Fusarium oxysporum P450s

 

D. Nelson

 

August 8, 2009

 

165 Sequences

 

>CYP51F1 Fusarium oxysporum

92% to CYP51F1   Fusarium graminearum

FOXG_00394

MGLLQELASHPLAQQYQELPLGQQIGIGFGAFIILSVVLNVLNQLLFKNRNEPPLVFHWFPFVGSTITYGMDPPKFFKEN

RAKHGDVFTFVLLGKKTTVAVGPTGNDFILNGKLKDVSAEEIYTVLTTPVFGKDVVYDCPNAKLMEQKKFMKIALTTEAF

RSYVPIISAEVRDYFKKSPDFKGKSGIVDIPKKMAEITIFTASHALQGSVIRNKFDESLAALYHDLDMGFTPINFMLHWA

PLPWNRKRDHAQRTVAKIYMDTIKERRAKDNDDTEHDMMKHLMNSTYKNGTPVPDHEVAHMMIALLMAGQHSSSSTSSWI

MLRLAQYPHIMEELYQEQVRELGADLPPLTYDNLAKLPLNQAIIKETLRLHAPIHSIMRAVKSPMPVPGTKYTIPTSHTL

LAAPGVSATDSAYFPNPDEWDPHRWEVDSPNFPRMATRGDDEEKIDYGYGLVSKGSASPYLPFGAGRHRCIGEHFANAQL

QTIVAEVVREFKFRNVDGGNTLIDTDYASLFSRPLEPANIHWERRQQ*

 

>CYP51F2 Fusarium oxysporum

83% to CYP51F2   Fusarium graminearum

FOXG_11545

MFSLLYYPLWAFASCLVIITLNVLYQKLPRNANEPPLVFHWLPFVGNAVAYGLDPYGFFVKCREK HGDVFTFILFGRKIV

ACLGVDGNDFVLNSRIQDANAEEIYSPLTTPVFGSDVVYDCPNSKLMEQKKFVKFGLTQKALESHVQLIEREVLEYIQAV

PSFSGKSGTVDVSKAMAEITIFTAARSLQGEEVRRKLTAEFAALYHDLDLGFTPVNFLFPWLPLPHNRRRDAAHAKMREI

YMDIINGRRRGVGDLEKGTDMIANLMNCEYKNGQPIPDKEIAHMMITLLMAGQHSSSSASSWIILHLASSTDIAEELYQE

QLINLSADGVLPPLQYTDLDKLPLLQNVVKETLRVHSSIHSILRKVKRPMQAPGSPYTITTDKVLLASPTVTALSEEHFT

DAQRWNPHRWDNKPQEEAVTDDVIDYGYGAVSKGTKSPYLPFGAGRHRCIGEKFAYVNLGVIVATLVRNFRLSTLDGKPG

IPATDYTSLFSRPAQPAYINWERRRA*

 

>CYP51F3 Fusarium oxysporum

87% to CYP51F3 Fusarium graminearum

FOXG_13138, note: gc boundary at DQKR

MEALYSNWRSFPLSLSVPITAFLIIAIATITNVIKQLWFPNPHRPPVVFHIFPLIGSTVQ

YGIDPYKFFFDCQAKYGDCFTFILLGKSTTVFLGPKGNDFILNGKHADLNAEDVYGKLTT

PVFGKEVVYDCSNARF MDQKR (0)

LLKLGLTTDSLRCYIPKFVKEVEEYIATSPYFKGSTGIVNITEVMAEITIYTAAGSLLGNEVRSMFDSTFATLYR

HLDDGFQPINFVMPGLPLPQNFRRDHARKVMEELFSDIIRKRREIGNQGGETDMVWTLMNAKYKDGEDLPDHHAARMLIA

ILMGGQHNTAASGAWLLLNLAHKPHLVQELYDEQLEVLGSPQEPLTWENLQKLTLNGQVIKETLRLHSPIHSILRQVKSP

MRVPGTDWVVPPSHTLLASPGTQARSEEFFPRPMEWDPHRWDKIESLEDSKGNGETVDYGFGVMNKSVSSPYLPFGAGRH

RCVGENYAYAQLGAIIATFVRLLHIEQPDPNAPLPAPDYSSMFSRPMNPAVIRWTRRNTEAN*

 

>CYP53A19 Fusarium oxysporum

90% to CYP53A8

FOXG_04952

MAVVDILFTWWSIPIAACVLIATYLYSYFVTYGHLRDIPAPFPAQFTNLWLLYVCRRGGRYRVVDEIHKRLGPVVRIQPN

HTSIADPDAIATIYGHGNGFLKSDFYDAFVSIRRGLFNTRDRAEHTRKRKLISHVFSAKSISQFEPYIHANLELFVKQLD

KLVASGQTTDKNGKRQALIDCLPWFNYLAFDVIGDLAFGVPFGMLANGADVAEVRETPDSAPIYASAIEILNRRGEVSAT

LGCWPQLKPYAQWLPDPFFSNGLNAVKNLAGIAIARVKARLDNPPSVERKDLLARLMEGRDEKGEPLGREELTAEALTQL

IAGSDTTSNSSCALLYHVTRTPGVLEKLQAELDEAIPADVSVPTYDMVRDLTYLNNVISETLRYHSTSGIGLPRQIPDNS

PGVTIKGHYFPPGSVLSVPTYTLHHSKEIWGSDADDFKPERWDSVNNLQKTAFNPFSHGPRACVGRNVAEMEMKLIAATW

ARRYTPELKQEVMETREGFLRKPLGLDIALKMR*

 

>CYP53A20 Fusarium oxysporum

92% to CYP53A7

FOXG_02776

MAITELLISPWAPLALAVALVAWYILPWISNSNLRGIPAPFPAQFTNLWLLSTCRRGKRYEIVDQVHKKLGVLVRIAPNH

VSVADADAINTIYGHGNGFLKA

DFYDTFVSIRRGLFNTRNR

AEHSRKRKLVSHTFAPKSVLEFEPYIRQNLDIFINQWDR

IASNKDADGYGSVDCLNW

FNFLAFDIIADLAFGKPFG

MLSTGADIAEVKASPTSPTIYAPAVEIMNRRGEVSATLGCLPQ

LKPYAKYFPDPFFSQGLQAVENLAGIAIARVSERLERGGDSTRKDLLARLMQGRDEKGEPLGRDELTAEALTQLIAGSDT

TSNSSCALLYHVVRTPGVMQKLYEEISAVVPEDVAIPDYESVKHLPYLGYCINETLRIHSPSGIGLPREIPPNHKGVTLH

GRYFGPGTILSVPTYTIHHSTEIWGPDADEFKPERWENLTDKQKTAFIPFSYGPRSCVGRNLAEMQMRLIATTWIKRYDV

RLRQDIMETREGFLRKPMGLDVGLARR*

 

>CYP53D1 Fusarium oxysporum

48% to CYP53A10

FOXG_14732

MSLDSLLLSPWAPLAVLLCVLLFYILPYFYTYRHLRGIPGPLLARFSDLWLLYICRQSKRSYT

VYDLHERLGPVVRIQPNHVSIVDERAINLVYGHGNGLEKS (2)

SWYDSSISLTRSIFTARKRAEHARKRRYIAHSFAPKSSRAAEGPIADKVELLVRKWDEIIDKGPQFD

GFTQLECRRWFTYLSFDITGDLLFSEPFGMLENGSDLVKIDNKPRSYVSMMNSLAQRSAAVATLGVLPWLKPHAHHLPDP

FFHRGMDGLQNLLGVTSAHVKERMAAGQDNHDDWLSLLLRARDDQGELLKFEEIASESLTLFMAAIETVSNTLSAMMYYL

ATSPSSLQKLQAEVDSIDIPGTVPPFTNVRALPYLDAVLNETMCLHSVLGIGLPREVLPGSKGVHLDSFYFPPGTVLSVP

IYAIHRSRDIWGQDANNFRPERWEKLSDRQKTSFIPFGHGPAACVGRNLAEVEMKIIAATLIKRYNFCMMDSEIESTEGT

TRKLIKVNIGIKRRQ*

 

>CYP54C5 Fusarium oxysporum

82% to CYP54C1

FOXG_01238

MGNAQSPLDFVSNRWPIIVTALFACLVAAIGPRVVNALRLWTIPTIGEELGSTEKRRQAYLAGARKLYSAGYQKLTTFQF

KDGVFLITTSRTSPTIVISPDFLPELKKLPDATLSMEAAVDESMETKYTKIETSVPIIPHTIKGELTPSLSRLSLTIASE

VRDSLNLTMPPCDDWTEVNIHHALLRIVGMVSGRMFIGPELCRSEQYLDAAINYTMEVMGAQRAVQNMRPWLRPFRAQSL

PEVKKLYQRIAEAEAFLEPVVKTRTDAMNDPTYEKPDDFLQWLIDGKDKFPDKNSQNLAKVQLGLTFAAVHTTTLTATNA

FYDLAALPDLQIELRDEVREALAQSGGKFTSNVLQSMKKMDSFLKETLRVHPATMASFQRKVLKPFTLSSGQVIPAGVTI

EIPAVAVSSDSNVFPQADKFDPLRFYKLRTEAKDGGSVEKAANNQFVSVNQSSLTFGYGRHACPGRFFAANEIKMILAHA

LLQYDVKNAGDATERYPNMEFAHMSIPDPSKKLRFKSVEV*

 

>CYP55A1v1 F.oxysporum M63340

MASGAPSFPFSRASGPEPPAEFAKLRATNPVSQVKLFDGSLAWL

VTKHKDVCFVATSEKLSKVRTRQGFPELSASGKQAAKAKPTFVDMDPPEHMHQRSMVE

PTFTPEAVKNLQPYIQRTVDDLLEQMKQKGCANGPVDLVKEFALPVPSYIIYTLLGVP

FNDLEYLTQQNAIRTNGSSTAREASAANQELLDYLAILVEQRLVEPKDDIISKLCTEQ

VKPGNIDKSDAVQIAFLLLVAGNATMVNMIALGVATLAQHPDQLAQLKANPSLAPQ

FVEELCRYHTASALAIKRTAKEDVMIGDK

LVRANEGIIASNQSANRDEEVFENPDEFNMN

RKWPPQDPLGFGFGDHRCIAEHLAKAELTTVFSTLYQKFPDLKVAVPLGKINYTPLNR

DVGIVDLPVIF

 

>CYP55A1v2 Fusarium oxysporum

96% to CYP55A1v1

FOXG_12350

MASDAPSFPFSRASGPEPPAEFAKLRATNPISQVKLFDGSLAWLVTKHKDVCF

VATSDKLSKVRTRQGFPELNAGGKQAAKAKPTFVDMDPPEHMQQRSMVEPTFTPEAVKNLQPYIQKTVDDLLEQMKQKGC

ANGPVDLVKEFALPVPSYIIYTLLGVPFKDLEYLTQQNAIRTNGSSTAREASAANQELLDYLATLVEQRLVEPKDDIISK

LCTEQVKPGNIDKSDAVQIAFLLLVAGNATMVNMIALGVATLAQHPDQLAQLKANPSLAPQVEELCRYHTASALAIKRTAKEDVMIGDK

LVRANEGIIASNQSANRDEEVFENPDEFDMNRKWPTQDPLGFGFGDHRCIAEH

LAKAELTTVFSTLYQKFPDLKVAVPLEKINYTPLDRDVGIVDLPVTF*

 

>CYP55A15P  Fusarium oxysporum

74% to CYP55A2 Cylindrocarpon tonkinense

FOXG_14888

SNPRSFPFERASVLEPPAEFAKLRATDPVSQVKLFHGSLPWLVTKHKDVVFVATPDKLSK (0)

VCTRPGFPELDAGGKEAAKAKPT (?)

LDMDSPDHMHQR (?)

RRMVEQIFTQEAVEKLQPYIQKTVDDLLEDLKQKGCADGPVHLVKIFALPAPSY (0)

VIYTILGAPFHDLEYLT*QNAIRSNGSSTAREPSAANN (2)

REFLDYVANLADK*LEEPQDDLISKLCTEQVKPGNIEKADAVQISFLLLVAGNATMVNMIAL (0)

GVITLPQHPDQLSELKP*SIPGPQFVEELCRYHTASALAIK

RTAKEDLEISGK (0)

SKGIIASNQSANRHEDAFKNPD*FDMDCKWLVEDALGFGFDGHRCIDEHLAKTEPTTVFGT (?)

LYRKFPDLKNAVPLEEVHYTPLCQDVGVVDLPVTF*

 

>CYP55A16P Fusarium oxysporum

83% to CYP55A11

FOXG_17502

INYDILGVALKDVDYLTQCNATRTNGSATASAAQDANM (2)

ELLNYFAKRVDKKIESPEPSNDVIGSLVSNELAN &

VDKKHVVELSFLLLVAGNLTMINMIALV (1)

CVLTLLEQPDQLDALIQDPSLLKPFVEELCRYHTASSFATRRVAKVDIKVRGH ()

EVKAGEGIIA*NQAANRDPDVVPDPNVFDLF*KRGSEEALGFGWGDHRCIAASLARAEPEAVF (1)

STLFQTLPTLKLAIPSSEINGSAPNKDIGVSELPVTWSSPQVS*

 

>CYP57B4 Fusarium oxysporum

81% to CYP57B2

FOXG_01386

MAFLRDAESNPTVQAIFSRLKHVDATAVAAGLPLNTFRSCLFILLHRITL

(sequence gap)

KLNQFAKEGRLVDIPHW MQYYAFDVIGAITFNKSFNMMENEGDTTGMIKGIREANDFLAFWGIVPNLVPWLIGIATALGMTSNTSTLVSYALKQIDN

TRKENAKSTVKGTTKYDTFLKKLLEGESEGRLKTPNLLDACGSNIGAGSDTTAVTLSSALYYLFQNPDKLKKLREEIDQK

AAHGGLSDPVTFQEAQDMPYLQAVIKETLRIHPAVGTILPRVVPRDGMELSGIYFPEGTEVGVNAWVLHYDKGIYGPDPE

VFRPERWLGDEKTSIMDSMMFAFGAGARTCIGRNISLLELTKMVPQIVRKFDLVIEDADKPLDTFCAWFVYPHYNGRFKV

RE*

 

>CYP61A1 Fusarium oxysporum

99% to 61A1 Gibberella moniliformis

FOXG_04166

MEAVNATSSGFSSVLAGTKYANVALPPQVEYVIEAVSNAGVWTWVFTFIALCVAYDQIAYIIRKGPIEGPAMKLPFIGPF

LDSMDPRFDGYHAKWSSGPLSCVSIFHKFVVIASTRDMARKVFNSPAYVKPTVVDVAPKLLGHDNWVFLDGKAHVDFRKG

LNGLFTRKALESYLPGQEEAYNTYFKHFLKMTKDAGGKPVPFMHEFREVMCAVSCRTFVGHYISDEAVTKIAEDYYLITA

ALELVNLPVILPYTKSWYGKKAADMVLAEFSKCAAKSKVRMAAGGEVTCIMDAWVLSMIQSERWREAEEKGEGHTVEKPT

PLLRMFNDYEISQTIFTFLFASQDATSSAATWLFQVTAQRPDVLDRVREENIKVRNGDPNAPITMDQLESLTYTRAVVRE

LLRWRPPVIMVPYVTKKAFPLTENYTVPKGSMLIPTTFMALHDPEVYDNPSHFDPERYYSGDAEEKGSKNYLVFGTGPHY

CLGQVYAQLNLALMIGKASVMLDWKHHATPKSEEIKVFATIFPMDDCPLTFEERKW*

 

>CYP61A6 Fusarium oxysporum

96% to CYP61A6 Gibberella moniliformis

FOXG_09685 revised

MASIVSPGDEAVVSNASLTFKDDISNSNGLLSSYLNGYSNTQILLTILVVLIAYDQCIYLWRKGPIAGPAFKIPFMGPFI

RALYPKFDHYLAQWASGPLSCVSVFHKFVVLASDRDIAHKVFKSPTYAKPCIVPMAETLLRPSAWVFLQGKAHTEYRKGL

NGLFVNKALSTYLPVQEKVYDDYFGRFVAASEANKGKPMAFMRLFREINCALSCRTFFGDYISQDAVEKIADDFYEVTAA

LELVNVPLSVYIPFTKCWKGKRTADAVLAEFAKCAAACKANMASGAEPRCIVDQWVLHMMESKKYYDRIAAGEEGVEKPR

NLIREFTDDEIGQTMFTFLFASQDASSSATTWLFQVLAQRPDVLDRLREENLAVRNGNRHQPFELPMLESLPYTNAVIKE

LLRYRPPVIFVPYEATKSFPVTPKYTVSKGTLIVPTCYPALHDPQAYPNPETFDPDRWITGDAESKTKNWLVFGAGPHDC

LARKYVPLTMAAMIGKASLELDWVHHATSRSEEIRVFATLFPE (0)

DECQLVFTKRE*

 

>CYP62B3 Fusarium oxysporum

76% to CYP62B1   Fusarium graminearum

FOXG_07404

MYIANYLSMPLLAGVFLIGIVLYALVNAFKSPLRGLPGPWYTHFTHLVLKWQILAGNRVHYIHSLHQHYGPVVRVSPGEVAVSDLEAF

SKIHKIGSGFLKSAWYDGITPNREPGIFVMRDPHQHAARRRLFARAFSVSSLLTNWESEIRQKTELAVNNIKRDAQGAGA

DVFKWWTLMATDVIAHLSFGESFRMLELGKQTPYIDAIQSALLMSGIRAELSWIYPLLQRLPFQGLKKLLNADNVVFDHG

AIAVQNMQSAGDGFSKANLFSQMLAESDSQDKTNLSLLSVQQEAGNLIVAGSDTTAVTLTYLIWAVLKQPQLQAELEREI

SELSDELSFDELKSAPLLNSVIEETLRLYGAAPGALPRVVPGKGLDVCGHYIPPGTVVSTQAFTLHRNENIFDDAQR (2)

FNGYRFMDKSTLTGAQKTALSPFGAGSRICIGLHLAWMELRLGAALFFRECRSATLSPEMADEMME

MENRFLIAPKGHRCIVKL*

 

>CYP65R2 Fusarium oxysporum

82% to CYP65R1

frameshift at TLQ/KMH = &

FOXG_10066

MGPILASIAILALYLLGNAIYHATLHPLANIPGPKICGITRIPYWLASLKGEDVKWMKGLHDRYGPVVRFGPTDVSYTAS

EAWNDIHGPKVTEKAQEFSVQPVNGVPSMLTTNTENHTRVRRLFSPAFSERALKQQAPLFKKYSELLMYKISEVGNDGAK

PVEMTQLLNFTTFDVMAELCFGHPLNLLVHNEYSPWVRSIFESLKMLPIASMINYYPILNAIFTRFEPKSVTQQRVTHCKHSEDRVNHRLENGSDQPDVWNLVMSAKEGKGLTLQ &

KMHSNAELFML

AGSETTATLLSGCLYNLLTYPEKMKTLLEEIRGKFTNTDDLTFERLAELKYMNACLKEALRVYPPVPIGSPRVVQPGGQQ

ILGKYIPPETRVSVHHYSTYHSESNFRDADTFVPERWLKTDSKYAGDMWEAHQPFGFGPRNCLGQNMAMHEMRLILATLL

FKYDLELCEESRNWVDQKSFALWIKTPLMMRAKPVATHTRLNI*

 

>CYP65S4 Fusarium oxysporum

58% to CYP65S1 Fusarium graminearum

FOXG_02668

MGVLHTEALAELSLGSAMALSGIALLLYLFISSVYYAFFHPLAKVPGPKLYAITQIPYLYYLSKGDWVFHLAKLHEQYGP

AVRFTPKDVSFITAEASKKIYGHKAAGNKSFEKDFRMYRQNRPCSSIVRSDQEDHRRMRRLLAHAFSSKALRGQGDVVDH

YVELFMKGLTERAQRGEEIDIVAWYNFASFDLIGHLALGQPFGCLENGKYHPWVSRVFKGLKVLSYTQIYVRLGLQNWIS

LLSPPSLRKSYEEHMQFAEHAALARIESKDTDSQDFMSYVLRHNDEKGMSQLEIIENSGVMIIAGSETTATLLSGTTYFL

LKNPDKLEKLINEIRSAFSSEEEITVTQVDQLKYMLAVFNEGFRMYPPVAVGLSRLSPAGGEFIDGYWIPENTAVSMPHW

PAYYSELNFRDPKKFVPERWLDDPRYASDNRAILSPFSLGPRDCIGKNLAYTEMRLLLARMLWKFDLEAVPADKDWYDQK

IFFLWEKGGLPIKLKEVVLKAARFSDLQRATKSNCNASEYHEWAILGSVAKSSSPACIPRTQQWDAHKATAHKPDASSSI

EKSICKTGVNSLVMNFCFTFEFLSNASPRCTITTSEESKDDSEYESKSRASVYR*

 

>CYP65AW1 revised Fusarium oxysporum

44% to CYP65A1 Fusarium sporotrichioides

FOXG_17343

MSRLVGFLINARSPSTCIFLLFAS (0)

LVLYLIGKITYNVFFHPLRKFPGPILWSMTQIPFSLA

WTSGAGHKKIYDLHQIYGDIVRVAPNELSFGYPEAWEDIMGHRKRGQAENGKD

PDFWRGNDIYTLVGSDRDRHSRLRKILSHGFSAQAMMEQQPIFQRYVNLMMKKLREASSSGQSVEMTQWLNWATFDMAGD

LIFGESFGCLEKVEYHSWVKLLYKHIEGFAVSTALIRYPFADTIIKLMTPKHVARDIKAHSDFTKAQVGKRMAYENPRPD

FMESMIRAYEKGHVNHAELLANAHNLIIGGSETTATTLAGTIYLLATHRPILMKLYAEIKERFRSEEEIDLLSVQKLEYM

FAVLHEGLRVYPAVPAAIPRKTSEAGMIGKHYVPANTIVSIWPWPMFHNPKFFKDAEVFVPERWLGDPKYADDKRVAVQP

FSVGPRNCIGKNLAYAEMRLILAKLIWNFDIDLDSRSEGWLGKNTAFLLWEKPELWVRLTPRSDI*

 

>CYP65AX1 Fusarium oxysporum

42% to CYP65B1

FOXG_17420

MLSVSILAGAVAATTVLCIGYVVYNIFLHPLRNFPGPLLCRASPLYRHYKFLRGDLLFETQRLHEQYGPVVRIRPNELSF

IDPEAWRDIYVAHGGSARLGDMARYDRFYQWAGPSAPETFVSLNRPYHDSMKRQLAPAFSERSLQFQEPIIQGYTDTLIR

KLTEVSKDGNPVNLREWFNYYTFDIIGNLGFGSDFGGLESEQYHPWVKAVSQNVREFAFMQVLMYLGLQRIVHVLSGSSL

LRGKILHEHLTREKVEARIKVEKPRLDIFQPLLDRKPPLTFAQLMENSTILITAGSESSVTLLVAAVSLLTDNPAKLQKL

AEEVRSTFNNDDEITIVSVNQLTYLAACLNEALRCFPAVPPALPRVVPHGGAVIAGHAVPEKTVVAVASWATNHSERHFK

KALEYHPERFLKDPEFSKDRFEAFQPFGLGHGNCPGRNLAWAETRLALARLVYNFDIESVPESRGWTTKQKAYMLWDKKP

FWAVLKPVR*

 

>CYP68J3 Fusarium oxysporum

68% to CYP68J1

FOXG_10386

MSSYLDLLLGNPQYAIFCGVTLFTLFVIRYSLLGHVTKFPVLNPKKSLELTSNRATQDFIADSKNILTNGRALYKDQPYR

AYTDWGKVVVIPPKFLDALKSHKQLDFTIPAEDDSHAYIPGFDPFVSDPNISKVVTKYLTKSLTKLTAPLSEEASLAFRQ

VLTDSTEWHEMHPQHDIVRIVSRMSSRVFMGESLCRDDEWVRASGDYTVQSFKTGDILRTDPRCSRPFVHWLLPSCWTLR

KKLAEAIQCLKPHLERRSCISAEAEAQGKPSPFDDSIEWYKKEGSTRNPALLQISLSLVAIHTTSDLLMETLFNIAQHPD

LFQPLREEITDVLTTEGLKKTALYNLKLMDSVIKESQRLRPVLLGSFRRQAMADITLPNGDVIKKGEKIVCDTTHMWNGD

YYEEAAKFDGYRFLRMREASEQDKHPHLVSTSFDHLGFGHGNHACPGRFFAANEIKIALCHMLLKYDWKLADGVVPKPSG

FGMAYLPDLQAKLLIRRRTEELDIDSIETC*

 

