FWFNRDNTEALWDHMSPEDRKGFNFDMKSLDWDDYFKTIWGVTIEKLLRI

TEVKRIYVLIRAKNGQEIKDRLVAWESDPVFEILLKTQPKAMQRVAPIQG

DCQEPDLGLGAEDRKLLIEEVQLVLHGAATVRFTEPLHIALAINTRAARL

MLQLAKQMQRLEAFVHISTAYSNCVVEKIEEKFYPEHLNCSANQVLELNE

WLESELIDNMAPALMGKYPNTYTYTKALAEQVIQREAGDIPLCVYRPGVI

IASYKEPMAGWIDNLYGPIAVLYGVAFGVLRITRLNVKAQAGIVPVDYAS

SMALATVWQTAIDAKPPGDPVIYNFTPSEENLITWGGFRDRAQNLVNNYP

LTKMMWCPFLHCTTTPWLFRLVAYFYHLVPGYAIDVVLRLRGKKPRMIKL

YDKIHKNINVLAPFVDTTWKFDTSNTQRLWKRMSSLDQNLFDFNMRGLNW

DDYFRQALYGIRIYLGKEQPTSIVRGKKILFR

 

>9h1 AC017648 8657-10342 also AC005450

MDQSMIALALFIILLVLLYKWSVAKYDVFSERGVSHEKPWPLIGNIPLKAMIGGMPVLKK

MIELHTKHTGSPVYGIYALRDAVFFVRDPELIKLIGIKEFDHFVNHNSMHNNIQESILSK

SLISLRDGRWKEMRNILTPAFTGSKMRIMYDLIQSCSEEGVIHIQEQLELSQDASIELEM

KDYFTRFANDVIATVAFGISINSFRRKDNEFFRIGQAMSRISAWSVVKAMLYALFPRLMK (0)

VLRIQVLDTKNIDYFSSLVTAAMRYRQEHKVVRPDMIHLLMEAKQQRLADLSDKSKDELY

YSEFTADDLLAQCLLFFFAGFEIISSSLCFLTHELCLNPTVQDRLYEEIISVHEELKGQP

LTYDKLTKMKYLDMVVLEALRKWPPSISTDRECRQDIDLFDENGQKLFSARKGDVLQIPI

FSLHHDPENFEDPEFFNPERFADGHALESRVYMPFGVGPRNCIGNRMALMELKSIVYQLL

LNFKLLPAKRTSRDLLNDIRGHGLKPKNGFWLKFEARQ

 

>9h1 Ortholog OF D. pseudoobscura Jun SHEN

MEKWIVVLSLVAVLLVLLYKWSVAKYGILTERGVPHAQPKPLLGTIPIRGMFTGLPVLKY

MIEQHMQYQGSRVYGVYALRDPLIFLRDPDLIKLVGIKEFDHFVNHHSMHNNVQESILSK

SLISLKDARWREMRYILTPAFTGTKMRVMYQLIQSCSEEAVRHIGEQLAQSNTGAIELEM

KDYFTRFANDVIATVAFGLSVNSFRRKDNEFFRIGQALSKISVWSIVKAVLHALVPRLMK(0)

LLRIQVLDFEKIDYFTSLVKVAMRYRKEHNVLRPDMIHLLMEAKQLRHAELVNQSKDSSR

YADFTDEDLLAQCLLFFFAGFQIISSALCFLSYELCMNPEVQSELYSEILSVDRELDGKP

PTFDRLTRMKYLDMVVQEGLRKWPPSIATDRECNNDIDLCDESGEKLFSAKKGDVLQIPI

FPLHHDPENFAEPERFDPQRFSDERRDEIRPGTFLPFGLGPRNCIGSRLALMELKSIVYQ

LILGFRLVPAQKTSTNLLDNIMGHNLQPKDGFWLKFESRK*

 

>12a4 AC006091 85973-87865 also AC015190 AC008141 rev 9/11/2000

EST AI109374

MLKVRSALSLIQSQKATLSLATQK (0)

RWQTNVATAEAREDSEWLQAKPFEQIPRLNMWALSMKMS MPGGKYKNMELMEMFEAMRQD

YGDIFFMPGIMGNPPFLSTHNPQDFEVVFRNEGVWPNRPGNYTLLYHREEYRKDFYQGV

MGVIPTQGKPWGDFRTVVNPVLMQPKNVRLYYKKMSQVNQEFVQR (2)

ILELRDPDTLEAPDDFIDTINRWTLESVSVVAL

DKQLGLLKNSNKESEALKLFHYLDEFFIVSIDLEMKPSPWRYIKTPKLKRLMRALDGIQE

VTLAYVDEAIERLDKEAKEGVVRPENEQSVLEKLLKVDRKVATVMAMDMLMAGVDT (0)

TSSTFTALLLCLAKNPEKQARLREEVMKVLPNKNSEFTEASMKNVPYLRACIKESQRLHPLIVG

NARVLARDAVLSGYRVPAGTYVNIVPLNALTRDEYFPQASEFLPERWLRSPKDSESKCPA

NELKSTNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVEFNYPTENAFRSALIN

LPNIPLKFKFIDLPN

 

>CYP12A4 D. pseudoobscura ortholog 75% to 12A4 Marie van der Merwe

MLKVRTGLSIIQAQKAALSVSCPL (0)

RWQTTAAVAEPRNDEEWLQARPFKQIPSTTFLSTVRNF

MPGGKYRKLDIVELFQALQDDY

GDIFYLPGIMGGPSFLTTHNPKDFEVVFRNEGVWPNRPGSDTLRYHRQTHRKDFFQGVEG

VIPTQGKTWSDFRSTVNPVLMQPKNVRLYYKKMSQVNQEFVQR (2)

IKTLRDVDTQEVPDDFISIINRWTLESVSVVALDKQLGLLKESGDNDLAVLLFKHLD

DFFELSADLEIKPSIWRYVKTPKLMKLMKALDGVQEVTLAYVDEAIERLEKEAKEGVVRP

ESEQSVLEKLLKVDKKVATVMAMDMLMAGVDT (0)

TSSTFTAALLCLAKNPEKQAILREEVMK

VLPEKDSEFTEASMKNVPYLRACIKESQRLYPLVIGNIRVLNRDSVLSGYQVPAGTFISM

VPTSLLSSEEHFLKANEFLPERWMRSATDSTGECPANDLKLKNPFVFLPFGFGPRMCVGK

RIVDMELELGIARLIRNFSIEFNHPTEKAFRSSLISLPNIPLKFKFTDLPN

 

>12a5 AC006091 8344985296 also AC015190 AC008141

MLKGRIALNILQSQKPIVFSASQQ (0)

RWQTNVPTAEIRNDPEWLQAKPFEEIPKANILSLFA

KSALPGGKYKNLEMMEMIDALRQDYGNIIFLPGMMGRDGLVMTHNPKDFEVVFRNEGVWP

FRPGSDILRYHRTVYRKDFFDGVQGIIPSQGKSWGDFRSIVNPVLMQPKNVRLYFKKMSQ

VNQEFVEL (2)

IKEIRDASTQEVPGNFLETINRWTLESVSVVALDKQLGLLRESGKNSEATKL

FKYLDEFFLHSADLEMKPSLWRYFKTPLLKKMLRTMDSVQEVTLKYVDEAIERLEKEAKE

GVVRPEHEQSVLEKLLKVDKKVATVMAMDMLMAGVDT (0)

TSSTFTALLLCLAKNPEKQARLR

EEVMKVLPNKDSEFTEASMKNVPYLRACIKESQRVYPLVIGNARGLTRDSVISGYRVPAG

TIVSMIPINSLYSEEYFPKPTEFLPERWLRNASDSAGKCPANDLKTKNPFVFLPFGFGPR

MCVGKRIVEMELELGTARLIRNFNVEFNHSTKNAFRSALINLPNIPLKFKFTDVPN

 

>CYP12A5 ortholog Contig8255_Contig717.47 76% to 12A5

MLKVRSGLSIIQAQKAALSVSSPL (0)

RWQTTAAVAEPRNDEEWLQARPFEQI

PSTTFLSTVRNF MPGGKYSKLDIVNLFKALQDDYGNILYLPGMMGGTSYL

MTHNPKDFEVVFRNEGVWPHRPGSDTLRYHRKTHRKDFFQGVEGAIPTQG

KTWSDFRSAVNPVLMQPKNVRLYYKKMSQVNQEFVQR (2)

IKALRDIDTQEAP

DDFLTVINRWTLESVSVVALDKQLGLLKESDDNDQAVLLFKYLDDFFELT

ADLEMKPSIWRYFKTPKLMKLMKALDGVQEVTLAYVDEAIERLEKEAKEG

VVRPENEQSVLEKLLKIDKKVATVMAMDMLMAGVDT (0)

TSSTFTAALLCLAK

NPEKQAILREEVMKVLPEKDSEFTEASMKNVPYLRACIKESQRIYPLVIG

NGRVLNRDSVLSGYQVPAGTCVSMIPLRLLSSEEHFPKAAEFLPERWIRN

ATDSSGVCPANDLKLKNPFVFLPFGFGPRMCVGKRIVDMELELGIARLIR

NFNIEFNHPTENAFRSAMISLPNIPLKFKFTDLPN*

 

>12B1 Drosophila acanthoptera

MWKFAIHSQQPFCWQQLCNRRHLYVGNVQQQTHLELLDAAPTRS

DDEWLQAKPYEKVPGPGTWQVLSYFLPGGKQYNTNLIQMNRRMREWYGDIYRFPGLMG

KQDVIFTYNPNDFELTYRNEGVWPIRIGLESFTYYRKVHRPEVFGSIGGLVSEQGKDW

AHIRNKVNPVQMRVQNVRQNLPQIDQISREFVDKLDTLRDPVTHILNDNFHEQLKMWA

FESISFVALNTRMGLLSDRPDPNAARLAEHMTDFFNYSFKYDVQPSIWPYYKTPGFKK

FLQTYDKITEITTAYIDEAIKRFEIEKDSGNECVLQQLLSLNKKVAVVMAMYMLMAGI

DTTSSAFVTILYHLARNPHKQRQLHRERRRILPDSDEPLTPENTKNMPYLRACIKECM

RITSITPGNFRIATKDLVLSGYRVPRGEGVLMGVLELSNSEKYFGQSGQFMPERWLKA

DTDPDVKACPAARSRNPFVYLAFGFGPRTCIGKRIAELEMETLLTRLLRRYQVSWLAE

MPLQYESNIILSPHGIYVQVRAAC

 

>12b2 AC018326 72279141 also AC004345 AC004657

revised Nterm removed small in frame intron

MWKYSNKIIYRNVSGNQLWFNRNSSVGGTLSQQ (0)

TQLELADSRIDEKWQQARSFGEIPGPSLLRMLSFFMPG (1)

GALRNTNLIQMNRLMREMYGDIY

CIPGMMGKPNAVFTYNPDDFEMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVGGLASD (2)

QGQEWADIRNKVNPVLMKVQNVRQNLPQLDQISKEFIDK (2)

LETQRNPETHTLTTDFHNQLK

MWAFESISFVALNTRMGLLSDNPDPNADRLAKHMRDFFNYSFQFDVQPSIWTFYKTAGFK

KFLKTYDNITDITSNYIETAMRGFGKNDDGKTKCVLEQLLEHNKKVAVTMVMDMLMAGIDT (0)

TSSACLTILYHLARNPSKQEKLRRELLRILPTTKDSLTDQNTKNMPYLRACIKEGLRIT

SITPGNFRITPKDLVLSGYQVPRGTGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPD

IQACPAARTRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVSWLPETPIEYES

TIILSPCGDIRFKLEPVGDLM

 

>CYP12B2 ortholog Contig3295_Contig8282.217 76% to D. melanogaster 12B2

MWKNTMKTVRRQSAAHQLFNARDLSLNRTLGQQ (0)

THLELLDKSPPRTDERWQQAKSYGELPGPNGWRMISYFLPG (1)

GKLHNTNLIQMNRRLRVMYGDIYRLPGLMGKPDIVFT

YNPEDFELTYRNEGVWPIRIGLESFSYYRKVKRPDVFGGIGGLVSE (2)

QGKDWADIRNKVNPVLMKVQNVRQNLPQLDQIAKEFIDK (2)

LESQRDPETHLLQDDFHDQLKNWAFESISFVALNTRMGLLSDQPDPNAARLAKHMSDFVN

YSFQYDVLPSIWPYYKTRGFNRFLKTYDDITEITTNYIEEAIQRFKIDDGRKNKCVLEQL

LGLNKQVAVVMAMDMLMAGIDT (0)

TSSAFVTILYHLACNPSKQSQLRRELL

HILPDSKGSLTDESTKNMPYLRACIKEGLRITSITPGNFRITTKDLVLSG

YQVPRGTGVLMGVMELSNSDEYFAQSADFIPERWLKADLAGDVLACPEAR

TRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRRYHVNWLPNAPLQY

KSTIILSPCGDIRFKFLPVEGVRESL*

 

>12c1 AC009385 comp(57935-59646) also AC012807

MLRLTVKHGLRANSQLAATRNPDASSYVQQLESEWEGAKPFTELPGPTRWQLFRGFQKGG

EYHQLGMDDVMRLYKKQFGDICLIPGLFGMPSTVFTFNVETFEKVYRTEGQWPVRGGAEP

VIHYRNKRKDEFFKNCMGLFGN (2)

