110 P450 seqs plus three false positive hits

 

Note: Gibberella zeae is the same as

(anamorph: Fusarium graminearum) thus the FG contig #s

while the entries are Gibberella zeae in the definition line

 

3 of these sequences are not p450s, but were found

in a P450 blast search

 

For a list of F. graminearum P450s in CYP name order see

/FG.CYP.list.htm

 

For a list of F. graminearum P450s in chromosome order see

/FG.list.htm

 

>CYP620C1 FG00007.1 AACM01000001 FGcontig1.1_scaffold1

36% to cyp64

AACM01000001.1 revised

MLLIIVVLVGTLIYFLSFHNKKRHGLPPGPKPLPIIGNIKD

MPPKGVAAFRHWLKHKDTYGPVSSVSVLGQPLILIHDREAAHYLFDKSSG

KSSGRPSANFGGRLCGFDQILSLQQYGDTFKRHRKLVHRQMGTRAGAAKF

RQIQDVESHRFLLRSLDNPGNLMEHIRK (2)

EAGGVILKATYGYSIEPHKPDPLVHLVEFMVEGISIVVVPMKFVVDFLPWLEYI

PECLPGMSFKARARRWRTILNNTIEAPYQFVRQQMAKGIQFESYVSSLLT

QEKLKGGNDTLDETYEADIKRTAAIMYAGGADTTVSTIQSFVLAMMVYPE

VLKKAQAEIDNVIGPDRLPGFEDRENLPYINSMVKESLRWMPAVPMGAAH

KADDDIYYGDLCIPKGSFLLPNVWWFLHNPETYQDPERYDPDRYLEPRNE

PDPDSNCWGYGRRICPGRLLADESIFIVIARVVAAFDIEKDVDEQGNTIE

PKVEFTTEGALSRPVDYPYRIKPRNAKCVDLIRAVEKEHPWDKGDASLLQ

QDMVVL*

>CYP630A1 FG00012.1 AACM01000001 FGcontig1.1_scaffold1

poor match 29% to CYP53 44% to 630B1 looks intact

MIVFYSLGAAFAALFVRIFIYPVILYFADPKGLRKFENFSWLSPLTDLRH

CYLSHTGKRSETLAAEHERRGESILRIGPNALSFNHPQAVRDIYGHQTKC

TKDHKETVLAGPHRNLFDVVDKGEHSRKRRLLSAAFATRNLAKWEFKVRY

TTQRLLDAFDPLCTAPLKTNTDPDPEDLTVDFNNWINLWTIEAINYIALS

SKMTLLDTGTDEAMAETTDGTLYPARYRQSQNHSAMVKSVFCWEYELYPW

LRRISKVVPNKWKSYWATSAPWVDVCYHQAKNRLRRYQAGEKLDDFFSCL

MHDKNGVANAVEWGEVVAEISAIIDAGAETTAIALTHLLQLLISHPAQLQ

KLRDEISGVIGEDDVIAPLDKVKDLTYLKACLDEGLRLIPPVSSGLPRRT

PPEGANIMDTWIPGNTSVSMTIWSAHHNEDIYPDAYAFKPERWLDPTERK

RMEPFFIPFSAGARGCIGRNISYLEQQIVVSTLVHRYDFAMPTKDFKVSR

FEAFNLIMGQLPIKIWRR*

>CYP548B1 FG00037.1 AACM01000002 FGcontig1.2_scaffold1

first part is a P450 missing N-term 40% to 548A2

MHRAPNVLTAVDKKAHGMRRRILSQGLSDSSTRAFGNTIKKHIERLCQKI

EGHSDPNTQWSESYDMARWFSYLTFDIMADVVFGQPYNLLGNSEYRYVVD

SIEGSNIRTGVLIQAPEAYTWRLDKRLFPASIRHRNTFVKFISSLVQERL

TTKPLERDDIISHLLTAKDSETGQGFTKNEVAAESSTLIVAGTDTSSTAL

AATLFYLTQYPNMYRRAVAEVRSSFAKSQDVKLGRALNECVFTRACIEES

MRLSPPAASALWRRVQVGGQTVDGHAIQAGCNIGVCIYAIHHNELYYPDP

FVFNPDRWLQNDKQAQSAFSPFSVGPRSCIGKGFAMAELMLAVATILVKF

DIRRAPGDQGCIGQGHLEGEDGRRMVDEYQLHDHV

TAFKQGPVLQFRRRD

TVVQSEAEYTTNTCMMFPGDMESKASSMNGDQPSSPTPSSSTSVTIPTYT

PTSMYDQELQFSRSVAKHVYEAAATLRAAFLCGFQPYTDVASFAHDEIVS

QLHYWSSFISFVNDPANNQAFTRMDILEVTRALVQCAEDTVLAGNDIHMI

VAHLQIPQSEKGRIIKTFVTANSMLGDQPEVEVSNLVRSSLDGESTVYVI

FGGQGNGDGYFAELAELYEVYQPLVGDLVRSASDLFRHLTDKMDVNDCFS

EGMELMAWIDKDNDTPIPSRPYLLSSAISFPLITLLQLLHFKISFHYSGC

SFKDVQRFLAGVTGHSQGIIAAAAIAAVDSPASFHELSLQAMTVSFSMGV

RIHQYYGPQVLPQLITEACLAEGKPIPTPMLSVRGLSIETLATTIQDLNK

SLPRTKVQLEVGLRNNDSNYVITGDPMSLRGLCTHFDHKKKALDIVYQFL

PAAAPYHNSYLSIAASRAIEDCQEIILRGCDLKMPVFSTVDGSDLRNNEG

ANLVPDLIRMVCCQVVNWPAALNMPGATHILDFGPGGAQGVGVLANSMKA

GQGVRVIHATVLNGLNTELGYKPDLFDRSRKASERVSKPQPWVNSFQPTL

TRFTENKLVVSTRFTRLFLQPPIMVAAMTPTTTSWDFVAAVMKAGFHAEL

ACGGFHDRDSLSAAITAIANQVEPGTGITCNVIYSSPTSLRWQIDELEKL

VAAGYQIDGLSIGAGVPSVEVVQGYVERLQLQHIALKPGSTEAIERTLKI

AKALQPLPVVLQWTGGRGGGHHSNQDFHAPLISMYGKIRAQDNVVLVVGS

GFGGPSDTLPYITGKWASDMGLPPMPVDGILLGSRVMVAKEAHTSTEAKH

LIVATEGAPDDEWSGTYSRPTGGVLSVISEMRQPIHKIATRAVRLWHELD

QTIFHLGPKERVAEITRRRDEIIRRLNHDYHRVWFGCSGPTRDPVELDEM

TYSEVLHRFVELAYVTAEHRWVHLSWKKLFSELLTRTMSRLHRTSDSRSE

TLVDDLDDPYSTLATLTDASAQLITYEDSIYFLQLFRRRGQKPVPFIPVL

DADFETWFKKDSLWQSEDIAAVPNHDAQRVCILHGPVAAQYSTKVDEPVG

EILGNIHTAWVTAILQTHYQGQSELVPVFDNSPFHASQVESSKTNTELST

PPLNHGLWTLEQWIVHIVQSRDKNLNWAKALLASPRVLCGRRLVPNPFIT

TLSGLRSMDIHVAETTKTGVGAGFTFFKIPLEETHQDLLDLTLQSNNEIS

IQISHYPTLQSAPITLTHHMSCQFSKLAMNKSLSDRSAMIRDFYRRIWLG

TSHESSHKSIYDKFECEPYTVTADAIRKYNDCTRLPTSMPPTSWATSEVP

LDFAVVIAWKALVKPLFSRELEADILKLLHVSNEITLHSDHSPPMVHDVL

HTESQVTEVVLQPSGKMVQVEAHVFRGKSCILDLKTRFLLVGNDTHRDHL

FRRSILPPSEILLEDEISAMQLVQSSWFQPLRDTSDLVGKRVVFQLEDLM

QFHENGQIRCHQITGCAMLDGSIVGNCYLETPDDAYLSLMGNILSQQTGS

SSQPAIFETPLLLFEEQEISFTAPTCEQTIAYSAASGDSNPIHVSPVFAS

LAGLSSPIVHGMHISAEVLQIVYTWLCASSMSRLKKSHVLFAGKVCTGDR

LAVSMKHTAMHRGLRVVEVQIHKNMAEELVFVGTYEIEQPLTALVFTGQG

SQKKGMGMDLRDKSAAARRIWDTADDHFQHEYGFRITDIVRHDPPSLTVH

FGGVHGRRVRSNYMALTYERVASDGQIIEAKLFPTINENTTKYVFSSESG

LLSSTQFTQPALGLMELAIMADLEARQLIPSNVTFAGHSLGEYSALMAVG

HIMPLEVFISTVFYRGLVMQSTVTYDHHGRSKYAMCAVDPTRVSTDFDGQ

KLGWLVTQIASEGQWLLEVVNHNVIDSQYVCAGEAIALHCLGVVLDRIHY

ASKSFFDDGSFDLTDCIRESVKEIRKDRSKVVLSRSKASIPLKGLDVPFH

SSHLRSGVDPFRRRLQRSIKLDNASPTKLIGRYIPNLTGKPFEVTRQYFN

EVLRLTGSIPIQQALESWDRVASTI*

>CYP68C2 FG00071.1 AACM01000004 FGcontig1.4_scaffold1

64% to 68C1 looks intact

MALITSLQDVRLDMLAYFVAFLVVVSVVRKKLAPQPSAYLLNPRRWYEFT

DARAVSEVLHTTRQTLEEWFHKHPTTPVRLTTDFGEMTFLPPTLADEIKS

DKRLSFIKAANDSAFHTEIPGFEPFREGGRNEAALIKEVIHGQLKKTLNK

MTFPLAQETQLAVEHYLGANKEWHKIRLRDALLPLVTRISTRIFLGEDLC

QNDKWISITSEYAANSLEVANRLRVWPKYMRYVVSYFSPGCGILRNQVKN

ARELITPIVERRRSEEKGKEYNDSLGWFEKTAKQAYNPAATQLFLSAVSV

HTTTDLICQCLEDIAAHPEIIKPLQEEIRRVIAEEGWNTKAMYKMFLLDS

VFKETQRLKPIQVASMVREAQSDITLSDGTFIPKGHQIAVSCHNMRDGRI

YENPEKWDGYRFFRERQQSAREDKVQLSSTSVEHMGFGYGEHACPGRFFA

AKQVKIVMMYLLLNYEWKIPEGPEPQLMAWCTTWVTDPDYEVLMRRKDKD

DPCLRLELVQDD*

>CYP645A1 FG00127.1 AACM01000005 FGcontig1.5_scaffold1

fused gene 33% to bacterial CYP116B2, Non-P450 part

matches this seq better than the P450 part

see J Bacteriol. 2002 Jul;184(14):3898-908.

probable lateral gene transfer.

26% to CYP55A1

MFNKKTATTSKPDMITKCPFSNPNSLFQDLATVRQTDGIEYNEKLKGYLV

TRFDDIVDVLNRPDEFSSRPTVPDFPPPVKPLFKDKVPEKGTLLAWDNPD

HDRLRKSVASFFVPRRLKRFEPMLHDAANELIDSFIDKGTADMKSAFALP

LPLRSIVTIAGLDPERWQWIGQCLTLFGGIARRDDEEEVSIQQKIQDVLD

LHEYIRQVIEERRLDRRDDLISHIWNERDAGTVIMTDFEHLSMIPGLLLA

GHETTTNVLTMGLAHILHNGLWEQISQSDETRKAAIEELLRFESAITGMP

RQVTSDGVQLCGMKLNAGDRLFVAYNSGSRDESKFENPNKLDISRQSKTQ

HLGFGRGVHACLGAPFARLLLRTELAVLYTRLPNLRLVTPYEELAYGEVH

EARSIGATFYAWDIPSPGTARKVHVQSNGNATSRSAAVQNIPMVVQSLGS

VAQNIMQISLQPKDTAKQIEWTPGAHIDINVGTFGYRQYSVCSDPTDTQQ

LKIAVLREDQGTGGSRYLHENLKVGDKISIRGPRNNFKFTPGTRRTFLIA

GGIGITPMIPMAEEAAASGIDYKIIYLGRSRAGMAYIDKITQRHGERAMI

WVTDEHDGARLELAKLLQAEDPNGLRVYCCGPESLLTAVGESMSHAPLGT

VHVERFANPVSPLSSSNTAFDVLMAKSGRVLHVPEDKTVLEVINEAGGNV

LSTCNKGLCGTCEVGVLEGTPEHRDVVLTAAERAENSSMMTCVSRCRGKS

LVLDLW*

>FG00863.1

not a P450 mitochondrial processing peptidase beta subunit

MASRRLALNLSRGLRNRAGFSAAVPFTRGFATPSTVGKTQTTTLKNGLTV

ATEHSPFSQTSTVGVWIDAGSRAETDENNGTAHFLEHLAFKGTAKRTQQQ

LELEIENMGGHLNAYTSRENTVYFAKAFNSDVPQCVDILSDILQNSKLEE

SAIERERDVILRESEEVEKQVEEVVFDHLHATAFQHQPLGRTILGPRQNI

RDITRTELTDYIKNNYTADRMVLVGAGGIPHEQLVQLAEKHFAGLPSSGP

QTGAYLRSKQKADFMGSDVRVRDDNMPTANIALAVEGVSWNSEDYFTALV

AQAIVGNYDKAVGQAPHQGSKLSGWVHKHDLANSFMSFSTSYNDTGLWGI

YLVSDKPDRVDDLVHFAIREWMRLCTNVSASETERAKAQLKASILLSLDG

TTAVAEDIGRQLVTTGRRMAPNEIERKIDAITEKDIMDFANRKLWDRDIA

VSAVGTIEGLFDYQRLRNTMKPKF*

>CYP51F1 FG01000.1 AACM01000048 FGcontig1.48_scaffold1

CYP51F1 64% to Erysiphe graminis 72% to M. grisea 51F1

MGLLQELAGHPLAQQFQELPLGQQVGIGFAVFLVLSVVLNVLNQLLFRNP

NEPPMVFHWFPFVGSTITYGMDPPTFFRENRAKHGDVFTFILLGKKTTVA

VGPAGNDFILNGKLKDVCAEEIYTVLTTPVFGKDVVYDCPNAKLMEQKKF

MKIALTTEAFRSYVPIISSEVRDYFKRSPDFKGKSGIADIPKKMAEITIF

TASHALQGSAIRSKFDESLAALYHDLDMGFTPINFMLHWAPLPWNRKRDH

AQRTVAKIYMDTIKERRAKGNNESEHDMMKHLMNSTYKNGIRVPDHEVAH

MMIALLMAGQHSSSSTSSWIMLRLAQYPHIMEELYQEQVKNLGADLPPLT

YEDLAKLPLNQAIVKETLRLHAPIHSIMRAVKSPMPVPGTKYVIPTSHTL

LAAPGVSATDSAFFPNPDEWDPHRWEADSPNFPRMASKGEDEEKIDYGYG

LVSKGSASPYLPFGAGRHRCIGEHFANAQLQTIVAEVVREFKFRNVDGGH

TLIDTDYASLFSRPLEPANIHWERRQ*

>CYP617A1 FG01048.1 AACM01000052 FGcontig1.52_scaffold1

34% to CYP582A1 looks intact  37% to 547A1

MGLPWEIITATSAISTLTLAWTHDDWSKSQLLGRFPVFWIAGLAVWIVWA

VWVYPLLVSPLRHLPGPSGNHWLMGQSKKIMAEPSGVPMRQWASEIPNDG

LLCYRGFFNQERVMVSSPKALAEVLVTNSYAFPKPSHFRWSIGRILGVGV

LLAEGDEHKMQRRSLTPAFAFRHIKNLYPVFWRKAREVTRTMMAEFGQQE

ETQVEISGWASRATLDIIGLAGMGRDFGAIQNPNNTLAQTYSKIFKPSRQ

AQILAFVGMIIPMEFITKLPFRRNEDIAKAASDIRAICRDLIQEKKAKMA

NKEQADVDILSVALESGGFTDENLVDQLMTFLAAGHETTASAMTWAIYMM

ARHSDIQTRLREEIREHLPSVDSDVDITSLDIDRMPYLNAVCSEVLRYYA

PVPLTMRDAAYDTTILGQTIRKGTRIVIVPWATHFDHDLWGPDADQFNPD

RWLSAGGENKIGADRKAASGGANSNYAFLTFLHGPRSCIGSSFAKAEFAC

LLAAWIGRFEFSLANPEEMDEKNVEIRGGVTARPAKGMHVKVKVIGGY*

>CYP539A3 FG01284.1 AACM01000065 FGcontig1.65_scaffold1

63% to 539A2 looks intact

MGVVEALLEQVTLKTTLVILFVSYCIYSIICRIDEHRRIRRLGHYGPHMK

TYAPWGLGIVARFVVSTVKHQNLATWRDDMFGAENSWTVETRLLGVRTIF

TADPANLKAILATQFVDYGKGKPFHAEWKDFLGDSIFTTDGAPWHASRQL

IRPQFTRDRVSDLHCFEAHMQTLFKAIANRGPLHGEDQPVPTEGLDGKVL

DISDLFFRYTLDVATEFLLGWDVKSLTTPRQEFAEAFNDVQRIQNIVART

GKLRHIIPRYKFWKGLKTVNHFINFYIERALRLSPEELNSKTKDDHSYTF

LHALAGFTRDRKVLRDQIIAVLLAGRDTTAATLSWTLYELGRYPNAVKRL

RSEILSTLGSERTPTYDDLKSMSYLKAVLNETLRLYPAVPFNVRLALKDT

TLPRGGGPDGSEPLPVLKDSPVGYSTLVMQRRSDLYPPISDTFADPQIFS

PERWAHWHPKPHDYIPFNAGPRICIGQQFALTEMSYVLCRLFQKYERVES

RMKDIDGGEPLLKADIVLSPGQGVNVAFWEAKK*

>CYP642A1 FG01583.1 AACM01000081 FGcontig1.81_scaffold1

weak similarity to CYP611A1

MFDHTRTLNHISSFSLNIIPTLIFFLVAAYVLPIITRRLLRYVASPTSFS

EKSSGHGTPSISNLPHLSGVVPWLGHLMGLTIDSTRYINSLIASTTAPIF

TINIPFARITVCHPSMDRVLSRHVNDTGLAQVLVYVGPRLFGLKQDTIKA

VFGYNPQPLHKQKFGHAENIVSLNQRSSTNIRDRVAKMPEVNELLIGRWV

FELAVSATASAVWGVANPWSMDQEFSNEFMKLSETFDTLGRPFSWLTANS

AWKSRKFLLKRLREFHLQHREARVQTTGHSINVVASSDPDWENNPDYYHI

EMVSALGLLATTSTLAVWLTRHLLTDPDLVKFVLKEVEQVKYVEEDEDKP

RLDFANVRSECPWLMASWYETLRLHMTGVARIARHDFMLNIPGSEPIAVP

QGEIFMLPMCASNLDVDVWGLDAAVFKASRFIDKEGQVSGSAVRKVRAFG

VAGNMCPGRVFGTDIVFSVIGTMLRTFDIEAAPGEEFRVPTLRGGFNVGF

ERYGDDVKVLLKRKHTA*

>CYP643A2 FG01722.1 AACM01000091 FGcontig1.91_scaffold1

poor match looks intact 65% to FG02367.1 40% to FG04724.1

MNQTYVWAIAQTETLFQSHSRNSLWGYFLVISTAGYLLYWAFDRTYKLHM

HPLASFPGPKEACVSQKWLHRVSEEGSPERVFEKLHQKYNSRAIRIGPNE

LHIDDVTLYKSVYNQNATYLKHEGFYGGFNVPHTVFAEHVPSLHKERRRR

LNPFFSRRAIEKLEDLLKGKIGQLGKRIDSQIGPYNIYNAARCTTVDIIS

HYCAGKPLGQLEKSDQNFHGDFLQSFDSLSKVLWKFMYQPIFRKIITSIP

DSIAKAADSETRTMLTLYDACRAAAIEYKRSPPQSDHATIFSCLSDLREE

DMGAEACDLLIAGSDTTAYTIASSIFHISQNTSIKRKLVEALDAANINVE

ELPSLVELERIEYLNATVREAIRFAIPAPGRLPRVVPHDAKPLVVDGQVI

PAGTVIGMSAYTMNFSKELWGEDAAMFNPDRWLGVNGKAMESNMCSFSKG

IRSCLGQNLANAEIHYNLAYIFGKYDVDSVTKGDKLEVFDRFATHVPSHN

IMVDLRRRENSAR*

>CYP551B1 FG01739.1 AACM01000092 FGcontig1.92_scaffold1

44% to 551A1 looks intact

MERLKMDSLNININDWFEKDLPATADWKLFALASVVFVVLRFTCIVIYRI

YFSPLSKFPGPKLAAATHLYESYYDFWKKGQYYKVIQRMHEVYGPLVRVT

PDELSINDPDYYDTVYVNGNVRRTESFGHSFGGGLGIEDTFFASQDHDLH

RKRRKPIEPYFSRNGVLKLENLIGERVEKLFHKFHELSGTGVVARLDYAF

EAFTGDVMQHICIEKPESLLNSDDFSSEWFEMLRNVSLSVPLMGMIPWLV

HVLKFIPESVIMWLAPSAAHFQTFRVQAGRQIEQAKHEKVENDRKGITTV

GGKPTLFRFLVHESGLAPEDLSTERLQKEAMVLLGGGTTTTARTATMTCF

WMLSMPEKGQRLRDELKDIMAEYPKKKPSLTELEKLPYLGAVIQESLRMA

YGSMRRLPRTSPDVALQFKDWVIPPGTPVGMNAYYLHTDPNAFPEPFEYK

PERWLGNVTPAMKRSFVPFSRGSRRCPGSSLALADLHFVLAALFGPTGPK

FELFESDRSDVDAIHDYLMPLPRLDSKGVRVTVK*

>CYP561D1 FG01740.1 AACM01000092 FGcontig1.92_scaffold1

45% to 561A1 looks intact

MELPSFSLKFDHEKLLPLAIISTGLLVTSLVAISIYRIWFHPLAIFPGPK

WLAISNVPERYMSNISGTWIWRVSSLHRKYGPIVRIGPNRLAVDGSIGWF

QVYAMRGKEDEFPKYPEYIFPGDGLSILGANQVNHRRHRRQFWSAFNDQA

LVEQEIVIQPYTDMLLQRLSEQAKIGKPINIVDWINFLLFDIAGELVFSS

PFDCLDKQEYHPWVANFFRAVKGNAVNRFVTHYPITKPIVNFLFTGKEQI

QREADQRNMTFHHAMQRMKLGEQPTPGRRDFMSFLMRRNRDGGGLSDTEI

LVDCPVLIGASSETTTTALSGFFFYLGISPQAYKRLVEEVRSSFRSESEI

NMKTTKQLEYLNATVDEALRVYPPAAESPPRISPGAEIDGKYLPKGVVVS

VYQWGTFHNPDNFADPDEFIPERWLQPSHPLHNPKYDNDNRSVYRPFGFG

MRDCLGKNLAHAEIRVVVSRILYRFDYELAPNQENWHANQKCFMAWDKTP

LILTLKPRDFAP*

>CYP532A3 FG01745.1 AACM01000092 FGcontig1.92_scaffold1

59% to 532A2 3 small defects

MHGGLIETLLSVLAQHWVLALTTVTFAWLVRNRFHHGLNKYPGPFLASIT

DWWRFFDVYGQKSEATLRKLHAKHGDIVRLGPNNLSFSDPSVLKQIYGLS

KGYVKSDFYIVQQSVVQGHRLASLFSTTDNDFHSQFRRSVNAAFSMSALV

QYEPFVDNTTKLFLDQTEKLFAKKXXXXSEVCDFTQWLQFYAFDVIGEITYSKR

HGFIEKNEDVEGIVAYLSKLFLYVAPIGQIPFLDLLFLKNPIYLKLSQWG

LFDSTFPVAKFARARMAERLIPELHASDGLPTSNIKKQPLGQDLLSKFIA

AREARPDFMTDTLVQTMAVSMAFAGSETTAISLSSVFYYLLRNPACYEKL

KKELDDAAKAGVFSDYETGLVTFTEAQKFPYLHACVQEAFRVHPAPGLPL

ERIVPPQGAEINGEFIKGGTVVGVSAWLIHHRQEIFGPDTDAYRPERWLP

DPKLXXXXXXXXXXNPEDEDKRIKKMTGMMFQFGMGSRTCIGKNISLLEIYKVVPSLLRR

FEISFDDPTKEWKTINAWFIKQTDFNVRFTKRELVQPEFSEK*

>CYP527E1 = OLD CYP527D1 FG01767.1 AACM01000092 FGcontig1.92_scaffold1 527D1 WAS ALREADY GIVEN.