>CYP68J4 Fusarium oxysporum

70% to CYP68J2 Fusarium graminearum

FOXG_16939

MTAYINTILQNPQYAVLSAISVITLLVVNFSFFTQQEKYPILIPKKPFELTNTRVVKEFIANSRSLLANARTVYKDQPYRAYTELGKVLVIPPSWVDALKSNRHLDFQTPARD (0)

DSHEYIPGFQPFGGSHKLTTVINKYITKAL (1)

MVKLTGPISEEASLSIRDTLTNSR (1)

EWHPIRPQADLIRVVSRVSS

RIFMGEELCRDEEWNRTSSEYTLLAFGYGGLLRSYPRWLRSYIHWFLPQCWEVRAKLNEARQCLKPHIERRKVIKQKALAEGK

PSPFDDSIEWFEKEYEKHDPATEQIAVSIVAYHTTSDLLAETLLNLCQHPELFQELREEIIAVLTAEGGLTKGALYNLKL

MDSVVKESQRLRPILLGAFRRIATADVTLPNGDILKKGDKIIGGMSHMWDSDTYDNALEFDPYRFVKMRQTGDDKKAHLV

STSADHLGFGHGFHACPGRFFAANEIKILLCHMLLKYDWKLPEGCKPQPSHSGFKLLGDYSSNLLVRRRTEELDIDSLSS

SKGHDSLPY*

 

>CYP504A20 Fusarium oxysporum

85% to CYP504A5 Fusarium graminearum

FOXG_09779

MSDQVIYLAIIIGLYVLYKLANSTDQPKIKGIPEIPGVPLFGNLIQLGTDHARVAQKWAKKYGPVFQTRLGTKRVIYVNS

YEAVKHFWITHQSALISRPMFHTFHSVVSSSQGFTIGTSPWDESCKNRRKAAATALNRPAVQSYMPILDLESL VSIKELL

DDCKDGS KDLDPSPYFARFALNTSLTL NYGFRIDGDVNSE LLHEITYVEREISNFRSTSNNWQDYVPLLRLWGAQNSSAE

EFRVRRDKYLSDLLANLKSRIDNGTDKPCITGNILKDPTAKLNDAEIKSICLTMVSAGLDTVPGNVIMGIAYLATEHGQK

IQAKALKEIYKVYPNGEAWERCLVEEKVPYVTALVKEILRFWTVIPICLPRESIKDIPYQGAVIPAGTKFFMNAYAADYD

ETRFANPYEFDPERYIDDKEVGTPHYAYGAGSRMCAGSHLANRELYTAFIRLITAFEILPPKDNKDFPVMDCIECNANPT

SLTTDPEPFKVGFKPRDEAKAREWIAAGEERTQDIR*

 

>CYP504B10 Fusarium oxysporum

87% to CYP504B4 Nectria haematococca

FOXG_07489

MTIANLLVSLNNQVHENKGQSLLVTLLIGPLIYIFINELIRHNARISNLKGPSGLPLIGNIWDIHINAAEKYRAWAKKYG

PVYQIQLGNIPIVVVNSAAAARSIFGANAQALSSRPEFYTFHK VLSDTAGTTIGTSPYSDSLKRRRKGAASALNRPSVAT

YVDHLDVETRDFVKELFEYGKGGSIPVDPMPMIQRLSLSLALTLNWGIRLKSQKDDLFSEITHVEEEISRFRSTTGNLQD

YIPLLRLNPFNLHSTKAREMRNRRDKYLTALNNGLDERIANGTYKPCIQANVIMDKEAKLNKDELTSISLTMLSGGLDTV

TTQVAWFVAYLSQHPEIQEKAVSEIRKFYSEKQPMCDEQDDQKCEYIVALVKESLRYYTVLRLALPRASIRDIVYEGVTI

PKGTVVFLNAWACNMDDQVWSDPEVFRPERWFEQPDAPLFTYGVGYRMCAGSLLANRELYLVYMRLLNSLKIEKSDEVDC

HPITGSLDPTSLVALPRRYKAIFKPRNPEALQKALAVEN

 

>CYP504B11 Fusarium oxysporum

63% to 504B9 Coccidioides immitis

FOXG_10783 revised with gc boundary at EXXR motif

No ortholog found in Fusarium verticillioides

MLIAELFKALSNEAVTRPYQTAVTSVLVSFLAYIIVNEYVARSARLAAFDGPKRLPIVGNLHQLRSNAAEKYRKWAKTYG

PVYQIQLGNVPILLVNSASAARTVFGTNSSATASRPEFYTFHKLVSNTAGTTIGTAPYSESLKRRRKGAASALNRPAVET

YIPHLDLETKDFIAEAYKFGKAGKTEVDPLPLVQRLSLSLALTLNWGTRMPSSDSDLLREITHVEVEISRFRSTTDNLQD

YIPLLRLNPFSFGHKKAAEYRNRRDAYLGMLNRDLEERVSKGTHKPCIQANIMLDREAKLNDVEMMSISLTMLSGGFETF

STVTTWAIAYLATHPEIQDKAYKAITDLHGSKSPLCDPNDDQKCDYVRALVRESLR (2)

YFTVLRLSLPRATNKDFYYEGKFIPKGTVV

FLNSWACNMDDELWEDPEIFRPERWLEHPDHPMFTFGVGYRMCAGSLLANRELYLTFMRMIASFELSTRDEIDTNPLTGV

EDLTSLVSTPRKYRVTFKPRNDAVLKAAIAQGFDE*

 

>CYP505A1 AB030037 Fusarium oxysporum CYP505

MAESVPIPEPPGYPLIGNLGEFTSNPLSDLNRLADTYGPIFRLR

LGAKAPIFVSSNSLINEVCDEKRFKKTLKSVLSQVREGVHDGLFTAFEDEPNWGKAHR

ILVPAFGPLSIRGMFPEMHDIATQLCMKFARHGPRTPIDTSDNFTRLALDTLALCAMD

FRFYSYYKEELHPFIEAMGDFLTESGNRNRRPPFAPNFLYRAANEKFYGDIALMKSVA

DEVVAARKASPSDRKDLLAAMLNGVDPQTGEKLSDENITNQLITFLIAGHETTSGTLS

FAMYQLLKNPEAYSKVQKEVDEVVGRGPVLVEHLTKLPYISAVLRETLRLNSPITAFG

LEAIDDTFLGGKYLVKKGEIVTALLSRGHVDPVVYGNDADKFIPERMLDDEFARLNKE

YPNCWKPFGNGKRACIGRPFAWQESLLAMVVLFQNFNFTMTDPNYALEIKQTLTIKPD

HFYINATLRHGMTPTELEHVLAGNGATSSSTHNIKAAANLDAKAGSGKPMAIFYGSNS

GTCEALANRLASDAPSHGFSATTVGPLDQAKQNLPEDRPVVIVTASYEGQPPSNAAHF

IKWMEDLDGNDMEKVSYAVFACGHHDWVETFHRIPKLVDSTLEKRGGTRLVPMGSADA

ATSDMFSDFEAWEDIVLWPGLKEKYKISDEESGGQKGLLVEVSTPRKTSLRQDVEEAL

VVAEKTLTKSGPAKKHIEIQLPSAMTYKAGDYLAILPLNPKSTVARVFRRFSLAWDSF

LKIQSEGPTTLPTNVAISAFDVFSAYVELSQPATKRNILALAEATEDKDTIQELERLA

GDAYQAEISPKRVSVLDLLEKFPAVALPISSYLAMLPPMRVRQYSISSSPFADPSKLT

LTYSLLDAPSLSGQGRHVGVATNFLSHLTAGDKLHVSVRASSEAFHLPSDAEKTPIIC

VAAGTGLAPLRGFIQERAAMLAAGRTLAPALLFFGCRNPEIDDLYAEEFERWEKMGAV

DVRRAYSRATDKSEGCKYVQDRVYHDRADVFKVWDQGAKVFICGSREIGKAVEDVCVR

LAIEKAQQNGRDVTEEMARAWFERSRNERFATDVFD

 

>CYP505A1 Fusarium oxysporum CYP505

98% to CYP505A1 Fusarium oxysporum AB030037, only 13 aa diffs

FOXG_04152

MAESVPIPEPPGYPLIGNLGEFTSNPLSDLNRLADTYGPIFRLRLGAKAPIFVSSNSLINEVCDEKRFKKTLKSVLSQVR

EGVHDGLFTAFEDEPNWGKAHRILVPAFGPLSIRGMFPEMHDIATQLCMKFARHGPRTPIDASDNFTRLALDTLALCAMD

FRFNSYYKEELHPFIEAMGDFLTESGNRNRRPPFAPNFLYRAANEKFYGDIALMKSVADEVVAARKASPSDRKDLLAAML

NGVDPQTGEKLSDENITNQLITFLIAGHETTSGTLSFAMYQLLKNPDAYSKVQKEVDEVVGRGPVLVEHLTKLPYISAVL

RETLRLNSPITAFGLEAIDDTFLGGKYLVKKGEIVTALLSRGHVDPAVYGNDADKFIPERMLDDEFARLNKEYPNCWKPF

GNGKRACIGRPFAWQESLLAMVVLFQNFNFTMTDPNYALEIKQTLTIKPDHFYINATLRHGMTPTELEHVLAGNGATSSS

THNIKAAANSDTKTGGSGKPMAIFYGSNSGTCEALANRLASDAPSHGFSATTVGPLDQAKQNLPEDRPVVIVTASYEGQP

PSNAAHFIKWMEDLNGNEMEKVSYAVFACGHHDWVETFHRIPKLVDSTLEKRGGTRLVPMGSADAATSDMFSDFEAWEDT

VLWPGLKEKYKISDEESGGQKGLLVEVSTPRKTSLRQDVEEALVVAEKTLTKSGPAKKHIEIQLPSAMTYKAGDYLAILP

LNPKSTVARVFRRFSLAWDSFLKIQSEGPTTLPTNVAISAFDVFSAYVELSQPATKRNILALAEATEDKATIQELERLAG

DAYQAEISPKRVSVLDLLEKFPAVALPISSYLAMLPPMRVRQYSISSSPFADPSKLTLTYSLLDAPSLSGQGRHVGVATN

FLSHLTAGDKLHVSVRASSEAFHLPSDAEKTPIICVAAGTGLAPFRGFIQERAAMLAAGRTLAPALLFFGCRNPEIDDLY

AEEFERWEKMGAVDVRRAYSRATDKSEGCKYVQDRVYHDRADVFKVWDQGAKVFICGSREIGKAVEDVCVRLAIEKAQQN

GRDVTEEMARAWFERSRNERFATDVFD

 

>CYP505A16 Fusarium oxysporum

57% to CYP505A12   Nectria haematococca

FOXG_17221, no ortholog in F. verticillioides

MALSCDESTPIPEPRGLPFLGNVTE

FRSEDSLQDLDRLHDTYGEIYRLRFPKVGSCVIVGSQKLVNELCDEKRFRKAIQAELAEIRLAAGDGLFTAREGEV

SWDIAHRVLMPVFGPTAIRSMFDEMYDVVSQMTLKWARYGPTSPISASEDFTRLALDTIALCSMGYRFNSFYKDTTHPFV

QSMSDSLVELGNRSLRPSWARIFYRSSERKLAKDINFMRTTSEDLIKARKADPNADQRKDLLAAMMNGVDPRTGSRMDDE

SIINNLLTFLIAGHETTSGTLSFAFYSMLKNPDAYLKAQQEVDSIMGRDPITVDKLFQLKYVPAVLRETLRQCSPIPGIT

LEAREDTLLDGKYHIRKGEAVAAIFSKSHLDPLVYGADAKEFKPERMMDENFDRLQQEFPNCWKPFGNGVRACIGRAFAW

QEMLLATSMLLQNFDFYLDDPLYKLKIAETLTIKPKDFLMGASLRHNMTPLDLESHLRGTNNKQGIPAAHSQSPPSTIKA

SIAATPISIYYGSNSGTCEILARRLASNASSHGFSVMVIDTLDTARNRLPQDHPVVIFVASYEGQPPDNAAHFVNWIQSM

TGNEVQKVHYVVFGVGNSEWRQTFHRIPKLIDDELGKRGGERLVTLGLTNVAEKDPFLDFEIWESKELWPALEKKYPDVT

GGTPEALVGSMGLSVDISVSRASALRKSVKEAIVTGVRDLAAPGLPRKRHIEMKLPSGCSYEVGDYLEVLPMNPRDAVTR

ALRRFKLPWDAVLTIAGSEITSLPIGIPVSAWDVLSSYVELAFLSTRKDTLVLASYAQSEKVRTEIELLASDVKFKSEIE

DKRVSILDLLERFPSVELPIATYLGMLQPIRTRQYSISSSPLKDPSHATLTYSVLETPSLSGQGLYMGVASNFLASLKPD

DRLQVSIRRSNIAFHLPLAPDTTPIICVAAGAGLAPFRGFIQQRSIQMKADRILAPALLIFGCRRRDDDLYREEFDAWEG

EGAVVVKRAYSRDAKLTAGCKYVQDRVIEQQEYIRKLWNQGGNVYVCGSRQVGDAVEGALGSILSGVQGGDREDGKRFLD

NFRNKRFVMDIFS*

 

>CYP505A17 Fusarium oxysporum

86% to CYP505A11

FOXG_17581 revised

MAGTVEIPSPSGLPLLGNITSIDPEFPLGSMVSLAEQH (1)

GEIYRLKFPGRSVVIVSTQALVNETCNEKRFKKCVNSALT (0)

EIRDGVHDGLFTARLGEENWGIAHRVLMPAFGPLSIQRMFDEMHDIASQLALKWARYGPNSPIMVTDDFTRLTLDTLAL

CSMGYRFNSYYSPVLHPFIEAMGEFLTEAGEKPRRLPLPGIVYRDRDRKYQQDIEIMRDTAREVLEARKADGSTRKDLLA

AMLEGVDTKTGKKMTDESIMDNLITFLIAGHETTSGLLSFAFYQLLTHPDAYQLAQNEVDRVVGKGPIQVEHLSKLPYLN

GVLRETLRLNATIPLFTVESFEDTLLGNKYPVKAGETIINLLAKSQLDPTVFGDNADKFRPERMFDENFARMNKEFPNSW

KPFGNGMRACIGRPFAWQESLLVMVMLLQNFNFVLDPNYHLGFKQTLTIKPKDMYMRAVLRDNLTPTTLERRLAGLPVLA

TGEANGTNGESADAEDGIPITILYGSNSGTCESLAQRVATDAAQHGFRVTKIDCLDMANGNLPADQPVVIITASYEGQPP

DNAGHFVAWVENAAQEEKPFKDVSYAVFGCGHKDWVLTFHRIPKLVDRSLAKHGATRLVDMGLADVSQNMVFSDFETWED

NILWPALEKRYKPGCKTMLTDKGLSVKSCTFRTLTLRQDVKEATVVCTKTLTSNIDVKSKKKHIEIQLPEGTGYTAGDYL

AVLPINPHEIVRRALRRFRLPMDAHLKISSSTPAALPTDTSVSAMDVLSSYVELSQPATKR (0)

NLLIIAEAASDVETKAALTSLSQESYVEEISNKRVSVLEILERYPSVELSIGDFLQMLPSIRIRQY (2)

SVSSSPLWNQAHATITFSVLKGPAFSGHGTYNGVATSYLDSLAEGDTLQVAIRSSPAAFSLPSNPECTPIICVAAGS

GLAPFRGFIQQRAIIYDSGRTLAPALLFFGCRAPDQDDLYRDEFDSWQRLGAVQVRRAYSRHREGCRYVQDRIWQDKEDF

IELWNKGAMVYVCGSRAMADSVKEVMLKVKTEIEKRSGGDIGLDEARKWFDEQRNVRYVMDVFD*

 

>CYP505H1 Fusarium oxysporum

46% to CYP505B2

FOXG_15285

MAVKQESKKHDEKHKGQIPGPKGLPIIGNLLDIDVTNSLQSIIDMAKDYPKLFALNVGGNTEIMICSRELMDELSDEARF

HKLVVGGVEKLRPLAGDGLFSAQHNNQEWAIAHRILMPLFGPLTIREMF PDMRDISEQLCLKWARAGPSATIDV GNDFTR

LTLDTIALCTMGFRFNSFYSNDKMHPFVESMVAALVDAEKQSMLPDVVQSFRLRAQSHFKKHAAVMKSTCHEILEQRRKN

PVEGKDLLNAMMNGKDPKTGMGMSDGNIVDNLITFLIAGHETTSGLLSFAFYYLLENPEKLQKAREEVDEVLGDENLTAD

HLPKMPYINMIFRETLRLMPTAPGFYVTPFKDEVIGGQYNVSAGDPLFLFLHMIHRDPEVWGPDAEEFRP

ERMADEQFNK

LPKNAWKPFGNGMRGCIG REFAWQEAQVVTIMLLQNFDMVKADPNYKLKIKQS

LTIKPDGFNMKVKLREGRDLTNLFKNP

SLASSKQPSLSSRMNLKISQKDLKPISIFYGSNTGTCEALAERLSADCATFGFMPSKPLPLDEATRNLSKDGPNIILAAS

YDGKPSDNATEFTKWAESLQPGELDGIQFAVFGCGH KDWVSTLYRIPKILDKCLAAAGADRLVDIGLTDASTGRLYPDFD

DWAHSKLFPELASRHGITLDHAPDSLELSVTINQSQRNDIGGNFKRAEVVENTLLTSPGVPRKHSLLLKLPKDMAYTPGD

HVL

VLPKNPPQLVDRVMTCFGVDDDTVLTVSSQRPTFLPTGTPILASNLFSTLVELSQTVSRTSLKRLVDFAGNDGTKGE

IQSLAGDRYDAEIDQQRMSILDILRKYPSINMPLSTFLSMLPQMRPRTYSFASTPEWKAGHGSLLFSVVEATEASGSSLA

RPGGLATNYMAQLRPGDSILVEPRPCRPELRTAMITELNVPIVMIAVGAGLAPFLGFMQKRYLQTQNSGHLPNSPCTLFF

GCRGAKMDDICRDTLDEYSRAGVVSIHRAFSRDWDSPYKYVQHLVAKHADTLARLWGQGAIVMICSGKKVSDDVFDVLGP

ILHSEDRRLNTTRASDWKTWREEVSKERLILEVFG*

 

>CYP506A1 Fusarium oxysporum

93% to CYP506A1P rev Gibberella moniliformis

FOXG_10952 revised

MSAKLPFQLSTGAMYKHPQFPSLIA

AGVMTFTSILLVALKFWSSSATPKVKILLQDEIKSARHRALEYCFNPRAVMAKGYAK (0)

FKNEVFGLDTQD (1)

GVKLVIPPNFLDELKSHPALSFKVSIDN (0)

DMQIEYTHFGGPAEYVIHAIKANLTGSL (1)

LHDRVLRLIATNNARVFQGTAASLDEEWLEASTGYVLACFDCIRALKQWH

PWLRPLVYILIPERAAIKDQWTKGRKRVMASMRERQEKGGNLEDPPTMLDHLSNGRNEHIADDVELQLLHQMTLIAVGTV

TTFSSTTQAIYDLVAHPEYIPILREEVESVPRDPNGNFTKDSTVAMNKLDSFLKESQRFNSPDL (1)

TTFQRAAIADMKLPDGTFVPKG

TKLEINTCSIHKDHELYGNPELFDGLRFHKWRKAPGKGKKYMYSSSGTDDLSWGFGRHACPGRYLSAINIKLIMAELLMN

YDIKLPDGVSRPKNIEFEVLASLNACANA*

 

>CYP506A1 Fusarium oxysporum fragment X82490

MAPMLRPLVYRFIPERARIKDQWTKGRKRVMASMRERQEKGGNL

EDPPTMLDHLSNGRNEHIADDVELQLLHQMTLIAVGTVTTFSSTTQAIYDLVAHPEYI

TILREEVESVPRDPNGNFTKDSTVAMDKLDSFLKESQRFNSPDLSM SNLKNYKLCESL

TGHSNLPTR TIADMKLPDGTFVPKGTKLEINTCSIHKDHKLYENPEQFDGLRFHKWRK

APGKEKRYMYSSSGTDDLSWGFGRHACPGRYLSAINIKLIMAELLMNYDIKLPDGLSR

PKNIEFEVLASLNACANA

 

>CYP511A2P Fusarium oxysporum

44% to CYP511A1 Botrytis cinerea, N-term, cannot find whole seq

FOXG_05899

78% to CYP511A2P Fusarium verticillioides, probable ortholog of the pseudogene

WATTSTS*

NILYYTAVAFGVFGFYWLCLVFYRLFLHPLRNVPGPKVAAATSWYEFYQDVILDGHYIKDYPRLHERY (1)

GPIVRMSPNRVHINDPNFYHK (2)

VYSTGNKFFKEPAMFRFARELDALPFIMDPAARKVRR

GIVNPMFSPRAIKDFSPLALQIIKGALKKIGDSYETGKPVSLKRLESNFA (0)

 

>CYP526E3 Fusarium oxysporum

68% to CYP526E1 Fusarium graminearum

FOXG_17165

Seq runs into a seq gap. One frameshift = &

MLSRLIELSERAPKDFTLALGFSILSALYLLRRWLLPKPIPGIPYNENAVKSFMGDIPEFRD

APNRREWWAQQPARHQSPIVQVF MRPFGAPWVFVADYFEASDICMRRLKEFDRSDVTWEQ

FNGVVPGHHITLKSSDPKFKKNKELIRDLMAPTFLQQ (0)

ASAPEIH

DKFGSLLKLWDRKLDLSGGRPFDIAQDIHNSALDIILGASFN &

DSGDGQIGRQLEELKAK

PASGGPDDLFEFEDVSLSDEQGCFTTLADSVGLSMRSPLSTIHHFLYRNLSPKMR

 

>CYP526F3 Fusarium oxysporum

69% to CYP526F1

FOXG_04849

MSLLDALDSSSTRLLLGCLLLAGIAYTLYRSMLPRPLADIPYNVSATNRILGDLPDVKAFGSLTDWLATQAIKYQSPLFQ

AFIRPFGKPWVVVADHYEAAEICTHRVKEFDRGTSSTAVFNCVVPGAHITLTSSDPQFRKNKELVRNLMTPSFLSEVSAP

EIYDKFSRLVELWNMKTEHANSQFFSASKDVHNAALDIIVCAAFGLDTQHTQLVKEIQELTPDNNISSTKIDGEIAFEEL

PLNEELNALATVAESVAKIIKTPSPPLFHWMYRSFSATLKNAFALTKQLQEREIANGIKRRANGEAMKCALDEISVREEA

LAKKEGREPDYYSQVITSEMMSYLIGGHETTSSAVRWGLSYLSAEQRAQSELRNALQQAYPQAKSERRAPSLVEIIQTRV

PYLDAVVEEILRLSYPFGMTLREVQVDTQILGARVPKGTTVVFLSNGPSILSPPIDFDDSRSSEWVKSRKPKPLEKDYDY

SSFKPERWLKTAAGPDGKEDVSFDSQAFPIQAFGLGPRGCFGRRMSYLEMKIFFTLVVWTFELLPLPADVARPKPVSSLT

RNPDRVFIKPRKVVL*

 

>CYP526G1P Fusarium oxysporum

40% to CYP526F1, first exon is about 6000 bp upstream and second intron boundary is defective. probable CYP526 pseudogene

FOXG_12987

MSWFELTAGALSIFLLLFCLYNLALPKPIPGIPYNKSATKRLLGDLPDLIEYQKHTEEQCRWFALQNQKFNSPVCQVFIRPI (1)

RKPRVVVSDFREAHDVLSKRLKDFDRSDRAREAFAGIVPHQMLSYQTVDPKFKKHRELMRDLMSPKFLN* (0)