GAEWGKNRSAVNPVLMQHRNVAIYLKPMQRVNRQFVNR

IREIRDKESQEVPGDFMNTINHLTFESVATVALDRELGLLREANPPPEASKLFKNIEVLM

DSFFDLGVRPSLYRYIPTPTYKKFSRAMDEIFDTCSMYVNQAIERIDRKSSQGDSNDHKS

VLEQLLQIDRKLAVVMAMDMLMGGVDTTSTAISGILLNLAKNPEKQQRLREEVLSKLTSL

HSEFTVEDMKSLPYLRAVIKESLRLYPVTFGNARSAGADVVLDGYRIPKGTKLLMTNSFL

LKDDRLYPRAKEFIPERWLRRKDDDKSDVLMNKDLNAFIYLPFGFGPRMCVGKRIVDLEM

ELTVANLVRNFHIEYNYSTEKPYKCRFLYKPNIPLKFKFTDLKY

 

>D. pseudoobscura ortholog of Cyp12c1 Y. Zong 65%

MIRRAVVQQGIRARSSLAEVQVISKKNLDPAAASSSYMEQLEGEWSTAKPFEEIPGPTRWQLWRGFQKGG

EFHHLDMAELMDLYRSRFGDMVRVPGLFGMPTTVFTFKVENFERIYRAEGQWPVRGGADP

VLHYRANRKDGFFKDCVGLFSN (2)

GPEWGRLRSAANPVLMQHRNANLYLEPMQRVNNQFIDRIRATRDKESLEMPGDFLDTINTL

TFESVAVVALDRELGLLRDSDQKPEAKELFRNIKIFLQSFFDLGIKPSVYKYISTPTYRKF

SQASDAIFDTCSMYVNEAVARIDGQSAAEREGRRSILEQLLQINRKFAVVMAMDLLFGAVD

TTTSALAGVLLSLAKNPKQQQMLREEIVSMLPHPDRQFTLAEMKSLPYLRACIKESMRMFP

VTFGNIRSAGTDVVLDGYRIPQGTNLLMLSSNMLRDERFYPRPNEFLPERWARPQDDNSAE

SPLRNNLNPFVYLPFGFGPRMCVGKRIVDLEMELTVANLVRNF

HIEFNYPIENAFKRSFLNMPNIPLRFKFTDVNYS*

 

>12d1 AC008187 comp(84371-86114)

MNTLSSARSVAIYVGPVRSSRSASVLAHEQAKSS (0)

ITEEHKTYDEIPRPNKFKFMRAFMPG

GEFQNASITEYTSAMRKRYGDIYVMPGMFGRKDWVTTFNTKDIEMVFRNEGIWPRRDGLD

SIVYFREHVRPDVYGEVQGLVAS (2)

QNEAWGKLRSAINPIFMQPRGLRMYYEPLSNINNEFIER (2)

IKEIRDPKTLEVPEDFTDEISRLVFESLGLVAFDRQMGLIRKNRDNSDALTLFQTSRD

IFRLTFKLDIQPSMWKIISTPTYRKMKRTLNDSLNVAQKMLKENQDALEKRRQAGEKINS

NSMLERLMEIDPKVAVIMSLDILFAGVDATATLLSAVLLCLSKHPDKQAKLREELLSIMP

TKDSLLNEENMKDMPYLRAVIKETLRYYPNGLGTMRTCQNDVILSGYRVPKGTTVLLGSN

VLMKEATYYPRPDEFLPERWLRDPETGKKMQVSPFTFLPFGFGPRMCIGKRVVDLEMETT

VAKLIRNFHVEFNRDASRPFKTMFVMEPAITFPFKFTDIEQ

 

>D. pseudoobscura ortholog of Cyp12d1 Y. Zong Contig6654_Contig5965.95 71%

MNAWQSLTRRLAVATGPIRSLRGSSAQAQAQRSVEDVEARPFSEVPRPGR

LQFMRSFMPGGEFSDASIVEFSMGMRRRYGDIFILPGMFGRKDWVVTFNT

GDIATVFRNEGAWPHREAFDSIVHFRQHIRPDVYGRTLGLTVG (2)

QGEDWGKMRSAVNPIFMQPRGLRMYFEPLSNINNEFIER (2)

IKEIRDPSTLEVPSNFND

EMQRLIFESLALVSFDRQMGIIRKHRDNPDALALFRTSRDIFRYTFQLDV

QPSAWKIVSTPTYRKMMRTLNESLDVAQRVLAESQQLLEHRRRAGEQVNS

HSMLQRLMDIDPKLALIMGLEILFAGVDATATLLSAVLLTLAKHPEKQHK

LRAEVRQVMPSKESLLNEDTMRDMPYLRAVIKETLRFYPNGLGTLRSCPT

GVTLSGYAVPPGTTVLLAANALMKDPAHYPRPDEFLPERWLRDPQSGQKM

QVSPFTFLPFGFGPRMCLGKRVVDLEVETSVAKLIRNFHVEFLHDASRPY

KTLFVMEPAIDFRFRFTDIQE*

 

>12e1 AC018294 2070-3932 N-term revised

MLSTQWNANKQISRQIYQLCR (1)

VLNLEEAKPYADIPGPSKLQLIRAFLPG (1)

GLYKNLPVHEMFLDMNRQYGSIFRMPSVAGTDLVLTMNPQDYEVIFRNEGQYPYRR

SFEVMDYFKRVHRREVFDGYDGLTSG (2)

NGPAWGKMRTAVNPILLQPRNAKLYMTNLVQVSDEFLER (2)

IRIIRDPVTQEMPDDFAVDIRHLVIESICSVALNTHLGLLGEQRNNKDIQKLVLA

LQDVVELGFQLDIMPAFWKYLPMPNFKKLMRSLDTITDFCYFHIGNALKRIEEDAKAGTL

NEIGLETSLLEKLARFDRQTAVIIAMDLLFAGADP (0)

TLVTLGGILFSLSKSPDKQARLLEE

IRGILPNKDSSLTIENMRNLPYLRACIKEGIRMYPIGPGTLRRMPHDVVLSGYRVVAGTD

VGIAANYQMANMEQFVPKVREFIPERWLRDESNSHLVGETATPFMYLPFGFGPRSCAGKR

IVDMMLEIAISRLVRNFKIGFDYPIENAFKAQFFVQPNIPFKFKFIERNE

 

>D. pseudoobscura 12e1 ortholog 77% Van Alstine

MLSQQLNAKRQASCQIYQIYRN (0)

ETISLEQAKPYAEVPGPSKFQMIRAFMPG (1)

GRYKNAPAHEMFLDLSRQFGGLFRMPSIAGTDMVLTMNPQDYATVFRN

EGQWPHRRSFTTVEYFRKVRRPEVFGEYDGLLSG (2)

NGAAWGKMRTAVNPILLQPRNAKLYLKNLVQVSDEFLER (2)

IRLIRDPVSQEMPDDFTEDIRNLVIESIGSVALNTHLGLLGENRYSDEANQ

LKAAMRDFVELGFQLDMMPAIWKYLPVPKFNQLMRSLDTMTDFCVTHIEQALQR

IEEDVKAGKMSPEMGMEASLLEKLARFDRKTAVIIAMDFLFAGTDP (0)

TLVSLVGILLSLAKNPDKQARLLEEINQILPAKDSPLTIENMSNLPYLRACIKEGIRLYPIGPGTV RRMPHDVVLSGYRIVAGTDVAIAANYQMANMEEYVPRVREFLPERWLRDESNSKLVGDTATPFMYLPFGF

GPRACAGKRIVDMMLEIGVARLVRNFEIGFDYPIENAFKTQFFVQPNIPFKFKFVERTA*

 

>18a1 AC012164 114600-117669 also AC015216

MLADSYLIKFVLRQLQVQQDGDAQHLLMVFLGLLALVTLLQWLVRNYRELRKLPPGPWGL

PVIGYLLFMGSEKHTRFMELAKQYGSLFSTRLGSQLTVVMSDYKMIRECFRREEFTGRPDTPFMQTLNGY (1)

GIINSTGKLWKDQRRFLHDKLRQFGMTYMGNGKQQMQKRIM (0)

TEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSIDDPKFRRFNFLIEEGMRLFGEIHTVD

YIPTMQCFPSISTAKNKIAQNRAEMQRFYQDVIDDHKRSFDPNNIRDLVDFYLCEIEKAK

AEGTDAELFDGKNH (1)

EEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQ

VVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHSPTR (2)

DVELNGYTIPAGSHVIP

LINSVHMDPNLWEKPEEFRPSRFIDTEGKVRKPEYFIPFGVGRRMCLGDVLARMELFLFF

ASFMHCFDIALPEGQPLPSLKGNVGATITPESFKVCLKRRPLGPTAADPHHMRNVGAN

 

>D. pseudoobscura ortholog of Cyp18a1 96% FOUND BY W. JIANG

MLADSYLIKFLLRQLQVQQQDAGAQHLLMVFLGFLALVSLLQWMLRHYRELRKLPPGPWG

LPVIGYLLFMGNEKHTRFMELAKQYGSLFSTRLGSQLTVVMSDYKMIRECFRREEFTGRP

DTPFMQTLNGY (1)

GIINSTGKLWKDQRRFLHDKLRQFGMTYMGNGKQQMQKRIM (0)

TEVHEFIGHLHASDGQPIDLSPVISVAVSNVICSLMMSTRFSIDDPKFRRFNFLIEEGMR

LFGEIHTVDYIPTMQCFPSISTAKNKIAQNRAEMQRFYQDVIDDHKRSFDPHNVRDLVDY

YLCEIEKAKAEGTDAELFDGKNH (1)

EEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQY

LPVTESTILESMRRSSIVPLATTHSPTR (2)

DVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGKVRKPEYFIPFGVGR

RMCLGDVLAKMELFLFFASFMHCFDIALPEGQPLPSLKGNVGATITPEAFKVCLKRRPLA

PTATDPHHMRNVGSN*

 

>28a5 AC018242 6065-8082 also AC001660

MVLITLTLVSLVVGLLYAVLVWNYDYWRKRGVPGPKPKLLCGNYPNMFTMKRHAIYDLDDIYR (2)

QYKNKYDAVGIFGSRSPQLLVINPALARRVFVSNFKNFHDNEIAKNIDEKTDFIFAN

NPFSLTGEKWKTRRADVTPGLTMGR (0)

IKTVYPVTNKVCQKLTEWVEKQLRLGSKDGIDAKH (0)

MSLCFTTEMVTDCVLGLGAESFSDKPTPIMSKINDLFNQPWTFVLFFILTSSFPSLSHLI

KLRFVPVDVERFFVDLMGSAVETRRAQLAAGKQFERSDFLDYILQLGEKRNLDNRQLLAY

SMTFLLDGFETTATVLAHILLNLGRNKEAQNLLREEIRSHLQDGTIAFEKLSDLPYLDACVQ (1)

ETIRLFPPGFMSNKLCTESIEIPNKEGPNFVVEKGTTVVVPHYCFMLDEEFFPNPQSF

QPERFLEPDAAKTFRERGVFMGFGDGPRVCI (1)

GMRFATVQIKAAIVELISKFNVKINDKTRKDNDYEPGQIITGLRGGIWLDLEKL*

 

>CYP28A5 L. Hunt

MILITLALGLATVGLLYLLMTWNFDHWRKRRVPGPKPKIPTGNYPHMYTMKRHAIYDLNDIYV (2)

KYKNKYDAVGIFGGRVPQLLVISPELARRVFVSDFKHFHDNEVSNLIDEKSDFIFAN

NPFSLTGDKWKQRRADVTPGLTMGR (0)

IKTVYPVTNKVCQKLSEWVDKQIRLGAPEGINAKD (0)

MSLCFTSEMVTDCVLGLSAESFSDNPTPIMGHIKDLFSQSWSFLIYFVIISTFPSLSHLI

KLRFVPPKVERFFIELMENAVKARRAQLVAGKQFERTDFLDYILQMAEKRSLDTRQLLAH

TMTFLLDGFETTATVLAHMLLLLGREPEAQKRLREEILAHVKDGIVSFEKLNELPFLDACVQ (1)

ETIRIFPPAFMSNKLCTEAIELPNKDGPNFTVEVGTTIVIPHYCFMLDEDYFPDSQSF

QPDRFMEPDAAKKFRERGTFMGFGDGPRVCI (1)

GMRFALAQIKAAAVELITKYNVKVNPKTRKDNLYDPMSFITSLQGGIWLDLEAL*

 

>28c1 AC014191 comp(8254-10002) also AL133495

MFGSLLLGIATLLGAIYAFLVSNFGHWRRRGVTEPRALPLFGSFPNMIWPRQHFTMDMRDIYM (2)

HYRNTHSYVGCYLLRAPKLLVLEPRLVYEIYVSAFSHFENNDASKMVDIAKDRLVAL

NPFVLEGEEWRHQRAVFSTLLTNGRIRTTHAIMQRVCLDLCQFIAIKSAGGKDLDCID (0)

LGLRFTGESLFDCVLGIQARTFTDNPLPVVRQNHEMSAENRGLAIAGAVHGLFPNLPRWLRP

KVFPRSHDRFYGQMISEALRLRRSKHQERNDFINHLLEMQRELDLSEEDMASHAMTFMFD

GLDTTSNSIAHCLLL (0)

LGRNPDCQRRLYEELQLVNPGGYLPDLDALIDLPYLSACFN (1)

ESLRIYPAGGWASKTCTKEYELRGSHHSEPLKLRPGDHVMVPIYALHNDPDLYPEPDVFRPERF

LDGGLKNCKQQGIFLGFGNGPRQCVGMRLGLAMAKAALAAIVQRFEVVVSPRTLNGTELD

PLIFVGVHKGGIWLQFVPRKNVTTK

 