40% to 527C1 looks intact

MDLNSLSNYKTPGGAVVVLLAFVTFWWLTTTLIAWNRLKHIPGPWVAGFT

YAWAGWTEYSGKQHFSFLDLETKYGSLVRIGPELLATSDVEVVRRMSARK

STYRKSSWVDGVRLNPYHETMFGVRDPIEHDRIKTRLAPTYSGRDTPHLE

SVVDQQVNNLVSLIRRKYVSDPTSGDFRVMSLIKVASYLTLDVISKVGLG

TEFGCCASDSDPYGFTKAVAEHMPLMAMTSGVPWMRNVFCSPLFLKYFGP

KDTDTYGLGPLIKVTNDNVRARYSQEDGGKRDMLSSLKASGLPEGEAQAE

TLFLFIAGSDTTAAAIRVTMFYIISSPRVYQKLKKEIRKAIHEGRASSPI

TVAQARELPYLQAVIYEGLRIRPVTTGPQSKEVPPGGDTINGHFIPEGTS

IAINFPAIMGSKKLFGPDADVFRPERFTDLQDPDLAEMRRNVEMNFGNGR

WMCAGKPIAFMELHKVYFELLRAFDFQLVEPLKPMTSESYSLFRDHGLNV

RVTLAEDME*

>CYP506A2 FG01786.1 AACM01000093 FGcontig1.93_scaffold1

100% to 506A2 Gibberella zeae anamorph: Fusarium graminearum, revision: added cyan seq 2/21/06

MKSLVSILKMDMQIEYTHFGGPPEYVIHAIKANLTGSLRENPCDELYDQD

YQANFSSRVCTHTPQNGTQEYAQSHGCIQKRVLICCLRSPKPLTRSQTGH

QSKSTTEYSASLQPITLALFKVPLQVRTKSGS

LKQWHPWLRPLVYRLIPE

RAAIKDQWAKGRKRVMASMKERQQKGGNIEDPPTMLDHLSNGKHEGMAND

IEKQLVHQMNLIAVGTVTTYSSTTQAIYDLATHPEYVPILRQEVESVSRD

ANGNFTRDSTLAMEKLDSFIKESQRFHSPDL

TTFQRAAIADMTLPDGTFVPKGTKL

EINTCSIHKDKDLYENPGDFDALRFYKMRQAPGQEAKYQYFSSLVRNLNT

HLCSAPPIPITRFC*

>CYP506A2 AACM01000093 Gibberella zeae N-term is a guess

MKSLVSILKMDMQIEYTHFGGPPEYVIHAIKANLTGSLRENPCD

ELYDQDYQANFSSRVCTHTPQNGTQEYAQSHGCIQKRVLICCLRSPKPLTRSQTGHQS

KSTTEYSASLQPITLALFKVPLQVRTKSGS

SNKITDWTPVKVHDRVLRLIATNNARAFQGTAASEDEEWLSASTGYVLACFDCIRALKQW

HPWLRPLVYRLIPERAAIKDQWAK

GRKRVMASMKERQQKGGNIEDPPTMLDHLSNGKHEGMANDIEKQLVHQMNLIAVGTVT

TYSSTTQAIYDLATHPEYVPILRQEVESVSRDANGNFTRDSTLAMEKLDSFIKESQRF

HSPDL

TTFQRAAIADMTLPDGTFVPKGTKLEINTCSIHKDKDLYENPGDFDALRFYKMRQAPGQ

EAKYQYFS

VGREDLSWGFGRHACPGRYLSAINIKLIMAELLMNYDIKLCDGASRPPNIEFEVLVSCTTEPGTQP*

 

>CYP602B1 FG01868.1 AACM01000100 FGcontig1.100_scaffold1

51% to 602A1

MQNTSSLPASPVGVNVQYPQLVLEGKRTGYYITFTLFILTLWLILPKKQR

SQLEVPFYKASKKNWIFDAETLIKDSYTKFRDRVYQIKATEGVQVLVPAS

LVGELKGLPEDVLSATEAVSDALQSKYTKFSPGHNGETLALLIRTKLTQN

LTRVVPRLREELEYILATEFPACEDWTPVKWQPFSLRAITRLSGRAFVGP

SLNRDEKWMDTTINFAVHVFTACVKLQFIPEWARPVGQYFVSELRQIRKD

IKIAKELLEPILKERLQNMELSNGEDAPDDMIQWLLEALPKDEKSDLTTQ

AELQLIIAAASIHTTNNLLCECLCDLAAYPEVQEELRQEXXXAYQILEAENGW

ERKESLAKLKKLDSFMREVQRLSGNITNQYAASFIRKVMKPISLSDGTQL

PAGTKVLAPQAGIALDERYFPDPERFDAFRFYKLRQESSE

ANHRWQFTSL

DDTYTNFGAGKHACPGRFFANNEMKLVLAHLLINYDIRLKPGQDRPKPMT

VVMAKAPSPDTELEFRRRSLVA*

>CYP61A1 FG01959.1 AACM01000104 FGcontig1.104_scaffold1

70% to 61A1

MEAVNSTTSGFSSVLAGTKYANVNIPPQIDYVXXXXIEAVSNAGVWTWVFTLVA

LCIAYDQIAYIVRKGPIVGPAMKIPFIGPFLDSMDPRFDGYHAKWSSGPL

SCVSIFHKFVVIASTRDMARKVFNSPAYVKPTVVDVAPKLLGHDNWVFLD

GKAHVDFRKGLNGLFTRKALELYLPGQEEAYNTYFKHFLKMTKDAGGKPV

PFMHEFREVMCAVSCRTFVGHYISDEAVTKIAEDYYLITAALELVNLPVI

LPYTKSWYGKKAADMVLAEFSKCAAKSKVRMAAGGEVTCIMDAWILSMIQ

SERWRKAEEKGEPHNVEKPSPLLRMFNDYEISQTIFTFLFASQDATSSAA

TWLFQVTAQRPDVLDRVREENIKIRNGDPNAPLTMDQLESLTYTRAVVRE

LLRWRPPVIMVPYVTKKAFPLTDDYTVPKGSMLIPTTFMALHDPEVYDNP

SHFDPERYYSGDAEEKGSKNYLVFGTGPHYCLGQVYAQLNLALMIGKASV

MLDWKHHATPKSEEIKVFATIFPMDDCPLTFEERKW*

>CYP505A7 FG01972.1 AACM01000107 FGcontig1.107_scaffold1

57% to 505A6

MAESVPIPEPPGYPLIGNLGEFKTNPLNDLNRLADTYGPIFRLHLGSKTP

TFVSSNAFINEVCDEKRFKKTLKSVLSVVREGVHDGLFTAFEDEPNWGKA

HRILIPAFGPLSIRNMFPEMHEIANQLCMKLARHGPHTPVDASDNFTRLA

LDTLALCAMDFRFNSYYKEELHPFIEAMGDFLLESGNRNRRPAFAPNFLY

RAANDKFYADIALMKSVADEVVATRKQNPTDRKDLLAAMLEGVDPQTGEK

LSDDNITNQLITFLIAGHETTSGTLSFAMYHLLKNPEAYNKLQKEIDEVI

GRDPVTVEHLTKLPYLSAVLRETLRISSPITGFGVEAIEDTFLGGKYLIK

KGETVLSVLSRGHVDPVVYGPDAEKFVPERMLDDEFARLNKEFPNCWKPF

GNGKRACIGRPFAWQESLLAMALLFQNFNFTQTDPNYELQIKQNLTIKPD

NFFFNCTLRHGMTPTDLEGQLAGKGATTSIASHIKAPAASKGAKASNGKP

MAIYYGSNSGTCEALANRLASDAAGHGFSASVIGTLDQAKQNLPEDRPVV

IVTASYEGQPPSNAAHFIKWMEDLAGNEMEKVSYAVFGCGHHDWVDTFLR

IPKLVDTTLEQRGGTRLVPMGSADAATSDMFSDFEAWEDTVLWPSLKEKY

NVTDDEASGQRGLLVEVTTPRKTTLRQDVEEALVVSEKTLTKTGPAKKHI

EIQLPSGMTYKAGDYLAILPLNPRKTVSRVFRRFSLAWDSFLKIQSDGPT

TLPINIAISAFDVFSAYVELSQPATKRNILALSEATEDKATIQELEKLAG

DAYQEDVSAKKVSVLDLLEKYPAVALPISSYLAMLPPMRVRQYSISSSPF

ADPSKLTLTYSLLDAPSLSGQGRHVGVATNFLSQLIAGDKLHISVRASSA

AFHLPSDPETTPIICVAAGTGLAPFRGFIQERAAMLAAGRKLAPALLFFG

CRDPENDDLYAEELARWEQMGAVDVRRAYSRATDKSEGCKYVQDRIYHDR

ADVFKVWDQGAKVFICGSREIGKAVEDICVRLAMERSEATQEGKGATEEK

AREWFERSRNERFATDVFD*

>CYP636A1 FG02111.1 AACM01000111 FGcontig1.111_scaffold1

poor match

MGVNNATLGLVCCVIVAVVALATRKGPDSREPPYVKERVPYFSHIYGLLK

HGLRYFDVVSAQQPHPIFTIDMSGQKNYIVTSPELVQAVQRNTTSLSFSP

AMIPAFRRMMGFDEAGIELIFRDAHTEKGMYGEIHRVQKASLLPGTESLD

ELCTIIRGKLLTIVNDMPSSQTIDLYAWVQDLYMRTNNSACFGAKDPFTL

NPSLISTFWLWEANIKVLLLGIPWFLSPSKYSTAQRTRNDLVNAFTQYLG

NDGLETACSFIKELSNLGIRRGLSTENNARALVGSILAIVGNTIPTTFWL

LIQIFSRPDLLKEIRSELEATLEDPSSRSEISLNYTVIREKCPVLMSTYE

EILRMTSGIATVRYTNEDTLIQDRWLLKKGAQVQMPTAFIHADPTTWGAD

AEVFDHTRFLKSKVLTKEQKARRAAAFRPFGGGNTLCPGRHFASYEVLTF

AGSILLGFDMTPTTEAFNLPEMDRSKLPLTSLKPAGDIKVNLTRRSGWEK

VQFK*

>CYP614A1 FG02113.1 AACM01000111 FGcontig1.111_scaffold1

poor match

MITPLHAIGFILLGYSGLCTVQLLWNYRKAKAIGLPVLITPIDPSNVPYL

LCSSWLEPLLRKILPFGLGNFVEYNSRDWNYSQIHGLQERIGDTFIIVSP

KQIRVFTGNAKASDDLCRRRKDFVKAVALYKPLEIFGRNVVTTEGDDWVR

HRRITTPPFNERNSALVWDESKRQATDMLNMWASNPKGVVNPQSDTMVLA

LHVLTAAGFGRSYKFGSGLESELENHSLSYRDALSLILGNLFTAVFTATL

NLPTWMLPSKFKKVQDAIINFRQYMAEMVAEEREAMNAGAEEQDNLMSIL

VRASENENKQGKGARHLTDTEIYGNLFSYNLAGHETTSNTLAYATVLLAA

NPEWQKWAAEEVDQVTAGVDLKDLDYETYYPQLKRVLAIMHETLRLFGAA

RAVPKTTLVDQTLKVNGTSYTIPKNTFIGVNLAGLHVSSASWGDNALEWL

PSRWITRDETEGEKMTVMPTGAFLPWAAGPRVCPGKKFSQVEFVAVLASL

LKEYTVEPDADGEGDLKTAASMALMEEAKQSSFNFLLKVKHPEKIKLRQG

PVIMSLHVHNWYLLSLSFLFIPVVTYAVSKLAGRLNTLKEVRLLKDLLVF

FLLQNSYIGQLTAEVQMNKHHEHEADGGKTQESISKTKGASWNTTQSMDM

NTIFTLPGP*

>CYP638A1 FG02114.1 AACM01000111 FGcontig1.111_scaffold1

poor match

MSILNSKLSFDLNSTTMKMNHWLETSPMAYILLSLLVLLFSTYFITTVRF

SLQRLSNRRYQGKEPSTLPYGVPGLGSALGLIRNPHGFFGSIVKNFDSGE

PIRMRLGLDHYYLIHGTRSVQHVFRCSKELTFEEFALRVAHKVKRLPERD

VALCSADKSGSARVPLIEAREEDRIWRKFHELYEHHLIGSSAVSGLTELF

VGLMNNELSTIALDGPIEVGIDHFLRKHMFRASTIALAGHGVFEVDPNFA

DVFWEYDVDFMPLLYGLPKIMCRKGWNARDKCLETTKTYLGNAWRNLDWR

AASEMNPEWEPNFGSRLVREREVAMEKYGLSLEGRASFQMGLIWSINSNA

IPMTSWIIIEILRRPEIFKRIKEEVATVFDKETKNIDIAEVRKLPLLNSV

YLECMRLRSSVFVVRKLRESIDLDGYTLKKGNLILAPSYLAHSAPEVWSS

GAHPPEEFWPERFIQKGSAGITAGNYFPYGGGVAMCPGRNYAKQEILAAA

TLFFAHFDAEPLRFVDDNGKTSDRGPEVGNEARGVARVDRDMVVRLWRA*

>CYP623A1 FG02117.1 AACM01000111 FGcontig1.111_scaffold1

32% to 512a1 looks intact

METYLLVAIALAVVFLVNHKTSPKVPSTIPRLQDSSPFLPFKLYWRYLTD

CRRLFLEAYQEFTKDGKTCVLPSMGFKDEIHLAHHHTQWAASQPDGVLSP

FEGFREIDKGDWNSGHASYIQDPWQSVVIKKEMGRFLEILASDVDDELKT

AVPEYVKPGPNDEVDVYESMKWIVAQVSSRFTVGLSLCRDKTYLKDTLEF

ADLFILNSGLLIYTPSLLKPLVGFFITLPTRYNRWKIQKHIQTLYEERTK

RLLNPELYEKSEEPTDNLQMMMKYAIDKHRDQVTLSQISNRLCLANLASF

HQTAVATSNVLINIAASNAEFNTIEVIRKEMADVLGENGVFDKASVSKMV

QTDSVLRESMRTHGFGNRAMIRKVVSPGGLKTPDGQTLPNGSTMSILSYP

VHNDPTIYEHPEKFHPFRFSQMRSEGNGANLSFVSTSPTYLPFGHGKHAC

PGRFLVDFEMKMILHHVLKEYDIELLPEHNGVRPESHWITEAVMPPVGVK

LRFKKRVLA*

>CYP617B1 FG02118.1 AACM01000111 FGcontig1.111_scaffold1

32% to 582A1 47% to FG01048

MAPIAVFLSYYRPWAAIAIVVAVYYQIIVDQNYSVKNAPFYLGKYLLGFL

SIWAVYTVFLYPALLSPLRHLPQPKPGSFINGHWAESVREPAGLPFRHWM

RTIENNGLIRYKHLFNQERILVTSPEGLKEVLGQNSYDYVKPHLLRAMVG

KILGYGLLLSEGNVHKMQRKNLMPAFSFRHIKELYPVFWSKAQELVHGIE

KEMSEAPGSQIDIADWASRASLDIIGSAGMGHEFKSLSDPSIEDTMKMYG

SMVKQSGGAKLLTVLQLVLPSMITDYLPFQRNMGVLAASKAARDTSQRLI

NAKKVQMAAKEKLSPDIISTALESGHFTDEGLVDTMMTFLAAGHETSAAA

LTWTIFLLAKNHGIQDRLREEIRQNVDGLADDVDSKKLDGLSYLHAVCQE

SLRLYAPIPFTVRDSLRDTTILGTFVPKGTMIILCPWAINRAHESWGADA

DDFYPERWMVPGQANSGGAKNNYANLTFLHGPRSCIGQKFSLAELMALTC

ALVGRYRFDIDKDYEVKDLTDGIVAKPREGLKVSVEEIQGW*

>CYP540B2 FG02138.1 AACM01000111 FGcontig1.111_scaffold1

72% to CYP540B1

MSTKRFHLLGEDPSTAQQIELPPSLDEQGLQHLVASHFAIVDPSVTNFSG

IGFVTDSEALPTVADVLAADDISITIDGKAVREVPGPSGLPFVGNYFEVY

PDHLGNHQRLFEKYGPLFKTTNMGNTIYQTNDPKLATIVFGESDFFSKRI

IEGHPLFPIKNKEAGVFVGDTDTEEWKEVHKFLPPALGPKAVRHYAPTMQ

RTVEDAFKVFDELDERDEAWNVYPYMLKLGAQAVGKLVLGMDFQHFSSPD

ARPHAMVLRIAQSLELNKKLTSMPSWYKSLPFGDPQRMREARAHMEAMMT

ESVANAAKGEGDLELQDAAVEAENMVDYVLRASDSKGNKLPRERIMEPLV

VATGAGFTTTSSLLSWLLYGLVVYPGMQERLLQELVDNGFDENTQITADL

TNKLTFLDKYIKETQRRHNPSYQPARTSAVDMILPGGYKLPKDSIVIPAL

HHIHNNTKIWDNPALFDPDRWDTDRVKNRPKDSYIPFATGPRMCVGFNFA

LQEVKVFLPKLVYRYKFNLAQDGPVEYDPMFQLIRPNNL*

>CYP552C2 FG02344.1 AACM01000116 FGcontig1.116_scaffold1

66% to CYP552C1 looks intact

AACM01000116.1 Gibberella zeae PH-1 revised

MDSKSTWETVDVRGIASFKSVATLVGVWFLYRIFVALYNISPFHPLSRFP

GPKIAAVSYLYEAYYDWWRVGRYGKVIRDMHERYGPIVRINPDELHCSDP

YFTDEIYAGPGRVRDKWQHQLNTGGAGPVSVTGFSTVNHEVHRMRKGALS

KYFSRSQMLKLEGEVRDFSQMTVDKMLRYAGGEPFDVKEAFNCFTADIIS

QYAFGESMGFIAQEGWEPNLATWVKSFFQSAYMMRHNVLARKMAQFLPFL

SDYLGEDIKAVMRQMNVVIPGYIKAALKNPDGGRVFAQVVESKTLPESEK

SLYRLSGEGFNFLLAGTETTAATLTVITYFLLDKPEIYKRLMADLDGLDP

ENLKWTDLEQRPYLWAVIHEALRVMPGVSHRSARIAREEDLVYQSQDGNT

NWVIPRGTPIGMTSMINHWNEDLFPEPDEFLPERWLENGKPNYKLQKFLI

SFGKGSRACIGEN (2)

182057  LAYCEVYIMAALMAFRVIPRARLYETTIEDLTYDHDLIVLQTKKGSISVRIAIS*  182221

>CYP59B1 FG02366.1 AACM01000117 FGcontig1.117_scaffold1

similar to CYP59

MALRWAGILLLTSISYFAIKLYQQRVWFRRTVEKYNLPTLPGHSWLLGNL

IAVGKIMVAYPADVHGQLMPDFLAREYPEIAEFGVCYIDLWPVSWPMMAT

FHPDIAAQFTQETSRPKHEIIRGQFRPLTGLKDLVLAEGSFWKKWRATFN

PGFSTQNISALVPEFIEEASIWKKYLQQVAKEDKVVRLEDSVMKATCDII

 

GRSVLGQSLGIQSGVDDKIFPTLKGAIALLVTDWSPPNWSRLLDPFRGRR

LASLNQKLRSQLKFLIESQLENHASIQGPKTVNGLAIRTYLKDTGKEDIS

KSGVDTEFLDVTIENLKIFLFAGHDTTASTLCFAYNYLHHHPDVLAKLRK

EHDEVLGPDPNSATSIISESPTILNQLVYTTAIIKETLRLEPPIGSCREG

SPTFFLRHPETGQQLPTDGFILFSASKAIHRNPKFWPNPDKFMPERWLEQ

DFHRTAYRPFELGPRGCIGQELALTELRLLLAMTVRDLEIVPAYKDEADT

LYXXXXXXXXXGYQAFQAHMPGELTAHPSKGMPVRVRLRKV*

>CYP643A1 FG02367.1 AACM01000117 FGcontig1.117_scaffold1

poor match added cyan region 2/21/06

MTNSTERLDSKAIRIAPNELHIDDVKMYKEIYNQTATYTKQPDFYAGFGT

PHSDVFAEHDLNLHKQR*RRLNPYFSRRAIGGLENLLKD

KVEQLGKRIDKQNGPYNLFNAVRCTTVDIISHYCTGEPLGQLENSD

ENFNGDFLDAFDAVSVSLWKFMYQPVFRSLMFGIPASIAKIVSRDARLMI

KLYGECHKSALNFKQNTPKSSHGTVFSSLSDLDEKDMGDEAVDLLIAGSD

TTAYTLAVAVVQICQNTQVKKKLVESLNAGISDVKNLPSLLGLEQIAYLN

ATVREALRFAIAAPGRLPRVVPRDSKPLVIDDQVIPAGSIIGMSAYTMNF

SKELWGKDAAEFNPDWWLGEDGKSLDTNMCSFSKGLRSCLGQNLAFAEMH

YILAYLFAKYDMELVDKSDNIKVHDRFTTYVTNHAIMVDMKKHKA*

>CYP624A1 FG02371.1 AACM01000117 FGcontig1.117_scaffold1

poor match in 53 clan

AACM01000117.1 Gibberella zeae PH-1 revised

probable pseudogene with stop codon and frameshift

30% to 678A1

MISDYLQLPKGYEIPILFLTPILLNFVGTILYNVFFHPLAAVPGPLACKV

CRAWLYLAERGGDGANTVAALHKRY (1)

GPLVRIGPNEVSIKDREAFVTINQK

GADF*K

DPAFYDAFSSNHGNLFTFSNVDEYS

KRKRLMSPSFSRASTEKHDAIVHATITPLVEEVALSVRKGESIDLYSVMR

RFAIKSIISFCYGNNSISPDYFESVIPKLFQVLDESPKDLLVLQHFPLLR

KSLTHLATVFPQLFPESIKFLQMVGMELLSSSRKSSSATQPGLFKEMQTL

LKVKDQSLTDDELIAESSTMFFAGTDTTATTVSVALWHLIHQPDDYARLQ

DELRTIMPDVNSGPSLRELESLPFLEACIKESLRLACPVRGRLPRIFPPE

GLEVNGFRIPARTVVSSCISYMTYDEEVFPEPWKFRPGRWLQDNSKDLDG

FLYPFSRGTRSCIGQSLSLAEQRVAISQMVRRFSPRKGMQFREIVGKELF

QTWVNTEKVNQVPVGDDSTR*

>CYP570C1 FG02419.1 AACM01000122 FGcontig1.122_scaffold1

48% to 570B1 missing C-term

revised AACM01000122.1 added C-term gc boundary after YVE

MAVAALINYLRDLRPSIAIAASLVLFLAAWTALSTWRQYIRLRQFKGPTL

AAFSKWWLVKKVGGGRAYLDFWEVTQKYGTIARVGPNDLLTDDPDLMKHI

LNVRTEYRRSDWYDGMRFNPGNNNILSHRDEDEHFKLRSKMSAGYGGREV

ENLEPKIDKNILSFISLLAKYAEAKKPMDLGRRAQFFTLDVISDLAFGEP

FGFLETDSDVYKYIQITEETLPAVMVTTVIPWLVKILSSPLFKSLLPSEK

DRLGFGKLMGIAKKVTAERFGPDKKVRKDMLGSFVAHGLTQKEAESEILL

QIVAGSDTTATAIRSTMLHIITNPNVYSKLRAEIAGTHYSEPIIPDSIGR

DLPYLQAVIKEGLRIFPPVAGLMSKQVPPQGDTWKGQFIPGGTKVGYCAW

GIFRREDIWGSDAGEFRPERWLESDPEKLKEME

GALELIFSYGRWQCLGRPVALMELNKIYVE (0)