VSAPEIYSKVYCLVKLWDEKCLYADGRPFDAKRDIQRATLDVVTTVSFGLDEENSATKRQLDD

MLSRSTAGLIFTEPEKKIVVFPVYPLTTELHATLTIVESATVGFSSPIPRWHYWSLSQFPYMKNAARVREEWTRREIDKA

VKAISRNVPENAWATGSALEFMVLREAAAAKKAQRPPRFHRRRMYDELFGFIIAGHDTTAATLSWGVRCIADDPQAHRKL

QSLLQNAFSTALAEHRQPTIDEITSASIPYLDAVIEETLRLSAVFPIVSREAMVDTMILGHAIPKGTSVFFTLNGPSLMK

PPIGIPENIWSESLQGTKSRYGEWRAEDVEQFIPERWIDVDDKGVETYNAMKGPFLMFGSGPRGCYGRRLAYLQLRIFWV

LLMWNFEFLPVDPELRTQDVVEHVGVEPRESYAE*

 

>CYP527E2 Fusarium oxysporum

70% to CYP527E1   Fusarium graminearum

FOXG_13007 revised

MTLSYLSEFPTSSGIGIAVLCLLSSWWLGTTFIAWYRLRHVPGPWFAGLSYIWNGWIAYSGKQHHIFVALDEKYGSLVRI

GPEVLLTSDVELVKRMSATKSSYGKSSWVDGVRFNPYHETMFAVRDPRQHDRAKARVAPAYSGRDTPNLEGAVDQQINSL

ISLIRRKYLSEPASGAIRTLPLLNVLSYFTLDVISKVALGTEFGCCTSDSDPYRFYEGLDEHMPLMALTSDVPWIRAVMY

STTFLKYFGPRETDTHGIGPLMK (2)

VTNDNVRRRYSQQDQTEKTDML (0)

SSFKVHGLSEGNAQSETLFMFVAGSDTTAAAIRVTLFYLMSCPRVYR

KLKEEIRGAIREGRASSPITAAQARELPYLQAVIYEGLRMRPVTTGQQAKEVPAGGDTINGHFIPGGTSIAINFSAILGS

KALFGPDADVFRPERFIGLSASNLAEMRRNVEMNFGHGRWMC

AGKPLAFMELQKVYFELLRAFDFQLTEPLSPMRSESYA

LFRDFGLKVRATVAEDME*

 

>CYP527F1 Fusarium oxysporum

51% to CYP527E1 Fusarium graminearum

FOXG_09111

MASPFFERGLTWLPYFIVALFTWLLLSSAISWYRLRHIPGPFFGKLSYLWVAYITITGTQHDHLVN

LNRSYGPIVRVGPNEVLVDDPDLIRKVSSTRNTYTKGNWYLGGKFNPYHDP

MFQITDPAQHDRVKAKLSPAYSGRDAPNLEAVVNRQIGSLIQLIKEKYTSAQGDYRPMEGTRVTRLFALDVISNLSLGQE

FGYLKADSDFHGIVKALNEHMLV MTLATDIPWLRNLIFSPMFLKLFGPTENDTKGIGPLMKVANTIVRERYAPEADEQHDMLA (0)

GSFKRHGLRLEECQAESLFMFVAGSETTATVIRVILLYIVASPHIYQ RLRQEITEAISEGR

ASSPITDVESRQLSYLQ (0)

AVIYEGIRIRPATLGMFFKDVPAGGETMHGKYIPAGTSIGINASSLLRSE

ALFGPDPQVFRPERYLEVDKETSAQMKRDVEIVFGYGRWMCAGKPIAFMELNKVIFE (0)

LLRVFDFQLVEPEVAMKSESYMVFHDQSLILRVTEADHK*

 

>CYP527F2 Fusarium oxysporum

52% to CYP527F1 Fusarium oxysporum

FOXG_15185

MLLEHFTANYWWAAALAIIAWYIVSSVISWYRLRHIPGPLLAKFSYLWLARLALSGKQYETHLELNKKYGPIVRVGPYEV

LTDDLELLRKVNGTKSLYAKGASYSGSRLNPWHESLFMMRDPIAHDKMKAKLIYGYSGKETMGPEAAIDEQIMNLVRLIQ

DKYISKPREFRPLLWSKTAGLFTLDVISRLALGQEFGCLNRDEDIYCFFDTLRDYLPIVSLTTDVPWLRNIAFSPLFLRL

FGPSIKDKKGIGKMMGLTNKVVEEFYHSDGEVRRDMLS

SFKKHGLTKDQCEIESIFMFVAGSDTTASVIRAGMLHILATPHVYCRLKREIANTIREG

RASKPISNADSLFQPYIQ (0)

AIVYECLRIRSVSTNMSFKEVPTGGDVYNGKFLPAGTNIGMNFSGLLRSETLFGKDAHIFRPERFTEVDDKTSAKLKRD

VELTFGLGRWSCLGKPIALMELNKIFFE (0)

LFRHFDFQLAEPHKAMQFDSYMLFRDKGLVLRVTESDLKDLKSIKEDIY*

 

>CYP530A11 Fusarium oxysporum

87% to CYP530A2

FOXG_13473 revised

MLTVQLFWVALAAIFVRLLFTGRRPKNYPPGPPTLPILGNIHL

MPTKDAHLQFRKWADEYGPVYSLILGTKPFIVLSS AQAVKDLLDKKSALYSDR

QEMYVGQILGSGGLRLLMM

GYGPTWRSFRKLVHSLLNVTTARSYVPYQDLENKQMLYEMIVQPDQFLQSIRRYSNALTTTMVFGWRSPIYRDPKLMQLFDG

FAEFAEINQTGIAALLDSFPVLRKLPDFLLPVQRKAKELHKKEKDLYMSHWLKAKQDIADGSIKPCFCVGLAEAQEKEKF

DDAQAAYISGTLLEAGSDTTSSTLYAFVQAMLLYPEIQRKAQDEIDKVVGKRMPTMDDEQSLQYVRACMKETLRWMPTTI

LGAVPHAVTQDDTYNGYLIPKGAGVLNNVWGIHMDPERHPNPRQFNPDRYRDDFQSLADAAANPDASKRDQFTFGAGRRI

CPGIHVAERSLFLGISRILWAFNIKPTVDKNGKPVLPDPDKLTQGFVCMPEEFPARIIPRSEEKKAQVIESWKKAEKDVL

DPETKQWR*

 

>CYP531A3P Fusarium oxysporum

51% to CYP531A2   Nectria haematococca

FOXG_13597

MITQSSPTELSYVGTTVVLFAVLLWWIISTLTSPLRPYPGPLFA (1)

KWTNLWRLYQVRTQKYQWTIQDLHKKYGPIIRIGPN

LLDLDYPELIKIIYGTDHRWLK (0)

FYLNNSSMVDGKIKHNLFSTTSPAEHAQMKKPMAKYYSSSNVLTMEVKMNQVIKELCK

QIDNRFLEDNKSFDLAELLGL (1)

YTWDMIGSLTFSQPFGYMKKGHDFDGTIIASALSVDYFAQIGQMPFLDWLLNKNPMVRI

GPPDMSHVTHFSIAQLQRRLEQQEQRKSSEEPDFLDHFIDGMKSNPDSVDAKLVLNFLLANVLAGADTTVIALRAIFDFL

LQNQHAMTKLKSEILTLGFNDAEAVPYSRARSLPYLDAVIRESLRMHPSVAMPLERYVPNTGLTLPDGSFIPPGVAVGLN

PYIIGRNEVVWGEDTH*FRPDRWIKAEDESEGEYQRRLRKMNGADLT

FGGGSRICIGRHIALIQIYKAVATLVSRYDIQLADQ

NVRMKIISGWFPLQTGLFVRMRKRSEMGKL*

 

>CYP531D5 Fusarium oxysporum

86% to CYP531D1 Fusarium graminearum

FOXG_05863

MALSSFDLSYVLYVGVAFVVARIFYDLLFSPLRRIPGPLAAKYTDFYRAFLATKGNVDGHMREWHQKWGSAVRVGPNTIS

ISDPDLIRVIYTTRNPWRKTNMYRPNDVVVNGQRMQNIFNTADEDFHTKYTKPIRGFWTLPKMLEAEPIMDETLCELITH

LDNRFASTGYVCKMDEWVAYYAWDAAANISFGRNYGFMDQAADVENIIAESTAGLKYFTPVSQIPWLDEWLDKNPIWRIG

PRPLVNGVLYTVKILTEYQQQVASGAAKRKPVDLFIDKYNSLKETVDYVDDQQILNWLMLNVLAGGDSTAGAMRAPAYHL

LKNPSVCEKMVAELRSANLTLPVPQWKEISQLPYFDAVMRESMRISPAVGLILEREVPKEGLELSDGRFIPAGTKVGINP

CVITRDVGVFGEDVDTFRPERWLRSKGESEQGHAHRVRRMHECTEMMFGHGSRVCMGKHMSKLEMYKMFATLYVNFDVRI

TDPNHRWKYDNSWFMYHKDIPCTISRRQKS*

 

>CYP532A8 Fusarium oxysporum

85% to CYP532A3

FOXG_10880

MHSGLVETLLSALAQHWVLVLTSLTVAWLVKNRYHHGLNKYPGPFLASLTDWWRFWDVYGQRPEVTLQKLHAKHGDIVRL

GPNTLSFADPAVLKSIYGLSKGYVKSDFYIVQQSVVKGHRLASLFSTTDNDFHSQFRRCVNSAFSMSALVQYEPFVDNTT

KLFLEQTEKLFAKRADVCDFTQWLQFYAFDVIGEITYSKRHGFIEKNEDVEGIVAYLGKLFLYVAPVGQIPFLDLIFQKN

PIYLKLSQWGLFDSTIAVARFARARMAERLIPELKSVDSLPTSNLKKQPLGQDLLSKFIAAREARPEFMTDTLVQTMAVS

MAFAGSETTAITLSAVFYYLLRNPECYQKLKNELDEAAKAGVFSDYESGLVTFSEAQKFPYLHACVQEAFRMHPAPGLPL

ERIVPPQGAEIGGEFIKGGTIVGVSAWIIHNRPEIFGTDTDKYRPERWLPDPNLDAEEEDKRIKKMTGMMFQFGMGSRTC

IGKNISLLEIYKVVPSLLRRFEINFEDPSKEWRIINAWFVKQTDFNVKFTRRELVQPEFSEKQE*

 

>CYP532H3 Fusarium oxysporum

81% to CYP532H1

FOXG_10225

MILERIVPQSFSAAVLWLIGVILTRLIYNKYGHGLNHVPGPWLAGFTDLWRLLVVRGRR

AQEVHIELHKKYGPAVRLGPRAVSIADTDALKVIYSPSAGWSK (0)

FYPVQQALAKGKRLET

MFNTDNDRYHARLRRSVSNAYAMSTLVTFEPFVDSTSAEFIRQLKLRFSDQTGNAGICDFGAWLQFYAFDVIGELTF SKR

LGFVEKGIDIDNIIRDLESFLNYVSW IGQIPFLDKLFIKNPIKIWLVKYGFLNSSAPVAEFARKHLVERQHEEASDMPKA

PRRDFLNRFKEAHNKDPDFITEQLVLALTVANMFAGSDTT GITLRAVFYYLLKDPPKMESLLKELAAESKAGRFSRDDGL

VQWEEVRDLPYLSAVINEALRCHPAVGLTLERIVPSGGVTLGGHFIPGGSIAGCSPWVIHQDAEVYGADAAEFRPERWIE

ATPEQRKKMNSCLLSFGAGARTCVGKNISLLELYKLVPTILRIFELELVNPDTPWKLHNAWFVRQMGFNVRLKERKTIL*

 

>CYP532H4 Fusarium oxysporum

60% to CYP532H1 Nectria haematococca

FOXG_16603, AAXH01001105

MILDLFLQHPWAYLTAAVVGLLVTKLLVNKYGNGLNGIPGPALASFTDLWRFLDVYRRRPEVTQIALHEKYGTVVRLGPN

TVSIADPAAIQTIYAHNSGYTKSDFYPVQQTINKSGKRLITLFTSQDEKFHSQLRRSVSNAYAMSTLVQFEPFVDSTTTE

FFKQLDQRYANQNDILDFGTWLQYYAFDVIGELTYSKRLGFVDHGKDVDNIIGNLEWLLNYAAPVGQLPILDSLLLKNPL

RLQLTKWGFTNSSSPVAIFARNRMLARVDPEKLGDMKFDQDNGRRDFLSRFLEANQKDPEFMNNDRVLALTVANMFAGSD

TTAITFRAIFYYLMKNPADMKTLMAELAEEEKAGRFAREDGLVSWNEVRDLPFLNAVVKEALRCHPAAGLMLERIVPARG

LEVNGHHISGGTIVGVNAWVLHRNKDIFGHDADRWRPSRWIEASTEQKRRMENYMFAFGAGSRTCIGKNISLLEMYKMVP

ALLRRYE (0)

LEFPSADNTWHLNN (1)

AWFVKQSNFNVRLRRKHKLSFLPDERQD*

 

>CYP534C3P Fusarium oxysporum

60% to CYP534C1 Fusarium graminearum & = frameshift

FOXG_05507

ILLI*ITILYLIYTFTSNPRQTTVLSKESGVSYTIA ()

VGAGGNDSGTITTLNQNIMRPTPNFIACPGFGLY*IW

PGESLPSKADPRMTKYGSPKPIADHELSVATAIATAPENILMLPPYHAGFSV (1)

SLMPFKRTQIAAKSSE*FGEYMQELMDENIIEARRGERIDGMDLMG*LERSS

YRTDVGPHPQGKELNKGALSQDDIRGNTFIMLAAGQETSAGVLQFILLELANNP VSQRSL

HGAIDETCGDGDPSLWDYENLINPKMASMLGACINQTLRMTPAVVEIPEAVPLN*GQIVT

IGGKSH &

VPSKTFISSGAVSAHRNPRCWPGRPSLINDGKDDINDWVPERWYRNSQESTARS

TESGCQPRDEEFGSAATSTLLFRLEGDSFIPFSDGPRSCLGRRISQGEIIATLAVLFKDH

SLELAVDDWASDEQ MDREARREVYAKAQSSSRKKIRGATSVLTLKIRDGHVLVRLVK

 

>CYP535D3P Fusarium oxysporum

seq. runs off the end of the contig

75% to CYP535D2

FOXG_17443

MGLFASVSEHRELLVCALLGLFVIKKLVVYSKLRQFGGPRWTGFSDWPHSWAMLQDRCHELYEQANLKH (1)

GPIARVAPNILITSSPELWIHVNNKPGYKRSDWYYNACRIEYRRDNVFSQTDNQKHEQRRKQMAPG (0)

YSGRENPHLENSVDERVQEFLDLI &

RNKYLSSDTQAIPMDVAQKVQYLTLDIISGIGFGKPFGMVQKDSDVDEYLKSSEE

 

>CYP537A6 Fusarium oxysporum

87% to CYP537A4

FOXG_09472

MLILSPSFMLGAAALLVITHIIIRLTSATAKVPGPFVSNFTSLVLKWHELNANRTMYIHELHKRYGPVVRVAPNEVSFTS

IDALKEIYGSGGSGYDKTEFYDLFQVYGKRTMFSTLVKGDHAKRRRMIGDRYANSNVMKQAPLAGIQERSKRFVERCVDS

PDKTADVF (0)

LTKTALHAYACDCVTHQLFHPYGSNCLQNKDDEEMMHQVAADDSLQ (1)

NRLVQYYSPILHRLGSSILTSFAKPRLIPLADNFVIENAK

ENGAADFTVLNRLKEKDSVLDTIDMAAECLDHMAAGIDTTGDVLCFLM

WELSQPRSTKYQRLLREEFRSKPDAHFDELPMLDAVLNEGLRCFPAIPMSLPRYVPHGGRVIDGFSLPEKSVVSCQALSV

HRINDHVFPEPDKFYPERWLEAEGDADRRRHQWAFSSGGRGCIGKHLAMAEMKTLLRDVYSRYETEPDESMKSESMAMDD

QLISSRPLGKRCLLKFVPVKG*

 

>CYP537D2 Fusarium oxysporum

78% to CYP537D1 Nectria haematococca

FOXG_09731

MATLSLAHLAGAAVLIFIGVLIVRLRSPLASLPGPRLGLLTPWQLRYHELRGKRTQYVHRMHQKYGNAVRVAPNEVVFSS

LDAMKEIYLSKGSGFDKTSFYNLFSQFGLR (2)

TMFSTLQKGP (0)

HSQRRRVIADRYANTNVNREASLHGIQERSQNFIARCKDAPKQELDVY (0)

MFLHCYAFDCVTHHLFHPHGSDSILQASDEETLHEAVFDNSLVSK (2)

LLNYYHPTLGSVAGKLGLFGKSRGIPRATELVLNGVKKGGVADFTLVSRMQEEKFGMGTFDIASECMDHMLAGIE

TTGDALCFLMWQISQPGYTFIQERLRDEFRANPDVPSDQLEYLEAVVKEGLRVFPSIPMSLPRCVPEGGATVDGHWLPGG

TIVSCQPYSMHRMDEGVFPRPDSFEPQRWLEEKGSAERNRLFFVFSNGGRACIGRH (2)

LAIVEMKTLLRDIYSRYRTAPADGMSFDMSMDDQIFTSRPRDQKCNLKFVEWVEVAGC*

 

>CYP539A7 Fusarium oxysporum

88% to CYP539A3

FOXG_00101

MGVVEALLEQISVKTTFIVLFVAYGVYSIICRIDEHRRIRRLGRYGPQLKTYAPWSLDLVARFVRSTVKHNNLASWRDGI

FGPLNSWTAEARLLGVRTIFTADPANLKAILATQFVDYGKGQPFHAEWKDFLGDSIFTTDGPSWHASRQLIRPQFTRDRV

SDLHCFEAHMQTLFKAIANRGPLRGEGQLVDMNNTDGKVLDISDLFFRYTLDVATEFLLGWDVKSLTTPKQEFAEAFNEV

QHIQNIIARVGKLRHIIPKYRFWRALNTVNHFINFYIERALRLSPEELASKTKDDHSYTFLHALAGFTRDRTVLRDQIIA

VLLAGRDTTAATLSWTLYELGRYPNAVKKLRAEIISTLGTERTPTYEDLKSMSYLKAVLNETLRLYPAVPFNVRLALKDT

TLPRGGGPDGSEPLPVLKDSPVAYSTLVMQRRSDLYPPTSDTFADPQIFSPDRWAHWHPKPHDYIPFNAGPRICIGQQFA

LTEMSYVLVRLFQKFDRVESQMKDIDGGEPLLKADIVLSPGQGVKVAFWEAQN*

 

>CYP540B15 Fusarium oxysporum

90% to CYP540B5

FOXG_04494 revised

MATKRFHLMGEDPSTAQEIEIPTSLDEQGLQHLVASHFAIVDPS

GIGFVTESDALTTVADVLATDDISITIDGKAVREVPGPKGLPLVGNYFEVY

PDHLGNHQRLFEKYGPLFKTTNMGSTIYHTNDPKLANIVFGETDFFSKRIIEGHPLFPIKNKEAGVFLGDTDTEEWKEVH

KFLPPALGPKAVRHYAPTMQKTVEDAFKVFDELDERDEAWNVYPYMLKLGSQAVGKLVLGMDFQHFTSPDARPHAMVMRI

AQSLELNKKITSMGSWYKNLPFGDPQRLRDARAHMELMMKESVENASKGEGDLELQDAAVQAENMVDYVLRASDSKGNKL

PRERIMEPLVVATGAGFTTTSSLLSWLLYGLVAYPGMQERLLQEMVDNGFDENTQITADLTNKLTFLDKYIKETQRRHNP

SYQPARTASVDMVLPGGYKLPKDSIVIPALHHIHNNTKIWDNPALFDPDRWDTDRVKNRPNASYIPFATGPRMCVGFNFA

LQEVKVFLPKLVYRYKFSLAQDGPVEYDPMFQLIRPNNLYVRAERRIKWPSKSD*

 

>CYP540B16 Fusarium oxysporum

92% to CYP540B3

FOXG_16987

MATKQFYLLGEAPSTTREVDLPPAVDFEELQNIVASHFAIVKPNGVGFVHDDRRLNVVSEVLDKDEPIAVSINGNAVRDV

PGPAGIPYFGNYLEIYPDHLGNHQRLFEKYGPLFVTNSMGNRLYQTNSAELSNIFLAEDHYFTKDIVPGHPLHPIKNQEA

GVFLADTDTEQWRLAHKFLPPALGPKAVRHYAPTMQRTVEQSFKVFDELDEKGEAWNVYQYMLKLGSQAVGKLVLGMDFA

HFEEVDSPLHEMVLKIAENLELNKRVSSMGAWYAKMPFGDPKKVRDTMGRIMEMMTESIARASKGQEDLELQDAALKAEN

VVDYFLRAKDNKGSKLPPSQFAPTLLVATAAGFTTTSSLLSWLIYSLVKYPGNQERLLQELIDNDWDEDTQVTAETTSKL

SFLDKFIKETQRLHNPSFQPGRTAKVDMILPGGYRLPKGAVVISALHHMHNNKDIWENPGRFDPDRWDTEQVKNRPPGSY

IPFATGPRMCVGFNFALQEIKVFLPKLVYRYKFSLAQDGPIEYDPYFQLIRPNNLYVQAEKRVKWPPKSE*

 

>CYP542B3 Fusarium oxysporum

91% to CYP542B1 Fusarium graminearum

FOXG_03513

MASNTFMAVQETIAALTWQQTGCLLAGIWLIYLVQLVIWRLWLSPLAHIPGPKLAALTQYYEFYYDFVLGGQYTYKIIDM

HERYGPIVRINPWE VHVGDPEFFSDLYTGPSRRRDKWTFYTQQ SGAPRTRVPHPTALAGPKTATEGSLAAIDHSLHKLRR

SALNPFYSTQTVRELQPVIEERVEALLGAFLNYAEVSNGQPLDVMYPYSAFTNDVINEYAFARSDHLVEKPDFGAEVTND

LLIGTHMGPCVQQLDWVLTLVNALPESISNRCMPGWGGFLKMKNDILEQIHSVDPPQSSGKWMMDGGHPTMLSTKTRSVR

DKTASRQTQESQITVQGGTLTTSWAMSLATFHLLNRPETLRKLRDELFDAIPDAYETIPLSKLEKLPYLRGVVKEALRLG

IGTSSRLARVAPDEALVYHDRENDEEWNLPPGSIVGMSPYKTVMDENIFYDARGFHPERWVEDGERLDKYLDIFCSGSRI

CLGMALAHAELYLTLAKLFRRWGSGGVVYGSDDGDQRFGDVGYLSIFETRVRDCEIDADYFMPIPYKGSEGFRFVFETY

 

>CYP544A6 Fusarium oxysporum

75% to CYP544A4 Nectria haematococca

frameshift = &

FOXG_03445

MDYLSFVLEQPIVLSTTLLLFLYLLGKKSPKPTRNGKPLR (2)

RKPPNS

LPLVGNGIMFLQPRQRLFSWFHRCERLYGYETLHITVPTLPPGVIINNPQNLEFIFRHEG

IFEKGEFFKQRSWDLFGHGIINVDGEFWRLQRKAGLRFLSTAALKTLTSDRLPEYLEHAI

HVLKGKEAERDVVDLQAVIHEVTTQLMGRMAYNMEMHADDDFTVAFEHASGATAERFQNP

LWFVTEMFFGTRMRRSIRTVKAYGQRIVKSAVADREETEGKTQSDAPGSLIQSLLDAIGD

GDLVADAALNYLSAGRDTVAQALTWTLYLLMKHPEVTNKLCQSIQDLRDEVRDQDHSEND

PELLTPVRLPYVLAVFYETLRLRPPIPFEIKQAQQETILPDGTFLPKGAVVLWCAWAM &

GRSHTTWGPDADEFRPERWLTTSPSGDVTVMQRSAAEFPVFNGGPR

VCLGKKMAQLVAVQ

TLARLVPLFDFKPAFEGERVSKSSLTLPMEGGLPVYVHARKTSETS*

 