>28c1 ortholog Y. Abdelrahman

MIGSLLLAVGALATLVYGFLVWNFGHWRARGIKEPRALPLLGSFPNMVWPRQHFTMDMRDLYM (2)

KYRETDSYVGTFLLRSPKLLLLEPRLVYEVFVSAFRHFEDNDAARMVDTGKDVLVCCNPFVLEGNEWRQQRGIFSSLLTNGRIRTTHTIMQRVCRDLCDFIAKESLKGEPQDGMD (0)

LGLRFTGDSLFDCVLGIQARCFSDSPLPVIRHNREMSNENPGLAIAGALNGLFPRLPRWLRP

KIFPRSYDRFFGDLIRQAFSLRRGQHQERNDFINHLLALKREHGLTEPQLTSHAMTFMFD

GLDTTSSTISHCLLL (0)

LGRYPECQQRLYEELDKASPSKELPDLDALNDLPYLSACFN (1)

ESLRIYPAGGWASKTCTEPYKLHGSHHSQPLQMLPGDNIMIPIYGLHHDPQFYPEPEEFRPERF

LDGGLKRFKQMGVFLGFGNGPRQCVGMRLGLAQAKAALAAIVQRFEVRVHPRTADGLELD

PYIFVGCHKGGIWLDFVSRPV*

 

>28d1 AC017780 comp(28385-30262) also AC009355 AC008324 AC008327

MCPISTALFVIAAILALIYVFLTWNFSYWKKRGIPTAKSWPFVGSFPSVFTQKRNVVYDIDEIYE (2)

QYKNTDSIVGVFQTRIPQLMVTTPEYAHKIYVSDFRSFHDNEMAKF (0)

TDSKTDPILANNPFVLTGEAWKERRAEVTPGLSANR (0)

VKAAYPVSLRVCKKFVEYIRRQSLMAPAQGLNA

KDLCLCYTTEVISDCVLGISAQSFTDNPTPMVGMTKRVFEQSFGFIFYTVVANLWPPITK

FYSVSLFAKDVAAFFYDLMQKCIQVRRESPAAQQRDDFLNYMLQLQEKKGLNAAELTSHT

MTFLTDGFETTAQVLTHTLLFLARNPKEQMKLREEIGTAELTFEQISELPFTEACIH (1)

ETLRIFSPVLAARKVVTEPCELTNKNGVSVKLRPGDVVIIPVNALHHDPQYYEEPQSFKPERF

LNINGGAKKYRDQGLFFGFGDGPRICP (1)

GMRFSLTQIKAALVEIVRNFDIKVNPKTRKDNEIDDTYFMPALKGGVWLDFVERN

 

>D. pseudoobscura ortholog of 28d1 Wei Liu Contig3635_Contig7816.10

MCPICAVLLLLATLLTLIYIFLTWNFGYWKRRGIQTAKAWPLVGSFPSVFTQKRNMAYDIDEIYR (2)

QYKNTESVVGVFNTRIPQLMILCPEYAHKIFAGEFRSFHDNEIGKF (0)

TNKKVDKILANNPFILTGEDWKERRAEITPGLSANR (0)

VKAVYPVSQSVCKHFVEYIKRQQRMATSDGINAKDLCLCYTTEVVSDCVLGISAQSFTET

PTPLVGMIKRVFEQSFGFIFYTMAANLWPPIRKIYSVPLFAKEVEQFFFDIMEKCIILRR

ENPKQQREDFLNYMLQLQEKKGLDTTELTSHTMTFLTDGFETTALVLSHTLLLLGRNPAE

QRKVRDEIGKGDLTFEQLSELPYIDACIH (1)

ETLRLFAPLLSGRKLVTEAYDFVNKNGVTVRVHPGDVVIIPAHSMHHDPEYYEDPEVFKP

ERFLEINGGVRKYREAGVYYGFGDGPRVCP (1)

GMRFALTQVKAALVEIVQNFEIKVNPKTRSDNELDDTFFMATLKGGIWLDFEARK*

 

>28d2 AC017780 comp(31545-33456) AC008324 revised 9/11/2000

MCPVTTFLVLVLTLLVLVYVFLTWNFNYWRKRGIKTAPTWPFVGSFPSIFTRKRNIAYDIDDIYE (2)

KYKDTDNMVGVFTTRVPQLLVMCPEYIHKIYATDFRSFHNNEWRNF (0)

VNKKTDMILGNNPFVLTGDEWKERRSEIMPALSPNR (0)

VKAVYPVSQSVCKKFVEYIRRQQQMATSEGL

DAMDLSLCYTTEVVSDCGLGVSAQSFTDTPTPLLKMIKRVFNTSFEFIFYSVVTNLWQKV

RKFYSVPFFNKETEVFFLDIIRRCITLRLEKPEQQRDDFLNYMLQLQEKKGLHTDNILIN

TMTFILDGFETTALVLAHIMLMLGRNPEEQDKVRKEIGSADLTFDQMSELPHLDACIY (1)

ETLRLFSPQVAARKLVTEPFEFANKNGRTVHLKPGDVVTIPVKALHHDPQYYEDPLTFKPER

FLESNGGGMKSYRDRGVYLAFGDGPRHCP (1)

GMRFALTQLKAALVEILRNFEIKVNPKTRSDNQIDDTFFMATLKGGIYLDFKDL

 

>There is no ortholog of 28d2.  The UCSC browser aligns the 28d1 ortholog here.

 

>49A1 DROSOPHILA mel.SEQ (new N-term)

MSGLRKTSIALMRRSTSSTTILPHSGGVGGAVSPPSSGVGVATEIEKSIA

MQRLRTGESSNPKKLNVS (2)

QQPVTSVATTRTTASSLPAETTSSPAAAVRPYSEVPGPYPLPLIGNSWRFAPLI (1) GTYKISDLDKVMNELHVNYGKMAKVGGLIGHPDLLFVFDGDEIRNIFKKEEAMPHR (2)

PS MPSLRHYKGD LRRDFFGDVA GLIGV (2)

HGPKW EAFRQEVQHI LLQPQTAKKYIPPLNDIASE FMGR (2)

IELMRD EKDELPANFL HELYKWALE (1)

SVGRVSLDTRLGCLSPEGSEEAQQIIEAINTFFWAVPELELRMPLWRIYPTKAYRSFVKALDQFTA (2)

ICMKN IGKTMDKADA  300

DEARGLSKSE ADISIVERIV RKTGNRKLAA ILALDLFLVG VDT (0)

TSVAASS TIYQLAKNPD  360

KQKKLFDELQ KVFPHREADI NQNVLEQMPY LRACVKETLR (2)

MRPVVIANGRSLQSDAVINGYHVPKG (0)

THVI FPHLVVSNDP AYFPEPKRFL PERWLKQSTD A (1)

AGCPHANQK IHPFVSLPFG  480

FGRRMCVGRR FAEIELHTLL AK (0)

IFRKYKVS YNSGEFVYRV NSTYIPQSPL NFKLTLRDE

 

>CYP49A1 ortholog 91% to CYP49A1 intron 8 missing possible extension to N-terminal

MSGLRKTSFALMRRSTYSGSATATMLPHAGPGPGTGVDGAAPPSGVGVATEIEKSIA

RQRLRQGQSETAKKLNVS (2) exon 1

HLAATAVPATETATATATRTASPTAGVRPYSEVPGPYPLPLIGNSWRFAPLI (1) exon 2

GTYKISELDKVMNELHVNYGKMAKVGGLIGHPDLLFVFDGDEIRNIFKKEEAMPHR (2)

PSMPSLRHYKGDLRRDFFGDVAGLIGV (2)

HGPKWEAFRQEVQHILLQPQTAKKYIPPLNDIASEFMGR (2)

IEAMRDEKDELPANFLHELYKWALE (1)

SVGRVSLDTRLGCLSPEGSEEAQQIIDAINTFFWAVPELELRMPLWRIYPTKAYRSFVRALDQFTA (2)

ICMKNIGQTMDKAEADEARALPKSEADISIVERIVRKTGNRKLAAILALDLFLVGVDTTS

VAASSTIYQLAKNPDKQRRLFEELQRVFPHREAEINQNVLEQMPYLRACVKETLR (2)

MRPVVIANGRSLQSDAVINGYHVPKG (0)

THVIFPHLVVSNDPAYFPEPKRFLPERWLKQTAAVA (1)

VGCPHASHKIHPFVSLPFGFGRRMCVGRRFAEIELHTLLAK (0)

IFRKYKVSYSSGEFVYRVNSTYIPQSPLNFKLTLRED

 

>301a1 AC017275 comp(35594-38192) also AC007356

MNNLSLKAWRSTVSCGPNLRQCVPRISGAGSRRAQCRESSTGVATCPHLADSEEASAPRI

HSTSEWQNALPYNQIPGPKPIPILGNTWR (2)

LMPIIGQYTISDVAKISSLLHDRYGRIVRFGGLIGRPDLLFIYDADEIEK (0)

CYRSEGPTPFRPSMPSLVKYKSVVRKDFFGDLGGVVGV (2)

HGEPWREFRSRVQKPVLQLSTIRRYLQPLEVITEDFLVRCENLLDENQELPEDFDNEIHKWSLE (1)

CIGRVALDTRLGCLESNLKPDSEPQQIIDAAKYALRNVATLELKAPYWRYFPTPLWTRYVKNMNFFVG (2)

VCMKYIQSATERLKTQDPSLRAGEPSLVEKVILSQKDEKIATIMALDLILVGIDT (0)

ISMAVCSMLYQLATRPVDQQKVHEELKRLLPDPNTPLTIPLLDQMHHLKGFIKEVF

RMYSTVIGNGRTLMEDSVICGYQVPKGVQAVFPTIVTGNMEEYVTDAATFRPERWLKPQH

GGTPGKLHPFASLPYGYGARMCLGRRFADLEMQILLAKLLRNYKLEYNHKPLDYAVTFMY

APDGPLRFKMTRV

 

>CYP301A1 ortholog D. pseudoobscura found by Michael Mohler

MNKLPVRACTASASSLRRTVSRISGSGLLPNEKQRLEIRDSSTGVAACPHLLEPEETAAP

TTPRIHSTPEWQNALPYNQIPGPKPLPILGNTWR (2)

LMPIIGQYTISDVANISSLLHDRYGRIVRFGGLIGRPDLLFIYDADEIEK (0)

CYRSEGPTPFRPSMPSLVKYKSVVRKDFFGELGGVVGV (2)

HGEPWRQFRSRVQKPVLQLSTIRRYLQPLEAITDDFLVRCEHLLDGNQELPKDFDNEIHKWSLE (1)

CIGRVALDTRLGCLEANLSPDSEPQQIIDAAKYALRNVATLELKAPYWRYFPTPLWTQYVKNMNFFVG (2)

VCMKYIQSATERLKTQDPSQRAGEPSLVEKVIMSEKDEKIATIMALDLILVGIDT (0)

ISMAVCSMLYQLATRPEEQQKVHEELKRLLPDPNTPLTIQLLDQMHHLKAF

IKEVFRMYSTVIGNGRTLQEDSVICGYQVPKGVQAVFPTIVTGNMEEYVTDAATFRPERW

LKPQHGGVPGKLHPFASLPYGYGARMCLGRRFADLEMQILLAKLLRNYKLEYNHKPLDYA

VTFMYAPDGPLRFKMTRI*

 

>302a1 AC015396 3195433705

MLTKLLKISCTSRQCTFAKPYQAIPGPRGPFGMGNLYNYLPGIGSYSWLRLHQAGQDKYE

KYGAIVRETIVPGQDIVWLYDPKDIALLLNERDCPQRRSHLALAQYRKSRPDVYKTTGLL

PTNGPEWWRIRAQVQKELSAPKSVRNFVRQVDGVTKEFIRFLQESRNGGAIDMLPKLTRLNLE (1)

LTCLLTFGARLQSFTAQEQDPRSRSTRLMDAAETTNSCILPTDQGLQLWRFLETPSF

RKLSQAQSYMESVALELVEENVRNGSVGSSLISAYVKNPELDRSDVVGTAADLLLAGIDT

TSYASAFLLYHIARNPEVQQKLHEEARRVLPSAKDELSMDALRTDITYTRAVLKESLRLN

PIAVGVGRILNQDAIFSGYFVPKG (0)

TTVVTQNMVACRLEQHFQDPLRFQPDRWLQHRSALN

PYLVLPFGHGMRACIARRLAEQNMHILLLR (0)

LLREYELIWSGSDDEMGVKTLLINKPDAPVLIDLRLRRE

 

>CYP302A1 ortholog Contig3838_Contig6523.13 82% identical to 302A1

MLTKLLKISCTSRQCTFAKPFEAMPGPRGPWGLGNLYNYMPIIGSYSFLR

LHQAGQDKYERYGAIVRETMAPGQDIVWLYDPKDIAKLLNERDCPQRRSH

LALAQYRRQRPHVYKTTGLLPTNGPEWWRLRSQLQKELSAPKSVRNFIPQ

VDGVTREFLTFLRESSDDGDAIDMLPKLTRLNLE (1)

LTCLLTFGARLQSFSP

EEQSPQSRSTHLMHAAETTNSCILPTDQGLQLWRLMETPSYRKLRQAQSY

MESVALKLMESSSSEQSSLISTYLQNPELDHSDVVGTAADLLLAGIDTTS

YASAFLLYHVARHPEVQQRLHAEARRVLPDPDQPLSADALRTDITYTRAV

LKESLRLNPISVGVGRVLNQDTVLSGYFVPKG (0)