LLRRFDFSICDPTKPWKVFNCGIFSQSELMVRVTER

>CYP528A2 FG02458.1 AACM01000122 FGcontig1.122_scaffold1

same as 528A2 Gibberella zeae anamorph: Fusarium graminearum

MAIYFSFFFAWMMTLGSLLPMSLDLDSLPFQVYGTPIMLAMDAWRTLERL

FIDDTDLLCALDRMKFGSIPRKLFMRFTAVEVVMKSRTFIRRLIGPVYQT

SSLIQYEAAVDEVLARTVAKLKSLKGAQVELNEWMHIIAVECLGAIVLSW

SPSMLKNGTDNGSGTHAYHGWRRKSVFGLFPLAAKLEFLSKSTGRLFSTI

WGVNFQPPKDFRPFFPDVGKRASRRINAATKSKHHKDDRQDLLKDLISLH

KSKPEFTVNYLRKMVITNFGAGHETMASTLTSIIAMLGSNNDIQEQVSRE

ILETHNPADYSTATRLPKTQCLIKETKRLYPVISMSLPRTVPAGGLHLHN

NYFPPNTTVGCNPVALHRNPEIFGSDCNEFKPDRWLTADSDAARNMERVS

LSWGGGARTCPGRHLAELVVFKVIPALIKEFSIEAIVPPEDENRSYFLSM

LTSVKPIATENALISGSRVAYGIYGKGKPVVLLHGTPSSSLIWRNIVPKL

VDAGYKVHLFDLLGFGLSERPWNLAVDTSMTGQVSILEGFLELWGLEKTH

IFAHDIGGGIAQRFSIFSPERVLFLTLIDVVSFGSYPSKQTKKQMQKGLE

TLIKTDKNEHRAHFRE*

>FG02668.1 AACM01000132 FGcontig1.132_scaffold1

very poor match linoleate diol synthase not a P450

MSFNEKYQAGESYKDTSKEDPSSLLDNPEKLVADLMKDFAGVRSQASPAD

LLALVKQLLSKGQPLDDKKGVRTTELLIGILTALPRSSKARTALTNKLID

TLWGNLQHPPLSYVGGDVKYEVAGAEPDHKSHCAQYDTIEFQVPGTNVTL

KEQVPQAPDGLHQYRMPDGSFNNILEPNLGKAGTPYAKSVRTEKRLHGVK

PDPGLLFDLLMARDEGSFKENPAGISSMLFYHAAIIIHDIFRTNRTDMNK

SDTSSYLDLAPLYGSSLKDQLEIRTMKEGKLKPDTFHEKRLLGQPAGVNV

MLVLYSRFHNYVADILLKINENGRFSMSTPPNATEEEKAKAIAKQDHDLF

NVARLITGGLYINICLHDYLRAITNTHHSASDWTLDPRVAIDKQFDGEGV

PRGVGNQVSVEFNLLYRFHSCISKRDERWINGFFLKLFPGRKAEDLQDVS

WTELGQALMTFEANTPKDPSVRTFDGLERQADGTFKDEDLVNILKTAMED

PAGCFGARMVPKALKVVEVLGIIQGRKWQCASLNEFREFFGLKRYNQFSD

INSDPEIANILEKLYTDPDMVELYPGLMVEDIKPQRNPGSGIMPTYSVGR

AVLSDAITLVRSDRFNTIDYTVSNLTSWGYNEVQQDYKTLGGSMLYKLIQ

RGVPNWFPYNSVAVMQPMYTKSANEKIAKEIGTFDQFTTDDPKPPAKVAV

TMSNETIKKVLSNTKQYVVPWLKPLNDLFPGKKEYGWFMLAGDEAKNYQH

RADWTKALKKVPNLHDAVHTFIEREGARLIKKESFTFKKGLDQIDIIRDV

AIPLNAQLLSDMFYFDMRTDENPDGELGAAELYRSLLDIRVWGVNNNDPG

QAWNRRRRAQEGVKRIYDSTKKLVSEVEVARPRGIGLISAVSNRIGAKSY

LKKDSLRSCGLKLVEELLAQGSSIDHVTDNLWLTAFGGIGVPVTAFYEVL

AFFLRPENASIWAEVQAIAQKGDDATLHAYVAEALRMTSSQRNVRISKTP

GEVDGQSIAPGTAVVLMLGEAGRNPKEIPDADKFNAQRKQQEVSAFSYGQ

HECVAKDVALAFVTGLIKLVADLKELRPAPGQMGTVKTIRVGTEKAYLND

SWSYLGFDASTWKVHFNGHGKGNFEGDRVPTSNTPIQEYYSLLQKRKDEL

LRR*

>CYP68J1 FG02672.1 AACM01000132 FGcontig1.132_scaffold1

45% to 68E1

MICRALDASTVCSYKTQHSSSMATDLDLVLGKSQYALFCGITLFSFFILK

YSLLGNGGKQYPYINPKKPFELSNQRVVQDFIENARDILTKGRSLYKDTP

YKAHTDLGDVLVIPPEFADALKSERQLDFTEVARDDTHGYIPGFEPIGSP

FDLVPLVNKYLTRALAKLTKPLWAEASLGVNHVLGTSTEWHPINPGEDIM

RIVSRMSSRIFMGEELCKDDDWLKVSIEYTVQLFQTADELRNYPRWTRPY

IHWFLPSCQGVRRKLQEARDLLQPHIDRRNAVKKEAIAEGRPSPFDDSIE

WFENEYEGKSDPATEQIKLSLVAIHTTTDLLSETMFNIALQPELLGPLRE

EIVTVLSTEGLKKTSFYNLKLMDSVIKESQRLRPVLLGAFRRMALADVTL

PNGDVIKKGTKIICDTTHQWNPEYYPDASKFNAYRFLQMRQTPGQDKRAH

LVSTSHDQMGFGHGLHACPGRFFAANEIKIALCHMLLKYDWKLPEGVVPK

SKALGMSLLGDREAKLMVKRRAAEIDIDAIGSDE*

>CYP620A1 FG02837.1 AACM01000142 FGcontig1.142_scaffold2

36% to CYP64A1 42% to FG03700.1

MTGASILYFSALAFTTYLIFKYLQQRSKEPLPPGPKGLPLLGNVLDLPPP

GTIEWIHWQKHKEKYGPISSVSVLGQLFVILHDKQTIMDLLETRSLKSAS

RPKLVFAGDVVGYDSIMGMMPYDRTFRLHRKLTATQVSGKSIGRFEPIQE

LEISRLLKRIYNDHNSDNLPEHLNQVSGSIMLRILYNYETDPNKNDHIVS

MANTVMEEFSKATSPGAWAVDLVPWLKYLPEWIPGAGFKKTAKVFRDHLL

QNVKDPYNYVRDQMARGNDHVSYVAGLVEDIHRKIDPEEESVIQWTAASM

MNAGTDTTGATLLSFFAAMVIYPDVQKRAQEEIDRVVGHSRLPSFADKAN

LPYINSIAQEALRWHTLAPMGFPHMTTENDIYKGYFIPKNILLFPAVASV

THDPDVYHDPMAFKPERYSEPYSEPSPADVVFGFGRRACPGKWIAEQTMF

LIIAQTLATFNIEKDLDKDGREIDVVYEQLPGVISRVKPFPHRIVLRSEV

fused to another gene

NSQAIYCCLALSPFRDQLPTQHVLSSTMSKQTCDVCGTFLSSAPDTDAQK

CLGHVRLARCRPDESFATLAVGYPVNGEFTVPEDVTARISLRESGPGLEQ

HPDDRVSLLDIFHEPCWNMLLDYWLGHPREPNSRHLINQPETIPCIVPGQ

PTLGFNMYFGGLDGSWLPRLIQVSVLTTPNTDVLRGLGFYYTDGSCKRYL

IPGANAAFRGSRPYHEIGFLLNGPEGERINALVLEKFNDEVDLKAITNFH

RVFKVSQADKEKEARLKGQIYKPLIKRTEVPDGLTLVAILATVKLSVSHE

TIETLGTSCIQDQRSTSLGPNRHQGEPLAITLPRWERTVNTCPSDISMTM

VRLEGIKRIGISTATFGKTPAQRYISGLCFEFWDTIPLIYLGYFYKQHDY

LNLEDGDEIQDIKCCVAGNFMTVKKQPRDPLEERLVSDFDAADFDIAVSV

TSEELFWEIEDSKAMVRAVTHIHTYFHAIVKQSLCGFEFGYEDFVFHTTA

AREITLSPSRCRTRELVPAPSMDDILAQVLAGTEVPSGEATQNPTVQEPE

SPVLPECHWLNAQAYDEPTYGEDEYRKVCQAVQSKSKRPSVGMYVEMTYH

PTRERREVMNAVPLFFAPCT*

>CYP634A1 FG02872.1 AACM01000142 FGcontig1.142_scaffold2

31% to 610A1 looks intact

MDSHSSSFLGQTFLDLRNGDLSSSSAWTTAAIATAIALSLLNYFLTPRLD

PREPPVVKPTIPWIGHILGIIRHQADYGRLIHNANPNHQIATLPMLNGKL

YAVFDPSLLQSLLRNKTASFEPFAIDYAKKTFDLTQEEFLKVKAPGVYDE

FTDAIHASFQTVSLHQMNVHFLACISAKLDPMSNGTMRAHADTHGKEKVT

NGQLQVENLYLWCRDVMSLATTKALYGDTDPFGSKPDLIEDMWCFEESVP

YFLLSLYPSITMPKAYKARSTLQDIVCKWYSEDHDVTDPSVSAIVRNRAG

SLRKNGLIGSEIGKFEVILPNVATLNAVPTFYWLLLYILDRPELVARIRS

EAEAAAVIAHDNGKKTVTFNIAEYEAKLPLLVSCYRETMRLVNQSVSMRR

ILEDITVTTPEGNTYLLKKGTDMQLPAGVAHYEQSVWGSDVNTFDPERFH

PGSKGSPEEERKRKAAYIPFGGGRHLCPGRNFAFAEIIGFASSLLLGFDV

EATGMGFGDMKKLGPQLAGGTVRPEKYGSGLGAQIKSRQGWGNVQWKFEC

*

>CYP570C2 FG02929.1 AACM01000143 FGcontig1.143_scaffold2

43% to 527C1 45% to 570B1 60% to FG02419.1 570C1

MGFIQLDSRGFALVGLLVFVAYVVATLRQWARLRHFKGPALAGFSQLWLI

SCVGGGRTHLDLWEACKKYGDIARVGPNDLITSDPDLMKHMLNVRTLFQR

SNWYDAMRLDPTKDNVLSQRNDDLHASTRSKMVGAYSGKEVDNVETTVDT

NVERLIDLLDTKYIAKNKAFDFGYKAQYFTLDVISSLAFGEQFGDLETDS

DVNGYIKAMEESMPTIIVTTVMPWMMKLLQLPVFKSMLPSEKDKVGVGRV

MAIAKRVTADRFGPNPKEHRDMIGSFIARGLLQHEVESEILMQILAGADT

TATAIRATVLYILSTPRVIEKMRAEIDQARPSLPVITDSEARAMPYLQAV

VKEGLRIHPPVVGLMSKEVPAGGDTFKGKYLPGGTKIGYCAWGIFRRRDI

WGEDADEFRPERWLESSEEQLHLMEGTLELVFGYGRWQCLGKTIAQMELN

KVFVEQVFIIASPAELVV*

>CYP531C1 FG02982.1 AACM01000145 FGcontig1.145_scaffold2

46% to CYP569A1 49% to 531A1 (same family combine)

MSKHTLYETSILGPARNIFSLVSPSVFLLLVVPASTLSLWTLASYFTSPL

KKYPGPFLAKFTRLWYMYQASTGDSHLVLERLHKRYGPIVRITPDIIDVD

IPEIINTIFSTKDDWLKTPFYHGSSALVNGHIVLNTFSQTDPVKHKKGRQ

PIAKLYSSAGVSTLEPHMNKVINQLCDELEKRFTGHNAGQVCSLGQWILF

YAWDVVGAITFSQPIGYLKKGCDFDGTLKNADKAMDYFTVVGTMPFLDRI

FDKNPVFHMGPPGFNTSTEISVKHLIDRYQGNDKENHDPAHPDFLDKFIE

IKNSKPDEADDAQIISWLMVNMIAGADTTAITIRSVLYFSLKHPRVWKRL

TEEILRAGFQQVPAYKDVKALPYTDAVCREALRMLPGVAMTMERFVPKEG

FVLPNGDFLPGGTIVGMNPYIVARNKSVYGDDADDFRPERWMRSEDETEE

QYQIRLLAMNQADLSFGGGSRICIGKYIGLFQTYKVIAILLTRFEIELAD

PNKEWKVTNSWFPRQEGLEARIRKRTGSRLPKSSY*

>CYP573A2 FG03008.1 AACM01000145 FGcontig1.145_scaffold2

62% to 573A1

MALLSIVNVALLGVAYFVACAVWQVVKYRFLHPLAKFPGNFWGSVTRLWI

TYHNVEADECETFQELHKKHGPIIRITPTMLLVSDATELPKIYNRHANKS

KHYITGSFGKDESLFNMQDSVMHAKYRKVAAPLYSLTNIKKMEPLIDNNM

SAWMSRLQRDFAATNKPFDFAPFSVYLAYDVISEVGFGAPFGFVKEGKDV

EGLIQGFHDGLTPFGIMARLYPFTNWVKSTFLGKYMVASPEQDSGIGILM

RFRDRLIEQRFKDIENGSTGGRIDLLQTFIEARDEDDKPLDINYIKAEIL

LVLLAGADTTGTAFQAMMVHILTNPSVYKKLLAEIDEATAAGNLSEMPQY

DEVVEHLPYYIACVKEAMRLTPSAPNIFPRIVPQGGLEICGHFVPEGTEV

TCNPWLVHRDPNIYGDDAEIFKPERWLDADKAKIYNKYSMGFGYGPRVCL

GQDIARMELYKGPLLFLRSFNVEWVDETKRGKYVINGGQMLHEVSCQYPC

SFLLMIENMAYQPIYTHWISKDVVSSQSRLEAACEAIFPRDGSGKRTCEL

IVDPVERPGYVKINSLSREPSNLMVELRARGGDNGLEPEIKVEPQA*

>CYP628A1 FG03086.1 AACM01000147 FGcontig1.147_scaffold2

32% to CYP67 looks intact 33% to 574A1

MAGPQAYSPSDEQCEVMEPPTMTFSSISLDSAESLAILFFLGVASHVLAF

RKGEWDMWTMPFICTWITYQAVTPCALNQLRHMAYFDAMILANKWLFSFL

FGMTSSILIYRGFFHRLNKFPGPFVARLSNVYASWLAIKEEHMYLEVQKL

HQKYGDIVRIGPQELSIATPSAFRILHANNSPIVKGPFYNVARPCVNLLA

DRNKKSHAQRRKTWDKAFTAKALRDYEPRVVRYTKQLTEQIEKTKGNPIN

IGAWINFYTFDIVGDLAFGTSFNYLVNGVKDKFLRDSHDSQVLMGYFRQC

TWLFEVFKETPLLNNSWLSFQSWLKQKVEARRQNKPSEPDVLSWILEEYD

SIENPTKDDYLRLCGDAHLIAVAGSDTTSAATSILLHQLTLHPHVLKKLQ

AEIDEYQANYEKPDHFSMTKLQYLQACIDESLRLHPVIMSGLQRMTPPEG

MQIDDVFIPGDTIFHAPSYTIYRDERCFVRPLEFIPERWTTQPELIIDSS

VYAPFSTGRGACAGKQLGLMEMRYVLTEILSKYNMSFAPGTNPEAFIDGL

RDCFTLELPELNMIFTPRGEKSHQTVPY*

>CYP65R1 FG03191.1 AACM01000148 FGcontig1.148_scaffold2

45% to 65K1

MFSALTALAGSLVLYIICTSIYYITFHPLASIPGPKICGITRIPYWLVAF

RGEDVRWMKTLHDKYGPVVRFGPTDVSYAATQAWNDIHGPKDSEKAQEFS

VQPVNGVPSMLTTDVENHTRMRRLFSPAFSERALKKQEPLFKKYSELLMY

KISEVGDNGAKPVEMCQLLNFTTFDVMAELCFGDHLDLLAKNEYSPWVRS

IFESLKMLPIASMINYYPILNALFTRFEPKSVTQQRVTHCKHSEERVNRR

LENGSDQPDVWNLVLEAKEGKGITVKEMHSNAELFMLAGSETTATLLSGC

LYYLLSCPDKMDILLKEIRSKFDKVDDITFERLAELKYMNVCIKEALRIY

PPVPIGSPRVVSPGGQQILGKYIPAETRVSVHHWSTYRSESNFKDADKFV

PERWLKTEARYAGDALEAHQPFGFGPRNCLGQNMAMHEMRLILTTLVFSF

DFELCEESKNWADQKSFALWIKNPLMIRATPVTTHARLNI*

>CYP5080A1 OLD NAME = CYP532B1 FG03260.1 AACM01000150 FGcontig1.150_scaffold2

40% to 532A1 36% to 532C1 55% to 532B2

MAIPTSTLLAPAIIIFLILHVLLRALFSPFRTVPGPFLARFTDAWYFWNI

RKGSFQQVNIDLHKKYGPIVRYGPNRYSINDPEAAKTIYGLGNHFPKSSW

YSAWASPGQWXXXXAIFSDQSIERSTQNRKMYSATYAMSAQVHYEHFVDECTEL

FTQRLSELSTSDSNLFVDMRHWFQCYAFDVIGLITYAKRIGFLDRGEDVR

GVIEALEDHMGYATLCGIFPSLHQFLFPLRNYLAGSKGAGRAYVVSFTNXXXXE

RIRESQTSPKPVAAENEVTTQDFLTKFLAKNLADPQNFTQHHVLMGCTSN

MVAGSDTTAISLSALFYHLIKNPSCMEKLRNEIDQLTSRGELSKAPTFKE

SQQMTYLQAVIKETLRIHPATGLPLERVVPEGGATIAGRFFPENTIVGVN

SWVAHRNKNVFGEDAEVFNPDRWLTQDTARLSAMNRYYMPASILYHNFGL

GSRTCIGRHVSQLEMSKLVPRLIRDFNFELDPSLPGGNWSTWNYWFVKPV

DFKVGISLREPKVYA*

top 532C1 bottom 532B1

Query: 20  LVTFFFGLIILSYVHGRFRSGLANIPGPPVAKWTKLWRLYDVYKGQSHHTAIRLHQQHGP 79

           ++ F    ++L  +   FR+    +PGP +A++T  W  +++ KG      I LH+++GP

Sbjct: 13  IIIFLILHVLLRALFSPFRT----VPGPFLARFTDAWYFWNIRKGSFQQVNIDLHKKYGP 68

 

Query: 80  LVRIAPNVVSVGDPQAIKTIYGLAGAFTKTAFYPIQSISWQKKPQMNLFSTRDPVYHRDQ 139

           +VR  PN  S+ DP+A KTIYGL   F K+++Y   +   Q      +FS +       

Sbjct: 69  IVRYGPNRYSINDPEAAKTIYGLGNHFPKSSWYSAWASPGQWXXXXAIFSDQSIERSTQN 128

 

Query: 140 KKKVAGAFSLTNLLESEDAIDSCTELFISRLDQWAADGKR--IDLGMWLQYYAFDVVGEV 197

           +K  +  ++++  +  E  +D CTELF  RL + +       +D+  W Q YAFDV+G +

Sbjct: 129 RKMYSATYAMSAQVHYEHFVDECTELFTQRLSELSTSDSNLFVDMRHWFQCYAFDVIGLI 188

 

Query: 198 NFAQKLGFLATGGDVDGMIKTIEGIIAYSSICGQIPEMHNVLLGNPLFPILLPSMENWNA 257

            +A+++GFL  G DV G+I+ +E  + Y+++CG  P +H  L   PL   L  S     A

Sbjct: 189 TYAKRIGFLDRGEDVRGVIEALEDHMGYATLCGIFPSLHQFLF--PLRNYLAGSKGAGRA 246

 

Query: 258 -VLTFTLKAINSRTSMKRDGELELPDEG---GKDLLSKWAAVKNKDPLKMSTRDAIVHLS 313

            V++FT      R    +     +  E     +D L+K+ A    DP   +    ++  +

Sbjct: 247 YVVSFTNXXXXERIRESQTSPKPVAAENEVTTQDFLTKFLAKNLADPQNFTQHHVLMGCT 306

 

Query: 314 ANVFAGSDTTAIALRAVIYFLIKNPDKMTNVVQEIDAADKNGNLSDLISYKESTSHLIYT 373

           +N+ AGSDTTAI+L A+ Y LIKNP  M  +  EID     G LS   ++KES   + Y

Sbjct: 307 SNMVAGSDTTAISLSALFYHLIKNPSCMEKLRNEIDQLTSRGELSKAPTFKES-QQMTYL 365

 

Query: 374 KAAIKEAMRLHPSIGLLMERHVPPQGAEICGHFFPGGTIVGINPWVVQHDPKVY-EDPEA 432

           +A IKE +R+HP+ GL +ER VP  GA I G FFP  TIVG+N WV   +  V+ ED E

Sbjct: 366 QAVIKETLRIHPATGLPLERVVPEGGATIAGRFFPENTIVGVNSWVAHRNKNVFGEDAEV 425

 

Query: 433 FKPERWLTSDAELLSKMEASFFTFGAGSRTCLGKHISLMELHKVVPQLLRRYHIVL--AD 490

           F P+RWLT D   LS M   +  FG GSRTC+G+H+S +E+ K+VP+L+R ++  L  +

Sbjct: 426 FNPDRWLTQDTARLSAMNRYYMNFGLGSRTCIGRHVSQLEMSKLVPRLIRDFNFELDPSL 485

 

Query: 491 PDADWEVKNRWFVQ 504

           P  +W   N WFV+

Sbjct: 486 PGGNWSTWNYWFVK 499

 

top 532B1 bottom 532B2

Query: 28  SPFRTVPGPFLARFTDAWYFWNIRKGSFQQVNIDLHKKYGPIVRYGPNRYSINDPEAAKT 87

           SP R VPGPF+ARFTDAWY +   KG F+Q N+ LH+++GPIVRYG NRYSI+DP A+KT

Sbjct: 28  SPLRQVPGPFVARFTDAWYLYRTWKGHFEQDNLALHRQHGPIVRYGVNRYSIDDPLASKT 87

 

Query: 88  IYGLGNHFPKSSWYSAWASPGQ-WAIFSDQSIERSTQNRKMYSATYAMSAQVHYEHFVDE 146

           IYG G+ F KS+WY AW +P   W +FSD+SI+  ++ R+ Y +TYAMSA + YE +VDE

Sbjct: 88  IYGPGSKFAKSTWYDAWTAPDSPWNLFSDRSIKHHSEARRQYQSTYAMSALIGYESYVDE 147

 