>CYP547B3 Fusarium oxysporum

80% to 547B1 Fusarium graminearum

FOXG_13409

MAVVSKLLGFPSLTLAAVIESFVAIKVFPDYYDSKSHLAAVFTILLVNYAFGIVFWGFLYPVFFSPLRHIPGPREYLSAA

HRSIAVKDRPSGDLFVDIANRYPGEDLLTLNSFRTHILVTNPQLLADLLVHNCYDFTKPKRISSFLRHILGDGLIIVEGE

PHKFLRKNSTPVFHFRHIKELYPMMWEKSQSLARAIQQDMTTSRSSVVELNSWASKVTLDIIGIAGLGRRFDAVEKKKDP

LADIYEGLLEPSREKLIFSGLALAIGLPIVRLIPWKMNDVFNYLTGTLNELCYPMIQEKKAAIIEKGDDHFDVLSLLIKS

NNFSDESLKDQLLTFLAAGHETTSSAITWACYLLTKHPEYQAKLREEVRNGLPEDLAANPTVDLAGILEQLPYLNGIMHE

TLRLYPNVPLTMRSAIRDTRIGDQFIPEDTDIMVSIWYINRSEAIWGPDATEFKPERWITDDGKPNQNGGASSNYNFLTF

LHGPRSCIGQGFAKAELRCLLATMVRSFEWTLAMDDKLVMPRGVITIKPENGMYLDLKAL*

 

>CYP548A5 Fusarium oxysporum

98% to CYP548A5 Gibberella moniliformis/ F. verticillioides

FOXG_07777

MTFNLTHLLVYLGLLVGGLALYGFGIVVYRVFFHPLAKYPGPFLAKITDGYQLYHAWKGDRQLEFWRMHQKYGPVVRFGP

NSLCFNSNKALKEIYGFRTNVRKAEFYNAFVHPTANTHNTRDKEVHARKRRVMSQAFSESAMKEMQRYILGNVRTFCEQI

GMLEGSGEETKGWTKPRKMSDWCNYLAMDILGDLCFGKAFHMLESPTNRFALELVEAATTRHLLCGTMPIVNKLNLDKIL

FPGLAAGRARYMGYSKGQLAERTKLGEETDRRDFFYYLLKARDPETGQGFSTPELWSESNLLIIAGSDTTSTAMAATLFY

LVRCPRALERVTEEIRSKFNDVEEICQGATLASCTYLRACIDEAMRLSPSVGGILPREVLSGGITVEGRAIPEGTVIGVP

HYTIHHNESYYPSPYEYVPERWLVGALNPLTGEKTTEDEVALAASAFCPFSIGPRGCIGKGLAYVEMTNTLARTMYLYDM

RKAIGIVDPAEGNPKNEWGRHRPGEMQLVDTFTSAKNGPMIEFRKAAHINA*

 

>CYP548E2 Fusarium oxysporum (temp 548E4)

94% to CYP548E2 Gibberella moniliformis

FOXG_05969, supercontig_6

MAIINAVAILSSSQIIWGITCLLFCYIAAVVVYRLYFHPLAKYPGPFWARISAVPAYYYTLRQDRHVWFWQLQEKY (1)

GPAFRITPNSVLINTPTGLKTIFNNKANVKKAEYYKTYPRNVHVMTTWNTIDKTMHARKRRVMNHAFSDKALRSCEPF

IQSNIDRWIELLDQEIGEKKWSPSLNMARWADHLIFDTLGELCFGKSFGMKEHDSELRHIPTLMTDFMSTIHPIAYSPFA

PLWAWLKPRGLDYLLAEAAPPAFSKWQAFVEQCFTERVQAENEMRGLWEKGDGRKDFFHYLFQAVDPDTGKGYSKDELFG

ESESLIIAGSDTSAISLAASFFYLSRYPHVQQKLAREVKSVFSSVDDIKGGPALYSCQYLRAVIDETLRMSPPVPADLSR

EVQEGGILVDGEYIQQGMKVSTASYCMHHNPDIYPEPFRFRPERWIVDEKNEFGVSPESVSLAESAFMPFSAGPRGCVGK

NLAYLEMSLALAKIVYHFEIRRDFSSNLGGGSPDAIEGRHTVDQYQLRDIFVAIRDGPMVQLARRSRTD*

 

>CYP548E3P Fusarium oxysporum

pseudogene 69% to CYP548E2 Gibberella moniliformis

FOXG_14148

MTAMITDSSLQMILSGTVFVSTIYGAAIVWYRLYLHPPSKYPGPFWSWISA (&)

VPGYCYTSR*DWHMKYSKYYEIC (2)

LTFRITPNSVLINTPSGLK

TIYNNKANVKEAVCYKVYHCNVHVTTTWISIDNATHARKRRAMNHAFSDKALRSSEPFIH

SNIDRWIELLKEEIRKRQWSCSLHMARWADRLVFDTLGDLYFGESFGTKERDRELRHIPAIS (&)

VFTSTIHS (0)

IGYSPCTSLWAWLKPGLDYLLAAAAPPAMSKW

TFVEECFTKRAQIEDEMQARCKSGTESRKDFFQYLVLALDLETGKGCSNEEVFSESGSL

IIAGSDTSAIGLAAAFFYLTRNPHAQEKHAKESRAAFSSVGGIQGGAALHSSQYLRAFIQ

GTMRMSPPVPTDIAPEVQQ (?)

GGIVVGGRYIPEGTKASTVSYCMHHDPDMYPEPFKFRPERI

VDEKDECSDSPESIYLAESAFMTFSAGPRGCVGKNLAYLEMSLTLAKTVYHFKIRRDHSS

NIGGGSSGAINGRRIVDQYQL*

 

>CYP548E4 Fusarium oxysporum (temp 548E6)

86% to CYP548E2   Gibberella moniliformis

FOXG_14116, FOXG_12421 identical sequences

MAIVDTITAFPSSQIILGTAFLLLGYIAAIVPYRLYFHPLAKYPGPFWARISAFPAYYYTLRQDRHIWFWQLQEKYGPTF

RITPNSVLINTPTGLKTIYDNKANVKKAEYYKVYPRNVHAMTTWNSIDKTIHARKRRVMNHAFSDKALRSCEPFIHSNVD

RWIELLDREIGEKKWSSSLNMARWADHLVFDTLGELCFGKSFGMKEHDSELRHIPVLMTDFMATVHPIAYSPFAPLWAWL

KPRGLDYLLAAAAPPALSKWQMFVEKCFTERAQIENEARGVSKSGTESRKDFFHYLFHAVDPDTRKGYSNDELFGESESL

IIAGSDTSAISLAAAFFYLTRYPHAQEKLAKEVKSAFSSVDDIKGGPALYSCQYLRAFIDETMRMSPPVPADLAREVQEG

GIVVDGQYISEGMKISTASYCMHHNPDIYPEPFKFRPERWIVDEKDDCGVSPESVSLAKSAFMPFSAGPRGCVGKNLAYL

EMSLALAKIVYNFEIRLDHSSNL GGGSPDAIKGRRTVDQYQLRDIFVAIRDGPVVQLAKRTHMD*

 

>CYP548E5 Fusarium oxysporum (temp 548E7)

frameshift at C-term

76% to CYP548E1   Nectria haematococca

FOXG_07116

MFIRYTVKDISPSQALALVAALALSWIIATIVYRLYFHPLSKYPGPFWARISAFPAYYRTKKQNRHIWFWQLQQKYGSTF

RITPNTVLINTPTGLKAIFNNKANVKKAEYYKAYPRNVHAMTTWNTIDKTIHARKRRVMNNAFSDKAMRSCEPFIQENID

RWFELINEEIGKKQWSDSLNMARWSDHLVFDILGDLYFGKSFGMKEHDSDLRHIPRLMTDFMALLHPIAYSPFTALWVWL

KPRGLDQLLAVAAPPALSRWQNFVEKCFAERAKVEDDARKLNKPEADSRKDFFHYLLQAVDPVTGKGYTKDELFGESESL

IIAGSDTTATSTAAAFFYLSRSPQVQEKLVKEITSAFSSADDIKGGTTLYSCQYLRAFIDETLRMSPPVPADLAREVDKG

GIVVDGKYIPEGINVSCASYCLHHNPEFYPEPFKFYPERWIVDEKNESGVSAESVALAQSAFMPFSTGPRGCIGKNLAYL

EMSLVLARIVYNYEIRPDITSNL &

GGGSLNAVEGRRTSDQYQLHDIFVGIRDGPMVQLARRTRSA*

 

>CYP548G3 Fusarium oxysporum

58% to CYP548G1

FOXG_16410 revised

MALSTNSPVPSWTLFASSAGLGIL (0)

LLYICIYRVFFHPYAKYPGPFLAKLTSWYSVYHTYYGDLHLDIWECHQKY (1)

GNYVRYAPNRVLINTPEGLK (1)

AIYNHPKNTQKSKAYRK

MSLVPGVHSSFSTIDNQAHAKLKSLISQGLSNSHIRAYDPELRQSALLFATRLGEKIDRFEPDQSDVGEDGWTAPKNLAS

WSNYFTFDVMSHLVFGTSYNLLTNSENHWVIDGVLGQMRRMSFLTMLPELEDMRFDLLLFSNARRMAYRFAVKSREIMEA

RKIREKAMEGQETKVDLFSKLLAAKDPETGEGLPDKQLWAESNVMIIAGSDTSSTAIAATLFYLSRNPSAYARVTKEVRS

AIITPEDICQGPKLLSCTYLRACIFESIRLSPPAGGAMWREVMPGGMHIAGNDVDIHVPGGCEISTGIYAVHHNEEYYPD

PFEFRPERWLADEVGDETVAKAHAAFDAFSQGPRGCPGRSLALIEISFAVAAVIMSYDFRKVESSLGEVGEGNGKFAGQY

QTSWVFSSFKDGPYLQFKRIK*

 

>CYP548J1 ortholog Fusarium oxysporum

97% to CYP548J1 Gibberella moniliformis

FOXG_11965

MPMSHMKTHWLPYAIRISRSITPPPLLIILLLAALSP (0)

VIGYVVYYAFFHPLAKYPGPFWGKFTGLRAAYHAWIGDVHIDMWKCHEKY (1)

GPYVRYSPNYLLMNTSQAYK (1)

DVYGHNKNVRKSLAYLA

MVHKTPSTFTLMDRHEHAWKKRILSQKLSDSAIRSFEPKITGMIDRFCEYVCPVSAGKENTVSKPFNMSEM (1)

CDYLFFDLV

TSIVFGENFDLIRSPWYRHIPPALARSNERISVIVQWPYVVWRRMDKVLFRNSVAGRKDFLRFAHNLVTERVQRGSGDDV

LSGLLDAADPTTGNKLTQDEIVAESILMLVAGSDTSSTLLASLFFYLTRNPDKKDRLTREVRSKFSTREEICLGPALNSC

RFLYACIMECLRLTPPVAAAPFREVLKGGMIVDGHYVPEGTNVGTGIFSLQHNQEYFHNPFEFMPERWLSEGKHAGLHNP

DAHVPFSIGPRVCLGRALAHAELSLAMAIICWKMDFNVVESMKDIGAGNENAEYGRHRPGEFQLYDHITCARNGPMVEFRERSF*

 

>CYP550B4 Fusarium oxysporum

78% to 550B1

FOXG_07659

MELSSLYQTASATFGSLPVAYKFLCAVLVIFAFSKAF

SGAERKGYKKNLPRYAPIELAIASYILSGDGIGRRIF (2)

SALSRYGGSLFGLTSGHQIFVDLPGVERLL

AQSHHTFNSDPAQYSLCTLVFGSTDTPELRAKFDTSLKDLVPPLERTFLNDAASTANVEK

SRVAERGASLVTFSSNPKDMARWELSAGIKVLQPETLDSPGKVEANLQSLTRDFGAC

MSVPLIYGQDILDRNPRLLDDFWTFDNDLFPLLMVGVPKWAPFRIMQDGLKARARIIDSLEAVYRRVDQYEKGEPVDLGA

DMSDVGMMLRERNKIYNRDGWTFPERAAADLGTFWGLNANAQPVLFWFLLYVYSTPGLLKRIRDEISPYVTLSDGAKPEI

KSMDFPSLFRKCQLFKACIFETYRLVNEPTSIRYVTQPVSLNDGNIKHDLQEGTYISVPLALKNKNPSIYEDPDTFIPDR

FLDTDPETGKATARYGKLKPWGLGAAMCKGRTFAEKEIISLGSAVVSLWDISPAEGEWKLPAMIPGTGVKRPVSDIRVVI*

SRRSPLKS*

 

>CYP552B4 Fusarium oxysporum

79% to CYP552B3

FOXG_02774 revised

MADATWSAFQGTLTSMTARDWIVALTSAWLAFKVLQALYNVSPLHPLS KIPGPKLAAATYLPEFYYDVILVGRYTHAIKQ

MHEKYGPIVRINPNELHCADMSFSDEIYAVGGRKRDKPFHQVNGSAAGTGNAFGTPDHDLHRARRAPVAKFFSRAMIARL

EQEVHDLAQTLCNKLLAENKDEKERKPFEIAHAYSCFTSDAISSYCFGEAFGLLSRNQWQPNYREATLAVLKPVFFFRFF

PILVSSVKL GKYLVDYLPADTALLIRTLQIDIP SRVQKTKNDLDS GIVYDRPTIFA

DLLQSELDDSEKKQDRLVEEAVTIVNAGTETTSWALAVITYFLLSQPEILAKLQDELKQVVDDPCHLPSWT

TLEHLPYLGAVINEGLRLSYGVSSRTARVPTTEDLVYRGEFNKKPMSLVLPRGYAIGMSAAIAHHDESVFPDSYAFVPER

WIDGDNKIRKDLERSMIAFSKGSRGCLGKNLALCELYLSLAALVLRVMPYMRLYETTERDIRYDHDMFIPMTESGSKGVR

VIIES*

 

>CYP552C4 Fusarium oxysporum

84% to CYP552C2

FOXG_10802, not in the F. verticillioides genome

MDQMAVLPASITAAALFQTIAYLFTSWLAYRILLVVYNISPLHPLYRFPGPKIAAASYLYEAYHDWWRVGRYGREIRRMH

ERYGPIVRINPDELHCSDPYFTDEIYAGPGRIRDKWQHQLNTGGAGPVSVTGFSTVNHEVHRMRKGALSKYFSRQQMLKL

EGEVQEFAQMTIDKMLRYAGGEPFDVKEAFNCFTADIMSQYAFGESMGFIAQDGWEPNLATWVKSFFQSAYMMRHNVFAR

TMAQLLPFLSDYLGEDIKAVMRQMNVVIPGYIAAALKNPEGGRVFADVMESKSLPESEKSMYRLSGEGFNFLLAGTETTA

AILTVITYYLLAQPLTYRRLMADLEGIDPQTLKWTELEQRPYLWGVIHEALRVMPGVSHRSARIAREEDLVYKSKDGNVE

WVIPRGTPIGMTSMINHWDKEIFPNPDNFTPERWLEGGRPNFKLQKLLIAFGKGSRACIGENLAYCEVYVMAALLAFRVI

PRARLHETTIEDITYDHDLIVVQTKKGSISVRIAIS*

 

>CYP552C5 Fusarium oxysporum

92% to CYP552C3, 65% to 552C4

FOXG_12228 revised, not in the F. verticillioides genome

MDNFNSIALERLLSPSALFGLTGLWLGYRVALALYNVSSLHPLSKFPGPKIAAASYVYEAYYDWILQGRYGRRIEKMHEQY (1)

GPIVRVSPDE

LHCSDPFFADEIYTGKPGRIRDKWQHHLKIAGAGPVSQATGTAGPHELHRKRRAAHARFFSRGQVLKLEDEVYNYAKLAI

EKMLRWTGKEAFEIKGAFNCYTADVFSQYAFGEPMGFIEQEGWEPNFGTWTSSFLTTTYMMRHNGLARRLADILPMFADY

MGEDVKRIMHQMNHVIPAYIKTALANPDGGRVFNEILNSNVLPEEEKSMYRLSGEGFVFLVAGTETTAAILTVMTFHLLH

QPKIYARLMKDLEGIDPNNLKWAQLEQRPYLWALVQESLRHQPGAAARSARIAREEELFYKSQDGKTQFVIPRGTPVSMT

AMINHWDTRLFPDPDAFNPERWLLPDGKPDYTLQKFLISFSKGSRVCVGESLALCEIYIMAALMAFRIIPKAELFDTTIE

DLTYDHDLVVLQTKKGHISTRIKIA

 

>CYP559C2 Fusarium oxysporum

71% to CYP559C1 Nectria haematococca

FOXG_06404

MTVLGDQLTEVTFTRVLLFGSLFLLVSFIVDLLTQPRYPSEIPVLGHSSEKWFSRIRNSLAYFTQHQAWIGEGYEK (0)

YGKNGLPFIAPAPISRPPDVILPRSQIAWMMEQPDRILSASHAHDKILYTEYNFLGKDLAAEPFANRVMHKYLARNLSSAIPAV

EDEVNGAVEHALETMMKAAAEKDPKNVDGEGYTKVNLWDLWLAIVPRVTNRLLVGSPACRNPDILKSM

VSFTDNVVMNSF

LLHGFPQVLHPIIGRLITIPNYLHWRKASHVLLPIIEQ

RLKHMQRQEAGDPEMKNYTPPEDFITWDIRLAMAEKKPFELD

PVVISKRLLPINFAAIHTTVLTGQSWMLDFLSSPPSVLDALRNEILEHKPSEGHWTKQALSSLVRVDSSIRESQRVSNFA

ANLIERQVIAPEGLHHPDYGWTLPRGAFVTVNLQGTHHDDEIYEDAMSYDPWRYSRVREEWEAKSAEEKQEKEEEAKKIR

GLGMVTTSDAHLAFGHGRHAC (2)

PGRFFVAHELKLIMAAFLLNYDIKTLEKRPKPQWMGATIIPPLDACIEIRKESTT*

 

>CYP561D2P Fusarium oxysporum

pseudogene 51% to CYP561D1 Fusarium graminearum, & = frameshift

FOXG_13060

LIVAIPAVIIYRLYFHPLAEVPGRKIHAITGFLTQWKSHILGTWL*EAAQLHRQY

GPIVRIGPNHIAVDGSIGWPQVHGHQPGKAEFSTYPNFIFPGDGMSLIGAQKDDHRRQRR

*LAHAFSDAALVEQQSVTLQYIDLLIKQLTQRAESGEPIDIVTWVNLTTFDIIGDLTFSE

SFGGLKSGGYHPWVQNFFDNIRGEGMMRLMDRYLLLKPLILAIGYRHI*ESMESAEMSMG

KAKARVALGEQPFEGRRDFVTYMLRRGKDGVTAMSETELLVNSSIVIGAGSETTATALSG

AFFYIGTHPQVYCYLVDEIRGAFTDASDITLKSTAQLQYLHACIEETLRIYPPAAETPPR

VCPGATIGGKYIPKG (0)

TVVTVYQWATFRNPSNFADPDSFRPER*LSQ &

THALDDEKYAGDNRAVFKPFSYGARDCIGRNLAYAELRVILSHILFQ (0)

FDFELKPGQSDWHEKQTSFLVWDKDPLNITLKLRQDEASIS*

 

>CYP561E1 Fusarium oxysporum

39% to CYP561C3

FOXG_17449

MLLLDFIIMFRPLFDSWPLSALWL (0)

LIIYRVTIIVYRLCFHPLAKFPGPKYLSVSSLPFRYCSHIQGLFFKTVEQLHAKHGPVVRIAPDSL

SIDGLYAWESIYTHKSSGLPEWSKVPGHFFP (2)

GDHNVLINAPRETHRRQRRAIAPAFSNVALNDMETDILRHIQELLRALASKASNTQENSAESIDIMS

WLYLLTMDTVSDLIFSNSFNGLKDRMQQKFLLGFFDSTQGLQIGSFLMAYPLLMPFLPLI

YMADVGGLKSSHKYGSFIEAKAKTRMTTGLHSGARRDFIVYMTQDREDAAMETSEKKGMN

DLEISQNSLILATAGSDSTTTTMCGVLYYLAQPAAAKAKRAVLDELRSAFQSEEEVTLRN

TTSTSLPYLNACIEEAMRVYPSTAEQPPRVSPGELVGGHFIPKG (0)

TKVYTYQWSTHRNPAHFAQAKEFHPERFLPESHQQYDKRFLDDRLSLVKPF

SHGPRDCVGRNLAYALMRLTLVNFLLRFDYELAEPKEDWLANQTVKFSWTKGPLRIRVRE

RNEAR*

 

>CYP567B2 Fusarium oxysporum

85% to CYP567B1, yellow is possible intron but it makes the seq too short

This seq is missing in F. graminearum

FOXG_10874

MTASLSILGVFCASLSFTMLYIIYRVLFHPLAKFPGPKLAAVSDIWYALKWTSGRYPFIMEETHRKYGDVVRIAPNELSF

ATVQAYHDIYGHALKDKKRFIKGSWYDVAGDHPGIVSVRDPVQHSRQRKYLSHAFSAKSLRGQETLIHGYVDLFLGQLR

NLGSPGGAGINVEEALNWLTFDIIG (1)

DLAFGESFSAVAEGRSHFWVSLIIDASYAMMLSGLRKRVPLVNLYLPFVVPKDASAMHRKHMALTREKMLKRLEMPNSEDR

GDFFSHLLRKGGNKVPEPELCQQSNTLIVAGSETTA TCLTGIVFCLLSNLSCLEALSNEVRSRFQSDTEITGDATADLKY

LSAVIEEGLRIFPPAPFGLPRVSPGAIIDGHYIPPGVVVSVDHWTTKHDGRYWKDPHAFIPERWIDGGFGDTKQASQPFS

LGPRACLGINLAYLEMRIIIAKMVYHFDWEL

VNNEVDLFRDSKLYLLWKK

PRLLVRFHPHN*

 

>CYP567F2 Fusarium oxysporum

59% to 567F1

FOXG_09562

MIAFNRKYERHNSEV (0)

FASWIIGVIIYRLYFHPLAKFPGPKIAACSE (0)

FWFLRSWASGYYVQNIGDLHRKYGDVVRTASNELSFRSPVALRDIYNHVSKDRPTFLKS

DTLYTVDPSVTRPDIVFTRDPQDHRLQRRSLAHAF SAKALRDNEESVQFHVKLLLERLGQ

NAGPGTGGANMSEVFNWLTFDVI (1)

GDLTFGESFDSLNQWRPSEWVTWLLGFISSLTFLPFINRFKIPMTLVVSVMPSYLKEKID

IHTTEKIKKRIGMGNSRDREDFFAYILRKESDNLDLVHLREQAKVLMIAGSETTANL

LAATTYYLLKNPDKLANLQAEVRSAFSARDEITGDAVAHLPYLNGVIEEGLRIFPPIPFG

PPRVCTGATIDGHHVPKGVVVSVDGFATTHDERNFIRPDEFLPERWIGEGFGDRKEASKP

FSLGPRGCLGINLAYMEARVTMASLVWKYDWEFVNQDLDWLADVRLHLLW

EKPKLMVRYHPRDEVATT*

 

>CYP567F3 Fusarium oxysporum

59% to CYP576F1

FOXG_17536

MNFLSTLAALWVALSLTM (0)

ILVGLSGLCLYRLFYHPLAKFPGPKLAACSQ (0)

FWFLRAWTGGKYPFVMRELHDRYGDVVRIAPNELSFKTPQAYKDIYNHAVGHKTPFPKSKY

FYNRGASIKHPDIVFTIDRESHRSQRRSLSHAFSARALREAESTIQRHARLFVHQISQRG

NPGTGGVDMSAAFTWLTFDII (1)

GDLTFGESFESVANWEPDTYVALILEFIKHFTIIQAAKRLGISEGLLSLFIPGDLKDS

MAFHESLTKEKVARRIKLGDFNQRRDFFAHILRDGGFNRDHLAEQAKILLLDGSETTATFLAGVTYLLLKSPTALSKLQC

EVRSSFASLDEIRGDSLNQLPYLRAAIEEGLRLFPPVPLGLPRTCPGAMIDGWYVPSGTEVSVDNFVMSHDAKSFPEPDEFR

PERWLEGQTGNNKEASRPFSIGPRACLGVNLAYLEASLILATMAYSFDWELVDKSLHWFE

EVELMSFWNKPQLFIRYHPRGSFHGA*

 