TTVVTQNMIACRLEQHFP

DPLLFQPDRWLQQRNALNPYLVLPFGHGMRACIARRLAEQNIHVLLLR (0)

LLRNFELIWRGGTDADLDVVTLLINKPDAPVMIELRSRSK*

 

>303a1 AC017306 12933-14444 no introns

MFYTVIWIFCATLLAILFGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVF

ARQYVNPYGFYGLKIGKDKVVIAYTNDAISEMMTNEDIDGRPDGIFYRLRTFNSRLGVLL

TDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHD

LTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNF

SGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGMFSDQSL

LAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLP

YCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPES

FNPDRYLFDGHLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPE

EVPLEGATAAVKPYDIMLVAREQ

 

>303A1 no introns Ajit Narang

MFYAVIWIFFATLLAVLLGGVRKPKRFPPGPRWYPIVGSALQISQLRCRLGMFCKVIDVL

ASRYVNPYGFFGLKIGKDKVVIAYTNDAISEMMTNEDIDGRPDGIFYRLRTFNSRLGVLL

TDGEMWVEQRRFILRHLKNFGFARSGMTDIVHNEATCLLQDLRAVVRREGGHQARIQMHD

LTSVYVLNTLWCMLSGQRYDPGSVEITELLETFFELFKNIDMVGALFSHFPLLRFIAPDY

SGYNGFVESHRALYSFMSKEIELHRRTYRSFDEPRDLMDSYLRAQEAGNDDKGMFSDESL

LAICLDMFLAGSETTNKSLGFCFMHLVLRPDIQERAYTEIKEVVGLERIPEWTRDRSKMP

YCEAITLEAVRMFMLHTFGIPHRAVCDTRLAGYEIPKDTMVIACFRGMLINPVDFPEPET

FNPERYLFDGQLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQHFKLVSIPGQMPE

EVPLEGATAAVKPYEVMLVARTPEQEC*

 

>304a1 AC008359 comp(80887-82836) also AC014292 AC009393

MITETLLTICAAVFLCLSYRYAVGRPSGFPP (1)

GPPKIPLFGSYLFMLIINFKYLHKAALTL

SRWYKSDIIGLHVGPFPVAVVHSADGVREILNNQVFDGRPQLFVAAMRDPGQDVR (1)

GIFFQDGPLWKEQRRFILRYLRDFGFGRRFDQLELVIQEQLNDMLDLIRNGPKYPHEHEMVKSGG

YRVLLPLLFNPFSANAHFYIVYNECLSREEMGKLVKLCQMGIQFQRNADDYGKMLSIIPW

IRHIWPEWSGYNKLNESNLFVRQFFADFVDKYLDSYEEGVERNFMDVYIAEMRRGPGYGF

NRDQLIMGLVDFSFPAFTAIGVQLSLLVQYLMLYPAVLRRVQNEIDEVVGCGRLPNLEDR

KNLPFTEATIREGLRIETLVPSDVPHKALEDTELLGYRIPK (0)

DTIVVPSLYAFHSDARIWS

DPEQFRPERFLDADGKLCLKLDVSLPFGAGKRLCAGETFARNMLFLVTATMCQHFDFVLG

PNDRLPDLSQNLNGLIISPPDFWLQLQDRH

 

>D. pseudoobscura ortholog of Cyp304a1 M. Nooh

MLTELLLTICSAAFLYLSYRYAVGRPVGFPP (1)

GPPRIPFFGSYLFLLLINYKYLHKAALTL

TRWYKSDIIGLHVGKFPVAVVHSGEGVREVLNNQVFDGRPGIFLAAMRDPGDDVR (1)

GIFFQEGALWKEQRRFILRYLRDFGFGRRFDELELVIKEQITDMLDMIRNGPKYPHEHHLVKPGG

YRVQLPLLFNPFSVNSHFHVVYNERQSREDMAGLVRLVQMGMQFQRHADDYGRLLSIMPW

IRHVWPEWSGYKKLNESNQFMRQYFAEIVDRHIETYEEGSERNFIDLYISEMKSCPGHGF

NRDQFIMGLLDFSIPAFTAVGVQLTLLIQYLMLYPSVMERIQQEIEEVVGCGRLPTLEDR

KNMHYTEATIRESMRIETLVPSDVPHKALADTELLGYHIPK (0)

DTIVVPSLYAYHSDARVWS

DPEQFRPERFLDDQGELCLKLDVSFPFGAGKRLCAGETFARNMLFLMTAAMCQNFNYVLA

PGDQLPDLSKNQNGLIITPPDFWVQLENRRCG*

 

>305a1 D. melanogaster AC018013 comp(3457437224)

MSALIFLCAILIGFVIYSLISSARRPKNFPP (1)

GPRFVPWLGNTLQ (0)

FRKEASAVGGQHILFE

RWAKDFRSDLVGLKLGREYVVVALGHEMVKEVQLQEVFEGRPDNFFLRLRTMGTRKGITC

TDGQLWYEHRHFAMKQMRNVGYGRSQMEHHIELEAEELLGQLERTEEQPIEPVTWLAQSV

LNVLWCLIAGKRIARQEDGTLRRLLDLMNRRSKLFDICGGLLAQFPWLRHVAPDRTGYNL

IQQLNTELYGFFMDTIEEHRRQLAKDPSPAESDLIYAYLQEMKDRSAGGESSTFNETQLV

MTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVAAASTDAFPHLSRREAF

DYMDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPL

EFRPERFIDSAGKCFKDEYFMPFGMGRRRCLGDALARACIFSFLVRIVQHFSVVLPAGES

PSMVLLPGITLTPKPYKVQFVKRT

 

>CYP305A1 ortholog from D. pseudoobscura (intron 2 is missing)

MSALIFLCAILIGFVIYSLIKSVQRPKNFPP (1)

GPRFLPWLGNTLQFRKEARAVGG

QHILFGQWAQRYQSQLLGLKLGQEYVVVALGHEMVREVQLQEVFEGRPDN

FFLRLRTMGTRKGITFTDGKLWYEHRNFAMKQMRHVGYGRSQMESHIERE

AEELLLQLGRTEEAPIEPVTWLAHGVLNVLWCLIAGKRIASEGNSMLQRL

LDLMNRRSKLFDVCGGLLAQFPWLRHVAPDRTGYNLIRQLNTELYGFFMD

TIADHRRQLEKASDNEPVESDLIYAYLQEMRDQSSDSESSSFNETQLVMT

ILDFFIAGSQTTSNTINLALMVLAMRSDVQEKLFAEVSANVNSAKSDAFP

HLSRRESFDYMDAFIMEVQRFFHITPITGPRRALWPTQLGGYDIPKNATI

LINLRSVHLDEKHWVDPLQFRPERFIDVGGKCFKDEFFMPFGIGRRRCLG

DALARACIFSFLVRIVQHFCIVLPPGETPSMVLLPGITLTPKPYKVKFVKRS*

 

306A1 D. melanogaster

MSADIVDIGHTGWMPSVQSLSILLVPGALVLVILYLCERQCNDLMGAPPPGPWGLPFLGY

LPFLDARAPHKSLQKLAKRYGGIFELKMGRVPTVVLSDAALVRDFFRRDVMTGRAPLYLTHGIMGGF(1)

GIICAQEDIWRHARRETIDWLKALGMTRRPGELRARLERRIARGVDECVR (0)

LFDTEAKKSCASEVNPLPALHHSLGNIINDLVFGITYKRDDPDWLYLQRLQEEGVKLIGVSGV

VNFLPWLRHLPANVRNIRFLLEGKAKTHAIYDRIVEACGQRLKEKQKVFKELQEQKRLQR

QLEKEQLRQSKEADPSQEQSEADEDDEESDEEDTYEPECILEHFLAVRDTDSQLYCDDQL

RHLLADLFGAGVDTSLATLRWFLLYLAREQRCQRRLHELLLPLGPSPTLEELEPLAYLRA

CISETMRIRSVVPLGIPHGCKENFVVGDYFIKGGSMIVCSEWAIHMDPVAFPEPEEFRPE

RFLTADGAYQAPPQFIPFSSGYRMCPGEEMARMILTLFTGRILRRFHLELPSGTEVDMAG

ESGITLTPTPHMLRFTKLPAVEMRHAPDGAVVQD

 

>CYP306A1 ortholog 66%

MSASFATASASASVFDWLPLSGHSFCLLVVPGLLILIILWLCDHQYDRVLGRPPPGPWGL

PWLGYLPFLSRRAPHKSLQALARRYGGIYQLRMGSVKAVILSDVTLVREFFRHEVMAARA

PLYLTHGIMGGY (1)

GIICAAGPIWKHQRRELIDWLKALGMTRRPGETRSRLEQRIGRGVDECVQ (0)

LYETDADVSPSSEFDPVPALQHTLGNIINDLVFGVTYERQDPDWLYLQRLQEEGVKLIGV

SGVVNFLPWLRRLPWNRRNICFLMEGKSRTHAIYDRIVESCENRLKELQEQYQEKQRQRQ

QQQDLQQYQQQDPQQDPEPESGSEQSLQQSPEQKEEKP (0)

KGEEEEDDDDDVYEPTCILE

HFLINRVPFSELYCDEQLRHLLADLFGAGVDTSLATLRWFLLYMAREQSSQRRLHELLLP

LSATPTLEELQPLAFLRACISEVQRIRSVVPLGIPHGAERDFTVGKYRIAAGSMIVSLQW

AIHMDPAVWPEPEQFRPDRFLNAEGHYSAPPQFIPFQTGKRMCPGDELARMMLTLFAGRI

LRRFHVEMVPGCDADMEGECGITLAPAPYKLRFTKLPPMELQVEEQPLVQA

 

>307a1 AC014810 comp(54284-52654) also AC007840 revised 9/8/2000

MLAALIYTILAILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRP

WPIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKV

MSGRPDFIRYHKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCE

EMEHWNRELGNQLVPGEPINIKPLILKACANMFSQYMCSLRFDYDDVDFQQIVQYFDEIF

WEINQGHPLDFLPWLYPFYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDRDFTD

ALLKSLLEDKDVSRNTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAII

EEENRSINLLDMNAMPYTMATIFEVLRYSSSPIVPHVATEDTVISGYGVTKGTIVFINNY

VLNTSEKFWVNPKEFNPLRFLEP (2)

DNEKLQLKRNIPHFLPFSIGKRTCIGQNLVRGFGFLV

VVNVMQRYNISSHNPSTIKISPESLALPADCFPLVLTPREKIGPL

 

>D. pseudoobscura ortholog of Cyp307a1 Jie Shen no introns

MSAVYSVLAILLAIIITSYIRILYKSRRRVCVAIRNGKSSTESEQIYEQAPGPRPWPIIG

NLNVLDKYRDNPFEGFTELAKKYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVVSGRP

DFLRYHKLFGGERSNSLALCDWSQLQQKRRNMARRHCSPRESSSFYMQMSQIGCEEMEHF

IREIDAKMVPGEPFDVKTFLLRACANMFSQYMCSQRFDYDDEEFHKIVQYFDEIFWEINQ

GHPLDFLPWLYPFYRRHLNKIVHWSSTIRSFIMDRIISHRELDIDVDEPDSDFTDALLKS

LVEDKDVSRNTIIFMLEDFIGGHSAVGNLVMLALAYIAKNPQVGRRIQDEVDAVSSKGQR

KINLLDMHQMPYTMATIFEVLRYSSSPIVPHVATEDLVISGHGVTAGTIVFINNYVLNRS

REHWEDSHQFEPQRFLEPSTEGRRDSRGSDSGIESDQKEFQLRKNIPHFLPFSIGKRTCI

GQNLVRGFGFLLLANLLQGYNVSSGDPTTIRITPASLALPASCFPLLLTRRA*

 

>307a2p AC019383 comp(3284-3706) AL078186

MLTSVFYVLFAIAITIILISYVFLLLKCKQKAFVVIGLLYQEKKYQCFDQAPGPHPWPII

GNINLLGRFQYNPFYGFGTLTKKYGDIYSLSLGHTRCIVVNNVDLIKEVLNKNGKYFGGR

PDFFRYHKLFGGDRNNCKFIXXLRF

 

>Contig3286_Contig7811B.fa.9 66% to D. pseudoobscura ortholog of 307A1

fisrt exon 67% to 307A2P 55% to 307A1 so this is the ortholog of 307A2P

MFFSVCYLIIAIGITAIVISYILIIFKCNEKATVRIGLSNPEKAIRKFGQ

APGPQPWPIIGNLDLLGRFKSNPFEGLGALTKQYGDIYSLTLGHSRCLVV

NSLDLIREVLNKNGKFIGGRPDFIRYHKLFGGDRNN (1)

SLALCDWSNLQQKRRNLARRH

CSPRESSPYFNKMSHIGCNEINHLMRELNKTQPGKPFDIKKLILGASANM

FCQYMCSIRFDYNDKEFRRIVRYFDEIFWEINQGYSLDFLPWMLPFYKNH

TQKIVQWSTTIRKFILDRVIHQREEMLDLDEPENDFTDALLRSLKEDQNV

SRNTIIFMLEDFIGGHSAVGNLVMLALAYIAKNPMIGRRIEHEADIVTNK

GRRRINLYDMDAMPYTMATIFEVLRYSSSPIVPHVAMEDTAIAGFGVTRG

TIIFINNYMLNMSEKYWNSPDHFEPERFLDENYRR (11aa insertion here)

RRGSEGSDSGIEFEKDTH (bad intron boundary)