Query: 147 CTELFTQRLSELSTSDSNLFVDMRHWFQCYAFDVIGLITYAKRIGFLDRGEDVRGVIEAL 206

           C ELF+ RL+ELS   ++  V++ HW QCYAFDVI  ITY+KR+GFLD+GED+ G+++ L

Sbjct: 148 CAELFSCRLAELSQGGTS--VNIAHWLQCYAFDVIASITYSKRLGFLDQGEDIAGLMQTL 205

 

Query: 207 EDHMGYATLCGIFPSLHQFLFPLRNYLAGSKGAGRAYVVSFTNERIRESQTSPKPVAAEN 266

           +  + +ATL GI+   H  LF L + + GS   G  +V  FT   I + + +P+ V  ++

Sbjct: 206 KSSISFATLVGIYSRWHPILFRLVSLVPGSGSNGFLHVERFTRSCINDCKANPRAVHDDH 265

 

Query: 267 EVTTQD---FLTKFLAKNLADPQNFTQHHVLMGCTSNMVAGSDTTAISLSALFYHLIKNP 323

           E ++ +   FL KFL K+  DP+ FTQ+H+  GCT+NM AGSDTTAISLS++ Y L+KNP

Sbjct: 266 EKSSDNGISFLHKFLDKHQKDPEKFTQYHIFSGCTANMAAGSDTTAISLSSILYFLLKNP 325

 

Query: 324 SCMEKLRNEIDQLTSRGELSKAPTFKESQQMTYLQAVIKETLRIHPATGLPLERVVPEGG 383

             M+KLR+EID     G+LS+ PTFKES  M Y Q VIKE LR+HPATGLPLERVVPEGG

Sbjct: 326 QSMKKLRDEIDSKQKEGKLSECPTFKESPDMPYFQVVIKEALRMHPATGLPLERVVPEGG 385

 

Query: 384 ATIAGRFFPENTIVGVNSWVAHRNKNVFGEDAEVFNPDRWLTQDTARLSAMNRYYMPASI 443

           A + G+ FP+ TI+GVNSWV HRN  +FG DA+ FNP+RWLT D A+LS MN+++MP  

Sbjct: 386 ADLCGQHFPQGTIIGVNSWVQHRNVGIFGPDADTFNPERWLTDDPAKLSLMNQHWMP--- 442

 

Query: 444 LYHNFGLGSRTCIGRHVSQLEMSKLVPRLIRDFNFEL--DPSLPGGNWSTWNYWFVKPVD 501

               FGLGSRTCIGRHVS LE+ KLVPRL+RDF+FEL  D +LP   W   N+WFV   +

Sbjct: 443 ----FGLGSRTCIGRHVSMLEICKLVPRLVRDFDFELAGDLALPNSEWELKNHWFVFQNN 498

 

Query: 502 FKVGISLR 509

           F V + LR

Sbjct: 499 FFVRVRLR 506

 

>CYP632A1 FG03264.1 AACM01000150 FGcontig1.150_scaffold2

poor match in 53 clan

MTISFFATRDNKVHRFLRSRVASTYSMTSILSMESLIQDVLDLNLKKLGE

RADEGKKFEVDKTVNYYTSDVVSQLALGGMVGCVEQQKDIGGIIQSVHDG

FYFMGNLGVLPWQMFWINNPVSKWLTKNFGGDRLNGFDIFLDWLDNRVEE

RMINGLLPNQRRDILQNFIEAKDPHGQPASKEEVMIEGVNVLAGGSDTTA

FGILSCLRHLLTSPDAKAKLMEEIDHAYEELGLTKEGREISFKQAEKLPY

LSAVITESNRVQPSIQYQLPRTVPSEGAQVGDYFLPPGTTCGTSSRAVNC

SREIFGPDAEEFRPERWIAQGPDDEARIRKEKSLLMTFGMGSRSCIGKNL

AIVELHLYIAQFFRHFDAEVAKSAKPWGIKSQWLTFHHDFVITITRREH*

>CYP637A1 FG03498.1 AACM01000159 FGcontig1.159_scaffold2

poor match

MLREILYGAAGLVLFAYTLEWLFSMSDDPREPKRLQSKIPVFGHLIGMMK

YSSGYHGITSKQTDQEIYTVAIFNTKLYVAKTARLIPLIQRSKTLSFRPF

MQTAAKHMGDAKPATFEIFGSEWVDSFSHAHKHSLAPGPSLDEQNSRMGD

RALIDIEELLPREKNGMNKVSLLEWVRLTEKLTEFRKWQDYMPLHLINLD

ITKKGYAAREIVFDAFRKYNTNIPTDVSAVYMARQRTMQEAGIDEDDICK

QQATFGTAAFANTVPILYWTIYELFSRPELLEEVRREVIEHAVSRNKETG

FVVDVAALKTQCPLLLSIYQETQRTRHVHANIRKVTEDTLLDDKYLLKAG

QFVMMPGHPVHTNQTTWGESADVFDPYRFMPKDGSDKKAIASSSFMAWGA

PPHLCPARQFASTEILIVVALLVVRCEMSPASGQWVRSPTLNTGDMATIY

TPKKDVELEVRRTEEWDGEWSLRMGGSKTRVSLASG*

>CYP58A3 = OLD CYP579A2 FG03535.1 AACM01000159 FGcontig1.159_scaffold2

100%

MIDQDWIKSLLNIPVSHVAGIFAASTVIYFLSSCFYNLYLHPLRKIPGPK

LAAIGPYLEFYHEVIRDGQYLWEISKMHDKYGPIVRVNAREVHIRDSSYY

TTIYTAGSRKTNKDPATVGAFDVPSATAATVDHDHHRSRRGYLNPYFSKR

TITNLEPFIHERVTKLLTRFQQHLDDDQVLSLDGAFCALTADVITNRFYG

KHNDYLSLPDFHFVVRDGFLGLTKIYHLARFLPGLVTILKRLPYSCIRMI

APSVCDLLQMRDEIQDRGGEEFLSNKSHEAKSSILFGALADSHIPSHERT

VERMLDEGTVILFAGTETTSRTLAITVLYLLTHPECLKKLREELNSLPPV

KDGQYSLATLENLPYLNGVIHEGFRLAFGPISRSGRVATQENLKYKEHVI

PKGTPISQSTYFMHTDPKNFPEPEKFKPERWIEAQQKGIPLKKYITNFSQ

GSRQCIGYTMAFAEMYLALSRIARAYDIELYDTTKADIDMTHARIVGYPK

AIPGKKEHLGEVRVKVLKAL*

>CYP65A2 FG03540.1 AACM01000159 FGcontig1.159_scaffold2

90% to 65A1 42% to 65F1

MFQYSLWPLLALSGGTAVAYFLVMLVYNLFFHPLRNYPGPWLNTMTQIPH

TLLMLCGLPHKRHLALHMKYGPVVRIGPNMLSFNHPDAMKDVRGHRKSGE

AEHGKDPIIVLSNGDNIVGSDRENHTRFRRALAYGFSAQAMLEQEPTFKA

YVNQLFQRLHEQSSSGIKPVDISKWYTFTTFDMIGDLAFGESFGCLDNST

YHPWVALAFESLKSLAFMAEMGRYPRIAPYIGFLLPRGLLTKFAENKELA

SMKVRKRLDTETDRPDFVGKITQGLKAKGSRMEFNELASNASVLIVAGSE

TTATLLSAAVYFLCSNPRTLELLTQEVRSTYTQADAIDLVSTQGLRYMQA

VLDEALRMYPPVAGGGSPRKIAKGGSFVAGYFVPEDTLVENDMWAMHYDP

KYFTRPNDFIPERWLGDARFSSDRLDAVKPFSIGPRNCIGMNLAYAEMRM

MLARTVWEFDIRLAESSRDWYQDSRVYLAWNKPPLNVYLDPR*

>CYP540B3 FG03548.1 AACM01000159 FGcontig1.159_scaffold2

65% to 540B1

MSTKQFYLLGEVVSTARDIELPPAVDFEELQXXXXXXXXXXXXXXSVGFIHDGRKLNAVSEILE

VNESIAISVDGNAVRDVPGPAGIPYFGNYLEIYPDHLGNHQRLFEKYGPL

FTTTSMGNRLYQTNSAELSNIFLSEDHYFTKDIVPGHPLHPIKNQEAGVF

LADTNTEQWRLAHKFLPPALGPKAVRHYAPTMQRTVESSFKVFDELDQKG

EAWNVYQYMLKLGSQAVGKLVLGMDFAHFEQVDSPLHEMVLKIAENLELN

KRVSSMGAWYAQMPFGDPKKVRQTMARIMEMMDESIARASKGQEDLELQD

AALKADNVVDYFLRATDNKGNKLPPSQFAPALLVATAAGFTTTSSLLSWL

IYSLVKYHGNQERLLQELIDNDWDENTQVTADTTSKLTFLDKFIKETQRL

HNPSFQPGRTAKVDMILPGGYRLPKGAVVISALHHMHNNKDVWENPGRFD

PDRWDTEQVKNRPPGSYIPFATGPRMCVGFNFALQEIKVFLPKLVYRYKF

SLAQDGPIEYDPYFQLIRPNNLYVQAEKRVKWPPKSE*

>CYP61Ax FG03686.1 AACM01000161 FGcontig1.161_scaffold2

54% to 61A1 prob. error in Mg seq

MASLLDCGAGLASANASFSTATDLSQENGLFSSWFERCSKTQIAVTIFAV

LIAYDQFMYIWRKGSIAGPAFKIPFMGPFIQALYPKFDAYLAQWASGPLS

CVSVFHKFVVLASDRDIAHKVFKSPTFVKPCIVPMAETLLRPSAWVFLQG

RAHTEYRRGLNGLFTNKAISTYLPAQEKVYDDYFERFVAASEANKSKPMA

FMRLFREINCALSCRTFFGDYISQDAVEKIAEDFYQVTAALELVNVPLSV

YIPFTKCWRGKRTADAVLAEFASCAAACKANMAAGAEPKCIVDQWVLHMM

ESKRYNDRIAAGETGAEKPKNLIREFTDEEIGQTMFTFLFASQDASSSAT

TWLFQILAQRPDVLDRLREENLSVRGGNKETPFELSMLESLPYTNAVIKE

LLRYRPPVIFVPYEATKKFPVTPNYTISKGSMIVPSCYPALHDPQVYPDP

ETFDPERWITGDAESKTKNWLVFGAGAHDCLARKYVPLTMAAMIGKASLE

LDWVHHATSQSEEIRVFATLFPEDECQLVFTRQG*

>CYP620B1 FG03700.1 AACM01000161 FGcontig1.161_scaffold2

38% to CYP64A1 42% to FG02837.1

MGLLLLPAVALAALIVYYVLFPKKQTGLPLPPGPKPLPIIGNLLDLPPAG

TAEYKHWAKHKELYGPISSLNILGQPMIVLNSPDAMHELLEKRSTKTSSR

PSATFGGELCGFKVMLPLIPYGDKFRYFRKLVHQQMGTKLICSEFRDTQD

LESLRFLIRNLERPEELQKHIKTEAAAIILRIIYGYSIEPRKVDPLVSLI

ETMMIHFSDAFVPLSWAVDIFPSLNNLPDWFPGTSFKKTAREWRRVTDQS

LDVPYDFVMKQMSTGTNRPSYVSNLMSKSFKNDQGTGKPTKEDIDAVKAT

ATIMYGGGADTTVSTISSFILAMIKFPEVQKKAQAEIDRVTGGERLPNFD

DEKDMPYIRALCKEALRWMPVVPTTTTHMTEEELEYGGYRIPKGTYLIPS

TWALLHDPEVYHDPSAFEPERYIEPRNEPDPAEYAFGYGRRICPGRYLAE

DSIFMTCVRLLAVFNMRKAVGEDGKEIDVVVDGTPGLISHPVDYAYSITP

RSDKHVELVRAAERAHPWEESDAPSLPKDSLV*

>CYP504A5 = OLD CYP504A3 FG03741.1 AACM01000162 FGcontig1.162_scaffold2

68% to 504A1 revised sequence added in bold

MSDQILYVTVLVGLLLLYRLANSTDKPKIKGIPEIPGVPLFGNLFQLGTD

HARVARKWVAKYGPVFQTRLGNKRVVYVNSYDAVKHFWITHQSALISRPM

FHTFHSVVSTSQGFTIGTSPWDESCKARRKAAATALNRPATQSYMPILDL

ESFVSIKELFDDCEKGTKDLDPSPYFARFALNTSLTLNYGYRINGDVNSE

LLHEITHVEREISNFRSTSNNWQDYVPLLRLWGAQNSSAG

EFRARRDKYLTDMLNHLKSRIAEGTDKPCITGNILKDPEAKLNE

AEIKSICLTMVSAGLDTVPGNLIM

GIAYLATPHGQEIQAKALEEIYKVYPNGEAWERCLVEEKVPYITALVKEI

LRFWTVIPICLPRVNIKDIPYKGATIPAGTTFFMNAYAADYDESRFAKPF

EFNPERYMDDKEIGTPHYAYGAGSRMCAGSHLANRELYTAFIRLITAFEM

VPPKDKSDEAIMDSIECNAVPTSLTTDPKPFKVGFKTRSESRLREWIAAA

DERTKELR*

>CYP633A1 FG03796.1 AACM01000164 FGcontig1.164_scaffold2

poor match

MAANPSGFLSFIAEDLQQSPGNYFTVLGVLFVTVLLHRLSTPSLETGEPP

LLKPKFPIVGHFYGLMKYQNVYLKQLYDKYHRQIATLPILGGKLYVIFDP

AIVQSAYRKKTLSFEPFAAEFAQRELLLSDRVQDKLKNTNLVPDFFAAIH

PAMTGDHLHRMNANALNYISKDINKISGQGSLEHANLWLWLRDLVTMATS

EALYGSKNPLRQDRSLLEDVWTFEAGLNMLLVNIFPAITAPKAHQARARL

QAALGKYYGARSYEDEDAAEIVRGRAGAFVKYGVPDEEVGHIELALLHVG

TANTIPTLYWFFANVFNRPDLVLKLREEVSQVVQKDGGNKVVIDVSILDE

KCPLLVSCYRESLRVSNQATGNRRVLEDTTVTDNKGNSYLLKKGENVQVS

AAVSHNLDAWGEDASTFRPDRFIETKDSNDAEKTRRSAFIAFGGGRNLCP

GRNFAFAENLGLVACLLAGFDVTLPDGPKLPASVDCSFAQAAVRPAKDGA

GFGVRIERRLGWQETQWSFKS*

>CYP639A1 FG03850.1 AACM01000166 FGcontig1.166_scaffold2

top part = catalase peroxidase

MHAKTLLLAAGLAQLASADCPFAAKRDTQQNLLPPREIAEDFGRCRIASN

QAGGGTRSTDFWPCQLRLDVLRQFSPQFNPLGEDFDYAEAFKSLDFEALK

KDIHALLTESQDWWPADFGHYGGLFIRMAWHSAGTYRAMDGRGGGGMGQQ

RFAPLNSWPDNQNLDKARRLIWPIKQKYGNKISWADLMLLCGNIALESSN

FKTLGFAGGRPDTWQADESIYWGAETTFVPKGNDVRYNGSTDIYERADKL

EKPLGATHFGLIYVNPEGPNGTPDPKASALDIREAFGRMGMDDEETAALI

IGGHTLGKTHGAVPGKNIGPEPEAADLGEMGLGWHNRVGEGNGPNQQTSG

LEVIWSKTPTKWSNHFLESLLGNQWTLVKSPAGAHQWEALNGTVDYPDPF

VKGKFRRATMLTSDLALINDDSYHKICKRWLKNPEEMNEAFAKAWYKLLH

RDLGTASRYLGPDVPKEKFIWQDPLPERKGDVITDEDISSLKTAILGADG

LDVSKLVSTAWKSASTFRGTDKRGGANGGRIALEPQVNWASNNPKQLKQV

LSALKSVQKEFNAKSGSKQVSLADLIVLGGVAAVEKAAKDAGLKDVVVPF

TPGRVDATQEMTDITQFNYLEPLADGFTNYGHGTARARTEEILVDRAGLL

TLTPPEMTVLVGGLRALNANFDGSSNGILTEKKGQLTNDFFVNLLSPAYK

WSKKDERGELWTATDRSTKSTKWTATRADLVFGSHAELRAISEVYGSADA

KEKFAKDFIAAWTKVMNLDRFDVK

 

TTRYHIAMDSINSIPDEILKEIFIYV

TDLDYDYIDIFQVRLVNKRFCKIATPLRVRHWSDCGYYSPINTSLSRTTL

NRFALELLRHPELRLQVRSIQIDWFRSDDGKETPRHLIRPDNLDLLAKAA

EETLPGLARSTDLCDQIRQGSDDGIAVLVLAWATNLTSLDLTIPSDSRLK

VGKDYLMLVLHFAKQIALRFVSDGPKSTLPLPMEKLHTSIFRYWNFDREI

HVAHLSPFLHFPNLKSLDALRIGDNRGRDLSYVAGSTESNYSMPLPERTS

SLESIFLDDPTLSNAGFSSLLHACKNLKVFDLQFASSMGTRSSTMLARAL

REHASSLEELSLSLQDNEDSQWVPDSADTDELPECYRELKRLKRAGIPMK

HLLQREDENDPTTTKLNPDRLPESLEHLTIFHSDLRFVRVQSESFPEVFK

GAILGTFEADLNEALVGIQTILEETGPGGRLEKLKTVDFSDALSDDPMVE

EIRRVKDLAKERGVEFILVTASSLYNRRRCTMNATTLGLAERGSSIDAAS

weakly similar to CYP611A1 cyp7a(24%) and cyp51 low 20% range

29% to FG02114.1 AACM01000111 FGcontig1.111_scaffold1

YGIYICLFILPFLVTYAFTVLGNTGYRDGTAAREPPKVPYWIPFVGNTIG

FAYDTERFLFSSLRKFGKVPLRIFVGAEQMYFIPHGQTIVELFKSSRYLT

TKTFGIMTVRDAFGLPQPDVEIYAGDNSGVDVKPAPGWEHVEQAKRFHFV

QHRQLNAYLSGNALNAIISKFTEGYSDQIAQDTTFQEDGWVEVDDLYGWF

KNHLLRATTVALCGEKFLELSPDFLEDFWSFDYHLPNLFRRLPRWVVPKS

YQARDRLLECLLRYHEYGQQNLDFTDQKLLEKDWTPEFGAKIMSTRQEMF

KNIGLSPRGGAALDVGMIWAVNANAIPAAMWMLLGILLDKNLTDRVMAEM

EPSFHEKSLSFDNDRLCSGPLLNSVYLEVLRVRVAAPVGRSSLIPNLKFG

KWQMKQDVGMLSTSWFGGHDPDFWNTGSTLPDGSEEHPVDTFWAERFLKY

EDDPTGGPVRNTNVKPSTRPSKRTADDDRKASVFTEGTQGYFYPYGGGTK

MCPGRFFAKQKLMAGVALSLRAYEIELVDPEAAAKVGPNMDYFPFGTIPP

KGKVPARIRRRKL*

>CYP526E1 FG03860.1 AACM01000167 FGcontig1.167_scaffold2

= G. zeae AACM01000167 CYP526 38% to 526B(nc)

36% to 526C and 526D 35% to 526A1

MSSHLVDLYEQAPKSFILTLFLSIASTLYLVRRALLPKPIPGIPYNKNAI

NSIMGDMAEFRAAKNRREWWALQAVKHQSPLVQVFMKPFGLPWVFVADHF

EASDICMRRLKEFDRADITRQQFDGLTPGHQITLKTSDPQFKKNRELVRD

LMSSSFLQQATAPQIHHKFSTLMSLWDRKRDLSGGRPFDISHDIHNAAFD

IILGASFGVDSGQGQIGKELDELRSKTTTGGNDDAFEFERVPFYDEELGC

FDTLIESFNVSIRSPYPLFSHFLYRNLSPKMREANAMRAKLQDREIAKSI

ERREKGHPQRCALDNMMAREDAIAEKEGRKPDYRSQAILSELLGYLVAGH

ETTSGVLRWGMKYLTKDQRVQSILREAFRTGYADALKQSRVPTMDEILKA

HIPYLDAVIEEMLRHARVAPITLREAVEDTQILGHHIPKGTTIGFLGNGP

GVMMPSIPVDPNKRSEASQAHVNKMELFDESNISQFVPERWLTTQTNEKG

EEVTVFDHNNGPQQAFGLGPRACFGKKLAYMEIKAFFTFVFWEFKLEPVK

AELATDEEMVALTRAPKNVFVKLTKVECCG*

>CYP618A1 FG03961.1 AACM01000168 FGcontig1.168_scaffold2

GAP1 gene for general amino acid permease (first half)

MKERDTQNMNGTQIELDSLPTTDSIKHEPPILYGAGNWINGFRRAEPRPG

YLPTDAPERFYDLRAANAKTANTALARELKGRHLQMIAFGGSIGTGLFVA

SGGSLYRGGPASLLLSYVLIGGMQYCTMQSLGELCVAFPIAGSFSAFSTR

FLDPSWGFAMGWNYCLQWLFVLPLEIIAGAFTIGYWDETIDRSVFVSVFL

LTIVAINLFGVKTYGEAEFIFSIIKITAIVGFILLAIVINIAGEPEGHYI

GGMYWRNPGAFKNGFKGFCSVLVTSAFSFTGTELIGLAAAETANPRKSLP

TAIKQVFWRIMIFYLVALLLVGLLVPSDDSRLVGGDNVADATASPFVIAI

EKAGTSLLPGIMNAIILIAVISVGNSAVFGSSRTLAALAEQSHAPHIFAY

VDRQGRPLMAILFASCIGLLAFLADVKYHDAIFNWLLSISALSTLFTWGS

ICLCYIRFRAAWSHNAHTIEQLPFKSNVGVAGAWVALIGYILVLLSQIWI

AASPVYAPDIVDGASGVAQNFFLKVLAIPIILLFYICHKAFVVQYMGDVH

37% to 582A1 (second half)