>CYP570C4 Fusarium oxysporum

84% to CYP570C2

FOXG_14304 Supercontig 24: 19205-19551   (-) strand same seq

FOXG_14867 Supercontig_25: 302853-303199 (-) strand

FOXG_14868 Supercontig 25: 303463-304548 (-) strand

Supercontig_25 302737-304548, joined the two models above

MSFLQQLPQIGLLQLAAVAGIIILICYVVSTIRQWARLRHFRGP

AIAGFTQLWLISKVGGGRTHLDLWEACKKY (1)

GDIARVGPNDLITSDPDLMKHMLNVRTRFQRSSWYDAMRLDLTKDNVLS

QRNDELHASTRSKMAAAYSGKEVDNIEMTVDENVERLLELLDTKYIAKGRPFDFGYKAQY

FTLDVISALAFGEQFGDLETDSDVNGYITAMEESMPTIIVTTVMPWMIKLLQLPVFKSML

PSEKDKVGVGKVMAIAKRVSADRFGPNPKVQRDMIGSFIARGLLQHEVESEILMQM (2)

LAGADTTATAIRATLLYVISTPRVVQAMRAEIDQAKPSLPIITDS

EARAMPYLQAVIKEGLRIHPPVVGLMSKEVPKGGDTFKGHHLPEGTKVGYCAWGIFRRPD

IWGEDSNEFRPERWLDCSQDQLRLMEGTLELVFGYGRWQCLGKNIALMELNKVFVE (0)

LIRRFDLAVVEPIKPWQSINVGVFLQSEYWIRGYKRAGLS*

 

>CYP570C5P Fusarium oxysporum

Supercontig_23 457233-458956 (-) strand

Not found in Fungal genome database

One stop codon, possible pseudogene

MGLIHLDGRAAALVGVVFVLWYVVSTIRQWAHLRHFKGPAIAGFSQLWLISRVGGGRTYL

DLWETCKKY (1)

GDIVRVGPNDLI

TSDPDLMKHMLNVRTRYKRSSWYDAMRLDPTKDNVLSQRDDDLHASTRSKMAAAYSGKEV

DNIETTIDENVERLLDLLDTEYISKDIPFDFGYKAQYFTLDVISALAFGEAFGDLETDSD

VNGYITAMEESMPTIITTTVMPWMIKLLQLPIFRSMLPSDKDKAGVGRVMAIAKKVAAER

FGPNPKVQRDMIGSFVSRGLLQHEVESEILMQM (2)

LAGADTTATAIRATLLYIISNPRVVQAMRAEIDNSKLSHPIVTDAEARAMPYLQAVIKEG

L*IHPPVVGLMSKEVPQGGDTFKGQYLPEGTKIGYCAWGIFRRTDIWGEDSDEFRPERWL

HSSVDSLRLMEGTLELVFGYGRWQCLGKNIALMELNKVFVE (0)

LIRRFDLAVVDPIKPWLSINVGVFLQSEYWIKGYERASLA

 

>CYP570C6 Fusarium oxysporum

Supercontig_2 5000713-5002479 (+) strand

Not found in Fungal genome database

MGFIQLDSRGFALVGLLVFVAYVVATLRQWARLRHFKGPALAGFSQLWLISCVGGGRTHL

DLWEACKKY (1)

GDIARVGPNDLITSDPDLMKHMLNVRTLFQRSNWYDAMRLDPTKDNVLSQRNDDLHASTR

SKMVGAYSGKEVDNVETTVDTNVERLIDLLDTKYIAKNKAFDFGYKAQYFTLDVISSLAF

GEQFGDLETDSDVNGYIKAMEESMPTIIVTTVMPWMMKLLQLPVFKSMLPSEKDKVGVGR

VMAIAKRVTADRFGPNPKEHRDMIGSFIARGLLQHEVESEILMQM (2)

LAGADTTATAIRATVLYILSTPRVIEKMRAEIDQARPSLPVITDSEARAMPYLQAVV KEGLRIHPPVVGLMSKEVPAGGDTFKGKYLPGGTKIGYCAWGIFRRRDIWGEDADEFRPE

RWLESSEEQLHLMEGTLELVFGYGRWQCLGKTIAQMELNKVFVE (0)

LIRRFDLSVVNPIKPWHSINVGVFLQSEYWIRGYRRIN*

 

>CYP570C7 Fusarium oxysporum

Supercontig_13

88% to 570C1

FOXG_10682

MAAASLLHRLRDVFGDVRPSIAIAGLLVVFVTLWSALSTLRQYNRLREFKGPRLAALSKWWLIKKVGGGRAYLDFWEVTK

QYGSIARVGPNDLLTDDPELMRHILNVRTEYRRSDWYDGMRFDPGNNNILSWRDEDEHFKLRSK MSAGYGGREVENLEPK

IDKNILSFMNLLGQYADEKKPVDFGRRAQFFTLDVISDLAFGEPFGFLETDSDVYKYIQITEETLPAVMVTTVIPWLVKV

LSSPLFKSLLPSEKDRLGFGKLMGIAKQVTAERFGPDKKVQKDMLGSFVAHGLTQKEAESEILLQIVAGSDTTATAIRST

MLHIITNPLVYSKLRAEITDTTFSEPIIPDSIARDLPYLQAVIKEGLRIFPPVAGLMSKQVPPQGDTWKGKFIPGGTKIG

YCAWGIFRREDIWGSDAGEFRPERWLESKGEKLREMENALELIFSYGRWQCLGRPVALMELNKVYVE (0)

LLRRFDFAICDPTKPWTVFNCGIFSQSELMVRVHRRD*

 

>CYP570D4 Fusarium oxysporum

82% to CYP570D3

FOXG_14514 revised

MTLEGDPSAGFLRDVLQSVTDHPRAVIATAVLGLVVLFVADTLRTWYRLSHVPGPFWAGFSKAWMVRQSFKGIQPYAIQQ

ANEKYGSLVRIGPNELATDDPKLLKRMMSSRSAYTRGPWYNALRFEPGKDNLFSMRDDDAHAKLRNKMAAGYSGKENESL

ERTIDEHIAKLINLLETKYLSTDKDYRPVDFAQKIQFFTLDVISDLAFGQAFGYMEQDDDVFDFIKITKSYFPVT LIMANIPSLVSLLHSKLFSGALPKESDKLGFGAFIG (2)

VANKK

VAERFAPGAQSHPDMLGSFIRHGLTQEQASRESLLNVVAGSDTSATTIRLIMLSLLSNPIMYLKLRNEIDDAIKAGSISS

PITDAEARKLPYLQAVIQEGLRIKAPAAGPLFKQVPPQGDEIDGKFIPGGTQIGQSPFAVYHSKEIFGQDASLFSPERWI

NADPAKYEAMAEVVSLVFSTGKYQCLGKPVAFIELNKIFVE (0)

LLRRFDFCMARPERPLHIMNAVSYLSMIDVAAANW*

 

>CYP570E2 Fusarium oxysporum

78% to CYP570E1 Nectria haematococca

FOXG_01097

MGFLTDQSLTKICFRVIIVLLIAQSFRLVRRWSRLRHIPGPASAGWTSWWQCRGAFSGRYHEHLKNAADQF (1)

GPLVRIGPNEVLSTDPVVLRN

MSAVRSNYTKGDFYSSGRIVPGVDNVVSERDEAKHKFMRVKMAPGYSYKENEGFGFEAGIDRQLLNFISLIDRKYLSTTS

ESRPLDLAEKTQFFALDVIGDVSFGEPFGYLTKDEDLFQYNEINASSLPVMNVVSVYPWLGRVVHRWPLSLLLPREEDQV

GFGRLMGFARHFVRKRLAEGITMKKDMMQMHISNGMNEEELIQQAFISIIAGSNTTAHALRMIILSLITNPNAYRSLIAE

IRKVTSSVSNPISWAQTQTLPYLQAVVREGLRTWPPVAGLGFKQVPPEGDTINGFFVPGGTQVGQGFYAVGRSRLVWGED

ADVFRPERWLLAGEDRLRDMVAALDTHFGHGKYSCLGKPIALMEIHKAVFELFKRYDFAILNAERPIKTQTSVFLFASDF

WVTITQRDDEEN*

 

>CYP573A8 Fusarium oxysporum

86% to CYP573A2   Fusarium graminearum

FOXG_12028

MAVLSFVNIALLGVGYIAFCALWQIVRYRFFHPLKKFPGNFWGTVTRLWITYHNVKADECATFQELHKKHGPVIRITPTM

LLVSDATQLPKIYNRHANKSKHYITGSFGKDESLFNMQDSVMHAKYRKIAAPLYSLTNIKKMEPLIDSNIENWMARLQRE

FASTNKPFDFAPWAVFMAYDIISEVGFGAPFGFVKEGKDVEGLIQGFHDGLTPFGIMARLHPFTNWVKSTFLGKYMVASP

EQDSGIGTLMRFRDRLIDQRFKDIENGATDGRVDLLQTFIEAKDEDGNPLDINYIKAEILLVLLAGADTTGTAFQAMMIH

ILTNPSVYKKLMAELDDATIAGKLSEMPQYDEVVEHCPYYIACVKESMRLNPSAPNIFPRIAPPGGLEICGQFVPEGTEV

TCNPWLVHRDPNIYGDDAEVFKPERWLDEDKAKVYNKYSMGFGYGARVCLGQDVARMELYKGPLQFLRSFKVDWVDEKNR

GTYVVKGGVSYFENMNITIQRREVVA*

 

>CYP577A7 Fusarium oxysporum

97% to CYP577A5 Gibberella moniliformis

FOXG_13528

MAILPIAAAVVAVVLFIKHIFLDPLILSPLRHVPGPKSFAATKWRLAYEDWKGTRTRTIFKLHQQYGPVVRIGPHEVSFN

SLSALRTIYGPGSRYGRTTFYRMFDVYGEQNLFTFHSPKEHGDRKKLLSHAYSKSVVLKPPTAKMVERRVRQYLDLIEAE

PENVSEIFSTLHYYSLDNITAFVYGKYGQTAAIRGSKIHRELIADILHPSRRKLSWSIVHLKALTQWLYRQSGLMGKLVK

PVLPMQQPTTYTGIRGYALRAFEAFRADVEKITHSEDEHVSIVENLWQHHESQKPGGLRDLQMASECADHFLAGIDTTSD

TLMFLVWALSLPGNEKYQEKLREEVMAISGDGLNQWGNPRAEASDRCTYINAVIKETLRLYAPLPSTEPRSIDIDSVIDG

YTIPGNTVVGMSPWIMHRNESVFKDPLVFNPDRWLGPDAAELNRWFWGFSSGGRMCIGMHLAMAEMTTLTATMYRQFRTT

IAPGFEDTTPAITARVETFYDDRFPNVQESKCLIKFTKLKD*

 

>CYP578A3 Fusarium oxysporum

64% to CYP578A1

FOXG_06037

MGLILVTALGLLPVLLIYRYIIYPVFFSALSRIPAPHWTCHISPLWILAARKWRRENTSLYRAHQRLGPVIRIGPNEVSV

DGLEGMRTIYQGGFEKGHWYSVFDNYGVPNMFATGNSKHHSLRKRMISNVYSKSYIQSSQVSKLQMAEILVNRLLPALDG

SLEYSRKSISTDYNDVEVFGLYLATAMDLITAYIFGLSNATNFIADEPYRRDWQDMYLARANYPFWTQEVPKLTNFCKRW

IPWLKLYPQWVDQSNKKLSDWNWELCENVRKTSKVKRSPGNSQDIKFSDEPVVYNSLLAGIDREFKTNGEKSILYSTSIL

QRDRAIASEVMDHSLAGQETAGIALTYATWHISKSPELQRQLHAEVQSLKPSLMTDPKAASVITNTSALPDPKEVDSLPL

LHAIVTETLRLHAPIPGPQPRQTPKNGCSIGGYYIPGDVRIASLAYTLHRDKEVFPEPGEWNPERWVEEKTRKSPEDEVK

HREMQRVFWAFGSGGRMCVGSNFAMNEMKFILAFIYANFETSIVDDEGIEQEDAYTARPIGEKLVIRFTPLKT*

 

>CYP578D2 Fusarium oxysporum

87% to CYP578D1

FOXG_16972

MTSLNIPAVAAGLVLLLAFYERIIKPAFLSPLAKIPAPHWSCHVAPFWLWWAKLTHQENKLVYKNHMAKGKALRLSPGLV

SLNCFEGGLKQVYLGGFPKTEFYTRGFINYNTENIFTFQDNGTHSARKRIISGTFSKSFILADSTSQASMKKILFGRLLP

VFSRAADSKKPLEVLELFYSYSMDSFITWQFGSTLSSNLIEDEKERRLYLDGFFAAAPYTFWQYEFPRLNNWLKTIGLIP

KKVDSGFHDIEQWNLEKCDKAQELIAQGEEDLSDADKPVVMSLALKAMSDPHAKPGQYPQRLEIASDMFAHNSAAHETSG

NTLTFCFYELSKRPELQAKLREELLTLDPPLYFPPPAEGEWVVPAPKAIDKLPLLEAVILESLRLYPSVPGGQPRRVPKP

SSLGGHDNIPAGTTVQCYAYSLHRTPEIFPEPDQWKPERWIDSSPEHLATMRRWFWAFGSGGRMCIGSNFAYFSMKNVVA

SVYTNFTTTLHDHGSMELEDAYLAGPVGHRLALKFGYIRKM*

 

>CYP581A3 Fusarium oxysporum

91% to CYP581A2

FOXG_12902 revised

MSLSTYLTKPSWIFPILAIVATVLHCINRLFIKPHFSPLKHLPSPKQGPFLFRLIHEPKVSEIETWMDELPHQGLIRYMG

VFNEERIYVASPEAAQELLSSNAYKTIKPELQWILANNIAGHGLLIQEGDQHRQARKRFNPVFSPAQMKKWFPTIWTLAI

DAIDLLPQHIKREPFAPHGVVGIIELVSAASIDIIGRFGFSTEFQTLQRVTSGQSTKGSSDPKVRFGKAYIEMFKTTKRG

QTTLRAASLIGPQIALKLPLRAVKTIDSIMALVRATAEDITTDHERNIEKYVGSPDPDMLTLLMQTGHFLHQDLVEQTVH

FFAAATETVAGSTCWAIHLLSRHPDMQDRLRAEIREHIVSSRSEVSQSQLHSLKYLNAVTNEVLRYHSINTLLWREPTQD

ITLAGERIRKGTKIVFSPWALNRDPAHWGPDARMFNPSRWLDNPSGGADHAYSFLTFGGGPRRCVGEQ

YARDQLSCFVASLVGRYRFTPVDLQNGSDEGREIGDDFALTLFKILSGWKLNVELVPGW*

 

>CYP584D4 Fusarium oxysporum

80% to CYP584D2 Nectria haematococca

bad ag boundary in EXXR motif = gg

FOXG_03506

MFSLLLIKFLEQNLLATIVLLFLPVP

LRILETYLRRWRLAQAQGCKEATSKVAVKDPIIGFDFLYKVFFEKSPERYLDSTWQAFKE

MGTTYIEKRWSWQCVYTCDPRNIKQILATAYHDFDLPEFRTSVIGHIFGQGIFVLSGHPW

KHARALLRQSFRKDNPAPFLDTLERNFQSFLQHVPTDGSEVDLQPLFLALTMDVSTEFIM

GHSTNMLIQNADHTREQQFVDDYMVCSEEIIQQMQLGPLHSL

KFNFAAKRAKKRVYEYLDAFIQESLNKSE

DGPGSSFLAEMMDVVDDRTGLSHHILHILLASRDTTSGLLGNLFFFLAKKPEIYAKLRDEVLSVAGHEPPTASQLKDMTY

LKWCVNE (1?)

SLRLHPVIPTNARVAVRDTTIPRGGGIDGKSPLFVSKGTAMFYNVYAMHRNEDVFGPKAEKFAPERWKDLRPGWGYLPFN

GGARACIGQQYALLETHYVVARMAQAYSELQSRDDEEWMELYALALCSKNGCRVAAKR*

 

>CYP585A3P Fusarium oxysporum

59% to CYP585A1, stop codon, frameshift = &, no start Met

FOXG_10811

LSIHLLNLLCKDVSHAHRAGQRGCLPAPLEPSKLPFGIDTLLASLRAD

RDQRTPDHVANRFAALGVYTFR

MSILGTTNLVTAEPRNIQAILATQFNDFGMGATRSTNLKTVLGRSIFAAD

GASWRAARDMMRPLFSRDNVSRLDVLEEHVQTLFRCIE

KEKSPTIAGGT*

SAPVSLAALLLSLTLDSATELFLRQSTSTLQASLDGDDSHLG

MVFHHAFERMVAVLETRV

RLRSFYWLYGTRELRLCVETLHGFVDIAITAS

DMAKKEGSSQALYDFLNVLRERCSGGDEEV

REQVLGLLAAGRDTTASLMSWTWYCLLHNPRVFAKLRSEILSTFGCSPDGPSVTMTFASLKECTYLQHVLSETLRL &

TVVPFNSRRALRDTTLPMGGGPDGKSPIFNPKGTEVNFSTHVLYRR

KDLWGEEDADDFVPERWEKQRGAASAAWHFVPFNGGPR

ICIGQKLALTEAGYVLVRMLQRYDAVKRLDVDLTRDWHNFTVVCSPGSPVNRNQAVLCQLKLA*

 

>CYP587B3 Fusarium oxysporum (temp 587B5)

94% to CYP587B3 Gibberella moniliformis

FOXG_11378

MWLLGLQDDGSSLLTRFVRFSGVILVALLVHAFRKGYRVRKKFQALKDQGIPIMKHSMILGHLEVIGKLVSTLPPDAHGD

YLMLKIQENWRELFPQCTKCPPVAYIDTWPFTTPMVISLNANVSAQFTQEHSLPKAYEQKHVLYPLTKNRDLASMEGAEW

KVWRKRLSPAFSIQNINSRLPDILEEVEDFANVLKSKAGKDGEWGEVFPLGDATANLTLDVIIRLFL (2)

NIRIHEQWGRSSPVCAALLDSISRLYFFVNPANF

IQYYNPWRHFKLWQDYRTLVKSFTPALQERMNKLQQDRTAKGKTLVDLIVQALDAERAEQKGVGQDSKDQSNMELDADFL

EMAIGQINTFLFAGFDITAATIAWLFRLLSEYPKVLAKLREEHDAVLGSNAWGVADVIRENPQLLNQLPYTLAVLRESMR

YHTNVGSMRRGEPGFFLVGPPGSDPGFEGKKLPTEDFIVWDGSYAIHRDPEIWHRAWEFLPERFLVTDPQDPLYPPPNGW

RSFEAGPRVCIGQHLATVEIKLAMVLVARCFDVECAWEEWDRINGTTNSEKARPTVWGDRCYQVGTDSPPRVKNGITSVT

KLYLSSYILELIQDTAWWHCSSFG*

 

>CYP595B2 Fusarium oxysporum

55% to CYP595B1

FOXG_08910

MAILFSPLGLGVSLVAILIGAIIFVNKKTKFPIINKYPKDFFHRRANHEYKTNVRKLLKDGAAKHGENPFAILVPNGIKT

ILPPSCVGWAKNNKDLDHQQLVRDEYFASYPGFDVQHVLHHPNRMVINMVQGKLSKTDKTLPVMNEHIKAGLSDIWGEGK

SWKTLNWEDGTTGVISRAAASIFVGPELAADPEWQKVSRAYVLDYFGAVGEMHLWPSWLRWLVVWYLPGASACRAGLKRA

REMVNEVVQKRRQEEQEAKLEGKEAPAYYDALAWTLESPLGNEFEPADVQLALAMAALFTTSELFRQILTEIARRPEVVE

HLRREIEDVAPYHDFTATSLVKMQLLDSFMKETQRQIPSLVILERLVIHDTRLPDGTVLKKGTHIAIDSREMYDPAKFEN

PEEFDAWRFYKRRQAGDNTSLFVQSSPEHAQFGMGKHLCPGRFFAGSELKLCLAQIILNYDIRLKDGCSGKSMQFGFLSA

TDPYTQLEVRRR*

 

>CYP602B3 Fusarium oxysporum

84% to 602B1, one frameshift

FOXG_04264 revised

MENVSSLAASPIGVDYQLPQ &

FVSEGHCTGYYITITIFLIAIWFFLPKKQTSHLEIPFYKASKTKWIFDAETLIKDSYTK (0)

FRDRVYQIKATEGVQVIVPARLVGELKGLPEDILSATEAVSD (0)

ALQSKYTKFSPGHNGELLALLVRTK

LTQNLTRVVPLLKKELEHLLATEFPVCEDWTPVKWQPFSLRAVARLSGRAFVGPSINRDEKWMDTSINFAVHVFTACVKL

QFIPEWARPVGQHLVSELRQIRKDIKIAKEMLKPILEERLRDMEFSNGGNAPDDMIQWLIEALPEEEKADLTTQAELQLI

IAAASIHTTNNLLCECLCDLAAYPEVQEELREEAYRVLEVDNGWENKESMAKLKKLDSFMREVQRLSGNI (1)

TNHYIASFIRKVMKP

ISLSDGTELPVGTKVLAPQAGIALDERYFPDPERFDAFRFYKLRQESAEASNRWQFTSLNDTYINFGAGKHACPGRFFAS

NEIKLVLAHLLINYDIRLKAGEDRPKAMSVVMAKAPSPDTELEFRRRSWAA*

 

>CYP606B2 Fusarium oxysporum

76% to CYP606B1

FOXG_13357

MANPVLELLSRPAIAAPLILIVSYVIYQLFLKHSNLPDLPIIGAREGDWFPILQAKIRNSLDVKAALNSAYIQYRNQAAI

FPLIDGGNIIYLPRSDTKFASEQPTNMLSMHESAQQDLQTDYTTMDPSLTHDPIHLELVTTTLTKEVGNLIPDLAEEIEH

CVRKQLGSSTDWSEICIMESAQKMLSGITNRAFLGLPLCRNEEMLKLGIAFAQDIPLSSMMMKLFPSFVKPLVAPLITRS

NRIHTRDFEKILEPEIKARLEEYDSQDEHTKSDRNDYLQWLIEQAKEIGNPKNWQVSALAQRVLLLNFASIHTTTFAVTH

ALLDIASSSPDLISELRDEVESVLKLHDGKWNKRAVAQLEKLDSAIRESQRKNSIVSIGVSRTVVGEKGVTFPSGTHVPK

GLRIAVPGYSVLQDSEIYPEPKTYKPLRFYDARQNEADEYVKSARNALPTATQDFLAWGLGRNACPGRFFASNEIKMLLA

YILLNYDIEHMAERPRNTWIAQNRIPPTKATLRIRRISRS*

 

>CYP614A2 Fusarium oxysporum

91% to CYP614A1

FOXG_04460

MISPLYAIGGLLLAYIGLSTLQLLYNYKKAKSIGLPVLITPIDPSNVPYLLCSSFLEPLLRKILPFGLGNFVEYNSRDWN

YEQIHDLQERIGDTFIIVSPKQIRVFTGNAKASDDLCRRRRDFVKAVALYKPLEIFGRNVVTTEGDDWVRHRRITTPPFN

ERNSALVWDESKRQATDMLKMWASNPKGVVNPQSDTMVLALHVLTAAGFGRSYTFGSGLESALENHSLTYRDSLSLILGN

LFTAVFTATLNLPTWMLPSKFKQVQDAVVNFRQYMAEMVAEEREAMDAGAEEQDNLMSILVRASENQNKEGKGTRHLTDS

EIYGNLFSYNLAGHETTSNTLAYATILLAANPEWQKWAAEEVDQITAGVDLKDLDYETYYPQLKRVLAIMHETLRLFGAA

RAVPKTTLVDQTLKVNGTSYTIPKNTFVGVNLAGLHTSSASWGDNALQWLPSRWITTDETGEKLAPTPTGAFLPWAAGPR

VCPGKKFSQVEFVAVMACLLKEYTVEPDAEGDLKEAASRALMEEAKQSSFNFLLKVKHPEKIKLRCVRRV*

 