QLKKNIPHFLPFSIGKRTCIGQNLVRGFGFVLLANIVQSYNITSADISKININH

ESLALPADCFPLVLTPRA*

 

Query:     4 SVCYLIIAIGITAIVISYILIIFKCNEKATVRIGLSNPEKAIRKFGQAPGPQPWPIIG 61

             S  Y ++AI +  I+ SYI I++K   +  V I  G S+ E   + + QAPGP+PWPIIG

Sbjct:     2 SAVYSVLAILLAIIITSYIRILYKSRRRVCVAIRNGKSSTESEQIYEQAPGPRPWPIIG 60

 

Query:    62 NLDLLGRFKSNPFEGLGALTKQYGDIYSLTLGHSRCLVVNSLDLIREVLNKNGKFIGGRP 121

             NL++L +++ NPFEG   L K+YGDIYSLT GH+RCLVVN+L+LIREVLN+NGK + GRP

Sbjct:    61 NLNVLDKYRDNPFEGFTELAKKYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVVSGRP 120

 

Query:   122 DFIRYHKLFGGDRNNSLALCDWSNLQQKRRNLARRHCSPRESSPYFNKMSHIGCNEINHL 181

             DF+RYHKLFGG+R+NSLALCDWS LQQKRRN+ARRHCSPRESS ++ +MS IGC E+ H

Sbjct:   121 DFLRYHKLFGGERSNSLALCDWSQLQQKRRNMARRHCSPRESSSFYMQMSQIGCEEMEHF 180

 

Query:   182 MRELNKTQPGKPFDIKKLILGASANMFCQYMCSIRFDYNDKEFRRIVRYFDEIFWEINQ 240

             +RE++ K  PG+PFD+K  +L A ANMF QYMCS RFDY+D+EF +IV+YFDEIFWEINQ

Sbjct:   181 IREIDAKMVPGEPFDVKTFLLRACANMFSQYMCSQRFDYDDEEFHKIVQYFDEIFWEINQ 240

 

Query:   241 GYSLDFLPWMLPFYKNHTQKIVQWSTTIRKFILDRVIHQREEMLDLDEPENDFTDALLRS 300

             G+ LDFLPW+ PFY+ H  KIV WS+TIR FI+DR+I  RE  +D+DEP++DFTDALL+S

Sbjct:   241 GHPLDFLPWLYPFYRRHLNKIVHWSSTIRSFIMDRIISHRELDIDVDEPDSDFTDALLKS 300

 

Query:   301 LKEDQNVSRNTIIFMLEDFIGGHSAVGNLVMLALAYIAKNPMIGRRIEHEADIVTNKGRR 360

             L ED++VSRNTIIFMLEDFIGGHSAVGNLVMLALAYIAKNP +GRRI+ E D V++KG+R

Sbjct:   301 LVEDKDVSRNTIIFMLEDFIGGHSAVGNLVMLALAYIAKNPQVGRRIQDEVDAVSSKGQR 360

 

Query:   361 RINLYDMDAMPYTMATIFEVLRYSSSPIVPHVAMEDTAIAGFGVTRGTIIFINNYMLNMS 420

             +INL DM  MPYTMATIFEVLRYSSSPIVPHVA ED  I+G GVT GTI+FINNY+LN S

Sbjct:   361 KINLLDMHQMPYTMATIFEVLRYSSSPIVPHVATEDLVISGHGVTAGTIVFINNYVLNRS 420

 

Query:   421 EKYWNSPDHFEPERFLDENYRRRRGSEGSDSGIEFEKDTHQLKKNIPHFLPFSIGKRTCI 480

              ++W     FEP+RFL+ +   RR S GSDSGIE ++   QL+KNIPHFLPFSIGKRTCI

Sbjct:   421 REHWEDSHQFEPQRFLEPSTEGRRDSRGSDSGIESDQKEFQLRKNIPHFLPFSIGKRTCI 480

 

Query:   481 GQNLVRGFGFVLLANIVQSYNITSADISKININHESLALPADCFPLVLTPRA* 533

             GQNLVRGFGF+LLAN++Q YN++S D + I I   SLALPA CFPL+LT RA*

Sbjct:   481 GQNLVRGFGFLLLANLLQGYNVSSGDPTTIRITPASLALPASCFPLLLTRRA* 533

 

>308a1 AC015216 72624-74273 also AC012164

MLPLVLFILLAATLLFWKWQGNHWRRLGLEAPFGWPLVGNMLDFALGRRSYGEIYQEIYT (2)

RNPGLKYVGFYRLFNEPAILVRDQELLRQILVGRNFADCADNAVYVDHQRDVLASHNPFI

ANGDRWRVLRADLVPLFTPSRVRQTLPHVARACQLLRDQVPLGRFEAKDLATRYTLQVVA

SAIFGLDAHCLGIHMRVAHEPSRWLEWLAPLFQPSVWSLLETMSLLHTPRLGRLIGHR (2)

YVPLPLQHWFRELVEARSGGDNLLQWLAESKRGLGKEELAGHATTLLLEGYETSAMLLAFAL

YELALNEDAQRRLHIELDEVAQRHAGNLIDPVALGELRYSEAALLEALRLHPAMQALQKR

CTKTFTLPDQKSGASSELKVHLGTVLVLPVQAIHL (2)

DPALYPAPNQFRPERFLNQPPMGCRFLGFGAGPRMCPGMRLGLLQTKAALTTLLQD

HCVQLADEDQCRVEVSPLTFLTASRNGIWLSFKRRTRRY

 

>Cyp308a1 D. pseudoobscura ortholog of B. WU

MLLLLLLLLLLLLFFLGTLWRRLAWSNSHWRRRVVSGPQGCPLVGNMASFALGQRSYGEVYEQIYR (2)

QHPELRYVGFYRLFNEPAILVRDQRLVREVLVGSSFLNCADNAVNVDAQRDVLATCNPFI

ASGDRWRILRADLVPLFTPSRLRQTLPHVAAACQQLQEFVGRRLTGERFEAKALATRYTL

QVIASAVFGLDAHCLCYDEDQEKGSQWLQRLLPLFQPSAWSLLETIALLHSSRLANILQHR (2)

YVPLSLQDWLCALVRARSGANNFLHWLGDKQGEQGDLAGHATTLLLEGYETSAMLLAFAL

YELSRNESAQRRVQTELEEVAQRHGGLLVGHAALAELRYAEAALLETLRLHPAMQALQKR

CTKSFTLPPQRSDTDTAVGSHGSIQVALGTVLVLPVQAIHM (2)

DPNLYSDPLKFQPERFMDTSPMGCRFLGFGAGPRMCPGMRLGLAQTKAAL

VTLLRDYSFSLADQAQDPVQVSPLTFLTASKHGIWLQLQKR*

 

>309a1 AC019891 comp(47437-49308) also AC009909

MFTLVGLCLTIVHVAFAVVYFYLTWYHKYWDKRGVVTAEPLTILGSYPGILINKSRSLILDVQDVYN (2)

KYKDKYRTVGTFITRQPQLLVLDPALAHEILVDKFSHFRDTITSSFVGHNPDD

KYVAGSPFFSAGDKWKRLRSENVGGLTPSRLKMAYSIWEQSGRKLVEYIERARREQGDIIETRD (0)

LAYRFTANAMADFIWGIDAGSLSGKVGEIGDFQKTSTDWSAHAFSSMIRFNKTLVA

IFVRKLFSMRFFTKATDEFFLRLTQDAVNLRQGGSGEGRTDYLSHLIQLQQRGNSIHDSV

GHALTVHLDGFETSGAVLYHMLYS (0)

LSEHHEEQEKLRSEILEALASEGQISYDQINNLPYLDQCFN (1)

ESLRLTTPIGFFMRICTKPTQINLGDDKTLDLEPGVTVMVPAYQYHHDNDIYPEA

SEFRPDRFENGAASVLTKRGCFLPFGDGPRICL (1)

GMRVGQLSVKTAIVHILSNYQVEQMKKVPLGADSGMGIFLNGDVELKYTKLQK

 

>D. pseudoobscura ortholog of 309a1 L. Yang 76%

MWTTVGLLLGAVHVAFAAVYLYLTWHHKYWQKRGVLTAEPLTILGTYPGVLADKSRSLILDVQEVYN (2)

KYKEKHRAVGTFLTRQPQLLVLDPALAHEVLVDKFSHFRDTVTSSFVGHNPDD

RFVQVSPFFSAGDDWKRRRTESGGGITPNKLKMAFTIWEQSGKKLLEYIERVRQERGDIIETRD (0)

LAYRFTANTMADFIWGIDAGTLTGAVGETSPFQKTSTDWTINAFKSIIRFNKSLVA

PFLRKVLQMRFFTKTAEQFYLQLTRDALRLRHSGSGSDRTDYLSHLIQLQQRGITLTDAV

GHALTVLLDGYETSAAVLYHMLYT (0)

LSEHPEEQEKLRSELVEALAADEHLSYEQLNALPYLDQCLN (1)

ESLRLTTPIGFFMRICTKATQLDLGQGQVADIEPGASVMIPAYQFHHDDAFYPEA

SLFQPDRFENGAASVLTKRGCYLPFGDGPRICL (1)

GMRVGQLSVKTAILHILSQYQVEQTTKVPMDADTGLGIFLNGDVQLKYTKLQK*

 

>309a2 AC009909 45541-45982 also AC019977

MYILASLALILLHLLVLPIYLYLTWHHKYWRKRGLVTARPLTLLGTYPGLLTRKSNLVFDVQKIYD (2)

KYKGKHRAVGVFVTRQPQILVLDPELAHEVLVSNFRCYKDSLQSSYLRHAKWDK

YARLNPFWASGQSWRRLRTDAQAGISGSRLRQAYNIWEQGGQMLTEYMTQQVAEKNNILETRD (0)

LCFRYTAHVMADFIWGIDAGTLTRPMEQPNKVQEMASKWTSYAFYMLTLFMATIVAP

CSRLLLRFRFYPKETDEFFSNLTKESIELRLKAGDSTRTDYLSHLLQLRDQKQATHDDLV

GHALTVMLDGYDTSGTALLHALYY (0)

LAENPAVQQKLRVEILSCMASEKSLDFEKLSSLQYLEQVIY (1)

ESLRLSSLIPQYTKVCTLPTVIRLSESKSLDVEVGMTIMIPNYQFHHDKQYFPEP

EAFKPERFDNGAYQELMRKGIFLPFSDGPRICM (1)

GVPLAMLTLKSALVHILSNFQVVRGRDRLIPKGDSGFGVVLQGDVNLEYRRFFR

 

>D. pseudoobscura ortholog of 309a2 S. Yu 79%

MYILVTLGLIVVHLLLLPLYVYLTWHHRFWRKRGLVTARPLTMLGTYPGLLTRTSNLVEDVQKVYD (2)

KYKGKHRAVGVFVTRQPQILVLDPELAHEILVLNFRCYKDSLTSSYIRHARWDK

YARRNPFWASGQSWRSLRTDAQAGISGHRLKQGYAIWEEGGRMLTSYMTDRIKAPHNLLETRD (0)

LCFRYTAHVMADFIWGIDAGTLSRPQEHPNKVQQMASKWTSHAFYMISVFMASIV

APFSRLLLRLRFYPKETDEFFSRLTKESIDMRLSAGNDITRTDYLSHLLQLREQKQASHD

DLVGHALTVMLDGYDTTGTALLHALYY (0)

LAENPAAQQKLRMEILQSLDADKSLGFEKLCALPYLEQVVY (1)

ESLRLSSLIPQYTKICTNATQIQLNESKTLEVEEGMTVMIPNYQFHHDRKYF

PDPETFKPERFDDAAHLELIRKGVFLPFSDGPRICM (1)

GMRLALLTLKSALIHILSDFQVVRGKKRLVPNGDAGFGVVLQGNVHLEYRRFVR*

 

>310a1 AC017690 comp(12877-14650)

MWLLLPILLYSAVFLSVRHIYSHWRRRGFPSEKAGITWSFLQKAYRREFRHVEAICEAYQ

SGKDRLLGIYCFFRPVLLVRNVELAQTILQQSNGHFSELKWDYISGYRRFNLLEKLAPMF

GTKRLSEMFGQVQKVGDHLIHHLLDRQGQGCPQEVDIQQKLRV (2)

YSVNIIANLIYGLDINNFEHEDHILTSYLSHSQASIQSF (2)

TLGRLPQKSSYTYRLRDLIKQSVELREDHGLIRKDILQLLVRFRNGNEVSGDKWQLEPIN (1)

DADKLLSIKRLAKVAEDLLKVSLDAVASTVTFTLLEIL

QEPLIVEKLRAEIKELSNENGQLKFEELNGLRYMDMCLK (1)

ETLRKYPPLPIIERVCRKSYS

LPNSKFTIDEGKTLMVPLLAMHRDEKYFSEPMKYKPLRFLQTANDVGQCEDKTKSNVFIGFGIGGSQCV (1)

GQNFAKLVIKVALIKLLQNFHLELDANQVKTLKVSHRPAPFIHTKDGLKVKLKRREINTKFYS

 

>310a1 D. pseudoobscura ortholog Y. Zhuang 78%

MWLLLPILLYSVLFLAVRHIYSHWRRKGFPSERAGISWSFLHQAYRREFRHVEAICEAYQ

MGRERLLGIYCFFRPVLIVRNVELAQTILQQSNGHFNDLKWDYVKGYRRFNLLEKLSPIF

ATKRLSEMFTHVQRVGDHLISYLLDIEQAQGGALELDLQQMLRV (2)