MKAMEASYATILWGVALAVVGFLSHRIIAIALRPHSSRFNGLPRPKGQQP

FAGHALRILRGGGPNDVYLQWTRQWPDAPFIRCLSWLNEEILLVNSLEAC

REVLQTNAYFFAKPGFFHTLVGEFLGLGLLFSVGEQHKRLRRIIAGPLSR

PSIRKLFPTFVTYSQKLNREIGEALERSKSGIVEIEDLIIRVTLDIIGVS

LLGRELRDFRSESSPLSFEQCYNAILAQPLAGQIISFINPFIPLRWLPVS

ANLNFIRAKSALKTMMEGLIEQRTAEVGAAKLMNEDDKLSDDLLTRMIEA

SAEESQKLSKEELIDITMQVIAAGHETTASALVWTAYSLAKDPASQQSLR

AEIHSLGTEMSAKGIDELPFLDNVIREAMRVHSPTLIIPWEAQKDMTIAG

THIPKGTTVQIVPAMIQLNPEIWGSDADVFRPGRWEDMGGNASSPYAMET

FSNGPRMCPGKALALLNMKVLLVGLIRDFEMEIVDDGKEVELRNPSLTLK

AKSLIQFKMRKVS*

>CYP51F2 FG04092.1 AACM01000179 FGcontig1.179_scaffold2

60% to CYP51F1 Penicillium 68% to Mg CYP51F2 54% to Mg 51F1

MFHLLIYPLWVLVALFAVIIANLLYQQLPRRPDEPPLVFHWFPFFGNAVA

YGLDPCGFFEKCREKHGDVFTFILFGRKIVACLGVDGNDFVLNSRLQDAN

AEEVYGPLTIPVFGSDVVYDCPNSKLMEQKKFVKFGLTQKALESHVQLIE

REVLDYVETDPSFSGRTSTIDVPKAMAEITIFTASRSLQGEEVRRKLTAE

FAALYHDLDLGFRPVNFLFPWLPLPHNRKRDAAHIKMREVYMDIINDRRK

GGIRTEDGTDMIANLMGCTYKNGQPVPDKEIAHMMITLLMAGQHSSSSAS

SWIVLHLASSPDITEELYQEQLVNLSVNGALPPLQYSDLDKLPLLQNVVK

ETLRVHSSIHSILRKVKRPMQVPNSPYTITTDKVIMASPTVTAMSEEYFE

NAKTWNPHRWDNRAKEEVDTEDVIDYGYGAVSKGTKSPYLPFGAGRHRCI

GEKFAYVNLGVIVATLVRNFRLSTIDGRPGVPETDYTSLFSRPAQPAFIR

WERRKKI*

>CYP587B1 FG04249.1 AACM01000185 FGcontig1.185_scaffold2

38% to 587A1 revised 2/21/06

206746  MLPLEYQHDGSSFLLHCLSFSGVVLAALLIHALRKGYQVRKKFKALEAQGI (0)  206898

206951  PIMKHSMIFGHLESVGKLVSSLPPDAHGDYLMMMIRENWRELFPQCTKCPPVAYIDTWLF  207130

207131  TAPMVISLNLDVSTQFTTQHSLPKAYEQKHTLYQLTKNRDLASMEGEEWKIWRKRLNPAF  207310

207311  SIQNINSRIIDILEEVEDFAAVLKSKAGDDGQWGDVFLFEKATTNLALDVIVRFFL  (2)207478

207554  DVRLNEQWGANSPMCHALQDTISRLCFFVHIANFIQYYNPWRQFX  207685

207688  LWKNYKTLADSMTPMIKERTRARQEDPTAKGKTLVDLVVQALQEEKAEQS  207837

207838  NTANEGKTQPGLEFDTEFMDMAIGQMNTFLFAGFDTTAATVAWLFRLLCQYPDVVAKLHD  208017

208018  EHDAVLGTNAWAAANVIREDPQLMNQLPYTLAILEESMRYHTNVGTMRRGEPGFFLVGPP  208197

208198  GSDPGFDGKKLPTEGFIVWDGTWAVHRDPEIWHRPDEFLPERFIITDREDPLFPPINGWR  208377

208378  SFVSGPRNCIGQHLLVLEVKLVMALVTRYFDVEVTWEKWDRAK  (2) 208506

208564  GTTNAKKAPTIWGDRCYQVGANALPRVKDSMPVHVRVRA*  208683

>CYP566B1 FG04590.1 AACM01000193 FGcontig1.193_scaffold2

45% to 566A1 correct N-term of 566A1

MEDLLDQVVVELHRARSCLSDPLVFTQAAVIGS

ILFVFLLGLYNYFLHPIAHIKGPFLAAVTPI

SLIR

ALRDIHNPGPDNHHYTKRGTSEDLILRFVFGA

NNILLVDEGEDHKRLRGALQPAFTAKAMRDQQDITHYHVQKTVERLLEAA

MDPSQTISLTKELNKLVWGNVGNLAFGEPATLEQLENHEKAKDLHAQIAP

ILEFFQYLNGNPILGRAARGLVGISRKVFGLSGNILGKDQLRRHIASQQG

QKNFLTAILGAKESSGLSFDEIHSNMLLLLMGGYDSSAASLSAIFYHLLR

EPQQYKRLQSELHHAYSSVNDITCNSLLSQPMLNACINESLRLVPPFNGH

GSHRVTTSGTMIDGVWVPAGTLISADFYSLHRDPSCWAFPDEYRPERWLK

EHQGPGTPFENDVKTAWRPFSLGPRVCVGREMALQSIRLAVSKIVYTFDM

TLANRDFVWDRDAGSHYMWHDFDIAVTLAKA*

>CYP68J2 FG04717.1 AACM01000196 FGcontig1.196_scaffold3

42% to 68E1 looks intact 44% to 68D1 55% to 68J1

MSTYIDIVLENPQYAVLSTISLIAILIANYSFFAKDDKYPVLNPKKPFEW

SNTRVVKEFTENSKSLLAHARSVYGEQPYRAYTDMGKVLVIPPSWVHALR

SKKELDFRIPAQEDSHEYIPGFDGFGFHANMPTVITKYVTKSLAKMTGPI

SEETSLSIRDRLTDSKEWHSINPPKEMIRIVSRVSSRIFMGKELCRDEAW

TKASSDYTVVAFASIALLRVYPRWLRPYIHWFLPYCKEARRLLKEARECL

QPHLDRREVIKQQALAQGQPCPFDDAIEWFNNEYDKHDPATQQISISIVA

YHTTSDLLCETLLNLCQHPELFKPVRDEIITVLRQEGGITKAALYNMKLL

DSVIKESQRLRPILLGAFRRKAMADVTLPNGDVLRKGDRVIGETTHMWGP

ESYDNALEFDPYRYVRMRESGEENKAHLVSTSPEHLGFGHGVHACPGRFL

AANEIKILLCHLLLKYDWKLPEGAEPKPSFASFRIDGDKTTNLLIRRRTE

ELDIDSLSA*

>CYP643B1 FG04724.1 AACM01000196 FGcontig1.196_scaffold3

poor match looks intact with C-term extension

MDYSRVVIDYFQKIINYPPSQLACLITVIIAIATFQILRAVYRLHFHPLS

KFPGPRSAAISRQWQAKIVRKGFPEKDYEKLHKEFGTKVLRIGPNHLHIS

DPSVYKVIYSQVNAFPKEPLFYNSFESRHTVFSETDVQLHKERRKLLNPL

FSKAGVQKLEPLILEKIQETKEKIKRISKDGSINVWPALRCMTIDIVSEF

LFGSCINMINEHPTSFESEYLKAMSLASELPFERYYSTMQRVVAKLVPLS

IAANFNPVLRQTEKLVGIIIDSYDTYKRRTTRSRFPVIFDKLESLSADLQ

KAEAINTFIAGSDTTAFTLTTALFHILHTPEVEKTLTETVDQLFGESHDI

PSLIQLEQVKYLRACVNEALRLGMGVPGTLPRIVPKQAQPFVVEGKVIPP

GTLVGMSAYTMNTDPQIWGQDAKSFNPARWLGPDSKELEKQLCTFSKGAR

QCIGMNLAYAEITMTLAHFFHYFKMELKTKELLAEDRFVHDVVGPEETKN

 

PTSKYLKLPSAEGWTDMEPLLESLGSSDMVGQVIKRIPYFDNDCKAFIHY

KSRLVDYPTLPQSCFKRVMWGRVSSSDEIYSERRQIIIDMRDVFPLATGR

EAWGKYIWLNVRDGEITVEERLMHDLLQVDLKVFFDGVKQDYIALKLIPC

RRRITIEADKIEERLGEEVITEEEVIAQDGAWGTALDIHYTRQLYRAFGW

PLAFRKYEAFDAVDRLMDKLGEHRNEWEPTEEDWDDDDHWC*

>CYP621A1 FG05113.1 AACM01000205 FGcontig1.205_scaffold3

31% to CYP502

MIELYSFAHMLGPALVFTSLLIFWAHTHFQPTLPLPPGPPSEFLLGHTRV

IPKENAAEVYSRWAKEYSQSTIVXXXXXXXXXLHSAEVAKDILEKKGANFCDRPRFTLL

EVMGWGKTLTFLPFGKSWQMHRKFLQTSFSNTNVRQWYNLQMTETHRTVK

GIMARPDTWETSLRRFAVAIVLQVSYGMEVPSDDDPYIRIANDAMYATGN

GGVPANSLXXVDLVPFDWLINDWSXXXXXXXXXLRFARQWRWAITKLHDVPFAAAQAERLL

QSYEHNELQGNKQDWSLDXXXXXXXXDIKGAAGAVFIAGADTTWATCVIFVLNMVLHP

EIQKKAQDELDAVLRPGKLPEFSDRPSLPYVEHIVQEIYRWSPLAPLGIP

HKSLHDDVYHGMFIPKGKADGIHTMPVVTVVYANSYAIAHDERVYKSPHE

FNPDRYGAGEPYPVGNXXXXXXXFGFGRRICVGRFLAGNSVWIMVATMLSTLQFCKK

VAQDGTPIEPRVQFTNGGTCHPEHFDCVIKPRNATATALINAS*

>CYP537A2 FG05426.1 AACM01000224 FGcontig1.224_scaffold3

54% TO CYP537A3 revised shortened at N-term added to middle

possible missing base at intron before ALHAY

MFILSP

SLISGAAALFLVAYIITRLSSATAKIPGPFVSNFTSLVLKWQELNANRTV

YIHELHKRYGPVVRVAPNEVSFTSIAAVKEIYGSGGSGYDKTEFYNLFQV

YGKRTMFSTLVKGDHAKRRRMIGDRYANSNVMKAAPLAGIKERSSKFLQH

CVESPERTADVF (0)

ALHAYACDCVTHQLFHPYGSNCLQDKQ

DEEMMHQVAADDSLQNRLVQYYSPVLHNLGSKVLASFA

KPRSIPLADNFVIENAQQNGAASFTVLNRLKEKDSVLDTMDMAAECLDHM

AAGIDTTGDVLCFLMWELSQPRSIKYQRLLREEFLRKTDMPFDELPMLDA

VLNEGLRCFPAIPMSLPRYVPQGGRVIDGFTLAEKTVVSCQAMSVHRIND

DVFPEPDKFHPERWLAAEGDADRRRHQWAFSSGGRGCVGKHLAMVEMKTL

LRDVYSRYETEPDESMKSESMVMDDQLISSRPLGKRCLLKFVPVKD*

 

>CYP62B1 FG05806.1 AACM01000233 FGcontig1.233_scaffold3

42% to CYP62A1 in 53 clan

MTLITTPGAPLLAGVFLFVIISYTLVTSLSSPLRRVPGPWYTHFTHFVLK

FHIVTGNRIHYVHSLHQRYGPIVRLTPWEVSVSDAEAVSAVHKIGAGFLK

SAWYDGITPGREPGIFAMRDPHQHSARRRLFARAFSNGSLLTNWEPEIRQ

KTSLAVQKIKQDALGAGADVFKWWTLMATDVIAHLSFGESFHMLEQGKQT

RYIDSIQLAMINSGIRTELSWIYPFLKFIPSQGLKTLLNADNVVYDHGTV

AVRNMQSAGDGLSRANLFSQMVAEADGQEKTTLTASSVQAEAGNLIIAGS

DTTAVTLTYLVWAVLKHPQLQARLEEEVGSLSDELTFDELKNAPLLNSII

EETLRLYGAAPGALPRVVPGKGATLVGQYLPGGTVVSTQAYTFHRDENIW

PDALRFDGYRFMDKSKMTASQKAALSPFGAGSRICIGMHLAYMELRLGAA

LFFRECRGVKIGVEMTDEMMEMENHFLIAPKTHKCIVKL*

>CYP550B1 FG05960.1 AACM01000237 FGcontig1.237_scaffold3

46% to 550A1 (nc) looks intact

MSSAEMASADESCNTYSPALRLYVLIKTNSSAISRYGGSLFGITSGHQIV

ADLPGIERLLTQSHHIFDSTPAQYSLCTLVFGSTNSPQLRDKLHTSLKDL

VPPLERTFLNDAASTAAVERSRVAERGASLVTFSSDPQHMERWELSAGIK

VLQSEQPGIPGKVEANLQSLTRDFGACMSIPLIYGQDLLDRHPQLLDDFW

VFDNELFPLLMVGIPTWAPFKMMQDGLKARTRIIDSLEGVYKRVEQERRG

ESIDFGADISDVSTMLRERNKVFNRDGWTLKERAAADLGTFWGLNANAQP

VLFWFLLYVYSTPGLLERIRQEISPYVTLVGGGRPEIASMDFQSLFRNCP

LFKACIFETYRLVNEPTSIRHVSQSVSINDGDLLHNLSEGTYISVPLALR

NKDPHLYQDPDSFVPDRFLDTDPQTGKSTARYGKLKPWGVGAAMCKGRTF

AEKEIISLGSAVVSLWDIAPADGSWKLPAMIPGTGVKKPINDIRVVIKRR

VL*

>CYP548A3 FG06068.1 AACM01000241 FGcontig1.241_scaffold3

66% to 548A1 (nc)

MTVDLAHLWVYLGLLVGGGLFYGFSIVIYRVFFHPLAKYPGPFMAKITDA

YQLYHAWKGDRQIEFWRMHEKYGPVVRFGPNLVCFNSNKALKDIYGFRSN

VRKAEFYNAFVHPTANTHNTSDKEVHARKRRVMSQAFSESAMKEMQRYIL

GNVRTFCEQIGMLEGSGEDNKGWTKPRKMSDWCNYLAMDILGDLCFGKAF

HMLESPTNRFALQLVEAATTRHLLCGTMPIVNKLNLDKILFPGLAAGRAR

YMAYSKGQLTERTKLGEETDRRDFFYYLLKARDPETGQGFSTPELWSESN

LLIIAGSDTTSTAMAATLFYLVRCPRALKRVTEEIRSKFNDVEEICQGAT

LASCTYLRACIDEAMRMNPSVGGILPREVLSGGMTIEGHVIPEGTVVGVP

HYTIHHNESYYPSPYEYVPERWLVGTLNPLTGQNTTEAEVALASSAYCPF

SVGPRGCIGKGLAYVEMTNTLARTMYMYDMRKAVGIVDPAEGNPKNEWGR

HRPGEMQLVDIFTSAKNGPMVEFRKADHMSS*

>CYP504B3 FG06447.1 AACM01000259 FGcontig1.259_scaffold4

64% to CYP504B2

MTIANILLSLNDKVQKNKGQSILITLFIAPLVYILVNELVRHNARISNLD

GPWGLPLIGNIRDIKVNASEKYREWAKKYGPVYQIQLGNIPIVVVNSAAA

ARHIFGANAQALSSRPEFYTFHKVNHTTPNTCQGXXXXXXXXXXXXXXAASALNRPSVATYVDH

LDVETRDFIKELIEYGNNGKSPVDPMPMIQRLSLSLALTLNWGVRLKSQK

DNLFAEITHVEEEISRFRSTTGNLQDYIPLLRLNPFNFHSSKAREMRNRR

DKYLTALNDGLDERIKNGTSKPCIQANVIMDKEXXXXXXXAKLNKDELTSISLTMLS

GGLDTVTTLVAWFVAYLSQHPEIQDKAVSEIGKFFSQKEPXXXXXXXMCDANDDQKC

EYVVALVKESLRYYTVLRLALPRASIRDIIYEGVKIPKGTVVFLNAWACN

MDEQVWSDPQEFRPERWLEQPEAPLFTYGVGYRMCAGSLLANRELYLLYM

RLLNSVKIEQXXXXXXXXXFDNVDCHPVRGNLDPTSLVAMPRRYKASFTPRSPDDLKKA

LVVSV*

>CYP505C2 FG07596.1 AACM01000315 FGcontig1.315_scaffold4

46% to 505B1 56% to 505C1

missing N-term

MAIKDGGKKSGQIPGPKGLPVLGNLFDLDLSDSLTSLINIGQKYAPIFSL

ELGGHREVMICSRDLLDELCDETRFHKIVTGGVDKLRPLAGDGLFTAQHG

NHDWGIAHRILMPLFGPLKIREMFDDMQDVSEQLCLKWARLGPSATIDVA

NDFTRLTLDTIALCTMGYRFNSFYSNDKMHPFVDSMVAALIDADKQSMFP

DFIGACRVKALSAFRKHAAIMKGTCNELIQERRKNPIEGTDLLTAMMEGK

DPKTGEGMSDDLIVQNLITFLIAGHETTSGLLSFAFYYLLENPHTLEKAR

AEVDEVVGDQALNVDHLTKMPYVNMILRETLRLMPTAPGFFVTPHKDEII

GGKYAVPANESLFCFLHLIHRDPKVWGADAEEFRPERMADEFFEALPKNA

WKPFGNGMRGCIGREFAWQEAKLITVMILQNFELSKADPSYKLKIKQSLT

IKPDGFNMHAKLRNDRKVSGLFKAPSLSSQQPSLSSRQSINAINAKDLKP

ISIFYGSNTGTCEALAQKLSADCVASGFMPSKPLPLDMATKNLSKDGPNI

LLAASYDGRPSDNAEEFTKWAESLKPGELEGVQFAVFGCGHKDWVSTYFK

IPKILDKCLADAGAERLVEIGLTDASTGRLYSDFDDWENQKLFTELSKRQ

GVTPTDDSHLELNVTVIQPQNNDMGGNFKRAEVVENTLLTYPGVSRKHSL

LLKLPKDMEYTPGDHVLVLPKNPPQLVEQAMSCFGVDSDTALTISSKRPT

FLPTDTPILISSLLSSLVELSQTVSRTSLKRLADFADDDDTKACVERIAG

DDYTVEVEEQRMSLLDILRKYPGINMPLSTFLSMLPQMRPRTYSFASAPE

WKQGHGMLLFSVVEAEEGTVSRPGGLATNYMAQLRQGDSILVEPRPCRPE

LRTTMMLPEPKVPIIMIAVGAGLAPFLGYLQKRFLQAQSQRTALPPCTLL

FGCRGAKMDDICRAQLDEYSRAGVVSVHRAYSRDPDSQCKYVQGLVTKHS

ETLAKQWAQGAIVMVCSGKKVSDGVMNVLSPILFAEEKRSGMTGADSVDV

WRQNVPKERMILEVFG*

>CYP577A2 FG07654.1 AACM01000316 FGcontig1.316_scaffold4

53% to 577A1

AACM01000316.1 Gibberella zeae PH-1 revised

MAILPLAAAVVAVALLVKYLLDPFLSPLRQVPGPKLFAATRWRLAYEDWK

GTRTRTINALHKKYGPVVRIGPNEISFNSLSALRTIYGPGSRFGRTSFYR

MFDVYGEQNLFTFHSPKDHGDRKKLLSHAYSKTAVLKPATARMIERQAWR

YLNLIDSEPEGVSEIFSTLHYYSLDNITAFVYGKYGATAAVRGSKIHRDL

ISDILHPSRRRLSWCIVHVKGFTQWLYRQSSFMGALVKPILPMQQPTTYT

GIRAYALSAFKQFRAEADSQEVKFTEDEHVSILERLWQYHETQRPDGMRD

LQMASECADHFLAGIDTTSDTLMFLVWSLSLPGNEKFQEKLREEVQAISD

DSLNKQGIPKAEVADRCVYLQAVIKETLRLYAPLPSTEPRSTGDDVTIDG

YVIPKNTVVGMSPWIMHRNEEVFENPLVFNPERWLGEKASELNRWFWGFS

SGGRMCIGMHLAMAEMTVLGAALYREYRTTIAPGFEDTSPAITARVETFY

DERFPKVK (0)

ESTCLVKFDKLKK*

>CYP65Q1 FG07765.1 AACM01000318 FGcontig1.318_scaffold4

44% to 65F1 47% to 65A1 looks intact

MSVLSILLDGEVIHPMVLLPLAAVTMLVGYVLFWVIYNLSFHPLSKFPGP

RLWAISTIPYIRNFTAGECHFTILEMHKKYGPIVRVGPNDLSLNHPDGMK

ALRGHRKSGTGENSKEPVAASFNADNVIGANRENHQRYRRTLAHGFSQHS

MMAQQPIIRVYVDKLMKGLHAASDNGTKPVDIATWYNFTTFDVIGDLAFG

EPFGCLDTGKLHPWITLIFAGMKDLAFITTMARTPWLNNLWNLVTPKKST

SEWASHVEMAREKVRKRLASGMDRPDFIDAMLKRTGAAGNEMTFEELASN

AQILMIAGSETTATVLTATTYFLASNPETLKKVVNEVRSGFSSENDINMD

SVKKLTYMLACLNEGMRVFPPVINGSVRTIRPEGDDIIGHYIPGGATVDV

WQWAVHNNPDHFAHADQYIPERWLDNNDPRFANDAKQALNPFSIGPRDCV

GKNLAYAEMRMILARVLWNFDVSLHPDTPGWEKRTKSYFLWERGAMNVML

TPRKTE*

>CYP627A1 FG07804.1 AACM01000320 FGcontig1.320_scaffold4

poor match looks intact in 53 clan

MWSKPLPGHLAQVADSLPPEVTEALSNLTWTQGFVAFVALFIIVPRVFEL

LRNILSPVSRIPGPLINKLSPWPLEIATFKGKSHRFARALHQKYGPIVVL

APNMISVGDANEIKRIIQNEDWVKCEAIYGNFRQDPHRPTLLAFTEKKAY

SRRKRMLSSMFGIRYIRSLEPLMKSCVDAGVAHLDKLCENSNNSTVINLQ

HFIHGLAIDTIGATTFGGSFNVVENGSHPLPSRLKAGMKISAVMQLISWI

KYIPFLPKRDPYIEEFTFNIVDKRRKESGDVKHQDLLQHLVDVSDDSPSS

EFRTSDVQDESVILLAAGSETTANAELFTIMQLLKHPNIMKKLVEEVDKW

YPPSEPDRDTECAYSQAGMTYLQACIDETMRLIPGQATGSPRDASKQETV

LGYRIPKGTTVFPNTQEAHLNPDNWENPDQFIPERWLDIYSQNQTSSVPY

WPFSAGSRVCVGKHFAFQEMHISLTTLLRKFSFEYVPGQDETTVFRIAQQ

LQANSYDVKVKRRFV*

>CYP5080A4 OLD NAME = CYP532B2 FG07977.1 AACM01000323 FGcontig1.323_scaffold5

38% to 532A1 needs some revision 37% to 532C1 55% to 532B1

AACM01000323.1 FGcontig1.323_scaffold5

MPFLNWISIWAIGIVAYLLAFFIRLGRSPLRQVPGPFVARFTDAWYLYRT

WKGHFEQDNLALHRQHGPIVRYGVNRYSIDDPLASKTIYGPGSKFAKSTW

YDAWTAPDSPWNLFSDRSIKHHSEARRQYQSTYAMSALIGYESYVDECAE

LFSCRLAELSQGGTSVNIAHWLQCYAFDVIASITYSKRLGFLDQGEDIAG

LMQTLKSSISFATLVGIYSRWHPILFRLVSLVPGSGSNGFLHVERFTRSC

INDCKANPRAVHDDHEKSSDNGISFLHKFLDKHQKDPEKFTQYHIFSGCT

ANMAAGSDTTAISLSSILYFLLKNPQSMKKLRDEIDSKQKEGKLSECPTF

KESPDMPYFQVVIKEALRMHPATGLPLERVVPEGGADLCGQHFPQG

TIIGVNSWVQHRNVGIFGPDADTFNPERWL

TDDPAKLSLMNQHWMPFGLGSRTCIGRHVSMLEICKLVPRLVRDFDFELA

GDLALPNSEWELKNHWFVFQNNFFVRVRLRTSQ*

 

Query: 38  RSGLANIPGPPVAKWTKLWRLYDVYKGQSHHTAIRLHQQHGPLVRIAPNVVSVGDPQAIK 97

           RS L  +PGP VA++T  W LY  +KG      + LH+QHGP+VR   N  S+ DP A K

Sbjct: 27  RSPLRQVPGPFVARFTDAWYLYRTWKGHFEQDNLALHRQHGPIVRYGVNRYSIDDPLASK 86

 

Query: 98  TIYGLAGAFTKTAFYPIQSISWQKKPQ-MNLFSTRDPVYHRDQKKKVAGAFSLTNLLESE 156

           TIYG    F K+ +Y     +W       NLFS R   +H + +++    ++++ L+  E

Sbjct: 87  TIYGPGSKFAKSTWYD----AWTAPDSPWNLFSDRSIKHHSEARRQYQSTYAMSALIGYE 142

 