>CYP615A2 Fusarium oxysporum

88% to CYP615A1

FOXG_12223

MASPLLLIGAIGLPIIILLQWLVTYARTVLKVRRNGHPAIHSGIMIFESVIRSWYPRVPVLVPMEKFTLKDPFKKFANAR

SDMIVITEASSPNGVAYLFGSPKIFREIGRNGDIFLKPLEKIRYRMLNTFGLQLASTQNGAQHERHKRVVKAVFNNELME

NGWHNMCNMWRALLREEGVYPAAANSETAPIVRDMKSTMLKVTLGAIGASWFDIDIPWDPAEESQRNTKSDLMPFAETLK

VVWDSPFVQTMLPLWFLEWSPSLYLRRAGWAQRSLVAHIKNAQAETRQRIEDMKDNTEVQGRPRKYRNLIDALVDSQNDV

EKAEKAEKGYVAPNVGLSDKEVQGNIFSFMVTGHETSSHTLTWVLSLLARNTDWQEKLYAEVSKVDTLPLDEDESVGDAK

PLKYFGYEEMANFPLVLAATIESLRMRDLAMQMTRVASRDTTLSYTTWDGDAANPSEAKVHQHTVAIPKGTRVHLDTAAF

GVNPFKWEDPQTYNPTRHLRETEDVNGNKKVTVSYEDFIGYSSGSRQCIGKRFAEVTMVCFLAHMIMNFRWEVVPEPGET

QEQAKVRASTGSEQFMLTPPAYDLRFIRR*

 

>CYP616A3 Fusarium oxysporum

74% to CYP616A1

FOXG_08398

MASVLPLMLSLSMGLVVLGMLVMGMIAFNVFVYPFYVSPLRYLPGPKDNAFFLGQTAKFLRVPWFPELFCKWSREFPDAP

IIRYLNFANGETLFVNSIEAYKQVLQTKSSYFVKPAFAKQFAHELIGDGLPFVEGKLHKVRRAAISQPFSAARLRAFSPV

VQQKAEQLIDVLTQQRNEHGNVEIESNIWKAALDVIGLETLGLDLNHLGSDESPLFDTFTTMMQPSTFGHVVNYLNSLIP

IRQYVPLKECIEFSQSCTRVREFIVGLMTIRRNQCEQGLVNEKHRDALQCLLEHSDPDWNDKNVVEY (0)

VLNLLILGHDTTACSITWAVHELSRRPDCQQLLRDEITSMDNTCGMSSFSDIDKLP

YLHSFVREVLRLYLAMAPRQATDDVEIDGIMIPKGTVIQLSPAVMNTHPLVWGPDAQEFNPDRWSDLTGDATSAYAFETF

HNGPRMCIGKQLSLLEMKTMLVEMVRKFKIEKPLGNEEKQVDVAGPAFTLRPKENLVVRLVEM*

 

>CYP617A3 Fusarium oxysporum

85% to CYP617A1

FOXG_00341 revised

MGLPWERITATAAIGTLSLAWAQNNWARLQLLGHFTELWIASLAIWGVWTVWIYPLFVSP

LRHLPGPSGNHWFMGQAKKIMAEPSGVPMREW (2)

ASTIPNDGLLCYRGFFNQERVMVCSPKALAEVLSTNSYAFPKPSHFRWSIGRILGIGILLAEGEEHK

MQRRSLTPAFAFRHIKNLYPVFWSKAREVTRTMMAEFGGKEEVHVEISSWASRATLDIIGLAGMGRDFGAIQDPQNTLAQ

TYKQIFKPSRQAQVLAFIGMIIPMQFITKLPFRRNEDIAKAATDIRAVCRDLIREKKAKIANKEQADVDILSVALESGGF

TDENLVDQLMTFLAAGHETTASAMTWAIYMLSKHSDIQSRLRDEVREHLPSVDSDVDITSLDIDRMPYLNAVCSEVLRYY

APVPLTMRDAAYDTTILGHSIPRGTRVVIVPWATHFDTELWGQDAGQFKPERWLPSGGESGSADRKAASGGASSNYAFLT

FLHGPRSCIGSSFAKAEFACLLAAWIGRFEFTLANPEEMDEKKVEIRGGITARPAKGMHVNIKTVSGY*

 

>CYP617B2 Fusarium oxysporum

87% to 617B1

FOXG_04464

MARIAVFLSYYRPWALCALAFAIYVQIIRDKNYSIRHAPFYMGKYLLAFLSVWAFYLVFLYHRFFSPLRYLPQPKIAGFI

NGHWAESVSQPAGLPFRHWSRTIENNGLIRYK (2)

HLFNQERLVVTSPEGLKEVLGQNSYDYVKPHLLRAMVGKILGYGLLLS

EGDVHK (0)

MQRKNLMPAFSFRHIKELYPVFWSKAQELVHGIEKELKEESTSEIDIVDWASRASMDIIGSAGMGHEFKSLADP

SIEDTMKMYGSMVKQSRGAKLLTVLQLVLPSIITDYLPFQRNMGVLAASKAARETSQRLINAKKVQMAAKEKLSPDIIST

ALESGHFTDEGLVDTMMTFLAAGHETSAAALTWTIFLLAKNHDIQNRLREEIRQNVDGLTDDVDAKKLDSLSYLHAVCQE

SLRLYAPIPFTVRDALKDTQILGTFIPKGTMVILCPWAINRAHELWGPDADDFNPERWMAPGQANSGGSKNNYAFLTFLH

GPRGCIGQKFSLAELMALTCALVGRYKFDIDKDYEVRDITDGIVAKPSKGLKVTVEEVQGW*

 

>CYP617J1 Fusarium oxysporum

51% to 617A1

FOXG_08717

MIETWQIILAGVTLSGYLLASLHTDNQKSMFLLGLLGTLCLETILWCIYR

IFIHPRFISSLRHIPTPEGNHWLWGHGMKLHREPYCSPVREW

NETVPNYG

FLRYLGFFNAERIVLTSPEALHEVLVTQNYSFPKPASLRETAGRFLGIGLILSEGDAHKLQRRSMNPALAPRNIKALYPL

FWDKTREMIERITADRLETVEVVEWASRITLDLIGVAGLGRDFGAIQDGHNEMVKTYNIVFQPSAQARMLHLIESLVPPW

VLTALPIKLNSDMSQAARSIRETCRDVISSKQKKLKEKKLDDMDIISAAIRTGTFTEDGLIDQAMTLLAA (1)

GHDTTGAAFTWGVYL

LAKHPEVQDRLRHEIRQRLPPLTQAKESPISSVNVDSMPYLQAVCSEILRFYAPVPQTLREAAHDTSILDQFIPKGTRIV

IAPWATNRCSKLWGSDAYLFKPDRWLG

KSAHGGAESKYGFLS

FLQGPRACIGQGFAGAELACLLAGWVGSFEFELRDGVSMDEKNVDVKGGLTARPAGGLHVKVKRLEECRKI*

 

>CYP618A3 Fusarium oxysporum

73% to CYP618A1

FOXG_11718

MWPLDLPLVRVVIFVAFAIWLHFIIKTLLRPSFSELRHLPGPK (0)

GHQFLVGHALRILRGSGPNELYLQWMQRWPKAPFIRCLSWLNSEVLLVNNIET

CREVLQTNAYRFAKPAFFHTLVGEFLGVGLLFSVGN

QHKRLRRIIT (1)

GPLSRPSIRKLFPTFMTYSRKLNSEIDAAIQQNSNGVLE

VEDLFTRVTLDIIGVSLVGKELRDFRSKVSPLSFEQCYNGILAQ

PLAGQIISFINPFIPLRWLPVSANLNFIKAKSALKGMMTELIEQRTSEVAKAKQLGTDSGLSDD

LLTRMIEASSVENQKLSKDELIDITMQVIAAGHETTASALLWTTYALSKDQKSQNRLRTEIYSMNATDMTAKSIDELPYL

DNVIREALRVYSPTLIIPWEALEDIDIAGVRIPKGTTVQLVPAMTQLNPEIWGPDVETFNPDRWDRLSGDALSPYAMETF

SNGPRICPGKALALLNMKILLVGLIRDFKIESVGDEEMEFRNPSLTLKSTMTVRFKVQREG

 

>CYP620A2 Fusarium oxysporum

76% to CYP620A1   Fusarium graminearum

FOXG_15685

MSFSLILVTAIVASLSFFLVKHIQQSKNTPLPPGPKGLPLLGNIRDLPPPGTLEWPHWQTHKEKYGPITSVSVLGQHFVI

LHDRQVIVDLLETQAIKSASRPKLVFAGDI VGYDGVMGLMPYNRTFRMHRKLTATQVSSKSITRFEPIQELEILRLLKRI

YQDQDPKSQNLPDHLNQ VSGSIMLRILYNYETDPCRNDHIVTMANLVMEEFSQATTPGAWMVDFIPWLRYLPDWMPGAGF

KRTAKLFRQHLLQNVQDPYKYVKNQMALGNDNVSYVAGLIKDVHRKIDPEEESIIAWTAASMMNAGTDTTGATLLAFFAA

MLLNPNVQKKAQTEIDRFIGDSRLPSFSDKPNLPYINAISQEVLRWHTLAPMGFPHMTTEDDTYGGYCIPKDTLLFPAVA

SLTHDPEIYHDPMEFKPERYFEPCNEPSPMELVFGFGRRACPGRWIADQTLFLSIAQTLAVFEIKKALDGEGREIEVVYE

QLPGVISRVKPFPHRIVLRSEKYRKFLE*

 

>CYP620B3 Fusarium oxysporum

82% to CYP620B1 Fusarium graminearum

FOXG_09726

MGLLLLPAVVLAALIVYYVLFPKKKTGLDLPPGPKPLPIVGNVFDLPPAGTAEYKHWAKFKDLYGPISSINVLGTPLVVL

NDREALHDLLEKRSTKTSSRPWSPFASELCGYSVFLPVIPYGNKFRYFRKLVHQQMGTKLICSEFRDTQDLESLRFLVRT

IERPEEFQKHIKTEASAIILRIIYGYNIEPKKVDPLVNLIEKMMINFSDAFVPLSWAVDIVPSLARLPDWFPGTSFKKTA

REWRNTTDQALNTPYNFVMDQMASGTNRPSYVSQLMSSKSFKNDNGTGEPTKEDIEAVKATATIMYGGGADTTVSTISSF

VLAMIAFPEVQKKAQAEIDSVTGGERLPTFEDQDRMPYINALCKEALRWMPVVPTTTTHVTEEEIEYRGYRIPKGTYLIP

STWWILHDPEIYANPDAFDPERFIAPRDEPDPSDFAFGYGRRICPGRYLAEDSIFMTVARLLAVFDMRKAVDENGKEIDV

VIDGTPGLISHPVEYAYSITPRSAKHVEMVRAAERVHPWEESDSSLLKKDSPV*

 

>CYP620C2 Fusarium oxysporum (temp CYP620C3)

83% to CYP620C2 Gibberella moniliformis

FOXG_11744

MLPAIFIVIGVVLAIIYIRTRPRKNLPPGPKPLPVLGNIRDMPDGTTPEYQHWIKFKDLYGPISHVSIFGQSLIILHDRD

AANAILEKTSIKTSGRPQFIFGNEMCGYNQILSFKPYGKLLKQHRKLVHQQLGTKTAASRFRDVQDVESRRLLLRILESP

EKLSTHIKTEASAIILKMTYGYNLEPHKADPLALLIEHMMHNFSLAFVPMSWPVDVLPILRHFPETLPGMSFKRIARDWN

ANMRMVVDVPYHFVRKKMAKQSHRPSYVSSLIKQYDEGLDTESEAAIKQTAAAMYAGGADTTVSSIRGFVLAMLLFPDVR

RKAQQEIDSIVGTDRLPQFEDRDNLPYVDALVKETLRWIPVAPMGVAHTADEDIQYKGFVIPKGASFLPAVWWFLHDPAI

YSDPSSFDPDRYLEPRNEPHPNFASFGFGRRVCPGRFLADDSLFISISRLLAAFEIKKAVDGRGNGIEPEISITPGMIGH

IRDFPYDIKPRSEKYADMIRRVELEHPWEEGDAGLLEEELSLYAVNV*

 

>CYP620E4P Fusarium oxysporum

64% to 620E3, end badly frameshifted

FOXG_13772

MFEISTFFSGVALGFLLYISIGVIRNGSKRPPLPPGPKGLPLLGNLSHLPPPGVFEAHHWLKFKDLY (1)

GPISSITVMGQTIIIINNWKLASQLLDKRSAKHSSRPKIMMAGEM (2)

VGWENSLGFSPYNDRFRTYRKNMARIIGSKRAAAKYDRLQEAEVAHFLLHVLDDPERFMDHIRK (2?)

EAGSVILKIAYGYTAEPSKEDILIK

MAGQAMDDVTAAGVPGAFLVDILPL (1)

LRYVPDWVPGANFKRLAKKWSSELDDLTEKPYAFVKHQHASGKQDNSFVSRLLEVGDSTE

EARFTTKWSALSLYAAGADT (0)

TVSSISLFFLAMILYPDVQKKAQEEIDGVIGNERLPNCSDRQSLPYVNAIVKEVLRWHPVAPMGLPHTSTVDDVFEGYF

VPKDALIMPNIW (2)

YFAHDPEVHHEPMRFNPERFLSTDGNQPEQDPHMYTFVF &

GVRVCPG & RV & IADMHCFYNI & IQSLAV*HIRKDENDAQP & EL &

LFTLGMISHPEPFKAAITPRSPHHERLIRSVEQEYPWEQSDGHIIENMQRQAS*

 

>CYP620L1 Fusarium oxysporum

51% to CYP620E3   Nectria haematococca

FOXG_13173

MESASLIVYTGVITFVFIYVTKLLAKTSHNAQLPPG

PRGLPLVGNVLDLPRAGEFEAHQWAKHKDLY (1)

GNISSITVFRQTLVIINDAKLAQTILNDRSAKHSSRSKMTFAGEM (2)

VGWDKTLSFLPYNGQLRSHRKKAHVCLKSEASIK TNDAIQEIEVGHFL

LHLLRDPDRLVEHIQK (2)

QAGSVIVKVVYGYTAEQFKPDPLLITVRKVVDEFGIAAKPGAFMVDLIPI (1)

LKYVPEWFPGAVFKSTAKQWRSNLESSVEDPAAFVEYQMANGKDNTSFLSQLLQKKS

LTDEEYSENKWLAASLYAAGADT (0)

TVSAITTFFLAMTLFPEAQKKAHYEIDEVIGRDRLPTLSDRQSLPYVNALVKEVLR

WHPVGPMCLPHTTSQDDVIDGYLIPKGAMILPNIW (2)

QICHDSALYHDPMAFRPERFLGPEAETDPGRFVFGFGRRICPAQAMSDKTLFLNMAQTLVVFD

IGVKEGAEMPKAEFTSGVVSHPKPFETEIKPQSSQTRKLIESIERMHPWQQSDAETLASL*

 

>CYP621A3  Fusarium oxysporum (temp CYP621A4)

Also Fusarium verticillioides FVEG_06100, one stop codon

I propose a 1 nucleotide MICRO exon agggt for the joint At PK/G/TVV

This is needed to preserve the length and seq in this joint

The phase (1) and phase (2) boundaries do not fit otherwise.

93% to CYP621A3 Gibberella moniliformis

FOXG_08569

MIEHYPSQALFGLTLAIATILLLAWARWRSRPTLPLPPGPPSEFLLGHSRVIPKENAAAVYAKWSKEY (1)

NSDIIHVRSLSRSTV

VLNSADVARDILDKKGANFCDRPRFTLLKI (2)

MGWGKTLTFLPFGERWQMHR

KLLQTSFSNTNVRQWHSLQITEARRTIRDILKKPKTWETSLRRLAVAIVLQVNYGTQVLEDDDPYIQIANDAMYATGNGGVPANSIVDLVPF (1)

VRYLPDCIVRDWSLRFARQWRWAIKKLHDVPLAAAQAEY (0)

HRDDHYRNTSLTHLLLREYKDKEFRGQEQQWSLDDIKGAAGAVFIAGADT (0)

TWATCVIFVLNMVLHPEIQEKAQQELDAVIGTDRLPDFSDRPALVYIEHIVQEIYR (2)

WSPLAPLGIPHKSLHDDIYKGMLIPK (1)

G (2)

TVVYANAYAMAHDERVYKNPHDFNPDRYE

AGEPFPVGNFGFGRRVCVGRFLADNSVWIMVATMLSVLRFCKKMSSDGKPIEPRVRFTNGGTWYIIS

TVPMACFALTHSLQ

 

>CYP622A2 Fusarium oxysporum

84% to CYP622A1

FOXG_12221

MVQWGVAEPVSGIAILARPSSEPSQPQKIGTVSGRRWSFFLCLDQSKAMDLSKYITPLLAGQYPLGGAVLVAVVAFVLLM

LIAPKDSIPVINKYPNDWFLSKAHMAFITNADGLIKQGFAK (0)

FNKPFRMITLLGDRIVLPADHFEWMRRHGPHLDHQPLVSK (0)

DFFAGYPGFDGTAAISDPSKLLANVIKKKLVQNPHVSKL

HNNVRKDLLAAWPEQSD (1)

DWKAVDWAKDGVSLISRMSASVFVGEELSRDETWQQVSTN

YGMTVFLAARALRAWPRLLRPIVQWFLPACKSCRAEVQRAREVLHKNLAKRAAEDKEHDDSISWFGEIAGGKSYDPVAAQ

LGMSMAAVVTTSELLKQTIIEICAHDLVAPLREEVEAVVAEHGWSPAALTNMRLLDSVIKETQRLNSAVI (1)

VNLDRQVLSPVTLPNGQYLPKGTAISIYMSQLRNPEVYDNPDTFDAYRYVKLRAQGGKWIYASSATST

SEDHFVFGIGKPICPGRFFAIAEVKTAIATILLDYDVRLAEGYKPKLMPFGFELFADPGVQLEVKRRS*

 

>CYP623A2 Fusarium oxysporum

82% to CYP623A1

FOXG_04463 revised

MAVYLFVAVFLAAVYLAQYRSSPKLPSNLPRLERNSYLPFKLPWAYLTDCRQLFLEAYQT (0)

FTKHGKTCVLPSMGFKDEIHLAHHHTQWAASQ

TPDAVLSPIEGFREIDKGDWNSGHANYIQDPWQSIVIKKEMGRFLEILAAAVDDELQYAIPEYIKPGAGDEVDVYE

AMKWIVAQVSSRFTVGLPL (1)

CRDKEYLKDSLAFADLFILNSGLLIYTPSLLKPLIGLLVTLPTRYRRWKIQKHIQPLYEER

TKRLLNPGLYEKGEEPTDNLQMMMRYAISKHGKQVAPSQISDRLCLANLASFHQTAVAISNVLINIAA

SDAEFSTIAVIRKEMADVLAESNGVFDKASVSKMIQTDSILRESMRTHGFGNRAMIRKVV

APGGLKTPDGHTLPNGSTMSILSYPVHQDPEIYEHPKKFYPFRFSKVRTGPDGKDANPTLSFVSTSSTYLPFGHGKHACP

GRFLVDFEMKMILYHVLNRFDIELLPEHNGVRPESQWVTEAVMPPVGVKLRFKKRE*

 

>CYP623B4 Fusarium oxysporum

AAXH01000338.1 cont2.338,

PKS ortholog to PGL1

This is the next contig after cont2.337 which has a pks seq at the end

About 31kb away

CYP623B5 = 73% to 623B1 probable pigment modification of pks product

Gene model FOXG_05831

33080 MSSSAELGLLARLPSLASPLGIASIVVIGVIAIYVIEKLIGVPYPPDIPLIREPKGARR 32904

32903 FSLRTRWAYLTDCQALFYEAYHE (0) 32835

32788 YLKKGKPVVIPGFGVRIEVYLPQSQMKGVLNQPEDVLDMEQAFAEVDQVRWSLGHDKYV 32612

32611 VDAWQGLVVKYDLNRAIEIIANNMKDELHEVFDEQFGTDTENWKRIDLTKTVKMIVAQAA 32432

32431 SRFTVGLPL (1) 32405

32355 CRNKEYLQLALETNDLFIMNAGLTGGLPRILQPITGTLFGQIVKTKVNKMKKWIIPLLK 32179

32178 HRFDRINNHPDEPQPQDQVQMMINYALRHRQHEVNDMESLARRVVAQNFGSIHNTQIQVV 31999

31998 NLFLNVLGSDAEFNTIATLRDEMDRILGTDDSVNWTKGGIQAMTRADSVARESIRLCSFG 31819

31818 GRAVFRKVMIDDFKTEDGHHVPKGSIISFMGHPAQTDNELYEDGLKYDPFRFSRVRETAA 31639

31638 NRDEKAPPVTFVTTSPEFLTFGHGKHACPGRFLIDFEMKMILAYALRNYDIKFADEYEGK 31459

31458 RPPNYWIAEANNPPSGVQIMVKRRERT* 31375

 

>CYP624A2  Fusarium oxysporum

80% to CYP624A1P   Fusarium graminearum

FOXG_06966

MLPDYFQLPKKYEILFLFLSPILLSLFGTVLYNVFFHPLATVPGPLACKISRVWLYLAERGGDGANTLAALHKRY (1)

GPLVRIAPTEVSIKDREAYVTINKQGSRFLK

DLAFYDAFSSNHGNLFTFSNVDEHSKRKRLMSPSFSRASMEEHDTIVHATIKPLVEEVVVSVRKGETVALYSVMRRFAIKSIIAF

CYGNNLISPEYIDNTVIPKLFQVLDKSPKDLLVLQHFPIVRRSLRHLATTFPQLFPEAIRFLQRVGMELLDSSRESSDAS

QPGLFKRMKELLKVKEQSLTDGELIAESSTMFFAGTDTTATTASVALWYLMHQPDNYARLQDELKTVMPDVNSRPSLREL

ESLPFLEACVKESLRLACPIRGRLPRVVPPEGWEVKGVRLPGGTTVSSCISYMTYDEDIFSEPMKFRPGRWLQENSKELD

GYLYPFSRGTRSCIGQSLSLAEQRVAISQIVRRFSPSKDMQFREIIGKEYVTWVMEDELPVQLKEAE

 

>CYP626A3 Fusarium oxysporum

67% to CYP626A1 Fusarium graminearum

FOXG_13273

MFLSFIPILSIVLLAFVLRALFNYHRGPLSRLPGPWYTHFTGLPLLYTRAVGTSRQHLRHLHKVHGPVVRVGPKEVSINS

VDGYYKVHGVGSHCLKAPVFDHIRFSHSSMLFTMRDPRIHSERKRIIGRGFSSIKEEQEVKIQRLASQAVANIKKEAEKG

QADVYKWWRCLAVDVVSEMSFGKSFNLLHSGGKGLPLYTALSNAGPSVVFQAVLPRRLISLFKWSPIAWLRDVGQVTETI

FNRVTSALGELRVSSNCGPSIARHLLSQEVKGKKPSLNDDELSSEVSMLLVAGSDSTATTLAYATWQIVRDPDLRKQIEE

EVSNLPTNFTAKDVEGLPLLNSALEEVLRMHNPAAALVERLVPPSGISVHDWDIPGGTMVYTTGWLISRLEDVFPEPDR (2)

FDATRFLNPTPEMKRAHVPFNIGARRCVGMHVARMEILVTLAMLFRECRGLQLHHGMTDEMMTQVGEFFIVPRAGRCDLSV

 

>CYP628A3P Fusarium oxysporum

51% to 628A2, 48% to 628M1, pseudogene

FOXG_10725

MHPTSLAIGTGLSSGILAHILIFSKGEWDLYTIKIL

QGLLIVIVLLALSFKRLGTTEAGSPYQRLRI &

TIASIYMVSLMVLGTFCNIFLYRICFFHRL*QFPGPLMAKVSNLYLTRRSVARFQLYKEI

QNLHRTYGDIVR (0)

(1) VGPSALSILDAKAFHAIHANNSPCRKGPWYNIEQPA

ISLHMTRDKNDHSRRRRAWDRAFSSK ()

ALRDYEPRVVKYTSQLLNRLEQSQATTIDIAKWFKFYSFDTMGDLAFGQSFNMLTDGVKH

PFMALVESHMAMAGTFSQLIWMFPLFRAMPFLGREDAIFQKWIGNQVRHQEQ (0)