YAINVIGNLIYGLDVNNFEQKDHILSSYVSAGHTSLQSF (2)

TLSRLPQKSSFTYRLRDLIKQGVEHREEHGLIRKDILQLLTRFRNGNDISGDKWQIDIDN (1)

EQDKLLSIKRVAKVAEDLLKVSLDSISSNITLTLFEI

LQEPLIVEKLQTEIKELSNENGSLKFEELDGLKYLDMCLK (1)

ETVRKYPPLPIIERICRKSY

TLPNTKFTIDEGKTLMVPLLAIHRDEKYFSEPMKYKPLRFLHSEKSGDCKSNAFIGFGIGGAQCV (1)

GQNFAKMVIKVALIKLLQNFHLELDATLAETIEISHQPAPFIRTKDGLKVRLKRREIKPKFYN*

 

>311a1 AC014186 2270-3910

MALWPLLLITLTIWILVRKWTLLRLGSSLPGPWAFPLLGNAQMVGKLRPE (1)

YIFLVFTELRDRFGATYRLRLGPQLWVFLHSAEETRQALHDPTLRKADTFMQLEPLIGNGLLISHGAHWT

RQRRLLTPAFQPQLLRSFAPAIGGHVERLVGRLGATRGAFLEVTEPLFACLLDAIV (1)

DTSMGAQLDTQSVDHSPIIQAFHLSSKLLFKRMINPLLSSDWIFQRTQLWRDLDEQLQVIHSQM

ESVIEKRAKELLDMGEPAGRAHNLLDTLLLAKFEGQSLSRREIRDEINTFVFA (0)

GVDTTTAAMSFVLYALAKFPETQTRLRKELQDVALDETTDLDALNGLPYLEALIKEVLRLYTIVPTT

GRQTTQSTEIGGRTYCAGVTLWINMYGLAHDKEYYPDPYAFKPERWLPEDGAVAPPAFSY

IPFSGGPHVCIGRRYSLLLMKLLTARLVREFQMELSPEQAPLRLEAQMVLKAQQGINVSFLKQ

 

>311a1 in D. pseudoobscura R. Aziz missing exon 1 in a seq gap

(1) IFLVFTELRDRFGATYRLWLGPQLWVFLHTAEETREALHDPTLRKAKTFLQLEPLIGNGL

LISHGSHWTQQRRLLTPAFRPTLLRSFAPSVAKHADRLIQRLEETRGSFLEVTDPLFACLLDAIV (1)

DTSMGEQLETQSVAHSPIIKAFHRSSQLLFKRMINPLLASDWVFKQTRLWRELSEQLQVIH

TLMDSLIDRRSAQLQQQGNEPRKALNLLDTLLLANIDGEPLSRKEIRDEINTFVFA (0)

GVDTTTAAMSFVLYALAMNPEAQDRLQEELRQLPPGISIDLDTLNELPYLDALLKEVL

RLYTIVPTTGRQTTRSTVIGGRTYCAGVTLWINMYGLAHDASYFPDPYVFKPERWMQETE

LQAEVPFSYIPFSGGPHVCIGRRYALLLMKLLTARIARAFQLELRLGQPELTLQAQMVLK

TREGIHLAFTKR*

 

>312a1 AC015424 57845-59744 also AC009369 AC007573 AC010003

MFWLGFGLLLLALSLYLLYVFERQSRIDRLTHKWPAPPALPFIGHLHILAKLVGPHPLRR

ATEMINEHLHDHRAKLWMGTKLYLVDCNPKDIQALCSAQQLLQKTNDYRVFENWLCEGLF

TSGFEKWSHRRKIVMPAFNYTMIKQFVAVFEKQSRILLTNVAKFAESGDQIDFLQLISCF

TLDTICETALGVSVGSQSSAKSEYLDAVKS (2)

ILVIIDKRLKNIFYRNSFIFKRTSHYKREQ

ELIKTLHGFTEGIIQKRIDEINQDAENRNYQSSDAELDGVKRTLCFLDTLLLSKGPDGKP

LTVKDIREEVDTIIFGGFDLTATTLNFFMYNMTLHPEHQQRCREEVWSVCGKDKSEPISI

EQVRQLEFLEACIKETLRMYPSGPLTARKATANCTI (1)

NDFFIPKGSDVIISPIYMGRCKDF

FPDPMVFKPDRWAIGAEPKIEATTFIPFMAGARSCMGQRYAMVMLKMVLAHLLRNFLFEP

LGERQVKLKLNFVITLHTVEPYLCRAKNLD

 

>312a1 ORTHOLOG S. Nance 73%

MVVWLGLCLLLIVLSLYLLYAFERQTRIDRLTHNWPAPPSLPILGHLHILAKLVGPHPFR

RATELVNTHLKDHRGKLWLGTKLYLVDCNPKDIQALCSAQQMLQKTTDYKVFENWLCEGL

FTADYDKWFQRRKTLTPAFNYTMIKQFVQVFERQSRILLPRVAEYAESGKSVDFLDLISC

YTLDVICETALGVSVDAQSGKRSSYLEAVRE (2)

VLHVIDYRLKNLFYRHSFIYRRTALFRRE

QELLKTLHGFTEGIVQERQHQFNLDEVNRNTMSTKDAEMDKRPALSFLDTLLQAKTPEGA

SLSVKEIREEVDTIIFGGFDLTATVLKFVMYNMTLHTDHQQQCREEIWQICGKDTKEPIT

IEQVQQLEFLEWCVKETLRMYPPAPLLTRRATANCQI (1)

NDFFIPKGNDVVISPMYMGRCKD

FFPEPLVFKPERWARGAEPKIEATTFIPFMTGARSCLGQRYAMVMIKSVMAHLLRSYRFE

PIGERQVKMKLNFVVTLHTVEPYYCRVRAVE*

 

>313a1 AC017740 comp(167857-169728) also AC007809 AC007928

MLTINLLLAVGALFWIYFLWSRRRLYFLMLKIPGPIGLPILGSSLENIITYK (1)

RKLSFRTKYLNKYGSTILTWMGPVPFIVTRDPKVVEDIFSSPDCHNKSQHIVNAITSCMGNGLLGKQ (1)

DPHWLDRRKHFNPSFKQDLLLSFFHIFDAETKVLMNLLDTYVDKGEIDVVPEMLRWSFKIAA (1)

QTTMGSEVKHDEHFKNGSLVESFES (2)

LISHSTLNILMPLVQNRMISKICGYDKLRADNFSRIQKMLDN (0)

VVNKKVNPLPKTDSDPESNIVINRAMELYRKGDITYMDVKSECCIMIAAGYD

TSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPDMQKLDYLERVIKETLRL

IPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENM

EQKHPYAYIPFARGKRNCI (1)

GSKYAMMSSKFALCRILRNYKISTSTLYKDLVYVDNMTMKLAEYPRLKLQRRG

 

>313a1 has no ortholog

 

>Note: there are two D. pseudoobscura paralogs of CYP313A1, 313A2, 313A3 and 313A5 from D. melanogaster (46-48% identical)  CYP313A4 has a direct ortholog (83%)

313b1 also has an ortholog.  The sequence similarity between 313a1, a2, a3 and a5 with the D. pseudoobscura sequences is so low that they should be treated as a new subfamily.  313a4 could also be treated as a separate subfamily, but for historical reasons its name will remain 313a4.  The ancestor of the two species may have had

CYP313A, B and C subfamilies, but A was lost in pseudoobscura and C was lost in melanogaster. 

 

>D. pseudoobscura CYP313C1 313ax same as 313a3 ortholog except exon 5

exon 1 and bottom half (exon 6,7) same as 313a2 ortholog of Cheng

MYSLHLWIAVGILAWIYFLWSRRRFYLLMLRVKGPVGYPFLGVAVEYLRNK (1)

HNMEQRSKQFQEYGPTNLTWIGSVPVLVTCEPNVVQDVLTSPHCLDKSKIACNPLRLICGPATFALN (1)

GSHWVERRKQMNPSFRHNVLMSFFPLFNEETKNLISLLETFVGQGEKKLLPEFINWSFRTSI (1)

QSTMGSDLKDNPSIMNGAIQKKISN (2)

LIEVTYYLITFPWLQNRAISTLFGFEKRKSEAMIHLNASLQS (0)

ILQEKLKTQGDESKESLASRNIVINRARDFLRSGDFSYEDVKSECILTI

VAGFETSAITVFNTLILLAMFPEYQETAFEELKDVFPHVGDFEVSYDDLQKLVYMDRVLN

ESLRLLPPLPLIPREVTEDLKLSNGILIPKGVTVAIDIFNTHRNKDFWGLGADTFNPDNF

LPEHIQERHPYVFIPFNRGKRNCA (1)

GRKYAEISIKIALAKILRNFRLSTSFRFEDLSFVDNIVLEFKEQPLLELQHRR*

 

>D. pseudoobscura CYP313C2 313ay 48% to 313a1 (this seq downstream of MYSLH seq

same as 313a5 ortholog except for exon 4

exons 1-4 match 313A2 ortholog of cheng

MITLQLWIAVGILAWIYFLWSRRRFYLLMLRVKGPVGYPFLGSVVGFLRNK (1)

RNIGLAGKVAEKYGPTFLTWMGTVPVLVTSEPNVIQDILTSPHCLDKSQTACNAIIMNSGPGILALR (1)

GSHWVERRRKMIPSFKKNVVMSFLPIFNEETNSLLSVLDTFVGQGEREILPNVLNWSFRTAY (1)

QTTLGSDVKANTSFKNGTLLKNFKY (2)

TMENTTLAILFPLVQNRIIAKLLGIEKRRTEATFIVNELTKS (0)

LIEEKMTNKPDENQESFAIRNTVISRVVEFLKSGEFSYEDAEGECSIMVGASFETTAVTV

FSTLTFLAMFPEYQDAAFVELKDVFPNAGDFEVSNDEIQKLVYLDRVLNESLRLIPAIPL

IARETSQEVKLSNGILLPKSLTLCLDIFHTHRNKDSWGPEADKFNPDNFLPENISKIHQY

AYIPFNKGKRSCI (1)

GMKYAEIAAKVALSKILRNYKLSTSFRTEDFVFIENLSIDFAKKPLLELQRRD*

 

313C1 vs. 313a1 46%

Query:     1 MYSLHLWIAVGILAWIYFLWSRRRFYLLMLRVKGPVGYPFLGVAVE-YLRNKHNMEQRSK 59

             M +++L +AVG L WIYFLWSRRR Y LML++ GP+G P LG ++E  +  K  +  R+K

Sbjct:     1 MLTINLLLAVGALFWIYFLWSRRRLYFLMLKIPGPIGLPILGSSLENIITYKRKLSFRTK 60

 

Query:    60 QFQEYGPTNLTWIGSVPVLVTCEPNVVQDVLTSPHCLDKSKIACNPLRLICGPATFALNG 119

                +YG T LTW+G VP +VT +P VV+D+ +SP C +KS+   N +    G       

Sbjct:    61 YLNKYGSTILTWMGPVPFIVTRDPKVVEDIFSSPDCHNKSQHIVNAITSCMGNGLLGKQD 120

 

Query:   120 SHWVERRKQMNPSFRHNVLMSFFPLFNEETKNLISLLETFVGQGEKKLLPEFINWSFRTS 179

              HW++RRK  NPSF+ ++L+SFF +F+ ETK L++LL+T+V +GE  ++PE + WSF+ +

Sbjct:   121 PHWLDRRKHFNPSFKQDLLLSFFHIFDAETKVLMNLLDTYVDKGEIDVVPEMLRWSFKIA 180

 

Query:   180 IQSTMGSDLKDNPSIMNGAIQKKISNLIEVTYYLITFPWLQNRAISTLFGFEKRKSEAMI 239

              Q+TMGS++K +    NG++ +   +LI  +   I  P +QNR IS + G++K +++  

Sbjct:   181 AQTTMGSEVKHDEHFKNGSLVESFESLISHSTLNILMPLVQNRMISKICGYDKLRADNFS 240

 

Query:   240 HLNASLQSILQEKLKT--QGDESKESLASRNIVINRARDFLRSGDFSYEDVKSECILTIV 297

              +   L +++ +K+    + D   ES    NIVINRA +  R GD +Y DVKSEC + I

Sbjct:   241 RIQKMLDNVVNKKVNPLPKTDSDPES----NIVINRAMELYRKGDITYMDVKSECCIMIA 296

 

Query:   298 AGFETSAITVFNTLILLAMFPEYQETAFEELKDVFPHVGDFEVSYDDLQKLVYMDRVLNE 357

             AG++TSA+TV++ L LLA  PE+QE  FEEL  VFP  G F ++Y D+QKL Y++RV+ E

Sbjct:   297 AGYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPDMQKLDYLERVIKE 356

 

Query:   358 SLRLLPPLPLIPREVTEDLKLSNGILIPKGVTVAIDIFNTHRNKDFWGLGADTFNPDNFL 417

             +LRL+P +P+  RE   D++LSNG+LIPKGV + ID+F+THRN + WG  AD FNPDNFL

Sbjct:   357 TLRLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFL 416

 

Query:   418 PEHIQERHPYVFIPFNRGKRNCAGRKYAEISIKIALAKILRNFRLSTSFRFEDLSFVDNI 477

              E+++++HPY +IPF RGKRNC G KYA +S K AL +ILRN+++STS  ++DL +VDN+

Sbjct:   417 AENMEQKHPYAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKISTSTLYKDLVYVDNM 476

 