Query: 157 DAIDSCTELFISRLDQWAADGKRIDLGMWLQYYAFDVVGEVNFAQKLGFLATGGDVDGMI 216

             +D C ELF  RL + +  G  +++  WLQ YAFDV+  + ++++LGFL  G D+ G++

Sbjct: 143 SYVDECAELFSCRLAELSQGGTSVNIAHWLQCYAFDVIASITYSKRLGFLDQGEDIAGLM 202

 

Query: 217 KTIEGIIAYSSICGQIPEMHNVLLGNPLFPILLPSMEN-WNAVLTFTLKAINSRTSMKR- 274

           +T++  I+++++ G     H +L    L  ++  S  N +  V  FT   IN   +  R

Sbjct: 203 QTLKSSISFATLVGIYSRWHPILF--RLVSLVPGSGSNGFLHVERFTRSCINDCKANPRA 260

 

Query: 275 -DGELELPDEGGKDLLSKWAAVKNKDPLKMSTRDAIVHLSANVFAGSDTTAIALRAVIYF 333

              + E   + G   L K+     KDP K +        +AN+ AGSDTTAI+L +++YF

Sbjct: 261 VHDDHEKSSDNGISFLHKFLDKHQKDPEKFTQYHIFSGCTANMAAGSDTTAISLSSILYF 320

 

Query: 334 LIKNPDKMTNVVQEIDAADKNGNLSDLISYKESTSHLIYTKAAIKEAMRLHPSIGLLMER 393

           L+KNP  M  +  EID+  K G LS+  ++KES   + Y +  IKEA+R+HP+ GL +ER

Sbjct: 321 LLKNPQSMKKLRDEIDSKQKEGKLSECPTFKESPD-MPYFQVVIKEALRMHPATGLPLER 379

 

Query: 394 HVPPQGAEICGHFFPGGTIVGINPWVVQHDPKVY-EDPEAFKPERWLTSDAELLSKMEAS 452

            VP  GA++CG  FP GTI+G+N WV   +  ++  D + F PERWLT D   LS M  

Sbjct: 380 VVPEGGADLCGQHFPQGTIIGVNSWVQHRNVGIFGPDADTFNPERWLTDDPAKLSLMNQH 439

 

Query: 453 FFTFGAGSRTCLGKHISLMELHKVVPQLLRRYHIVLAD----PDADWEVKNRWFVQQHGL 508

           +  FG GSRTC+G+H+S++E+ K+VP+L+R +   LA     P+++WE+KN WFV Q+ 

Sbjct: 440 WMPFGLGSRTCIGRHVSMLEICKLVPRLVRDFDFELAGDLALPNSEWELKNHWFVFQNNF 499

 

Query: 509 NCILKKRT 516

              ++ RT

Sbjct: 500 FVRVRLRT 507

 

>CYP532A2 MG07795.4 (version4) 65% to CYP532A1

AACU01000949 cont2.1444

MQGLTAPILHFLAANWLPVLVAVTAAWLARNRFQKGLHKYPGPFLASLTD

FWRVWDVYKQRPEVTHRKLHERYGDVVRLGPNALSFSDPKALKAIYGLNK

NMVKSDFYIVQQSVVKGRRLPSLFSTVDESFHAKFRRCVNAAFAMSALVQ

YEPFVDNTTKLFLDQTQRLFADKPAGDDSGCDFGRWLQFYAFDVIGEITY

SKRHGFVEKNEDIDGIVSYLSKLFLYVAPVGQMPLLDLLFLKNPVY LKLS

QWGLFDSTFPVAKFARARMAERLPAGGSMNGGFGAGADEKPAAEPHPSTK

SP DLLSKFLAAQEARPDFMDDSLVQTMAVSMAFAGSETTAISLSAVFYYL

LRNPSAMARLRREIDDAARRGEFEDGETGLVTWHE SQRLPYLDACVKEAF

RVHPAAGLPLERIVPEGGMEIAGHFVPGGTIVGVSA WVIHNNKDIFGEDV

DVYRPERWLVDEEL   VKAAGPAGHEVRARE  EQRIKEMGGMMMQFGMGSRTC

IGKNISLLEIYKLVPSLLRRFDIDFKDPQQEWELVNAWFVKQNNFWAKFK

TRELVQPDEKSGAIAR*

 

>CYP539E1 FG08005.1 AACM01000323 FGcontig1.323_scaffold5

missing N-term AACM01000323.1 FGcontig1.323_scaffold5

40% tp 539A1 THIS N-TERM IS NOT P450 SEQ

MDEIGPDFPFKATPKAVPATLKIDHDCGVKITTSPAINNPPLPADGPGNE

TFSNGLLISLLILVPTCTVWKLGGRFKTTVFFAVITTLPILITFCAITSA

TAPCTNERVKCPGLPVEHYLTFHKEEDQVKYRGRNKVPMETFMRKYFDGD

ADFNGDVLEVLEYRHDWASFRFTWELFRYIIVNFVTDVTAKYGLRWFKIW

KYFLASATTSSRQGSATCYQITLVKNINSVRRIDGVSTQFALSTALEASK

KAGRAVFPANNPSR

P450 STARTS HERE

LQPVFNRERISDLECVERHVQNLLPLLDTEGQTAEI

KDLFLRFTLDVSADFTLGVDLDTLKRPL

NRFAESFERLRHWKIQKERSNP

FKFLVLRSRYQADLDYIESFMDPIIMETVNEIKAEEAGETPHKKDSGFNL

LGASAEVSTNRRFLRDELLTALFAGRDNTAMAFTWILYELAQHPDVVRDM

RREIDAQIGLNSEPGYKTLKDMRILSNIINETLRLYPPVPLNTRAC

110308 LKDTSLPRGGGPLGNDPIGVLKGTGIINSNCL 110213

110192 EAYSTVPEGFPPADEWCPKRWNNWFPKPWAFVPFHGGPRFCLGQQLVLVEMSYTLVQLFQ 110013

110012 RFSRFELRIDE (0)

PRMVTEIALFPRREVRVAFVR*

*

>CYP539A2 MG09920.4  64% to CYP539A1 AACU01001746 cont2.1896

MGLVEVVLEHVSVKAAVLWIVGSWVLYLVVKNVLEERKINKLGARAARMP

SRLPLSLDNIIRAVRANIQNRNLQMWRSHMSHSITYTVEGRLLFQRIILT

ADPENIKAILATQFTDYGKGEPFHQEWKPFLGDSIFATDGEKWHTSRQM L

RPQFVKDRVSDLECFESHIKTLFKAMANGGALEGEHQHVELSAINGKRFE

ITDLFFRFSLDVATDFLLGYDVKSLSTPHAEFAEAFNEVQHVQSTITRSG

PAQALVPKGSYYRGLKVMDNFINPFIDRALRLSPDELASKTKSDHGYTFL

HELASFTRDRKVLRDQIVAVLLAGRDTTAATLSWTIYELGRHPECVKRLR

QEIAEVVGFGRTPTYADLKSMKYLQNVMHETLRLYPAVPFNVRLALHDT

TLPRGGGPDGTLPVPVLKDTPI GYSTLLMQRRR DLYPPVSENFADPDVFSP

ERWFHWQPRPWQYVPFNGGPRICIGQQFALTEMGYVLVRMFQ QYERVVSY

MDEIDGGNPTIKADIVMQPGDGVIVAFWEGDNEKI*

 

>CYP5078A2 OLD NAME = CYP532C1 FG08008.1 AACM01000323 FGcontig1.323_scaffold5

MAKTLFVNGRILSKTEAGLSGNAHFSDCMLIQDNKIVEIGSRHDVSQTLS

PDVQIRDLDQRVVLPGFIDGHMHLLLLGQSLRKLDLSRCTSLDDIRSCIR

KYAAENPDTPTILCKGWRHHMTPDGVTAAMLDDLDPRPIFIDAGSLHSCW

CNTAALKELEVDDIPDPAGGKIYRDADGKPSGLLDEGAMMSIIWPFQAKS

SPKHERIEAIRAAVKEYNAAGYTGAVEMAMDEEAWDALVTLKTTEPNLSL

RIAAHWLIKPTANHDENSKQVQRAIEQSKNYNSTTSPDLRIVGIKVITDG

IIDACTAYLSEPYATAGSPPPIWEPEFLEPVVREADAGGLQVALHAIGDG

AVRMAIDAIEKYATPGRRHRIEHLELVSPEDAKRLGKLGLTASIQPIHAD

PTALTTWPELLGEERYERAFAYREFADAGALMAIGTDSPTSPWSPMHNFH

VAINRQSSMNPENPKVVHEHFRLGLCETIVAGTEGAARSVFAEDRVGSLA

SGKLADFIVVHMDWDPKTLLKAEVKETCDLFGAVGYFGKGLSVDNTETSR

HLLNFQVGSPIKVKPNPSISNYVFGVEYCIPTITNDPTEVQLARITHVCF

EHEDLETFERFAHDFGSMQESRLRTFFSIRVMSKDGKQRFLGPAFVGASQ

AEFEKATAPGGSKRVSLEHTPGGGKMIMFNCPDNTRYLDKLHLVKGDVSQ

ESTNVEAVETVIRQGKRLTSLILNAATFKTLGPFSRLSLVNWKRAYDINF

FAIVHMTQMRQEGNLFAKATTFHRIPVRSSVP

38% to 532A2 34% to 57A2

MSHQYVAAAASAFLQFKY

HLVTFFFGLIILSYVHGRFRSGLANIPGPPVAKWTKLWRLYDVYKGQSHH

TAIRLHQQHGPLVRIAPNVVSVGDPQAIKTIYGLAGAFTK (0)

TAFYPIQSIS

WQKKPQMNLFSTRDPVYHRDQKKKVAGAFSLTNLLESEDAIDSCTELFIS

RLDQWAADGKRIDLGMWLQYYAFDVVGEVNFAQKLGFLATGGDVDGMIKT

IEGIIAYSSICGQIPEMHNVLLGNPLF

PILLPSMENWNAVLTFTLKAINS

RTSMKRDGELELPDEGGKDLLSKWAAVKNKDPLKMSTRDAIVHLSANVFA

GSDTTAIALRAVIYFLIKNPDKMTNVVQEIDAADKNGNLSDLISYKESTS

HLIYTKAAIKEAMRLHPSIGLLMERHVPPQGAEICGHFFPGGTIVGINPW

VVQHDPKVYEDPEAFKPERWLTSDAELL

SKMEASFFTFGAGSRTCLGKHI

SLMELHKVVPQLLRRYHIVLADPDADWEVKNRWFVQQHGLNCILKKRTVA*

 

Query: 36  RFRSGLANIPGPPVAKWTKLWRLYDVYKGQSHHTAIRLHQQHGPLVRIAPNVVSVGDPQA 95

           RF+ GL   PGP +A  T  WR++DVYK +   T  +LH+++G +VR+ PN +S  DP+A

Sbjct: 32  RFQKGLHKYPGPFLASLTDFWRVWDVYKQRPEVTHRKLHERYGDVVRLGPNALSFSDPKA 91

 

Query: 96  IKTIYGLAGAFTKTAFYPIQSISWQKKPQMNLFSTRDPVYHRDQKKKVAGAFSLTNLLES 155

           +K IYGL     K+ FY +Q    + +   +LFST D  +H   ++ V  AF+++ L++

Sbjct: 92  LKAIYGLNKNMVKSDFYIVQQSVVKGRRLPSLFSTVDESFHAKFRRCVNAAFAMSALVQY 151

 

Query: 156 EDAIDSCTELFISR-----LDQWAADGKRIDLGMWLQYYAFDVVGEVNFAQKLGFLATGG 210

           E  +D+ T+LF+ +      D+ A D    D G WLQ+YAFDV+GE+ ++++ GF+   

Sbjct: 152 EPFVDNTTKLFLDQTQRLFADKPAGDDSGCDFGRWLQFYAFDVIGEITYSKRHGFVEKNE 211

 

Query: 211 DVDGMIKTIEGIIAYSSICGQIPEMHNVLLGNP---------LFPILLPSMENWNAVLTF 261

           D+DG++  +  +  Y +  GQ+P +  + L NP         LF    P  +   A + 

Sbjct: 212 DIDGIVSYLSKLFLYVAPVGQMPLLDLLFLKNPVYLKLSQWGLFDSTFPVAKFARARMAE 271

 

Query: 262 TLKAINSRTSMKRDGELEL------PDEGGKDLLSKWAAVKNKDPLKMSTRDAIVHLSA- 314

            L A  S       G  E       P     DLLSK+ A +   P  M   D++V   A

Sbjct: 272 RLPAGGSMNGGFGAGADEKPAAEPHPSTKSPDLLSKFLAAQEARPDFMD--DSLVQTMAV 329

 

Query: 315 -NVFAGSDTTAIALRAVIYFLIKNPDKMTNVVQEIDAADKNGNLSD----LISYKESTSH 369

              FAGS+TTAI+L AV Y+L++NP  M  + +EID A + G   D    L+++ ES  

Sbjct: 330 SMAFAGSETTAISLSAVFYYLLRNPSAMARLRREIDDAARRGEFEDGETGLVTWHES-QR 388

 

Query: 370 LIYTKAAIKEAMRLHPSIGLLMERHVPPQGAEICGHFFPGGTIVGINPWVVQHDPKVY-E 428

           L Y  A +KEA R+HP+ GL +ER VP  G EI GHF PGGTIVG++ WV+ ++  ++ E

Sbjct: 389 LPYLDACVKEAFRVHPAAGLPLERIVPEGGMEIAGHFVPGGTIVGVSAWVIHNNKDIFGE 448

 

Query: 429 DPEAFKPERWLTSD--AELLSKMEASFFTFGAGSRTCLGKHISLMELHKVVPQLLRRYHI 486

           D + ++PERWL  +   + + +M      FG GSRTC+GK+ISL+E++K+VP LLRR+ I

Sbjct: 449 DVDVYRPERWLVDEELEQRIKEMGGMMMQFGMGSRTCIGKNISLLEIYKLVPSLLRRFDI 508

 

Query: 487 VLADPDADWEVKNRWFVQQHGLNCILKKR 515

              DP  +WE+ N WFV+Q+      K R

Sbjct: 509 DFKDPQQEWELVNAWFVKQNNFWAKFKTR 537

 

 