NEPDLPNIFSWLLEDYKSQLYPKEQDWLSLQADMQLIAVAG

SDTTSVTLTCLFYLLATNKNACMRLQEEIDNLFSSSSQPNHSSFSKLTYLQTCIDETLRL

FPPVPSGLQRMTPAEGLQVGEIVIPGGTIVTVPSYTVYR ()

DERYFTAPNDFVPERWMIKPEMVKDDSVFAPFSV

GRYACVGKQLGLMEVGYATCMILHRFNICLFGEGTITKPAFLKGLRDHFTLNAPELNVILTARKH*

 

>CYP628A4 Fusarium oxysporum

62% to CYP628A1

FOXG_12115

MLWTEAHLETPQAFGAAFLLGVLVHVFVLRKGEWDL

WTVKLIKAWATYEVTVSLFLAQLYSLSVWQALSVTNKWFASFATGLTISILVYRAFFHRLN

RFPGPFLARLSAFYPTYLVVDEEHMYLEVQKLHEKYGDIVRI (1)

GPTEISIATPSSFRVIHATASPVTKSPFYGISHPWTNLLAERRKRQHANRRKAWDRAFTTK (1)

AIALKDYEHRVLKYTKLLTDRIDDMKGKPFNVSLWVNFYTFDIMGDLAFGKS

FNMLENGVEHKFFTESHKSQGLLGAFRRLIWFFPLVTAIPIINSSYLSFQAFIRNQVETRRK (0)

DTPEEPDVFTCILEDYDAIEKPTEQDYNNLCGDAHLIVIAGS (2)

DTTSSSTTCLLHNLALHPDVLAKLQAEIDDYKNTHEESDLISLGKLQYL

QACIDESLRLYPVVPSGLPRMTPPEGMMEIDGVYIPGDTILHNPSYTMYR (1)

DERCFEKPNEFIPERWTTKPELIKDASVYAPFST ()

GRGVCAGKQLGLMEMRYVLMDILSRYDIAFAPGTNPQAFIDGLRDCYTLELPRLDMVFTPRASENGKA*

 

>CYP628B1 Fusarium oxysporum (temp CYP628B2)

80% to CYP628B1

FOXG_17440 REVISED

MMNLSAIQLDSFPVLVVVAFCGVATHLAIFRIGEWDVAVHRIIAFFGLIY

AFIFTLIAYHRDLDHQSLLSAWYTASALLATFIAGIYGSMVIFRFFFHALRRFPGPTFAP

ISSLYAVSMSMKKFHMFSEMQKLHNTYGDFVRL (1)

GPSEMSIASPSAVAAIYQNSSPCLKGPWYNVFVPSISLHASRDKQEHAHRRKVWDRGLSAK (1)

AMRDYEPRVEKYTHLLISQLQKRCGKPVDITEWCNFYGFDVM

GDLAFGKSFNMLNDGVRHYYMDLTQTSTLWGTQIARSSWLYLLIKSIPILNYQIANFLKW

LRTHVDQRAK (0)

NEPDLPDLFSWLLGAYREQSVHTKQDELNLLGDAHLIVVAGS (2)

DTTSTSLTCALFELSRHPDVYRKLRTEVDDLLKPEDTHSHSALAKLKYLQAVIDETMRLYPAIPSGLQRITPPQGLQISG

TFIPGNMIVQTPTYTLNRDERCFVRPNNFIPERWTTQPELVRDASAFAPFSIGRYSCAGKQLGLFEIRHVLSHIVSKFDL

RFAPDQTSELFQDGLADGFTLLCPKLEMIFETRKNGELPN*

 

>CYP628F1 Fusarium oxysporum

51% to CYP628C1 Aspergillus oryzae

FOXG_17036

MMMVEPKSFEAIVVSFASGCLLHILFYRKGEWDLLALRIFQAYATLPIIVIGLLRLAEFKGWQHDT

NLSAVSVLLLEGAHILGLLTSILCYRMIFHPLNKFPGPLRARISNFYPTYLTTKNAHLYE

EVEQLHQKYGDFVRL (1)

GPTQLSIIHPKAIDAIYSAKSPCTKGPFYNILHPRVSLHMIRDHKEHSNRRKIWDRALSSK (1)

SLRDYEPRVTKYTTQLLDRLNEMQGTTINASNWLNFYSFDVMGDLAFGKSFNMLRDGVN

HYFLSSLHDSMKMVGALAHISWIIPILKLIPAVSAEDRKFWAWIESQVEERSR (0)

MKPDNPDVFAWILDEYERSPKTHQAKLNVEAEAYLIAVAGS (2)

DTTSATLAGLLFELATNPSQIIKLRDEIDMYFSDREHADHTSLSNLIHLNAVIDESLRLHPPVPSGLQRVTPPQGLMVGDTFIPGNTIVQVPMHTVQR (1)

DERYFVRPSEYIPERWTTSPELVKDKTVYAPFSI (1)

GRYSCVGKQLGLMEVRYVIAHIVRAFDVRLGEGQTQEGFLKSKMDTFTLATPNLHLVFTPRLTK*

 

>CYP628G1 Fusarium oxysporum

no gene model

66% to CYP628G1, 47% to CYP628F1

upstream = NmrA family transcriptional regulator

MTTLYNPINLAYHGIAFALGVILHLSVFRRGEWNIHALSILQYFAIFEGIFT

CALRLFLGSEKCTTWTVIPIALTATLSTLVGLFTSMLIYRGFFHPL

KGYPGPFFSRFSSLYITFQAFKNRRLFEELQLFHKTYGDIVRI (1)

GPNELSILGPHALQALHSTSSSCTKGPWYSIEHPVTSLQMTRDKEEHTRRRRVWDMAFSSK (1)

CLRRYEDRVAEYTTQLLQHIEALQDEPLDISMWFNFYSFDVMGDLAFGKSFDMLS

NGTKHPFMELTHSHMLVAGSLSRLAWIFPLLKRISIFNQKTCELEERIKQLVDWRIK (0)

NEPDVPDIFSWILRDYFGLSKLTGQETLNLYGDAQLIAVAGR (?)

SDTTAASLTCLFFELAINPQALHNVQEEIDRYHLEYSTLDHQNLSKLSYLQACINESMRL

YPLLPSSLQRITPPEGLQVGSIRLPGDTIVSIPSYAFNR ()

DERLFKNADQFIPECWTTMTELTRDSSLFTPFSI (1)

GKYSCVGRQLGLMEIRFVASQILRVFDVKLANCNTAKEFASGLRDSFTLA

CPSLHLVFTRRDIWTPSPISEK*

 

>CYP629B1 Fusarium oxysporum

45% to CYP629A1 Fusarium graminearum

FOXG_16432, supercontig_36 275364-279696 region

MIQINSVNSEVLVSWPGFITELALLAFAIAVHRRYFSNLSDIPGPFWASVTRLW

HVWIILEGKQNVRLKALHRKHGQFVRIAPNEVSVCHPDGSTLLLRANLHK (0)

GDWYSVTAVPDYRFQNPMSTTNPKMKKALSKHFTAGYALSQVLKREPDVDE

NIEHLLRWVEKYAEDRMPMDLDRFITYTTFDNIGSALFSEPIGFIRA (0)

GRDIDGTLRNNVALSRFAAVAGFFIGPLRILINPLNSWLLLLPMGRLYKTTSVAI KKRLHNHEAHNDMVAHWLGAQQKSGELSLRKIEAQANVNVGAGAEPVSHVV (2)

SFCIILIQHPRRLALGFVTRIHRRESLKARAMVASVSFHDADNLTYLRACIKEALRVFSP

TTMGLPRVVAKGGINIAGRHFQQGTILSVSSH (2)

AVHSSKDIWGDDADQWNPERWLSGDTKK (2)

QFSAGYMTCPGRHFAWMQICKMAATLLRNYNIRQVNPKNQWRYQANFTALTHSWPVWVEK

REHEGNMHPDIETLPRDRDQF*

 

>CYP630A4 Fusarium oxysporum

FOXG_13427, FOXG_13426 Join models

85% to CYP630A1

Supercontig_19 936278-937336 (-) strand

Supercontig 19: 932834-933337 (-) strand

C-terminal half 3000 bp away with no good boundary, possible pseudogene

MIGFILLGAGLAALLIRLFIYPIILYFIDPKGLRKYANFSWLSPLTDLRHCYLSHTGTRSETLAAEHDRRDEHILRIGPN

ALSFSHPQAVRDIYGHQTKCTKDHKETVLAGTHRNLFDVVDKGDHSRKRRLLSAAFATRNLEKWEFKVQYTTQRLLDAFD

QRCTGPLKPNTNPDPEDLTVDFNHWINLWTIEAINYIALSSKMTLLETGTDEVLAEKPDGTLYPARYRQAQNAAAMCKSI

FVWEYELYPWLARISKVVPNKWKSYWATSAPWGDICYHQAKDRLRRYEAGEKLDDFFSCLMVNKNGIPNELEWGEIVAET

SAIIDAGAETTAIALTHILQLLISHPKQMQ (?)

KLRDEVAAVMDEDDIIAPFDKVKDLPYLKACLDEGLRLIPPVSSGLPRRTPPEGAKIMNT

WIPGDTSVSMTIWSAHHNEDIYPEPYVFKPERWLNLEERKRMEPFFIPFSAGARGCIGRN

ISYLEQQIVLATLVHRYDFAMPTKDFKVDRFEAFNLIMGKLPVKIWRR*

 

>CYP630B16 Fusarium oxysporum

90% to CYP630B4 Nectria haematococca

FOXG_03207

MYAQVVSVFTAVCLLTYFALYPIYTYLRDAKGLRRYPNFHPLAGITNIPFVREAAKGFRSRTLYEMHKTHPVIRTGPNSL

SYGSIQAIKDIYGHGTKCTKGEFYETLAGSHYHLADVIDKADHARKRRALSAAYALKNLENWEFKVADKAERFIRAADAA

CTLPLKEGFTRPDPRDLNFDYRAFTNFFTLDAIADIGLSERLGFLDQGHDRVKAERMDGTIHEVNFRECLHSTARAQSIL

AWTEKWYNFNVEVSKWFSKDFRQWWHLNEGWNDIVYHRATQRLERYKNGERLPDFFQALMDHSEANPPGLEWGEIVAEVS

IMMNAGSDTTAIAMNNVMYWLLKNPSCMAKLREEVDSVLDPEEIVAPYDKVKHLPYLRACLDESLRITPPTTFGLPRRTP

PEGWNILGDYIPGDTTVSISAYVTHRDPQVFPDPESYAPERWLGEKGKDLQPYFIAFSAGARGCIGRNISYLEQTVLLAS

VVHRYEWALPYPEWEPERREAMNLAPGPMPLKVWRRDLGVEEVDEKGN*

 

>CYP630B17 Fusarium oxysporum

81% to CYP630B7   Nectria haematococca

FOXG_02681

MSASVASLGSAPYAAAVGFAVVFYFIIYPFILYLKDPKGLRRFPNMSPFSGMSNLPFMILAHGGARSTHLAKLHKTKPII

RTGPNSLSFAGGQAIKDIYGHGTPCTKDKSYIVGAGTHFNLADVVDKHDHARKRKVLSSAYALKNLEGWEYKVADKVQRM

MDHFDKVCTAPLQKGARFPDPQDVNVDFRAWSNFFSLDAIADIGLSEKLGLLDQGHDRVEAQQTCGTVYETNLRECLYPT

ARKQSYLLWTYDYYKLLNKISNVIPFYRKMSESAKGWDDIVLRRAQIRLDRYQKGEKLDDFFQALMEDKNGNSHELEWGE

IVAEINIMMNAGSVTTAIALANILYQLILNPRVMELLRHELDSVLEPDEVVAPYEKVKHLPYLRACLDESLRLWPPTPQN

LGRQTPPEGLTIMGQYIPGNTSVGVSALVAHRDECIYPESEKFIPERFLGEKGKELQSHFITFSAGARGCIGRNISYLEQ

TVCLASIVHRYEFALPAGFELKREETMNHILGPMPVKVWKRNLEE*

 

>CYP634A3P Fusarium oxysporum

75% to 634A1, pseudogene fragment, no upstream P450 seq.

FOXG_12544, FOXG_12594, FOXG_17081, FOXG_13997

ARIRAEAENAAVVEEKNGKRSATFNIAEFEESMPLLVGCYRETLRLVNQTLSTRRILQDTSVTTPEGATYI

LKKDTDLQLPAGVAHYEDSVWGADVNVFNPERFLPSSKGSTEDERKRKAAYIPFGGGRHLCPGRNLA (?)

AEIIGFASALLLGFEIEAVGMGFGNVKMLGPQLAGGTVRPERYGAGLGAEIAMRQGWEDVEWRFEC*

 

>CYP634A5 Fusarium oxysporum

75% to CYP634A1

FOXG_15710

MTSQSLLTSLVDYRGGNVTILSTTVLAVIVAFSLLNRLLTPRIDPREPPVVKPSIPWVGHIIGIIRHQADYSRIIHNENP

HVQIATLPMLNGKVYAAFDPALLQTLLRNKTASFEPFVFDYAKKTFALKHETFAKVKVPGVYDEFTEAIHASFQVRHLHQ

MNVHFLGSIAAKLNHATIRADSINAGKETVANGRLHVKNLYLWCRDVMSLATTRSLYGDTDPFNRDPSLIEDMWLFEESV

PYFLLSLFPSITMPKAYKARSTLQNIACKWYSEDHDIHDPSVSALVRNRAGALRKNGLTGYEIGKFEVILPNVATLNAVP

TFYWLLLYILDRPDLLARIRAEAEGAAVIEDNNGKRSATFNIAEFEEKLPLLVSCYRETLRLANQTLSMRRILEDTSITT

PEGTTYILKKGTDLQLPAGVAHYENSVWGADVNVFNPERFLPSSKGNFEEERKRKAAYIPFGGGRHLCPGRNLAFAEIIG

FASALLLGFEIEAVGMGFGDVKMLGPQLAGGTVRPERYGAGLGAEIAMREGWEDVEWRFEC*

 

>CYP636A2 Fusarium oxysporum

86% to 636A1

FOXG_04458

MALSNLTIGVVCCVVVAIVALATRKQPDAREPPYVKETVPYFSHIYGLLKHGLRYFDLVSAQQPHPIFTIDMSGQKNYIV

TSPELVQAVQRNTTSLSFSPAMIPAFRRMMGFDEAGIELIFRDAHTENGMYGEIHRVQKASLLPGTESLDELCTLIRTKL

LNIINELPSSQTIDLYAWVQDLFMRTNNSACFGEKDPFTIDPSLNSTFWDWEANIKVLLLGVPWFLSPKKHSTAQRTRKE

LVDAFLKYLNDDGLDTACSFIKELSGLGIRRGLSNENNARALLGSILAIVGNTIPTTFWLLISIFSRPDLLKEIRSELEA

TIEDPASEIVSLDYTTIRERCTVFMSTYDEVLRMTSGIATVRYTNEDTLIQDRWLLKKGAQVQMPTAFIHADPTTWGADA

DVFDHTRFFKSKVLTKEQKIRRAAAFRPFGGGNTLCPGRHFASYEVLTFAGSILLGFDMAPTTKTFNVPQMDRSKLPLTS

LKPAGDIKVSMSRRPRWEKVQFR*

 

>CYP637A2 Fusarium oxysporum

78% to CYP637A1

FOXG_16528

MFREIVYGVAGFVLLAYAAEWILSLFDDPREPKRLQSKIPLFGHLWGMMKYSSGYHGITR (2)

SKQTNEEM

YTVAIFNTKLYIAKTSRLIPLIQKTSKTLSFRPFMQTAAKLMGDAKPETFEVFGTEWVDSFSHAHKNGLATGPFLDEQN

LRMGDRALIDIEQLLPVEKDGVAKVNLLEW

AQYAVVQASACGIFGVEHPFLDPKVDQAFW (2)

KWQSYLPLHMVNLDITGKGY

AARQIVFDAFRKYNKNLPSDVSFIYKERLRSMQEAGIDEDDICKQQATFGTAAFANTVPIMYWTIYELFSRPDLLEEVRK

EVIEQAVSGDKESGFKVDVAALKTKCPLTLSVFQETQRLRHVHANIRKVTEDTLLDGKYLLKAGHYVMMPGQPVHTNTST

WGPTADQFDPYRFTKDSSDRKA

SSFVAWGAPPHLCPARQFATTEILIVIALLAVRSDIAPVKGEWVKNPALNTGDMATVY

TPKKSVEVEVRKRDDWDN*

 

>CYP638A2 Fusarium oxysporum

77% to CYP638A1, one frameshift

FOXG_04461

MMDAPFFNASAST

IALVAVLLLLSTHCITTIRYSIQRFCDRRYQGKEPSTLPYVLPGVGSALSLIRNPHGFFNSIV (2)

QKVENGEPIRMRLGNVHAYLIHGTRNVQQVFRCSKELTFE &

EFALRVAQKVKRLPAKDAALVAKDISGSSRLPLTETREEDRIWRKFHEIYESHLIGANAVSALTELFIDTMIDELGTAA

TQGPIEIGIDEFMKHHMFRASTIALAGRKVFDIDPNFADVFWDYDEDFMSLLYGIPKFLCRKGSNARDKCLETVKGYLDQ

GWQNLDWRACHEQNRDWEPNFGSKLVREREVAMEKYGIGLDGRASFQMGLIWSINSNAIPMTSWIIIEILRRPEIFKRIQ

EEVATVFDKDTKQVDIVALKKLPLLNSVYLECLRLRSSVFVVRKLRNSIELDGYTLKEGNLVLAPSYLAHNAPEVWSSSA

HPPEEFWPERFIKKGNSGISAGNYFPYGGGAAMCPGRNYAKQEILSAVVLFFAHFEIEPLRFVDREGKTSDRGPEVGNEA

RGVARVDRDLLVRLQRV*

 

>CYP639A3 Fusarium oxysporum

69% to CYP639A1 Fusarium graminearum

FOXG_17188

MNATETAAANPGSATEAISYFKVLSLVVLPFIVTYVFTSFGNKGYQHGQSAREPPRVPYWIPYVGNTIGFAFDTERFLSS

ILSKFGKVPLRIFVGAEPMYFIPHGQPIIELFKASRHLTTKSLGVMTVRDAFGLPESDMPIYVDEDSQFGHVDPLKRFDF

VQHRDLHALLTGGPLNSMTAKFVEVYSDIIEKDTRLNEDDWTEVDDLYEWLKNNLLRAAITALCGDKFLEISPNFLEDFW

LFDYHLPSLFKRMPRWLVPKSYAARDKCVESMLRYHEYGNQLFDFTDEDGVVKKDWTSEFGTRLMSARQKMFQSVGMTPR

GGAALDLGLMWA (2)

VNANAIPAGMWILLDILLDKDLKDR

VMAEMQPSFIDKSLSFDIDKLCSSPLINSIYLETLRLRVASPVGRTSIIPNLKFGKWQFKKGVGMLSS

SWVGGHDPDFWNTGHVQPGGVEEHPVESFWAERFLVYENDPASGPVRPTASAEKPAKRTSEDDRKARSTIDGTQGYWYPY

GGGTKMCPGRFFAKQELIAAVAVALRAFDIELVDPEAASKVRPNMDYFPFGTIPPKGKVAARIRRRKL*

 

>CYP640B1 Fusarium oxysporum

47% to CYP640A1

FOXG_13207

MSAITVTPGVNATIGVVDTEGPVFTLHYQILFRVLGTCLVAYVAWLYLLRIGALWNSQLEPPMLPYWIP (1)

GIGQNISFFIDVEKLLVAARLVLTGLSITV (0)

PFSVLIGGRRTYVILDPHDIAETHQKTKELQFDAYIDQFMEYVSVSKK

ARDILWGTTLSETSLSVPNSLRSWIRADMTQT

SSRKFYSEVLLELDSVLQQGSPFTTGKSSEHDMLKWTSDIIVKASTKSFFGNALFEKSPGLVDHFRRFNRQTWKLL

YKYPRFLSRTAYDSRDSAIDGLERYFKMPQDQRGDAAPFVIKAEDEMRKHGISDRDIAAVLFKLYWAINGNPSVLAFWLL

VRTLYTPNLKEDIKSEVAPAFKNGIHHQPEIEYLKECPKLNATYYEAMRLHSGSSSFRRVVQDTTIAGFQLKAGNDVMMP

YRQLHLNKKYWGENAENFDIDKFVDNPKLHSARTYKPFGGGTTFCPGKLLARQMALVYLAILVTRYDIEIIGGCEGQPFP

EANDKAPTLGIISPKPGHDVKILVRDVS*

 

>CYP641A3 Fusarium oxysporum

84% to CYP641A1 Fusarium graminearum

FOXG_12845 MDRLEALLERLNETLIPHAQRYPLQAILVTTIILFITTRLFTGSSSSSRKDGSKTPPLAPFWVPLFGHAPRIFLSPSSAL

TRFRNRYAQGVFSIRLFQSIHSFVFRPSLVARLLEQPESVADKEYVARRIMMTNFGLSKQDLAAYDKAAPEVYQITKEYL

SGSHLDTLAKATLRDLDDNAADAISFNSYPTDQMDWERQANAELLEDTGDEKIMAVDFFELMKTFIARTATISVFGTDFV

EIYPDIWSHLWIFNDAFHSLAMGVPVWAPFPSSQRARIALGRLLTFMREYHTELDKFLSDEEPATKWQDFHTISPLVRAR

TEVYRKHGLPIDVRATFDVALLWATTVNSTSLISWSLFELYQDPVLLSQIREQITPFVKIVQPKNDFGGAVWIPPQVQKL

DLEGLVTKCPLLQGVYLETLRLYGGGWSARYLKEDVILKGKEDSFVLKKGTFAHIVNDLHHSDPRSFTDAKVWQVGRYLE

DTVDKKGVKTQRAEPCTVRASDGTLTMCDDSEFTLRKVLMYISVFISLYELEPAGSERWPSPSVVKGVASAQPWRSVRLW

VRRRSPQPQ

 

>CYP642A3 Fusarium oxysporum

85% to CYP642A1

FOXG_11132

MSSILQTQALSSLTINLIPTFILFSVAVYVLPALTRRLLQFLSSPSSFKEKPFTNDTPSISNLPRLSGVVPWLGHLFGLT

IDSTRYINRLIKSTTAPIFTINIPFARITVCHPSMDRVLSRHVNDTGLAQVLVYVGPRLFGLKEETIKAVFGYNPQPLHK

QKFGHAENIVSLNQRSSNNIRDRVMRMPETNEVLVGRWVFELAVSATASAVWGVANPWSMDQDFSNEFMKLSETFDTLGR

PFAWLTANSAWNSRKYLLTRLREFHLEHREARVKTTAHSINVVAHSDPNWETNPDYYHIEMVSALGLLATTSTLAVWLTR

HLLTDPELMKIILNEVQQLKHVEGEDKPRLDFANVRTACPWLMASWYETLRLHMTGVARIARHDFMLNLPDSDPIAVPQG

EIFMLPMCASNLDVDNWGPDAAVFKASRFIDKAGEVSGSAVRKVRAFGVAGNMCPGRVFGTDIVFSVVATMLRTFDIEAA

PGEGFRVPTLRGGFNVGFERYGDDVKVVLRKKGVA

 

>CYP643A3P Fusarium oxysporum

71% to CYP643A1 Fusarium graminearum

FOXG_06961

MRNIVSLGLRPPHTLTLLTASRLDSRAIRIAPNELHIDDVNIYKDVYNQNSTYIKH

ADFYAGFGTPHSVFAEHDPKLHKQRRRRLDPFFSRRTIGQLEALLKEKIEQLGKRIDSQS

GPYNIFNALRCTTVDIISHYCVGKPLGQLEKSDRRFNGDFLDAFDSVSNILWKSMYQPTF

R*IFSSIPAPLAKAISKEACLMISLYSACHTAAISFKSSPPKSANATIFTNLSDLGEKDM

EDEAVDLLIAG*DTTAYTLAAAVVQICQNTCVKKKLINTLDAGVADVDNLPSLLELEKME

YLNASVREVVRFAIASPGRLPRVVPQGGKTLVVDGRVVPAGSIIGMSAYTMNFSKGLWGD

DAATFNPDR*LGDSGKSLDANMCSFSKGIRSCLGQNLAYAEIHYILAYLFTKYNIKLVDR

EADIEVHDPFTSYVTSHAIMVDLRRREVSNSLK*

 