Query:   478 VLEFKEQPLLELQHR 492

              ++  E P L+LQ R

Sbjct:   477 TMKLAEYPRLKLQRR 491

 

>313a2 AC017371 4100-5929 AC007724 AL057969 AL067059 rev. 9/8/2000

MIVIQLLIAASLILWIRFLWSRRKLYMLMMQLPGRMGLPLLGNSVRYLIISR (1)

GRMSSRTTYMDKHGSTYMAWIGTTPIVITRDPKIAEKVLTSPFCINRSSQTTNALALSMGYGLLTLQ (1)

GSKWMARRKHMNPAFKHSVLLSFLPIFNAETDLLVSVFDSFVGQGEKDVLSDLIRWSFAIAT (1)

QTTLGTDVTKDDNFENDAILKTYQS (2)

MLRLTIINIFVPFVQNKIVSKLFGLEWLRRRDASAINKMINN (0)

ILDKKLNSNPENYCESELKTVIHRAIELFRNDEMSLMELGAECSSMVLAAF

ETSAHTVYYALVLLAMFPEHQEMVFNEIKEHFPLAKGIEVTHTDLQQLVYLDRVLNETLR

LMPSVPFSSRETLEDLRLSNGVVIPKGMTISIDIFNTQRNTDYWGSEAAQFNPENFLPEK

IHDRHPYAFIPFSKGKRNCI (1)

GWRYGLMSSKLALVKILRNYKLKTSFPYENLEFVDHMVIKLAQSPQLAFERRTL*

 

>313a2 has no ortholog

 

>313a3 D. melanogaster AC017371 18903720 also AC007724 chr3R:8,063,0238,064,850

MDTFQLLLAVGVCFWIYFLWSRRRLYMMHFKIPGPMGLPILGIAFEYLITYK (1)

RKMSIRTKYMDIYGSTCLVWVGPTPFVITRDPKIAEEIFLSPECLNRSSIFSKPVNSCTGDGLLSLE (1)

ASKWVDRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSFRIAT (1)

QTTVGTDVKKDASFKNDSVLKSYET (2)

FMKIIVMNVLLPFTHNKIFSTLGGFETQKALAKSNVNKMIGT (0)

IVDKKLMTKPESGSQPEITSVINKAIELHRNGEMSREEVQSECCSFVVAAFE

TTGDTVYHALILLAMFPEHQDTVYQELKELFPVAGDFEVTYDDLQRMVFLERVVNETLRL

IPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHFLPDNV

RDRHPYAYIPFSKGRRNCI (1)

GWKYGLMSSKLALSKILRNCKVSTSFRYEDLEFVDNIGMELAQSPGLEFHRRT*

 

>313a3 has no ortholog

 

>313a4 AC017336 153877-155807 also AC007752

MLTWTLWCGLLFLLWIYFLWSRRRFYLLTLKIPGPLGYPILGMAHWLMRRE (1)

DILNAFGCFLDKHGPTIFSWLGPIPFMIVSDPQVVQDIFTSPHCVNKGIIYKAVDDGAGVGLFSLK (1)

DPRWSIHRKLLNPAFGHKVLLSFLPIFNRETALLLDQLEPLQDDGEKDLIPLLQSFTLGIAT (1)

QTTMGSDVKDEESFRSNSLLGRYQC (2)

ILETMTDMCFSPWLNSRFCRQLAGKESHYYQAKTEIRQFIRK (0)

IIERKLAEDEMGALPSIQSNDKNLFLNLVTDLMRRGVFTLKNVEDESNIIVFGA

FETTANAVYYTLMLLAMFPEYQERAFEEIKTIFPNTGDFDVSYADTQQMVYLDLILNESM

RVIPPVPVVSRQTSQDLKLSNGIVVPKGVQIAIDIYHMHRSKKIWGPDAETFNPDHFLPH

NIQDKHPYAYIPFTKGIRNCI (1)

GWRYALISAKVTLAKLLRNYRFKTSFPFENLYFVEDITMKLKSVPLLELQKRT

 

>313a4 ortholog D. pseudoobscura ortholog found by Yi Jin partial seq

82% to 313A4 missing C-term exon in a seq. gap

second sequence in Contig837_Contig5345.19

MLTWTLWCGLLFVLWIYFLWSRRRFYLLTLKIPGPIGYPLLGMAHKLMRRE (1)

DILNEFGIYMAKHGPTIFSWLGPIPFMIVSEPQVVQDILTSPHCVNKGIIYKAVDDGAGVGLFSLK (1)

DPRWSVHRKLLNPAFGHKVLLSFLPIFNKETAQLLSQLDALPGGGEKDLIPLLQSLTLGIAT (1)

QTTMGCDVKSEENFMSNSLMERYQC (2)

CLETMTDMCFSPWLNSRWARQLSGKEANYYRAKTEIRAFIRK (0)

LIQKRLSEDTEDSIKSKDKNIFLNLATDLLRRGVFDWKNVEDESNIIVFGAFET

TANTVYYVLMLLAMFPQYQERAFEEIKSLFPNSGDFEVTYEDTQQMVYLDLVLNESMRVIPPVPVVSRQTSQDLTL

TNGIVVPKGVQIAINMFHMHRSKKIWGPEAESFNPDNFLPHNTRDKHPYA

(sequence gap)

 

313A4 paralog 73% to 313a4, first sequence in Contig837_Contig5345.19

MLTWSLWCGLLFVLWIYFLWSRRRFYLLTLKIPGPIGYPFLGMAHKLIHRE (1)

DILNEFGIYLAKHGPTIMSWLGPIPFVIASDPQVVQDILTSPHCVNKGIIYRAVDDGMGVGLFSLK (1)

DPRWSVHRKLLNPAFSHKVLLSFLPIFNKETGQLLSQFDDLPSKGEYNLIPLLQNFTMGITT (1)

QTTMGLDVKSEANFNSIVESYHC (2)

CLETITDMCISPWLHFKWVRQLTGREKNYHRSKTEIRAFLNK (0)

LIQKRLAEDTEDSIKSKDKNIFLHVTTDLLKRGVFDLTNVEDESNQVVFGAFETT

AKTVYYVLMLLAMFPQYQEKVFEEIKSLFPDSGDFEVTYEDTQQMVYLDL

VINESMRVIPPIPLVSRQTSGDLTLSSGTVIPKGVQIMIDIFHMHRSKKI

WGPEAETFNPDNFLAHHTGGEKHPYAFIPFTKGIRNCI (1)

GWRYASISVKVILAKLLRNFSYKTSFKFEDLVFIEDVTIKLKTVPKLQIQKRT*

 

>313a5 D. melanogaster chr3R:8,058,5988,060,388

MLTLQIFEAFAIILCVYFLWSRRRFYIMMLKLPGPMGFPFIGLAFEYIRLK (1)

RKIRLRTILFKIYGKTVLTWIGLTPVLVTCEPKILEDIFTSPNCSNRSSVVDKAISSCLGLGLLTLK (1)

NNHWNERRKLLLPSFKNNAVLSFVPVLNNEANFLVTLLAEFVDGGDINLLPELNKWSFKIAA (1)

QITMGDEVRNQANYQNGNLLESYKA (2)

LNNLIPIGVVMPWLRNKYLGKLFSYEKRRLEAATQSNAFIKD (0)

IIDKKLSSTDNSSEPALIDRILNLVRIGELSYDDVMGEFSNIIFAASDTLS

ITVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEASHADLEKLVKLDRVLHETMRLIPA

VPLLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAFNPDNFLPENKRAR

PPYSYLPFSKGKKTCL(1)

GWKLSLISAKLALAKILRNYMLSTTFLYKDLRFIDNTTMKLAEQPLLAVKRRI*

 

>313a5 has no ortholog

 

>313b1 AC007571 comp(104264-106046) also AC013225 intron 1 revised 2/11/2004

MLASIILSGWLLLAWLYFLWSRRRYYKVAWQLRGPIGWPLIGMGLQMMNPE (1)

TFLQYMDGLSRQFKAPFISWMGTSCFLYINDPHSVEQILNSTHCTNKGDFYRFMSSAIGDGLFTSSSPRWHKHR

RLINPAFGRQILSNFLPIFNAEAEVLLQKLELEGVQHGKRLEIYQILKKIVLEAAC (1)

QTTMGKKMNFQHDGSLCIFKAYNG (2)

LTEVCVKRMLSPWLYPDLIYRRSGLFRLQQKVVGILFGFIEQ (0)

LLEPIVSVVAANSNPDQQRSEMEMRGKSKAIFIEQVREHVERGQLSWQDVRDEANVTIAA (0)

TFETTSTALYFTILCLAMHPCYQEKLHKELVTELPPSGDINLEQLQRLEYTEMVINEA

MRLFAPVPMVLRSADQDIQLKRGDGEFLIPRGTQIGIDIYNMQRDERVWGPLSRTYNPDA

HFGLDSPQRHAFAFVPFTKGLRMCIGYRYAQMLMKLLLARIFRSYRISTEARLEELLVKG

NISLKLKDYPLCRVERR

 

>313b1 orth. 83% Drosophila pseudoobscura P. Khandelwal

MLLGTCIILAIWLLLVWTYFLWTRRRYYKAAWQLKGPIGWPLIGMGLQMMNTE (1)

TFLQYMDKLSHKFKAPFVSWMGTSCFLYVNDPQTVEQVFNSNHCTNKGDFYRFLSSAIGDGLFTFSA

PRWHKHRRLINPAFGRQILCNFLPIFNAEAEVLLLKLDLEGVQHGKELEIYQILKKIVLEAAC (1)

QTTMGRKMNFQQDGSAAIFEAYNG (2)

LTEVCVKRMLSPWLPELIYRRSRLFVQQTKVVGVLRGFIEQ (0)

LLSPIVSVVDLDTSKEPLQQESKSKSKSIFIEQVREHVERGQLSWQDVRDEANVTIAA (0)

TFETTSTALYFTILCLAMHPTYQEKLHKELVAELPPNGNISLDQLERLSYTEMAINEAMR

LFAPVPMVLRSAAQDFPLRRDDGDFLIPRGTQIGIDIYNMQRDERVWGPLARTYNPDAHF

GPEAPSRHAFAFVPFTKGLRMCIGYRYAQMLMKLLLAKIFRSYRIITEARLDQLLVKGNI

SLKLSNYPLCRVKRR

 

>314a1 AC012699 22585-24723 also AC006496

MAVILLLALALVLGCYCALHRHKLADIYLRPLLKNTLLEDFYHAELIQPEAPKRRRRGIW

DIPGPKRIPFLGTKWIFLLFFRRYKMTKLHEVYA (1)

DLNRQYGDIVLEVMPSNVPIVHLYNR

DDLEKVLKYPSKYPFRPPTEIIVMYRQSRPDRYASVGIVNEQGPMWQRLRSSLTSSITSP

RVLQNFLPALNAVCDDFIELLRARRDPDTLVVPNFEELANLMGLEAVCTLMLGRRMGFLA

IDTKQPQKISQLAAAVKQLFISQRDSYYGLGLWKYFPTKTYRDFARAEDLIYD (2)

VISEIIDHELEELKKSAACEDDEAAGLRSIFLNILELKDLDIRDKKSAIIDFIAAGIET (0)

LANTLLFVLSSVTGDPGAMPRILSEFCEYRDTNILQDALTNATYTKACIQESYRLRPTAFCLARILEEDMELSGYSLNAG (0)

TVVLCQNMIACHKDSNFQGAKQFTPERWIDPATENFTVNVDNASIVVPFGVGRRSCPGKRFVEMEVVLLLAK (0)

MVLAFDVSFVKPLETEFEFLLAPKTPLSLRLSDRVF

 

>Cyp314a1 ortholog 90.4% found by SunHong Kim

MAVILLLALALVLGCYCAIHRHKIGATYLKPLLKNTPLEDCYHATPVVPEQQKSRRRRSI

WDIPGPQRIPFLGTKWIFFVFFRRYKMTKLHEVYA (1)

DLNRRYGDIVLEVMPSNVPIVHLYK

REDLEKVLKYPSKYPFRPPTEIIVMYRQSRPDRYASVGIVNEQGPMWQLLRTSLTSSITS

PRVLQNFLPALNAVCDDFIDLLRARRDPDTLVVPNFEELANLMGLEAVCTLMLGRRMGFL

AADAKQPQKISQLAAAVKQLFISQRDSYYGLGLWKYFPTKTYRDFARAEDLIYD (2)

VISEIIDNELEEHKKSAECDDEGASGLRSVFLNILDLKDLDIRDKKSAIIDFIAAGIET (0)

LANTLLFVLSSVTEEPSAMTRILSEFCEYRDTNILQDALTNATFTKAC

IQESYRLRPTAFCLARILEEDMELSGYSLNAG (0)

TVVLCQNMIACHKDSNFQEAKQFSPERWIDPVTENFTVNVDSASIVVPFGVGRRTCPGKRFVEMEVVLLLAK (0)

LVVAFDVSFVKPLETEFEFLLAPKTPLSLKLRDRAI

 

>315a1 AC015141 229-2538 also AC008307 AC007725 AC007648

MTEKRERPGPLRWLRHLLDQLLVRILSLSLFRSRCDPPPLQRFPATELPPAVAAKYVPIPRVKGLPVVGTLVDLIAAGGATH (2)

LHKYIDARHKQYGPIFRERLGGTQDAVFVSSANLMRGVFQHEGQYPQHPLPDAWTLYNQQHACQRGLFFM (2)

EGAEWLHNRRILNRLLLNGNLNWMDVHIESCTRRMVDQWKRRTAEAAAIPLAESGEIRSYELPLLEQQLYRWSIE (1)