>CYP65S1 FG08023.1 AACM01000323 FGcontig1.323_scaffold5

40% to 65G1

MAIISTDLASGTSLGGGLVLLAAAVVLFVTGRAIYYVFFHPLAKIPGPKL

YAATQLPYLYHLTRGQWVYRLKELHEQYGPVVRYTYNDVSFITADAYKTI

YGHKTGGAREFGKDFRLYRQGRPAPSLIVTKHEDHKRQRKLLSHAFSHKA

LSEQNDLLMHYVNLFIEKLTQKAREGESVDMVAWYNFATFDLIGHLALGQ

PFGCLESGKYHPWVTKIFSSIKGISFSQAAIRLGLHNWISLITPAHVKKA

TKEHFEFTEHVAGARLDVKDNNSKDFMSYILRYNDERAGSETTATLLSGV

TYQLLTNPEAYKKLVTEIRLAFATEEDITAAAVDKQTYLLAVLSEGFRMY

PPVPGALGRTIPKGGDFVEGHWFPENVGVSVPQLPAYHSARNFKDPEKFV

PERWMDDPRYSNDCRAVVQPFSMGPRDCIGKNLAYLEMRLLLTRLLWKFD

AELMPESREWKEQKIFTLWEKGSLHVKLTEVVREKN*

>CYP53A6 FG08079.1 AACM01000324 FGcontig1.324_scaffold5

54% to 53A5

MAMFTVLPLIWLAPLGLISLFFYYIIPYFWNYRHLRSIPGPLFARLSNWW

LVYACREKSRWKYVNDAHTRYGPVVRIQPNHVSIANEEVINAIYGHGNGM

LKSSFYDASVITTYSIFTSRDRAEHSRKRKVVSHSFAPQSMRNFEPFIQQ

HLNVFLQKWDAMAANEAKFDGYADVESRVWLNYLVLDIIGDLAFGAPFGV

LAKGSEVVDFETEKGPSSLPVITSLSTRSEIAATVGALPELKPYLKWSPD

PFFRTGFNGMINLRTLGTSRITDRLNNPPGDEREKDLLERVREGRDHKGQ

PFGKGELIAEALTVLIAGTDTTSSTMAALLYHVVRTPGVLKKLQAELDEA

IPADVSIPSFEMVKNLKYLGFVVNEALRHHSTISLGLPRLVPENGNGVTI

AGYHFAPGTVLSIPIYTVHHLKEVWGPDADEFKPERWEDVTQRQKQAFIP

FSHGPRACLGRNLAEMELKVITATWARRYDLIMRDDTMEILEGLARKPEA

VNVGIRRRM*

>CYP53A7 FG08086.1 AACM01000324 FGcontig1.324_scaffold5

MSGSGLGRLGSTSPDPGASSRDNHALLDMVDGEEGISRGRSHGEVKGPTA

DLMRRLGVSPERRIKVTPEDDARVLKRIDMVVLPLMLAVYFLQATIAYAS

IFGLIEDTHLKGNQFSWLSSIVYVAQLIAQFPLAWLLVKLPIGKFTACMV

TFWGLTLTFMAAAHTFHSLLFARFWLGAFEASIAPSFVAITQMFWRRREQ

PLRMSYWYAMNGFTGVFGSLATWWLAQLPLGLKPYQTIFVAFGIITVCFS

TVLFNYMPDSPAEAKFLDKHDKLIAIERLRMNQTGVMSRQWRWDHFWETM

RDVKTWLWFALIFSISVPSGGVGSFGPLLIKSFGFDSFEAILFNAPFGIV

QLISTVGGSYVATKYHKKGPVIAFLAIFPIIGCMIMLSTPHTPDGRNTLL

GGYYMISVFPGIVPLIYSWASSNTAGDTKSPLLYKPSEAPEYHRGLSWNL

LLYMAIEGLVVLTSIYLTFLNRDHSRRRVLAGKDAVIVDYSLYSPEEADR

LRRAKAIDGQTVESAKDGTVGDRAFDDLTDLMNDEFLQDTLREPLCDSEY

LFILRDVSGNNIAEGRMWRKHSSEAVNGCLHLIWESLIK

69% to 53A4

MAITELLVSPW

APVALVVAFVAWYILPWVSNKDLRGIPAPFPAQFSNLWLLSTCRRGKRYE

IVDQVHKKLGPLVRIAPNHVSVADADAINTIYGHGNGFLKADFYDTFVSI

RRGLFNTRDRAEHSRKRKIVSHTFAPKSVLEFEPYIRQNLEIFVKQWDRI

SSNKERDGYGRVDCLNWFNFLAFDIIADLAFGKPFGMLASGADIAEVKAS

PTSPTIYAPAVEIMNRRGEVSATLGCLPQLKPYAKYLPDPFFSQGLQAVE

NLAGIAIARVSERLERGGDSTRKDLLARLMQGRDEKGEPLGRDELTAEAL

TQLIAGSDTTSNSSCALLYHIVRTPGVMKKVYEEISAVMPDGVDIPDFES

VKHLPYLGYCINETLRIHSPSGIGLPREVPPNHKGVTIHGRYFGPGTVLS

VPTYTIHHSTEIWGPDADDFKPERWETLTDKQKSAFIPFSYGPRSCVGRN

LAEMQMRMIAATWIKRYDVVLRQDVMETREGFLRKPMGLDVGLARR*

>CYP615A1 FG08183.1 AACM01000329 FGcontig1.329_scaffold5

poor match

MAYPIILIGVIGLPIIILLRWLLTYTRTVLKVRRNGHPAIHSGVMIFESV

VRSWYPRIPFLVPMEKFTLKDPFKKFADARSDMIVITEASSPNGIAYLFG

SPKIFREIGRNGDIFLKPLEKIRYRMLNTFGLQLASTQNGTQHERHKRVV

KAVFNNELMENGWQNMRNMWRSLLREEGVYPTAANSDAAPIVRDMKSTML

KVTLGAIGASWFDIDIPWNPAKETQRQNDELMPFAETLKVVWDSPFVQTI

LPLWFMEWSPSLHLRRAAWAQRSLVTHIKNAQAETRRRIEDSKDKAQVQG

RMRKYRNLIDALVDSQNDVEMAEKAEKGYLAPNVGLSDKEVQGNIFSFMV

TGHETSSHTLTWVLSLLAKNTDWQERLYAEVSKVNTLPLNEAESANGAKP

LKCLGYEEMANLPLILAATVETLRMRDLAMQMTRVASRNTTLSYTTWDGD

ATNPSEAKVQQHTITIPAGTRVHLDTAAFGVNPFKWEDPETYNPERHLRE

TEDMNGNKKVTISYEDFIGYSSGSRQCIGKRFAEVTMVCFLAHMILNYRW

EVVPEAGETQEQAKVRASTGSEQFMLTPPAYDLRFIRR*

>CYP552C3 FG08186.1 AACM01000329 FGcontig1.329_scaffold5

61% to 552C1

MDDFNIIALKRFVSPSALLGLAGLWLGYRVALALYNISPFHPLSKFPGPK

IAAASYVYEAYYDWILQGRYGRRIEKMHEQYGPIVRVSPDELHCSDPYFA

DEIYTGKPGRIRDKWQHHLKIAGAGPASQATGTAGPHELHRKRRAAHARF

FSRGQVLKLEDEVLKFAELFIQKMLRWNGKEAFEVKGAFNCYTADVFSQY

AFGEPMGFIEQEGWEPNFGTWTSSFLKTTYMMRHNALARRLADILPIFAD

YMGEDVKRIMHQMNHVIPAYIKTALANPDGGRVFNEILNSNVLPEEEKTM

FRLSGEGFVFLLAGTETTAAILTVMTFQMLHQPKVYARLMKDLEGIDPNN

LKWAQLEQRPYLWALVQESLRHQPGAAGRSARIAREEDLFYKSQDGKTQF

MIPRGTPVSMTAMINHWDTRLFPDPDSFNPDRWLLPDGKPDYTLQKFLIS

FSKGSRVCVGESLALCEIYIMAALMAFRVIPKSELFETTIEDLTYDHDLV

VLQTKKGHISTRIKIS*

>CYP622A1 FG08187.1 AACM01000329 FGcontig1.329_scaffold5

37% to 595A1 35% to 596A1 looks intact

MDFSQNTTTLGVGDYTPEGAGLVAAGAIILVLSLLVLVSPKEKIPVINKY

PNDWFSIKAQIAFVTNADGLIKQGFAKFQNPFRMITLVGDRLILPEDHFE

WIRRHGPQLDHQPLVRKDFFAGYPGFNGTAAISDPSKLLANVIKKKLVQN

PHVSKLHKSVQRDILAAWPQGCDAWKAVDWAKDGLNLISRMSASVFVGEE

LSHDETWQQVSTNYGMTVFLAARALRQWPRWLRPLIQWFLPACKSCRAEV

KRAREVLEKNLAKRAAEGKEHDDSITWFSEIAAGKIYDPVAAQLGMSMAA

VVTTSELLKQTVIEICSHDLITPLREEIEAVVHEHGWSPAALTNMRLLDS

VIKETQRMNSAVIVNLDRQVLSPVTLPNGQYLPKGTALSIYMSRLRNPEV

YENPDTFDAYRYAKLRAQGGKWTYASSATSTSEDHFVFGIGKPICPGRFF

AVAEVKTAIATILLDYDVRLAEGYTPKLMPFGFELFADPGVQLEVKRRS*

>CYP635A1 FG08191.1 AACM01000329 FGcontig1.329_scaffold5

35% to 553A1

MSLTSNSKQRKEPIVTLPMLNGKLYVINSPDLIQAALRNNDISFTPFILE

SSKAMWGLSDNAMASISDLANLKGGMQIIHSTLGGESLHKLNISSLSRFM

TYLNRVKPGENIGIADTYIWLRDMLTDASATAVYGPKNPITVDKMHLVWY

SLLQSIYSTCSNSGRDYDKQALLVAIGLPSFVTKAAINARLKVNNLLLSY

YKNGGNHEKGASEIIQQRATYLRKTGFTDDDLSHMEFMILWVGVTNTAPV

LFWLFVHVLTSAGYTSRVRAEIEAITIITKTPEGRKATFDTRLLEKSCPF

LNACYQECLRHYSHSIGNRRVMQDTEIQDSQGRKYLLKKGVNVQWPPPVT

HFNTEVWGQDADVFRPERFMDVTPQDEKKRRGALLSFGGGKHLCPGRKFA

YTELLGLVGVVALGFEVKGLELPESKYAGIGIGGKMPDWENMEKGFGLRR

REGWEDVTWVFDGDN*

>CYP633B1 FG08207.1 AACM01000329 FGcontig1.329_scaffold5

poor match

MALTEGISELLLSKPVVLGLAACALLFLIGRAFEPTVDALEPPMLRPSIP

IFGHFYSMMKDQEAFFKRLDKKYHMPIATVPILKYKMYAITDPILVQSAY

CNKNLSFTPFAINGAQKVTGFDDDYHKVLMETNVLPEYFKSLYDGTTAQH

IHQLNVTSLKHVSQHINSIQENGMTIDNTYLWLRNLMTVATSYLFFHIFN

SKTLQRTKEARRRIQLALGKWCTNMRQDDERVSAYIRNRVGILRNYGVEG

QKLGDIEVGLIHVPTSNSIPTLFWFFMHVFTRPDVVEQMRAEVEHIVQRG

PDETVTVNIDDILERCPLMISAYREASRLCNGFTCNRIVMEETTITDRHG

RSYLLKKGSSVKMPAGVMHASQEVWGEDAAVFRADRFLDKGLTSEQAKLR

RAALTPFGGGAHMCPGRNFATAEIYGFMTALLLGYNVEPVDGKWDAFKPP

PMATCPQSTSVCKPEDEASVCGTRLIRRSGWEGAQWKFVSGKVTE*

>CYP584D1 FG08320.1 AACM01000333 FGcontig1.333_scaffold5

39% to 52F1 38% to 584B1 40% TO 584C1

MFSLLFLQFFEQHFIATAILLLLPIPLRAIETYLRRWRLAQAQGCQDAAS

KVPVKDPIVGFDFLYKVFFGKAPERYLDSTWQAFKEMGTTYIERRWSWQC

VYTCDPHNLKHILASACEDFDLPEFRTSVIGHVFGQGIFVLSGHTWKHAR

AVLRQSFRKGNPTPFLETLERNFQAFSKHVPTDGSAFDLQPLFLAFAMDV

STEFLMGHSTNMLSDKADHTREQQFVDDYMICSEEIIQQMQLGPLHRLKF

NFAANRAKKRVYEYLDIFIEES LNSPRQGSKVSFLTDMMAIAGDRKGLSD

HILHILLASRDTTSSLLSNLFFFLSKNPRIYNKLRDQVLNVAGHEPPTAS

QLKELTYLKWCVNESLRLHPVIPTNARVAVRDTTIPRGGGADGTSPLFIS

KGTALFYNVYAMHRNKDVFGPEPEEFIPERWEDLRPGWGYLPFNGGARAC

IGQQYALLETHYVVARMAQTYTLLESRDDGDWMEFLDWFQWSIWTEDLMG

ANR*

>CYP544A3 FG08377.1 AACM01000335 FGcontig1.335_scaffold5

59% to 544A2

MALLSVNLRDGLILTAVITILLYIWEKKTAKITRNGEPLRKPPNTLPLVG

NGIIFLQPRQKLFSWFHRCERLYGYETLHITVPSLPPGVIVNDPQNLDFI

FRNEGVFEKGEFFKQRSWDLFGHGIINVDGEFWRLQRKAGLRFLSAAALK

TLTNEKLPKYLDQAIGVLEAKTNTKEVVDLQAVVHEVTTQLMGRMAYNME

MHADDDFTVAFEHASGGTAERFQNPLWFVTEMFTGARMRRSITTVKAYGK

RIVTSAVADRKEAEGKTQSDAPGSLIQSLLDSIGDETLVADAALNYLSAG

RDTVAQALTWTLYLLMKNPHVATKLRQSVESLRDEDTSTGDDPELLTPVR

LPYVLAVFYESLRLRPPIPFEIKQAQQATTLPDGTFLPAGAIVVWCAWAM

GRSHTTWGPNADDFRPERWLTTSLAGDVTVAQRPAAEFPVFNGGPRTLAR

LVPLFKFEPAFEGERVSKSSLTLPMEGGLPVYVQHQTPS*

>CYP630B1 FG08412.1 AACM01000338 FGcontig1.338_scaffold5

31% to 53A1 poor match

AACM01000338.1 revised

MYAQLVTASTALCLVTYFILYPIFQYLRDAKGLRRYPNFHPLAGVTNLPF

VREAARGFRSKTLYEMHKTHPVIRTGPNSLSYGSVQAIKDIYGHGTKCTK

GEFYETLAGTHYHLADVVDKADHARKRRALSAAYALKNLENWEFKVADKA

ERFIRAADAACTLPLKRGFARPGPEDLKFDYRAFTNFFTLDAIADIGLSE

RLGFLDQGHDLVKGERMDGSIHHVNFRECLHSTARAQSILAWTEKWYNAN

VKLSKLFSKDFRKWWNLNEGWNDIVYHRATQRLERYNKGEKLPDFFQALM

DHSEANPPGLEWGEIVAEVSIMMNAGSDTTAIAMNNVMYWLLKNPSCMAK

LRQEVDSVLDPEEVVAPYDKVKHLPYLRACLDESLRITPPTTFGLPRRTP

PEGWNIMGDYVPGDTTVSISAYVAHRDPHIFPDPESYVPERWLGEKGKDL

QSYFISFSTGARGCIGRNISYLEQTVLLASVVHRYEWALPYAKWEPSRTE

AMNLAPGPMPLKVWRRDLGGDENDEKHG*

>CYP542B1 = OLD CYP580A1 FG08809.1 AACM01000355 FGcontig1.355_scaffold5

AACM01000355 Gibberella zeae

MAVQETIAARNWQQTGCFFAGVWLVYIVALVVWRLWFSPLAHIPGPKLAA

LTQYYEFYYDFVLGGQYNYKIIDMHERYGPIVRINPWEVHVGDPEFFSDL

YTSPSPSRRRDKWTFYTQQSGAPRTQVPHPNALAAPKTATEGSLAAIDHG

LNKLRRSALIPLYTTQTVRELQPVIEERVEALLTAFMNYAEVSNGQPLDV

MYPYSALTNDVINEYAFARSDHLVEKPDFGAEVTNDLLIGTHMGPCVQQL

DWVLTLVNALPESISNRCMPGWGGFLKMKNDIFEQIHSVDPPQSTGKWRM

VGGHPTMLSTRARSTREKNASRQAQESQISVQGGALTTSWAMSLATFHLL

NRPETLRKLRDELFAAMPDAYETVPLSRLEKLPYLRGVVKEALRLGIGTS

SRLARVAPDEALVYHDRENGEDWNLPPGSIVGMSPYKTVMDESIFYDARG

FHPERWVEDGERLDKYLDIFCSGSRICLGMALAHAELYLTLAKLFRRWGS

GGVVFGSDDGDQRYGDVGYLSIFETRVRDCEIDADYFMPIPYKGSEGFRF

SFETY*

>CYP619A1 FG09086.1 AACM01000370 FGcontig1.370_scaffold6

33% to 530A1 poor match looks intact

MTAYNNVTLSLWALFGALVLYLLTVPGRRGKHLPPGPPTLPIIGNLHQMP

TRKGYLKLAEWAKQYGDMYSFKIGSTTTIVLSNRRLVKEILERRSVISAG

RPAVYGLEKLVFGGHFILLQQPDAPMYRISKKLLHQYFGEPAIDRSHLRI

INAEATQLIRDLMVDPDNFPHHAHRYANSFTMSTTYGIRTPSHDTPHLTA

ITKITAQATSLIAPGRLPPVDVFPFLKLVPERILGNWVTLCTNLGKASDK

LYMYILESVIERRKTKAPRDTFADRCLDNKEYEFSLHELMYLTGAVLDAG

TDTTSSVLITLIQMLCAYPDCLKRAHAEIDMVVGDERTPVWDDFAKLPYI

NQLMKETQRIRPATPISFPHKVLEDIWIDGKLLPKGATIIANVTGLHSDP

NKFKHPGEFHPDHYKGMQKLAQGYANTADENKRDHYAYGFGRRICAGMQI

AERSLFTTFSKVLWAFDISAPKDAQGRPVAMNLDPMTGYTEGTIVMPKPF

KACIKVRSERRRETILREFEEAENNVFAQFDLPKIGEGI*

>CYP623B1 FG09195.1 AACM01000371 FGcontig1.371_scaffold6

33% to 559A1 looks intact

MSASVMDLGPELLARLPTLTSPLGIASVAAILLISLFITEKLLSVPYPPS

IPLIREPEGARRFSLRTRWQYLTNCQPMYYEAYHKYLKQGKAVVVPGFGI

RIEVLLPQNQMKWTINQPDEVLDQGLAFAEIDQVSWALGHNRFVVDAWQG

MIVKTEMNRTIEVVANAMKEELREVFDEQFGTDTENWKKIDLTPTIKMII

AQAASRFTVGLPLCRNKEYLQNALDTNELFILNAGLTGGTVFGWLVGSKV

SQLKKWIVPLLKQRVDKIKNHPEEPEPQDLLQMMIKYALRERQDEAENWD

SMTRRVVAQNFGAIHNTQIHVVHLLLNVIGSDAEYNTISVLRDEMDRLLG

SDDTEGWTKAAIQSMTRADSVSRESIRLGTFGTRAVFRKVMTDDFKTQDG

HHLPKGTLLSFNSFQAQTDDELYEDGLKYDPFRFSRIREEAASRGEKAPP

ATFVTTSPEFLTFGHGKHACPGRFLIDFEMKMILAYIVKNYDIKFPDEYE

GKRPPNVWITEANNPPSGTHIMVKRRAQK*

>CYP531D1 FG09351.1 AACM01000383 FGcontig1.383_scaffold6

36% to 569A1 (531B1) 36% to 531A1

MALFTLSLGYLMYAGVAFVIARVLYEFFLSPLRHIPGPGPSKYTDFYRAY

LTTKGHVDSHTRAWHRKWGAAVRVGPNTVSISDPDLIKVIYTTRNPWRKT

NMYRPNDVLVNGQRIQNIFNTQDEDFHLKYTKPIRGFWTLPKMLEAEPLM

DETLCELITHLDNRFASTGDVCKMDDWVSYYAWDAAANISFGRTYGFMDK

GGDVEDIIAESTAGLKYFAPVSQIPWLDEWLDKNPIHRVGPRPLVNGVIY

TIKILTEYQQQLASGAAKRKPVDLFIDKYNSLKETVDYVDDQQVINWLML

NVLAGGDSTAGAMRAPAYHLLKNPSVCEKMVAELRSANLTLPVPQWKEIS

QLPYFDAVMRESMRISPAVGLILEREVPKEGLELPDGRFIPSGAKIGINP

CVVTRDVGVFGEDVDVFRPERWLRGKGETEEGHASRVRRMHECTELMFGH

GSRVCMGKYMSKLEMYKMFATLYVNFDVRITDPSHTWKYENNWFMYHRDI

PCKISRREKA*

>CYP616A1 FG09671.1 AACM01000401 FGcontig1.401_scaffold6

35% to 582A1 looks intact

MLVPFLSAVATLMPSLLMGIFILCLLGFSAITFNIFVYPFYLSPLRHLPG

PTDNAFFFGQAAKFLQVPWFPELFCQWSRDHPGAPFIRYLNFANSETLFV

NTIGAYKQVLQTKSAFFVKPAFARQFAHEIIGDGLPFVEGNLHKLRRAAI

SQPFSAPRLREFYPTVQGKAEQLVRVLSQRHDKNGNVEIETNVWKTVLDV

IGLETFGLDLNHLESNESPLFETFTTMMQPSALGHIVNYLNSLVPIRQFI

PIAECVEFSKSCTMVREFILCLINIRRNLGEKGFINNQDALQCLLEHNDA

DWNDESLVEYVLNLLVLGHDTTACSITWAIHELSRRPDCQQRLRDEIKIL

DDTCPMISFNDIDKLPYLHNFVREVLRLYCAVAMAPRQATEDVEIEGVII

PKGTVVQLSPAVMNTHPSVWGSDAQVFNPDRWNGLKGDAASAYAFETFHN

GPRMCIGKQLSVMEMKVMLVEIVHKFEIHKPFGDEFKEVAVAGPTFTLRP

KEKLVVRLVELLYDARYTIQHTPMTYPFPF*

>CYP534C1 = OLD CYP588B1 FG09916.1 AACM01000411 FGcontig1.411_scaffold7

44% to 588A1 long C-term

MQTVLLLVGSAILYAVYKYVSGLRCNIEAAKKSGLPYIVAPWSPISVPWV

LGYKGLVPIIKLLPKPLWEEWLEVLTPGFSYNTRHDAFARHGDVFIIVSP

NMLYMMTCNAEAIRQITSRREHFPKYVESYEILRVFGNNVLTSEGAIWRN

HRKVTSASFNERNAALVFQEAIHQAQGLVNMWMGPGGEDSGTINTLDEDT

MRLALHIIAYVGFGLKLLWPGESLPAKANLKMAKYGSPEATAGHKMSFVA

TIATALECILLILLVPRWILAMMPFKKTRLAADSHDEFSKYMHELMDEKI

EEARKGEHVDGMDLMGQLVRSSYATGIGEGMQSKKGALSRDEIQGNAFIM

LVAGHETTAGALHFILLELANNPASQRRLQNDIDEIFGGKEPSSWDYDAL

IYPMMASMLGACMNETLRMTPAVVEIPKKVPPKQEQVITIDGNSHLIPGS

TIISLVAVSIHRNPRYWPGRPSHIYAGEDDINDWVPERWYRSYEAAAKPT

ESDIAAPENEDFGGYKGPDTSSQLFRPERGAYIPFSDGPRSCLGRRIAQV

EIIAALAVLFRDYSLELGVDEWANDEEIERMNKEGRRKVYAKAQSASRAK

ILGATSLLTLKMNGDYVPVRMVKRGQERVQ

CGINGDERVAKKCRVARVTR

LPAHDYFSNSKFAARKKSQVVKHADWCKVTVIPPK*

>CYP631A1 FG10329.1 AACM01000425 FGcontig1.425_scaffold7

MGLYISPGWRQLDVAIIGGGVGGMSAAIALRRAGHRVSIYERASFVSEAG

ASLSCAANGTRWLKEWEVELERGDGVVLRKLISRDWTTGKVLSLYELDDY

EDRWGYVYYMFQRQRMHDMLKHSALGEGAGEPAKLWVDHKCERIDMDTGL

IQFENGRTVKHDLIVGADGIGSTVRGILDIWPKRQPADSSCLHANVLTKD

AVAAGLVDFSKDQALQFWGGQGELWDKIVLSPCQGGKLISYYCFFPRDKG

DYIQHSWGGENRPVEELLAPFPTLDPQVRAHLALGKDIQPWRLWKHEPYP

YITKDIVCLVGDAAHPMMPHQSQAACMAIEDAAALGILFSKRHFNGDVAE

SIAMYQDVRLPRATKVQAAAARASENINERIGFSSNVNAPVYKVKGEQEK

LTIEEMNAYDMHMHIEELACNKAGQPFTYKYIRGLPIGLKLSNGYTVGGL

YPFAPSKAALGQTSSDRGCSPCDEVPGNGRSIAYSNDCLRSFFGQLTTSQ

bottom half  = P450 related to 531A1 low 30% range

seems intact

YVSSDFALAFLAIGFSSVLIYQLAHNYRRLQHIPGPLVAKLTDIHRFMLV

RSGFIHLYQASAHERYGSVVRFGPNLVSICDPEAIQEVFNMRNGFNKSNM

YRAFRPWTPAGLLVSVFTAKDDIVNRQMKQHIAVYFSLSYTAASFEERVD

NAIRIFFKQLDSQFVTTGAKIDLTRWFKFFSYDAMGLMTFSRPYGCLENS

SDAAGIISDVKNSMLAIGPMTQMPWLDWLLHKNGLINMIKPEPVSALLKY

VLARISERRNSPKAMHSTVTDGPDANGDFLGYFLQAQEKKSNKVPPQFLS

TWTLANILGGSDSTASMLRSVVCFLVENPDALETMRAELRDKKQHAEGSS

APIPKWTKIQDLPFLNACVIESLRLDPPFATTLERVVPPEGVTICGAFYP

GGTVVGMNPYITNRHRPTWGEDADQWRPSRWLEGDPAHIRKLQASLLSFG

AGTRGCLGQHVAVFEIKKLVVALFMNYNLNLVRLLSQFSKGLS*

>CYP53A8 FG10451.1 AACM01000435 FGcontig1.435_scaffold7

63% to cyp53A1

MAIVDLLFTWWSLPIAAGLVAASYLYSYFITYGHLRDIPAPFPAQFSNLW

LLYVCRRGERYRVVDQIHKELGPVVRIQPNHTSIADAEAIATIYGHGNGF

LKSEFYDAFVSIRRGLFNTRDRAEHTRKRKLISHVFSAKSISQFEPYIHA

NLELFVKQLDKLVASGQMAKNGKREALMDCLPWFNYLAFDVIGDLAFGVP

FGMLASGADVAEVRDTPDSPPIYASAIEILNRRGEVSATLGCFPQLKPYA

QYLPDPFFSNGLNAVKNLAGIAIARVKNRLDNPPSIERMDLLARLMEGRD

EKGEPLGREELTAEALTQLIAGSDTTSNSSCALLYHVTRTPGVLEKLQSE

LDNAIPSEVSVPTYDMVRDLPYLANVINETLRYHSTSGIGLPRQIPPNSP

GVTIKDHFFPPGSILSVPTYTLHHSKEIWGADADDFRPERWENPTELQKT

AFNPFSHGPRACVGRNVAEMEMKLIAATWARRYVPELRQGVMETREGFLR

KPLGLDIALMMRE*

>CYP617C1 FG10461.1 AACM01000435 FGcontig1.435_scaffold7

35% to 547A1

MSVIGLWLVTVTATLSLFVWQLIFLLSIPKSIVVCLIAESLFFVAWFFYW

TVIYPRYLTPFRHLPTPASRSILTGNQNGLFTENSWDVARRVSQTVPNSG

LIRYYVALSNERILVTNTRALSDVLTNHSHDFGKSNLAKFALKRLTGNGL

GFLEGNEHKVHRKNLMPAFTRKHVKELTPIFWDKAMEMVKGMEAEVRCGK