VLCCIMFGTSVLTCPKIQSSLDYFTQIVHKVFEHSSRLMTFPPRLAQILRLPIWRDFEANVDEVLREGAAIID

HCIRVQEDQRRPHDEALYHRLQAADVPGDMIKRIFVDLVIAAGDT (0)

TAFSSQWALFALSKEPRLQQRLAKERATNDSRLMHGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEKD (0)

TMVLLSLYTAGRDPSHFEQPERVLPERWCIGETEQVHKSHGSLPFAIGQRSCIGRRVALKQLHSLL

GRCAAQFEMSCLNEMPVDSVLRMVTVPDRTLRLALRPRTE

 

>D. pseudoobscura ortholog of 315a1 (sad gene) L. WEI

MNRKRTSLLHWLQQLLRTLLVRLLCQFKSKAGLTKATAGSNRCRSKGGEIVPIPRVKGLPVVGTLLDLIAAGGATH (2)

LHKYIDSRHRQYGPIFRERLGGTQDAVFVSSAPLMRGVFLHEGQYPQHPLPDAWTLYNQRHACQRGLFFM (2)

EGAEWLHNRRILNHLLLNGNLNWMDVHIESCTRQLVDQWRARTEEATAECDVPGSPSYYELPNLEQQLYRWSIE (1)

VLCCIMFGSNVLTCPKIQSALDHFTQIVHKVFEHSSRLMTFPPRLAQLLRLRIWRDFESNVNEVLREGAAIID

HCIGGEITEDGQLEHLEQLEQREETLFNRLQAAEVPGEMIKRIFVDLVIAAGDT (0)

TAFSSQWALFVLSREPQLQSRLARERVASESQLLHGLIKESLRLYPVAPFIGRYLPQDAHLGDHFVEKD (0)

TLVLLSLYTAGRDASHFEQPERVLPERWCVGRSHGSLPFAIGQRSCIGRRVALKQLHSLL

GKCTTQFEMQCLNEQPVDCMLRMVTVPDQTLRLALRPRSSE*

 

77% identical to 315a1 D. melanogaster

Query:     3 RKRTSLLHWLQQLLRTLLVRLLCQ--FKSKAG---LTKATAGSNRCRSKGGEIVPIPRVK 57

             R+R   L WL+ LL  LLVR+L    F+S+     L +  A +    +   + VPIPRVK

Sbjct:     5 RERPGPLRWLRHLLDQLLVRILSLSLFRSRCDPPPLQRFPA-TELPPAVAAKYVPIPRVK 63

 

Query:    58 GLPVVGTLLDLIAAGGATQLHKYIDSRHRQYGPIFRERLGGTQDAVFVSSAPLMRGVFLH 117

             GLPVVGTL+DLIAAGGAT LHKYID+RH+QYGPIFRERLGGTQDAVFVSSA LMRGVF H

Sbjct:    64 GLPVVGTLVDLIAAGGATHLHKYIDARHKQYGPIFRERLGGTQDAVFVSSANLMRGVFQH 123

 

Query:   118 EGQYPQHPLPDAWTLYNQRHACQRGLFFMEGAEWLHNRRILNHLLLNGNLNWMDVHIESC 177

             EGQYPQHPLPDAWTLYNQ+HACQRGLFFMEGAEWLHNRRILN LLLNGNLNWMDVHIESC

Sbjct:   124 EGQYPQHPLPDAWTLYNQQHACQRGLFFMEGAEWLHNRRILNRLLLNGNLNWMDVHIESC 183

 

Query:   178 TRQLVDQWRARTEEATA-ECDVPGSPSYYELPNLEQQLYRWSIEVLCCIMFGSNVLTCPK 236

             TR++VDQW+ RT EA A      G    YELP LEQQLYRWSIEVLCCIMFG++VLTCPK

Sbjct:   184 TRRMVDQWKRRTAEAAAIPLAESGEIRSYELPLLEQQLYRWSIEVLCCIMFGTSVLTCPK 243

 

Query:   237 IQSALDHFTQIVHKVFEHSSRLMTFPPRLAQLLRLRIWRDFESNVNEVLREGAAIIDHCI 296

             IQS+LD+FTQIVHKVFEHSSRLMTFPPRLAQ+LRL IWRDFE+NV+EVLREGAAIIDHCI

Sbjct:   244 IQSSLDYFTQIVHKVFEHSSRLMTFPPRLAQILRLPIWRDFEANVDEVLREGAAIIDHCI 303

 

Query:   297 GGEITEDGQLEHLEQLEQREETLFNRLQAAEVPGEMIKRIFVDLVIAAGDTTAFSSQWAL 356

                + ED +  H       +E L++RLQAA+VPG+MIKRIFVDLVIAAGDTTAFSSQWAL

Sbjct:   304 --RVQEDQRRPH-------DEALYHRLQAADVPGDMIKRIFVDLVIAAGDTTAFSSQWAL 354

 

Query:   357 FVLSREPQLQSRLARERVASESQLLHGLIKESLRLYPVAPFIGRYLPQDAHLGDHFVEKD 416

             F LS+EP+LQ RLA+ER  ++S+L+HGLIKESLRLYPVAPFIGRYLPQDA LG HF+EKD

Sbjct:   355 FALSKEPRLQQRLAKERATNDSRLMHGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEKD 414

 

Query:   417 TLVLLSLYTAGRDASHFEQPERVLPERWCVG------RSHGSLPFAIGQRSCIGRRVALK 470

             T+VLLSLYTAGRD SHFEQPERVLPERWC+G      +SHGSLPFAIGQRSCIGRRVALK

Sbjct:   415 TMVLLSLYTAGRDPSHFEQPERVLPERWCIGETEQVHKSHGSLPFAIGQRSCIGRRVALK 474

 

Query:   471 QLHSLLGKCTTQFEMQCLNEQPVDCMLRMVTVPDQTLRLALRPRS 515

             QLHSLLG+C  QFEM CLNE PVD +LRMVTVPD+TLRLALRPR+

Sbjct:   475 QLHSLLGRCAAQFEMSCLNEMPVDSVLRMVTVPDRTLRLALRPRT 519

 

>316a1 AC017388 35538-37158 also AC010113 AC010557 AC010112

MILTATFICFCLASAFNYFRARRQRSLIKNLKGPFTWPLMGAMHKLLFLTPI (1)

NFFQRSTEYLTKYGTFSRCWVFHRLFIPLADLELSRQLLENDTHLETGYELMKDWLVGGVLMCQSEQW

QKRHSLISGLFDKGNLEQLIDLSRHQTEQLLQKLAKQADQKVFDIWYTVSPIVLDLMVMT

TCGAKPSEEYSKNLKD (2)

LSEIYRKRFLSLQSANRFNYWLSSPFMRKRQNRLIKRLNDEHNN

LMAMHQSQNQLKIENGLDIYQLRPIPLKDHKSLLEILLESKDPQLTGEEICGELNTCNYL

GYQLCSPALCFCLVTIARNPSVQQKCLDELNLAQIKDQGWDLEKLNYLDAVLHETMRLYP

PQVIVGRQLKKDFPY (1)

NAELPCGSEIYINLYELQRNEVRYPKANHFDAQRFLDSPPELLSY

SLGPRCCPARKFSMQLLKTLLAPILANFEVLPYGDEVRLDLRLVLGSSNGFQLALKPR

 

>316A1 ORTHOLOG FOUND BY I. Moisini

MILTTTFLCFCVASAINYFRTRRQRSLIKNLGGPFSWPLMGAMHKLLFLKPQ (1)

NFFQRSHEYLAKYGAVTRLWVFHRLFMPLADLELAKQVLQSEQHLETGYELMRHWLGGGVLMCDKNQW

TQRHGLIGSIFNKGNMLPLTELCRQQAVLLQLTLADHAEQRDVFDAWTIVAPAVRDLMVL

TTCGVRPSEGYSEAFTC (2)

LTEIYRKRFLSLQSVNRFTFWVSSPLLRRRQAQLIKQLNDEHK

EHIDRFRRLQKQEEQLKAGNVVVDRIDPLPAQWHQSLLEILLAGNHNPEISDDDICAELN

TCNYLGYLLCSSALCFSLVTISRHPAVQQRCLEELRKAQREDQSWDVRRLPYLEAVLLET

LRLYPPQVIVGRHLTEDMPY (1)

NGTLPFGAEIYVNLFEMQRNEDRYLNASHFRAERFLESPP

EIYSFSMGPRCCPAKQFSMVLLKTLIAPILSNFELLPYGDAPRLDLRLSLGSSNGFQLALKPR*

 

>317a1 AC020477 126550-128106 no introns also AC009844 AL109349

2 aa changed from ealier version, no introns

MWIIFLIIGLLVLGLLVLLIIAARYQRDYWRYLDIPHERPKKLWPIIRQIMTQTLSTEAM

KAEHYSAIYKKFKGSGPFCGFYALLQPRALILDRELIRQIMIKDFWNFNDRGLYCNQKSD

PLSGDLYALRGESWKEMRQKLDPSLEGDRMSLLYDCLYEEAEQLLLTVNSTLMSQPHSTV

HIQKIMRRYVLSSLAKCVFGLNAEQRKTYPLEDFEQMTELALNSHKHGYLMNLMMIRFPN

FCRMLRMRRTPKQAEEYFIKLLTSIVEQRETSGKPQKDYLQLLIDVKALEFITHQYEADK

ELGAHLQNELAAHAVVFLKAGYEQTANTLSYVLYELALHPELQVRVREEVKKAIERHDGH

ITHEGIKSLSFMGQVINETLRMHPITPYILRRTLNDYAVPDHPKYILVKELFLIIPTHAI

HHDPDIYPDPEEFKPDRWSGPRDSLQEQGTWFGFGVGARSCIGIQFAQLQLRLALALLLS

EYEFSLNTRKPLINLEDGIALTLMPLGVIEPGNEERAV

 

>D. pseudoobscura ortholog of 317a1  V. Lamba

Contig3531_Contig5436.187 no introns

MWIIFTIIGLVVLGLVILLIMAARYQRDYWHYLNIPHERPKKLWPIVRQIVTQSLSTEAM

KTAHYSALYSKFKGSGPFCGFYALLQPRALILDRELIRQIMIKDFWNFNDRGLYCNQKTD

PLSGDLFAMRGQSWKEMRQKLDPSLESDRMSWLFGSLYEEAEQLLLTVTSTLMKQPHSTL

HIQKLMRRYVLSALAKCVFGLDAQQRLKYSLEDFEKMTEMAVSSHKHGYLMNLMMIRFPN

FCRVLRMRRTPKQAETYFLTLLSDIVGQREASGVRHQDYLQLLVEIKALELITHQYQADK

ELNTHLQNELAAHAVVFLKAGYEQTANTLSYILYELAIHTDVQATVREEIKKAMERHDNN

LNYECVQSLAYLGQVINETLRVHPITPYILRRTLTDYQVPDHPTYMLVKELFLIIPTHAI

HHDPDIYPEPEEFKPDRWGGPRDSLQEQGTWFGFGVGARSCIGIQFAQLQLRLALALLLM

EYEFTLNSRKPLVSLDDGIALQLTPLGVIEPGTEERAV*

 

>318a1 AC014186 comp(968-207) AA803931 AA803220 AA821188 NM_167318 revised 2/11/04

MHLNIALWACGALLAVLLAWQQRKCWRLIWQL

NGWRGVIQQPVLWLLLCINLHPN (1)

SILEKVSQYRVHFQRPLAVLVGTRVLLYIDDPAGMECVLNAPECLDKTFLQDGFFVRRGLLHAR (1)

GQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAAEDLLSRAVLEVSC (1)

LTIMGTPTNFTQLDDAHIAHSYKR (2)

LLEISAVRVVKPWLQIRLLHRLLAPELY

EESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQIFQLAANG

EMTLEEIMDEAQSMVLV (0)

SFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDVGQ

VGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQ

HETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRD

RRHSYSFLPFSNGLRSCI (1)

GRRYGLFIMKVFLVKLITNFDFQSDFELEKLQFVENISLKFKNADDILLTIQPKKEST*

 

>CYP318A1 ortholog found by C. Lancaster 78%

MHLYVALWVCGTALALLLGWQQRKCWRLIWQLNGWRGVAQQPILWFLLCINLHPN (1)

SILERVTQMRKYFQRPLAILVGTRVLVYIDDPAGMESILNAPECLDKTFMQEGFFAKRGLLHAR (1)

GQKWKLRRKQLNPAFSHNIVASFFDVFNAVGNQMVEQFASQPHLHGRAVKFTDAEDMLSRA

VLEVSCLTVMGTPTNFTQTDDAHIASSYKR (2)

LLEISAIRVVKPWLQIDLLHRLLAPELYAEAEKCNQLLVEFVAGIVQSKHRNWQLRAAL

CEGAGEDSTAWQRRIFIEQIFQLAANGELTLQEIEDEAQSMVLV (0)

SFETVSNSIMLALLCLATHKGDCQQRLRAEIASVFPGQGQGSTSDAPH

VGLEQLQQLRYLDAFVSEALRLLATVPMNLRHVSRDFQLPGREAVVPQNSIIVLDTFNM

QREEEWWGDNAKQFDPQRFLDQDDQPDQSPEGEDISGSSIPKTNGQQKQQKQQRRHSYSFLPFSKGLRSCI (1)

GRRYGLFIMKVFLVKLIVAFDFSSDFQLDQLQFVENISLKFNNVDDISLAIQP