DTSTQGTGIVEIHDWATRATLDIIGTAGFGYDFGTLHNPSNEIGQQYKKM

FLEPSTAFNWLELLGNYIDFRFLMTLPVKKNRDLTAGSNFMREIAKKVIR

ERRHELFQRMTSQAGNMKNTKKDIITTALASDCFTDDQLVDHVMAFLVAG

HESTATAFEWAMYELGHRPEMQKRVRDEVRTYLPSPSAGGVKNITFESVP

YLQAICNEVLRLYPFLPFATRVAEKDTWVADQFVPKGTIVAYAAHISNRD

SELWSGPALDAFDPERWMEPGKESSGGANSNYAMLTFSAGPKSCIGEAWT

RAELPCLVGAMVGSFEIELVEGKQADGTVYPTVDFKMGKVLKSRDGVFVR

LRRLEDW*

>CYP5065A1 FG10571.1 AACM01000442 FGcontig1.442_scaffold7

38% to 546A2 name changed, formerly CYP546B1

MVVKLFVYAAVAVGLTYLVLIFPRLQQEYKLWSHRSQLPPGPKTIRTGIR

KPWLWFQELSQQYGDVVYLQLGPTPTIILGSAQAAWDLLEKRGAVFSSRP

RFIMGGELLSGGMRGLMAPYSSYWRRWRKLLHSGFMQRQSETYRPIQSLE

SKVLMHELLKSPHDFRTHLERYAASVIVTVTYGRRVEDVRSDIVVKRNGE

AMERLTMVNIPGKYAVERYPALKYIPSFLAPWKKQVLQQREKDIQLYTEL

MNEVREKVTRDTAPTCFAKHLLEEQHNLGMTDLEIAYTAGSPFGAGVETS

AGSLASFLLACVKFGPQFIPKAQEELDRVVGNDRLPTFDDLPKLEYVRAI

ASETLRWRPVAVLGGTPHASTADYVYKGMFIPKGSTIIAPLWTLHLNEAD

FPQPHEFRPERFMEERDYPGTLGHSAFGWGRRVCPGMHLGAASVTLNIAR

ILWGFEVNPEKDEKGRDIEVDIFAYSEGFNSSPLPFPCSITPRSTNHTEV

IEREHENALDDLVEYTAIASKVS*

>CYP644A1 FG10610.1 AACM01000444 FGcontig1.444_scaffold7

MDRVISNTALSPTSLVVLNSNQPPRLQDKIPYITNTIQYLTDAGRFIDRV

KEKLEKANSDIVRFNVGFIPAYVVRGPDNLLLMDKHWGMHHHEIAKFAND

KTGRGKAPAPGTETVPESERYWLGHDRLYVNYLANRQNSDALADVFHRTF

LQQLNSLSEEWSTINLFETLKTLMATSAITSLFGTRIFDLNPDLINVYWQ

FDDIAGHLVWGLPKFLQRRSVATKDRLHSMTLKYVNSAWENFDWDSSESE

SPWDPHFGSRLCRETAKWFRENNFSNHAAAGHAVGALFGLNGNTIPITTW

IMMHAIQDPVLFEALRKEALSVYEDDPLTGERHVNTQKLINLPLMQSVYV

EAMRVHVSFNVTRQASQPLAIGGYAIEKGALVQACSKIAHFEESTWGVEG

HPASEFWAWRHIKSVASVDSATGKAVHQDQFAMKGRPSSFFPYGAGYVMC

PGRFFAKQEILLAVAILVANFDIEFEQWIKEDGSDSDRPAQDDGRYAAFI

AMHPDREMV

second half = P450 38% to 526C1

MDELKVLKIPGAVYVLAGACVLVYFIYQRAYPRPLAGIPYN

KHALKRFAGDLPEIQERQKDGASIRPWFLEQAGKHQSAIMQIFLGPFASP

AVLISDFREASDILMHREADFKRGKKVDVFKGVLPHAHPAMETWDPRFKN

TRDLVRDVMTPSFLHSVSAPKVREVSIKLAELWKLKSQFATGRPFDVAEN

IVEFSFDAILSAATGLGPSGGDVNQQVLHLAEVLKEKPLESSVDIHRPIE

VPALDRSTKLKSLVTDEETLWKGFYMPWPGLYHMVNGLRPQVKDARRVLR

NYINSQITDAIPRLQTDGKPECALDYVIQREIKAALKEGRAPVLDDPRIR

DQIYGYLIAGHDTSAGTLSWIIRRLMANPEEQVKLRSSLRETYRAAWDEK

RIPTAQELTSHAPYLDAFLEEVLRYNCPVVTIMIVARRDTIILGHAVPED

TPVFLNLTGASMSRPSVPVDESLRSKSSKSYKPARENWDDMDPEMFYPER

WLVEDQDGKKSFSASAGPTLAFSAGNRGCWGKRLGYLELRVVLSILIWVF

NFEEVPEEIVNWDTYDSLVTAPKECFVRLTEAYPGAI*

>CYP526F1 FG10629.1 AACM01000446 FGcontig1.446_scaffold7

37% to 526C1 50% to 526B1 50% to 526E1

MALLTFDSIKYPVLAGGLLLVGFIYTIYRSILPRPLEGIPYNVAATKRIF

GDLPEVRAYGSLTDWLATQAVKHKSPIFQAFIRPISKPWVVVTDYYEASE

ICTRRFKEFDRGSASTSIFKGVVPGSQITLQSHNPQFKKNKELVRNLMTP

TFLSEVSAPEIYDKFSRLVELWNLKLDHADGKFFAASRDIHHAALDIIVC

ASFGIDTQDTQLVKEKDQLSIEPRSENDGEISFKEVPLREELGALTVLSE

SVAKVVRTPSPPLFHFLYRNLSSQMRNAIALTRKLQRREIENGIKRRENG

EAMKCALDEISVREEATAKKEGREPYYHSQAIASELMSYLIGGHETTSST

IRWGISYLNRDQRAQSELRKGLQEAYQQAKAEKRPPTLTEIIQTRVPYLD

AVIDETLRVSYTFGMTLREAVVDTQLLGAHIPKGTAIAFLSNGPGVLSPP

IQYDESRSSEWVRARKPKQPVDQEYAFPDFVPERWLKSVVNEAGKEEVVF

DSQAVPIQAFGQGPRGCFGKRLAYLEMKIFFTLIIWTFEFLTLPAHVATP

KEVSSLTRHPDRVFIKPRRVVL*

>CYP567B1 FG10695.1 AACM01000446 FGcontig1.446_scaffold7

39% to 567A1 38% to 65G1

MAATLIVFGGLLLLAWLVNIAYRSLFHPLAKFPGPKLAAVSDIWYAIKWT

SGRYPFIMEETHRKYGDVVRIAPNELSFATVQAYQDIYGHALKGKKKFVK

SNWYDTAGDHPGIVSVRDPKEHSRQRKYLSHAFSAKSLRGQEVLVHGYVN

LFLDQLR

KLGSSEGEGINIEEALNWLTFDIIG

DLAFGESFDAVANGKTHFWVSIIIDATYTSMLSALRKRVPLVN

LYLPFVVPKDAKATYQKHRALTREKMLKRLDMPNSEDRGDFFASLLRKGG

NEVPEPELLQQSNTLIVAGSETTATCLTGIVFCLLSNPSCLEALSNEVRS

RFQSDSEITGDATADMKYLSAVIEEGLRIFPPAPFGLPRISPGAVIDGHY

VPPGVTVSVDHWTTKHDRRYWKDPYSFIPERWIDEGFGDTKQASQPFSLG

PRACLGINLAYLEMRIIIAKMVYCFDWELPRLMVRFHPHN*

>CYP641A1 FG10910.1 AACM01000454 FGcontig1.454_scaffold8

very poor match like CYP7B

MDSLEALRAYLNENLIPHAQRYPLQAILVTTIVLFITTRLFTGSPSSVRK

DGSKTPPLAPFWIPLFGHAPRIFLNPSAALTRFRNRYGQGVFSVRLFQSI

HSFVFRPSLAARLLEQPDSVADKEFITRHIMMTNFGLSKKDLAAYDKAAG

EVYQVTKEHLSGSHLDDLAKATLRDLDDNAADVISFNCYSTDQMDWERLA

NAELLEDIKDENIMAVDFFELIKTFIARTATISVFGTDFVEAYPDIWPHL

WIFNNGFHSLAMGVPVWAPFPTSQRARIALGRLLTFMREFHDEFETFLSG

EEPGQKWQDFHTVSPLVRARAEVYRKHGLSSDVRAAFDVSLLWSTTVQTT

SLVSWSLFELYQDPVLLSQIREQITPCVQIVQPNHDFGGAVWIPPQIKKL

DLEGLLTKCPLLQGVYLETLRLYGGGWSARYLKEDFTLKDKEDSFVLKKG

TFAHVINNLHHSDPRCFTDSKIWQAGRYLEDTVDKKGVKTQKVDPYTVKA

SDGTLTMCDDSEFTLRKVLMYVSVFISLYDLQPAGSESWPSPSIVKGVAS

VQPWSSLRLWVKRRTPPKDN*

>FG10960.1 AACM01000456 FGcontig1.456_scaffold8

very poor match 39% to FG02668.1

linoleate diol synthase not a P450

 

MASNQVKNGAVASNGYGKEKSPSSASSSQKNEVPAPPHNKSEGLVKSIKK

LRLASKRPLPTEMGDGSYRQVATRPGLKQDVRRLRGKDLKTLLEIISSKL

KGEMQQDDKTMIMERTIQLVANLSDHSKVQEALTNSFIAQLWNSIDHPPM

LYMGNKYRFRQPDGSWNNPYLPQLGAARTPYSRTVRPKGMSLGAQPDPEA

IFESVFARGIFRKNPNNVSSILWYWATIIIHDLFWTNTKDPDQNDSSSYL

DLAPLYGSTVKDRDSIRTFKDGQLKPDCFADKRLIGNPPGVPIILIMFNR

FHNHVATNLADINEGGRFSKPGAHLDAEAAAAAWKKRDEELFETARLVTS

GLYINITLIDYVRNIINLNRVDTTWTLDPRQEMGVSVGTKNLSESGTGNV

VSAEFNLCYRWHSCLSEMDEKWVEDFYTELLGENYGPMNLQTMMRALKAF

EATVAEEPSERTFGGFKRGPDGKFNDDELVEALATAIEQPGGAFGGRNVP

RIMKPIEMLGIMRGRKWNLAGLNEFRKHFGLKAYDTFEDINSDPEVADAL

RNLYQHPDYVELYPGIVAEEAKTPMVPGVGIAPTYTISRVVLSDAVALVR

GDRYYTIDYHPRNLTNWGYKEVDYDLNINHGCVFYKLFLRAFPQHFKGNS

VYAHYPMVIPTENHKILTDLKRVDRFDFSRPAPTATRINIVGYKAAKYIL

EDQAKYRVCWEEGLKHLMGEGGGRFMLSGDTALHAQQRKCMGRLLYNDTW

RNAVKSFYSTTAEMLLNEKSYTLAGKKQVDVVRDVGNVAHTHFVARMFNL

PLKTKQNPKGVFSEQELYMILAVIFVCIFFDIDPAKSFPLRQAAREVAQQ

LGKIVEMNVKLATSVGIKGLFTSKPNKNDDPLAAYGENMAKGLKKAGLSI

DDIVWSQILPTAGAMVPNQAQVFAQTLDWYLSPAGEKYRPELHRIAALET

GDETDALLLGYAMEGIRMAGTFGLYREATTADVIQEDDGREVPVKAGDRV

FVSFVTAAKDPNIFPDPEVVDPRRPLDSYIHYGVGPHACLGRDISQVALT

ELFRALFRKKGLRRVAGAQGELKKVPRPGGFFVYMTEDWGSIWPFPTSMK

VTWDE*

>CYP625A1 FG10991.1 AACM01000457 FGcontig1.457_scaffold8

26% to 53A1 poor match in 53 clan looks intact

MPLILSITSSGTVLVLLTLLSLAAVVILSTYRLIKYRHIPGPLLCRVSHH

YVTLFDLLRQRPQTVAKWHRQYGPFVQIAPGQVSISDVTAMRELYSSSAR

NPKSGYFDNFLYHNARAIFAEKEYLGHREKRGLVSSFFQATSVYKPDIQQ

PLRDRVLAAMMRIEENIITSGQGVVDVMPIINHYAWDNTTSLVFGPCHSS

QALQGDENDRNLLARLKNSEMWGAVKNNLPIVFSGIKLAVAVYTRSTKYF

SAEDDLDKWAMQRLYKTTSDPKSSQDERSIVQLIQHLRQNGRPLSDSYLE

SEIIDNLYAGQATVTVALTYAVYHLSRNPYWQSMVQRELDGLPRDADGLP

NWTLLNKAPILEACIRESYRLNPVASGRAERVLARDSRYGDIFIPQNTIV

SASTIALHLDPQVWLNPREFNPRRWLDATPDEILRLERSFIPFGYGARLC

LGKAFANLQIKMFVAAIYSKDNTGLEIPGQTMEQWGTQDALPKGLKCRLR

FEERK*

>CYP68K1 FG11002.1 AACM01000457 FGcontig1.457_scaffold8

39% to 68B1 43% to 68E1 missing N-term.

MIDEIKNDRRFDFGAAASDDNHAYIPGFGALMHDPVMPKVIGRHLTKALV

LPAALGASANQLLQEWHILNVNEDISTIVSRMSSRVFMGEDLCRDQGWNN

ASAYYTRKTFKAMMILCVIPRWLRPYIHWVLPQCREVRRALAAARKELNP

HIERRERTKAEALARGEEPPFDDAIEWFAQSGSELPPADCQIALTLAAIH

TTTDLLSQTMVNIATYPEIFTALREEITRVLSEQGLKKTALADLKLMDSF

LKETQRMKPILIGWRRRALADVTLSNGMTVKKGNKVVVTAIHMWSDGNYN

NAKTFDPCRFVPKDKEQMSYLVNTSANHLGFGHGTHACPGRWFASNEVKI

ALCHLLLKYDWKLVDGKVPEPVAFGMAYVANPEAKLLIRRRKEELDLSML

EY*

>CYP51F3 FG11024.1 AACM01000457 FGcontig1.457_scaffold8

50% to 51F1 Nc (third CYP51 in this genome)

MESLYETLRTLPLSVSIPLTTSIIIILSIVTNVVKQLWFPNPHRPPVVFH

IFPFIGSTVQYGIDPYAFFFDCRDKYGDCFTFILLGKSTTVFLGPKGNDF

ILNGKHADLNAEDVYGKLTTPVFGEEVVYDCSNARFMDQKRLLKLGLTTD

SLRCYIPKFVKEVEDYVKNSPYFKGDTGIVNITEVMAEITIYTASGSLLG

NEVRSMFDSTFATLYRHLDDGFQPINFVMPGLPLPQNFRRNHARKVMEKL

FSDIISKRRETGNQGDETDMIWMLMNAQYKDGEPLPDHHAARMLIAILMG

GQHNTAVSGAWLLLNLAHKPHLVQELYEEQTQVLGSPQEPLTWENLQKLT

LNGQVIKETLRLHSPIHSILRQVKSPMRVPGTEWVVPPSHTLLSSPGTMA

RSEEFFPRPSEWDPHRWDKIEPLVKTAEDGQTVDYGFGVMSKSVSSPYLP

FGAGRHRCVGENYAYAQLGAIVATFIRLVHIEQPDPKAPLPAPDYSSMFS

RPMNPAEIRWRRRETVE*

>CYP552B3 FG11038.1 AACM01000458 FGcontig1.458_scaffold8

61% to CYP552B1

MDSNYDSVQGAIASLTIRQWVIVTVVSWFVYKIVEALYNISPLHPLSKVP

GPKLAGATYLPEFYHDVILVGRYTHAIQKMHEKYGPIVRINPNETHCSDM

AFSEEIYAVGGRKRDKPFHQVNGSAAGTGNAFGTPDHDVHRSRRGPVAKF

FSRAMIARLEEEVHELAQTLCNKLLAESSGKEKSAPIDVAHAYSCFTSDA

ISSYCFGEAFGLLSRDTWRPTFREATLAVLKPVFVFRFFPFLVGSVKYGK

HFVDYLPADAAMLVRTLQIDIPARVTKTKTDLNSGIVYERPTIFADLLQS

ELDESEKGTDRLVEEAVTIVNAGTETTSWALAVITYFLLSQPETMSKLQA

ELATVVDDPRHLPSWTTLEKLPYLGAVINEGLRLSYGVSSRSARVPTTED

LIYRGEFNKQHTTIVLPRGYAIGMSSAISHHDESVFPDSYSFTPERWIDD

DGTIRKNLERSMLAFSKGSRGCLGKNLALCELYLSLTALVMRVMPHMTLY

NTSERDVRYDHDMFIPVTVKGSTGVRVTIEA*

>CYP640A1 FG11108.1 AACM01000459 FGcontig1.459_scaffold8

poor match

MESMIITPEMNSTLKIADVQAHDLPLQHNFLSYLFGLLIATYIVWQYFLR

TGVTESACSEPPMLPYWIPVVGHTFSFLTNTHNTIMSGRSHFKSITHPFS

LLIGGRRTYVVLDPHYIGKVYKKTKDLVHEPFIDHLMMCIGTTQKTRDIM

WNTMIGDSSLTDSALDWLREEVSQSPSSQPFFDRFMMELDHGLQQGDPLT

TGRLREHNMLKFVETIIITVSTNSFFGKVLLKQSPEILDSFPIFDRHVWK

MVFRAPKFTFMTAHNAKGSVIDGLTKYFDLPQSERQDAASFILKSEDAMR

ENGICSREIAALLFKFFWGINGMPATLAFWFLARTVYTPHLWEDIRAEVA

PAFRNGIHSPPDIGYLKKCPKLNATFHETLRIHGGTAGFRQVASDTVIGG

FTFKAGSDVIMPYRQMHLDEGIW GQDAKTFDIDRFIHNPKLATAKTFK

PFGGGVTLCPGRFHAHRTALSFIAIVITRYDI

HVVGGCESRPFPHMNTRGPEVGVIFPVLEQVPQIIVKNVDIE*

>CYP606B1 FG11282.1 AACM01000464 FGcontig1.464_scaffold9

39% to 606A1

MIQAATDLVSRPAIAVPLIIFLSYITYQLFIKPSNLPDLPIIGARKSDWF

PLFQARIRNSLNVKAVLNSSYAQYKNQATILPLLDGGNVILLPRSDTKFA

SEQPTNQLSMHESVQHDLQTDWTTMTPSLTHDPIHLDLVLTHLTKEVGNL

IPDLAEEIEHCVRQQWGTSSEWTE

 

VCIFEKAQLITSGVTNRAFVGVPLCRNDEMLKLGIAFAQ

 

DIPLSSMLLKPFPNFLKPLVAPIIALPNRIHNNKFER

ILKPEIQARLAKYDAQATESEKPPKSERNDYLQWLIEQAKDIGHPKNWKV

NALSERVLMMNFASIHTTTFAVTHALLDIAASSPDLIAELRDEIKSVLEQ

HNGKWNKRAVAKLEKLDSAIRESQRKNSIVSVAVSRTIVAEKGVTFPSGT

HVPKGHRIAVPGYSVFQDPEVYPEPKKYKALRFYNARQNEKDEYVKSARN

AWPTTSADFLAWGLGRNACPGRFFASSEIKLMIAYMLLNYDIEHLDERPH

NTWIMQNRIPPMKATLRIRRVSQP*

>CYP547B1 FG11303.1 AACM01000464 FGcontig1.464_scaffold9

48% to CYP547A1

MAVMSKLLNFPSLTLAACIEGFFAIKLFPNYYSTQSHLAAVVTILLINYA

FGVVFWAVLYPRLFSPLRRIPGPKAYLSAAHHSLVVKGRPSGDLFLDLAK

EYPGKDVIMLNSFRNQLCIMNPQLLADLLVHNCYDFAKPKRISGFLRHVL

GDGLIIVEGEQHKFLRKNSTPAFHFRHIKELYPMMWTKSETLTKAIAQDI

TASRSPVVELNGWASKVTLDIIGIAGLGRKFDAVEKKIDPLADIYEQLLE

PDREKLIFAMLSLAIGLPIIRMIPWKMNDLFNYLTGSLNDLCYPMIKEKK

AAIIEKGDDHFDVLSLLIKSNNFSDEALKDQLLTFLAAGHETTASALTWA

CYLLTQYPDIQSKLRDEVRDSLPADVDCNTPDLASILEQMPYLNGVMHET

LRLYPTVPLTMRSALRDTRIGDQYIPEGTDVIVSIWYINRAPEIWGPDAA

EFRPERWMTEDGKPNQNGGASSNYNFLTFLHGPRSCIGQGFAKAEMRCLL

ANMVKSFEWTLAMDNKLVLPRGVITIKPENGMYLNMKAI*

>CYP530A2 FG11389.1 AACM01000465 FGcontig1.465_scaffold9

66% to 530A1

MFTLQVFFLALGAVLVRLLFTGRRPKDYPPGPPTIPILGNIHLMPKRDAH

LQFRKWADEYGPVYSLILGTKPFIVLSSAQAVKDLLDKKSGIYSDRQEIH

LHQLTFVFKGLWSDLAIGGFQQGHRRYQKSNTNRQFRKLVHSLLNVTAAK

SYVPYQDLENKQMLYELVTQPDQFLQSIRRYSNALTTTMVFGWRSPIYQD

PKLMQLFDGFADFAEINQTGIAALLDTFPILRRLPDFLLPVQKKAKELHK

KEKALYLSHWLKAKQDIANGSIKPCFCVGLAEAQEKNKFDDDQAAYISGT

LLEAGSDTTSSTLYAFVQAMLLYPDIQRRAQDEIDKVVGNAQMPNMDDES

SLQYIRACMKETLRWMPTTILGAVPHAVTQDDIYNDYLIPKGAGVLNNVW

GIHMDPERYPNPRQFNPERYLDDFQSLADAAANPDASKRDQFTFGAGRRI

CPGIHVAERSLFLGMSRILWAFNIEPALDEMGRPILPDPDKLTQGFVCMA

EEFPAKITPRSAEKRDLVIESWRNAEKELLDPVTKQWR*

>CYP629A1 FG11424.1 AACM01000467 FGcontig1.467_scaffold9

poor match in 53 clan

MEAGGIFELRVRLYWFQAFCTSSLKQFRDLERVHIRQCLALRVDLRNSDI

PGPFAASFTRLWHMNHILKGDQNLELIRLHEKLGHFVRVSYDEVSVSHPD

AISKILLSPLHKLTLLEGNWYKIHALPDYRFQSPMSTTDPRKKVKKSRYI

AGAYSVSNVVRSEEHIDRTFEQFLEWMNRYANDKKPIYLDKFISYTTFDV

IGEIVFSKQFGFLEQGIDIGGAIRNSLALNAYVAVAGYFRWINVLLVANS

LVTWMGIMPMGHLFNTTAAVLANREKNHDVRYDAVSYWFYQHSQHPDKLT

IREINTQALAAVGAGSDTVAAGIQSFIYHMIRHPNAWARAQTEVQDATKK

GLCEDNIVSYADVQELPYVQACVKEALRMFGPVPMGLPRIAPRGGLTFGD

RTIPEGTIVSVSPWVIHHSKEYWGEDAHEFNPDRWLKGDAVVKEKF*

>CYP626A1 FG11465.1 AACM01000467 FGcontig1.467_scaffold9

35% to 62B1

MSVTIVSAIAIFFVAIALKLLSNFYYGPLSSLPGPCYTCVTGIPLLYSRA

TGTSREHLRCLHKRYGPVVRVGPTEVSLNSVDGYYKVHGVGSHCIKAPVF

DSIRFSHSPMLFTIRDPKFHAQRKRILGRGLAAMKEGQESKIRRLAELAV

SNIEKEVQEGKSDVYKWWRCLAVDVISEMSFGKPFELLRPGGQDLPVYKA

LGNAGSGVVLQVMLPSFLQSLVRWSPITWLRDIARVGETIFGRVLIALNE

ASLPSCGPSMVRHILGEAELSKSPVLSDEELGSEVSMMLVAGSDSTAATL

TYATWAIIRDPDLRRKIEEEVARLPEHFTMKDLDRLPLLNSTLEETLRLY

NPAGALVERVLPPSGMSIHGWDLPGGTMVYTTGWLISRLEDVFPDPDMFD

ATRFIDPSPEQTRAHVPFSIGSRSCIGMQLARMEILVTLATLFRQCRDMKL

HHGMTDEMM

 

TQFAPPPPRRSSGGGFLGLSTWQVIALLIILILLLLGIFM

CMRKKSEPKAPEEDEGEEEEEEEEEEEEGDEEAADDDEGEEEPVPDEMQM

NAYNAQYLANPYGNPYAQQPSSATIIGSHAIYTFPRGFAVEWLFIVVNDS

IAKGFQVDNQLSAMDSDPWTDAMPGGDQTGLFGAERARRTQ*

>CYP570D1 FG11498.1 AACM01000470 FGcontig1.470_scaffold9

45% to 570B1

revised AACM01000470.1

MSNTSGGSAGLLRDILQIVNHEPKIAIGAVVFCFVVIFIVNSFRAWYRLS

HVPGPFLGSFSRFWMLRGSIRTHLPEEMQAAVDKYGSLVRVGPNELITDD

VKLIKKIHSGRSAYTRGPWFESVRFEPGKDNLFSMRDEEGHKKLRNKMAA

GYSGKENPSLEGSVDSIIASFIALLETKYLSTDDVYRPVDFAQKSQFFTL

DVISDLAFGQPFGYLTKDEDVFDFLKITRAFFPFTVTMANVPWMISLLHS

RLFSGLLPKDTDKIGFGAFIGVAKEKVAERYAPGAAPHADMLGSFIKNGL

SQEQTSRESLLNVVAGSETTATTIRMIMLCILTNPLAYRRLQQEIDDAAQ

AGKISSPITDAEARRLPFLQATIQEGLRIKVPAAGPLYKEVPGEGDTING

MFIPGGTQIGISPFSVYLSKKVFGPDASVFRPERWLNAEPERLEVMAESV

GLVFSSGKWQCLGKPVAIMELNKIFVE (0)

LLRRFDFSIVKPEKPLDIFNAVSNCSLVAVCKLTR*

>CYP54C1 FG11536.1 AACM01000473 FGcontig1.473_scaffold10

50% to 54A1 46% to 54B1

MGDTQSAFDIEANRWPVLLTALLVCLVAAIAPKVGSVLRFWTIPVVGEEL

GSTEKRRKAYLGGARKLYSDGYQKLTIEQFKNGIFMITTSKSSPTIVISP

DFLPELKKLPDSILSMEAAVDESMETTYTKIETSVPIIPHTIKGHLTPAL

SRLSAIIADEVRQSLELSIPSCDDWTEVNIHHSLLRIVGMVSGRVFIGPE

LCRSEQYLDAAINYTMEVMGAQRAVQNMRPWLRPFLAQSQPEVKRLYQRI

AEAEAFLQPVVESRIEAMADLSYEKPDDFLQWLIDGKDKFPDKNSQNLAK

VQLGLTFAAVHTTTLTATNAFYDLAAMPDLQVELRDEVQEALLQSEGVFT

SNALQGMKKMDSFLKETLRVHPATMASFQRKVLKPFTLSNGQVIPAGLMI

EIPAVAVNSDPYIFPHADEFDPLRFYRIRTQAKDESSVENAAKEQFVSVN

QSSLTFGYGRHACPGRFFAANEIKMILAHALLRYDVKLVGSETRRYPNIE

FAHMSIPDPSRKLLFKAIGF*

>CYP55A8 FG11585.1 AACM01000475.1 FGcontig1.475_scaffold11

65% to 55A6 83% to 55A2

MSSDPPSFPFQRASGSEPPAEFARLRATEPVSQVELFDGSLAWLMTKYKD

VTFVATSDKLSKVRTRTGFPELTARGKQAAEAKSTFVDMDPPDHMRQRGM

VESLFTPEAVKKLQPYIKKTVDDLLENLKQKGSANKQVDLVKEFALPVPS

IIYTILGVPFDDLQYLTQ

QNAIRTNGSSTAREASAANKELLLYLASLVEKRLEEPKDDLISKLCTEQ

VKPGNIEKPDAVQIAFLLLVAGNATMVNMIALGVVTLAQHPEQLAQLKSN

PSLAPQFIEELCRFHTASALAMKRTAKEDVEIGGKLIKVNEGIIASNQSA

NRDEDIFENANQFNINRKWPAEDPLGFGFGDHRCIAEHLAKAELITVFAS

LYQKFPDLNVVIPLEEVNYTPLSGDVGIVDLPVTL*