>CYP643A4 Fusarium oxysporum

67% to CYP643A2 Supercontig_9 136491-

FOXG_06968

MNSSPLPTIPQIQALIHDSQRGDILWGLVISTVVYLIYLVIDRVYKLYLHPLSKFPGPTEACLSQKWLLRVSEEGNPERV

FERLHEKY (1)

NSRAIRIAPNELHIDDVKIYKDIYNQTSTYIKQPDFYAGFGTPHSVFAEHDPNLHKQRRRRLNPYFSRRAIG

QIETLLKSKIEQLGKRIDSQNGPYNIFNAVRCTTVDIISHYCVGKPLGQLENSDENFNGDFLGAFDSVSVV

IWKFMYQPFFRWLVSVIPPALAKAVSREARLMLSLYNACQQAAISFKRNPPKSTQATIFSSLSDLGEKDMGDEAVDMLIA

GSDTTAYTLATAVVQICQNSRVKQKLVESLDAGIADVKSLPSLLELEQIVYLNASVREAVRFAIAAPGRLPRVVPRDNKP

LVVDGLVVPAGSIVGMSAYTMNFSEKLWGDDAAEFNPDRWLGEGRKSLDTNMCSFSKGLRSCLGQNLAFAEIHYILAYLF

AKYDIELVDKPDDIEVYDRFTSTVIEVSAIAGRGVIAANVSVAAGASISARCKSAIDEAQEVIEDSQCD*

 

>CYP645A2 Fusarium oxysporum

60% to CYP645A1, this seq. has a C-term extension

FOXG_02323

the second part after the heme signature resmbles a

phthalate 4,5-dioxygenase reductase subunit

MTCPFSNPRNLFDDLATARETPSIEYSEKLGGYVISRYDDIVSVLDNPAAFSSRPTVPDFPPQVKQIFANKVPERGTLLA

YDNPDHDRLRKSVASFFVPRRLERFEPLLRATAHGLIDGFVEKGCVDIKSNFALTLPLRTIVIVAGLEPSRWQWIGRCLA

LFGGITQTNEELSIEQRVQDVLDLHEYVAEVIAERKTDRRDDLISHIWNERDAGVVEMTDYEHLSMIPGLLLAGHETTTN

LLSMGISHLLHHDLWNAATEDEEARSTAIEELLRYESAITGMERLVKEESKIGDHIVQPGQKLFVAYNSGSRDSTKFGNP

DKLDFKRQHKHQHLGFGRGIHACLGAPFARLLLRTELAVLKERLPNMRLETPYEEIQYCRVHSGRGPERVEIAWDVPSLD

EMRVNVGQATVNSALRSSAKTEDLEMVVENVENVTERIVTLTLRPKDGGKVPKWSPGSHVDVQAGTIGYRQYSISSKPSD

DQHIKIAVLRENDTGASNWIHQNAIKGSQMLIRGPRNHFSLEFGSRKTIFVAGGIGITPIIPMAEAAKQADVDYTILYLG

RSKNNLAFVNELTEEHGDHFKLWYWPEATRFCEYRKTNRFWR*

 

>CYP655B2 Fusarium oxysporum

59% to CYP655B1

FOXG_14589

MSSRLSAISLAAFYGLVILYFLNRLWDHISYSIKTKKYKCGPLKTYPHWDPIWGIDFVLSMSRAFKEHRWLSWMEETWSA

QGTKTFKARFLGMRMVYSSEMENMKAMSTSQWEEFVLEPIRVDNGVATPFTGKGVSTADGEFWHYSRGIIKPYFERQAFA

NVARLKPFTDKMLDLIPTNGDTFDMQVLTRRWFLDTSTEFLFGKSRDCLTYPEREDVMLAMVDIMRGARVRLTMSKFMFL

HRDPKWYESIRFVHDFMNEYIDQAYDELHLRKEQGEKFADKPERTDLLWDMVQKIPSEDRILLRDQITAVWVPSNETTSI

HISNAIYQLARHPDAWEKLQKEVLDLGDEELTFSKLRGMKYMNWVINETHRTIPNGIQMIRVAAHDTTLPRGGGPDGKQP

IFCAKGDIVHCNRYLMHRDPDYWGKDAAEFRPERWDGLRPLWHFVPFGGGPRICPAHILVATETAYVLTRFCQKFKGIEA

RDERVYVPVMRVGPSSLNGIKIAVTPR*

 

>CYP655C2 Fusarium oxysporum

55% to CYP6455C1

FOXG_14594

MALHQLLAQQVTTRNLPILAVGAAFLIFIFRKLFTSSQKSEAKGWKPIPRYWQWDPIWGLDLVASQIHALRSNQFLAWLS

KLHASMPHTKTFSINMFGVKWIYTYDPEVLKAVYATHFKEFGVTPIGNLRRGLTPFADKGAITTDGEDWKHSRFLIQPFF

DRQVYTSTDRVARHTDQFIKLLPDNGETVDLQPLLQRWFLDIATEFIFGESTEALVYPERAKIANTMLDVLDGGRLRAQL

NRLMFLRDWTPWLKSVEEIHAFVTPPIQETIKEKHEREKKTKEGATDLEPERTDLLWTMVQNLEDVEELRSQICLILVAN

IDTTSVFISNCVWWLARYPDVWDKIRQEVHELGDIPMNFSVLRNMKYLNCVMNETHRMIPNNVSQLRGAFEDVVIPVGGG

PDGKSPTLIRKGDLVLINKTVMYRDPEAWGEDSNEFKPERFDGYRGSWGFLPFGGGPRRCPAQMMVQTEAAYILAHLAKT

FKRIEPRDPEPYVPVMRIGPSNKTGVKVALYR*

 

>CYP655D1 Fusarium oxysporum

43% to CYP655C1 Beauveria bassiana

FOXG_03951

MSNSTGFIADLPGLFTDIPGYVADIPSRIDFTSIPVILSSTVAVLAFTSFVKYVAERQQEKAMGFGHVPTLWQLDPFYGF

DAFVAMLLALKNNRYVPWLDSLHAKMPKTFALTFLGGRQIWTIEPENLKTVANNLADFQVGPIRYNSKAGQPFAEKGIVG

ADGKDWEFARALVKPFFMREWYANTERMEPFAERFFAGIPADGETFDMFPHLRTWSLNLNLQFLFGDYSDIVTEEETNNT

TDAFITGLAYARIRLLLHRVLWLFPWKTWYKVVGTIHSYVNKHIAKARAELKEREERISKGLPVGPERRDVCWHMVRELP

NDDEVRSHLCLLFVPNNETTLIFLSNVMWNLARQPEIWERLRQEVKGKELNFNSLRGMKLLQNVLTEAHRITPVGLFIAR

AAVRDTTLPRGGGPKGDQPVRVRKGNIVQINKAVMYKDPDYWGDDALEFNPDRFDKMRPGLSLTPYNTGPRRCPGEMMTM

NECGYMVARMAQTYKRLECRDPTPFVGAFRIGQLNKNGCQVAVYRE*

 

>CYP673B2 Fusarium oxysporum

58% to CYP673B1 Nectria haematococca

FOXG_13065

MSLELESFITWASSLPILLQTSAVVGFLGLVYIVYYRYLHPLAK

YPGPPLASVTNLWKTYHLWNLHLPHTLVRLHEQYGDVVRVGPNDLSFRNPDAVNTIYKGG

RQLQKTGFYDGFTTFNPNLFGTQDEE (0)

IHAIRRRQMAHAFSLQSIKEMEHFVDSHILKLRNNLDHFCDSNQDFDLKDMIALYVFDVL

GELAFSRSFDSQDERDLARLPPINDHIYLACLMGMTPDALPWIKKVLPFIPIPWLQRLFN

ARAQLRNLTAACVRQRIEAGSSGRKDLLSCLLVAVDPETGSKLTELDINTEAFAMI (2)

VAGSHTTSGTLTLLFSHLLQNPEVLNKVIQELDSNLSNHTGQVISYQALEKDLPYTRACM

HENFRINSVFTMPLPRKIMTPGGLVIQGCQIPQK (0)

TTVFALNHVVHHNPSAWGKDHDQFIPDRFLGPNSKDLQGYLSPFSTGHRMCIGK

NLAMMNILKVLSTVLRNYKLEMVHPQEPVDTLSVGISEKKGRLMCRISKR*

 

>CYP675D1 Fusarium oxysporum

42% to CYP675C1, 42% to 675C2

FOXG_14720 revised

MLLDFAFTNTWLIPASLATYWLGWLVYTLTFHPLSKIPGPYLARLSRLWYLHKIWT

EDVEKHERALHAKHGPLIRIAPDEISCSD (2)

PEAFASIYRFSNALDKGRFYEPYNTTGFSPHGDVFSCKNDKKHGQRRRITSNIYSMTNVASSEEYIDYCSNLLTERLGQ

FADSGKPCDIGEWLHW (2)

YTFDIIGELFYGRAFGFIDEGKDQNDWIKSLDKMIPFVCLMGVAPPILRPLIGLGTMISSAGNEIRKGV (2)

KNIGESSSRLMKEAYASRIEAP

RTDMAQQIFSIFEKNGERMDFRWGDVEQESYGALFAGSDTTAIAFRSLFYHLM

HNPEAYSRLEIEIDRAVDDGLLSMPATYKEAIKLPYLCACIKEALRIWP (1)

GINLILDIALPRTVPPEGLTICGQFIPGGYVVGINAAVMHFDKRVFGQDADSFNPDRW

MDTARANYMDKYMMAFGGGTRTCLGKNIALIELHKLSPQLIRNYRFEFYDRNRTRWHTRNTFFARQEGIVVRVKHREH*

 

>CYP682M1 Fusarium oxysporum

42% to CYP682H1

FOXG_14591

MENLQLNARTLLTVAASLIALRITYTVVYRLYLSPLAKIPGPRLAALTFFYEFYYDVVKRGKFLWKIQELHRQYGPIVRI

NPYEVHINDDSFYDEIYASGPHHPRNKIRFMSTHDESMFDSYAAETHRVRRAALSGSFSKQSIRALEPQILQTIHQLAGR

MSSLRESGEVVNFKALYSGLTMDVIAQYCFGESMDNMKQDQFGKELLDFFHEMPQAHPIGRMFPWLFDIIQKIPISYLAK

LDPKLQPLADYDKKISGQISDVLAKEKKDGIRTVFHEMRDSKQLPEADKTLERFKSEAAIFLGAGTETTAAALTTLSFHL

TENPDMLTTLRKELETVTADASSPITVAKLEPLPYLLYKKV (0)

EGIRLSFGVPGRLPRYAPTEDLVYAGYKLPRG (0)

TRMSSSSYLIDTNEEHYPDPFKFDPERWMHGKTSLSRH

FVPFCRGSRQCIGMNLAYAELYLTVATIFSRFDLELVGTTKRDVEIAHDFFVGMPPLDSKGVMVRVVKDRSE*

 

>CYP684B2 Fusarium oxysporum

68% to CYP684B1 Nectria haematococca

FOXG_14626

MDSQLEGGFLRLETTGLFLLFLCTLYLLYH (0)

VTCTIFFNPLSRLP (1)

GPWISCWTDAILKYHWLKGTRAQYVHRLHQRYGPVVRVGPHEVDISD

ITAVKEIHRVKDGYRKAPFYQNLVPNTNNLFNTLDLEYHRHHRRLLSSPLSESSLKSVEPTVDDYVKTAIASMKREMDER

GTADVAKFWLFMATDIIVELSFGESFGILKHGKKNQYIKDLEGLAAKGSIRSTFPTLTTIATKLPLPIFKETAAAAQRIR

DYSAEAVARYKRYVANNPAAAKPTLFKKLFEAGEAGLSDEEIRAEAHAYIVAGSDTTATTLTYLVYSVCCRGDVRQKLVK

ELMELPDDFGHSDLRDLLHLNNVIDETLRLYAAAPSALPRVVPARGAHLAGYFIPGDTVVSTQAWTLHRDPDVFPNPETW

DPARWEKGSKLMHDAVMPFGGGSRVCIGKHLARMELRLATARFFRAFPNACVSSIEGMSQDDMELRAYFLLTPKGGRCLI

QLD*

 

>CYP5040A2 Fusarium oxysporum

74% to CYP5040A1

FOXG_12072

MLSQSLAGYCLAACTALILYY (0)

AVAKVKTALYGPLSKIPGPAIGRWTNLVVKYHTLSGRRMQYIDSLFTQY ()

GPVVRISPTDVGINDADAVKVIQKVSGGFKKSAWYDKTGPGMLG MRDREKHARRRRLLAH

PLSNSSLSNFEPLIRAKVDLAMSQMQNEYRSLGYTDCHKWFSFMATDIIGDLTFGSSFRMLEQGR (0)

RSQYVDDLQAVMPTVNKRIELSPFFDLMFLLPLPQVKRFSERFQRILKYGEESIHRLQL

AQLTGSLDTPIFFEKIMNPKNKENALTDLEMQQEAAELMITGTDTTSNTLTYLVWSVLEN

PVIRTRLEEEVSTLPEHFSDADLVKLPYLNAVVKESLRLYGAASGAHQRDVPKGGWETCG

YLIPDTATVSTQAFSLHRLSNVFPSPYR (2)

FDPDRWLSLTAEMQDAYIPFGGGPR

VCIGIHLAYMELRVTTAVFFRKFRGAQVHASMTKDDMELENYTLIAPKSHKCLITL*

 

>CYP5042A3 Fusarium oxysporum f. sp. lycopersici 4286 chromosome 13 cont2.710,

AAXH01000710

86% to CYP5042A1 Nectria

also gene model FOXG_11943 revised

MISQITPYLSYAFERVPAASFLALSLCLAVLLLVVVAKYFEPVGKRRLRDGRKSHL 901

PPGPPGLPIIGSLHKLKEARGDPDHKYVSFLLSTVERLCRLSLLQLRELATYGEMTTVHL 1081

GSKTWIFLNSSRVVSEIIAKRGSATNTRSPMPISSGIVSRDGRSLILPQEAWME 1243

RRRVMHSLLNGTSLKQYGEWQELESTQMMAEYLFKPHLWYKHHYRYANSVIHRIALGERL 1423

GKSTQELADLQNCVTFFVGSIGSSIIDWFPDLARLPKFLQVWRSHWEALGKWN 1582

HDVYRSWWDPVRKQVENGTAPPSFVRDVLLNEETRYKGDDQDCMYLAMQLIEAG 1744

SDTTREALNIMVMAMLEYPEPFRKARADVDSICGVGEQARLPVLSDMDNLRFICAIAKEV 1924

LRWRPIFILTPDHVASQDIEFEGYLFPAGTGFTINEVPVGNEFEKPEAFYPERW 2086

MDGHEMDISHGLWQFGGGRRICVGYRLAQRSLFLNIARLVQCVDFKP (0) 2227

DGPYNAKILNLESVDEPFPVKSTIRSEAYEALIIKEATESWCFGGRAHGPGATIMMLFIVHTLVS

SLTRLE*

 

>CYP5043C1 Fusarium oxysporum

46% to CYP5043A1

FOXG_10831

MSLITEDKIIIILTVLLVGWLVSLVRTILRPGLGKVPGPWLAKFTQAWRIGLVWKGNAHEEYKSLHDKYGPIVRTAPNVV

DISDPTSIAIIYGISSKFLK (0)

SPFYQTLSVLYQNELMDSMFTTADPHEHKALKRPVAQKFSMSSLRTLEYLVDPCSDIFAKAMLDLQGQVVDL

GEWAQWYAFDVIGAITFSRRFGFMENRKDVKNIISGIELGLAYAGIVGQV

PSLHRYLLGNLTLRRILGRLGVPDPIAITTEASTEI (0)

MVSDCIREYDSQPYSSERADFLAYFRQEQKSTGQQMSQRDLMNHLMNNL (2)

LAGSDTTGISLRSIFYYLLHDKSAYKTLQNEIDEADRAGKLSPTITFSESLGLEYL (2)

QACIKEALRMHPAVSYPLERVVPPGGARLCGEYLPGGTIVGVNAAVIHRERDIFGQDADTFQ

PERWLHSSEERIKLMDRHNLAFGAGARTCIGKNISIMEMSKFVPQVLRQFDLEWASSEPGWRVKTYWFAKQTGLLVRFHR

RGKIRV*

 

>CYP5047A3P Fusarium oxysporum

(+) strand 57% TO CYP5047A1   Nectria haematococca

FOXG_04833

INVERTED DUPLICATION, two C-term P450 fragments face away from each other in a head to head orientation 88bp apart

1914 RNYTWYDGMLIPKDATVIIPSYAIHRSEQMKYTNPDTFDPSRYINHPRLASDYAGSPDFNNRD 2102

2103 HYGYGAGRRICPGMHLAERTQWRAIARILWAFDIELAVNPATGQKIVPDPEAFKEGIAHGPKPFKV 2300

2312 xxxxRSQAHIDTIFREAEQSLDEVAKWD* 2386

 

>CYP5047A4P Fusarium oxysporum

(-) strand 62% TO CYP5047A1 Nectria haematococca

FOXG_04832

INVERTED DUPLICATION, two C-term P450 fragments face away from each other in a head to head orientation 88bp apart

1826 DDYYDGMLIPKGSTIFVGVWAMHHDKDYYGSHDTFDPDRYLSHTKLANEYAVGPDYEKRD 1647

1646 KSIP 1635

1593 HHYGYGAGRRICPGIHLAERSMWRITAKLLWAFEFSEPIDPVTKR 1459

1462 KVQPLDPDAYTSANLVCPLPYKVNIKPRSVAHVEAIKRELESAEAFLSQYN* 1307

 

>CYP5049A3 Fusarium oxysporum

52% to CYP5049A2

FOXG_04077

MAVTNIITGLPLRMPGPILVTALAACLIIVILYRGYSHRRFLSRL (1)

GPPHSWLFGHIKVFGQVAASMPPNTHPQLLYTEI (0)

STYTTLKEIFYLDLWPIGPDMVVITDPKLMGN

SSRPKPLPIHPLTAVFMKPMLGEGTMAATNGALWRKIATAVSPAFSMGHVLGMTSIMADE

CLLFQEKLDELAVTGDVFSMEELIARLAFGIVSIVTLGEPQHSQAVGSQILKDLRDLVNL

AGGETNPLIAYNPMVQIPRRWKRHRIVSRLDSSLRQRVNECVERIVQEGDVPSRQNPRST

MDLLIHEHAEAMLDERKGGVYGRLELSSSEEEMIFSK (2)

LKTMLLGGHSTSTSTLC (0)

FLFILLSKAPDVVEKMHREHIEQLGASPTVTL

LDNPSMFRRLPYTEAVIKESPRLYPLGSDLKQAPPGTTITTHDGRRLPNANGLIMTASTH

TIHYDANIYPDRTSFRPERWLDPEKAPPEPGYFRAFGGDGRACSGQNMGMNMLKIVMVIT

MGKYTFECAGLAPNKETRTKHTKFDLVFGDIAFQQLGLDGRPGDGMMMTVRKKA*

 

>CYP5052B3 Fusarium oxysporum

84% to CYP5052B1   Nectria haematococca

FOXG_01376 revised

MKLAGRNIQVVPIAIALALLWILYRTVLWLRFHRKYKFPNLVPGVPLFGNMLQIPTDTAGRRLYLHK

MARKYGEMFTLKVGSNYWIFMNSQRVANELLDKRGARYISRQNLPMPGDVASGGKRVVFMPYGNLWKWERKLIHEIIGPG

NRNVFAPLQDVESRTLLHDYLTEPDMWNQANARYASSLIMSMVFGRRTKMGDANVDRIIETNNEIMKMFEPGSSLIDSFP

FLAYIPLPKALQPWRWWGDSVFEQSKKNFSEEFEGLAARQQQGKNVTCFVSEFKRLGRDKVLDYESTVFLAGSLIEAGSD

TTRVALNQLVAGAALFPDFVQRARQDLDNLCGADAQRLPVASDIASLPYIKAIGKEVLRWN (2)

ISFPEIAHSLIEDDSFEGY

NIPAGTNVIWNSWGVHMDASEYENPEIFWPERFMNEDLDKPIKGHLAFGA

GRRVCPGWVIASNSLHLLIARVLYCFDFHQVPGHPIPVGKPFEIGTEKPYEVRISVRSAAHAALIKADCSEAANF*

 

>CYP5057B2 Fusarium oxysporum (temp 5057B3)

91% to CYP5057B2   Gibberella moniliformis

FOXG_13126

MSGLFDNISDFSREALLTVLSLSLCLLYLSIK (1)

TIIRRLLFSPLRHVPGPSSTKLTGAAVWLSTIQGRRVY (0)

KLEELHRKYGPIVRTGPNEVSISNWRHLRTIYLNTKGMIKNPDFYEAATFVGKDNIFQMI (2)

NVQQHAARRKMSSPPYS

MQSVVLLDPLIKGNAQRLAQRLRSGTSSPVDAYTLCGLFSLEVICQAGFAKDFSNDINGAAALKLLQAMDGSALTLLFDG

ALPFVARFDVGTKLPGAIGDSYRKRDYWREKSYEMVDHFLEKSTDDEKYLLTPLATGVDGYLGRKLTHEELVEEAMGYMF

AGSGTTSSTLTYLLYELSKPDNAAIQERLRTEVLAIPDDDIVVIRNNAYINAIIKETFRAHPTIISTLPRLLTEPMTLGQ

YTLPSGTVVGMQNWLHHHDASVFPDPERFIPERWLAETPEMKSALTPFSLGKRNCIGQNLAWQELYWAVS

EVMRSGLRFRVAEEMKDWEMEMEDRFNIAPRGRRLMLTVSPVD

 

>CYP5065A3 Fusarium oxysporum

90% to CYP5065A1

FOXG_04882

MVVKLILYAVVALGLTYLALIFPRLQQEWKLYSHRSQLPPGPKTIRTGIRKPWLWFQELSQQYGDVVYLQLGPTPTIILG

SAQAAWDLLEKRGAVFSSRPRFIMGGELLSGGMRGLMAPYASYWRRWRKLLHSGFMQRQSETYRPIQSLESKVLMFELLK

RPADFRMHLERYAASVIVTVTYGRRVEDVRSDIVVRRNAEAMERLTMVNIPGKYAVERYPALKYLPTFLAPWKKEVLQQR

QKDIQLYTELMDEVREKVAKGTSPTCFAKHLLEEQESLGMSDLEIAYTAGSPFGAGVETSAGSLASFLLACVKFGPQFIP

KAQEELDRVVGSDRLPTFDDLPMLEYVRAITSETLRWRPVAVLGGTPHASTADHVYKGMFIPKGSTIIAPLWTLHLNEAD

FPEPHEFRPERFMEKREYPGTLGHSAFGWGRRICPGMHLGAASVTLNIARILWGFEVNPEKDEK GRDVDADIFAYSEGFN

SSPLPFPCSITPRSVKHAEAIESEHGNALEDLREYTAVTSKIS

 

>CYP5080A7 Fusarium oxysporum

80% to CYP5080A2

FOXG_09972

FOXG_09973 join these two models

MTSPIAIFAIPAVVLALLLRFIVQSF

RSPLRTVPGPTLARLTDGWYFWKVWKGSFQDVNLDLHKKY (1)

GTIVRYGPNRYSFNDPEAAKTIYGLGTHFPKSSWYSAWASPGTWAIFSDQSVKRHNQNRKLYQATYA

MSSLVHYEPFVDDCADTFAQRLSEMSNTSTHLPVDMRHWFQCYAFDVIGLITYAKRFGFLDSGDDVGNVIGALEDHLGYA

TLVGIFPSLHKYLFKIRNWLAGGKGTGRAYILNFTNERIRQAQVAPKPVAAESEVTMEDFLTKFLAKHAASPDVFTQYHV

LMGCTSNMVAGSDTTAISLSAVLYYLLKNPDCLQKLRAEIDDLTARGELSKSPTFKESQQMVYFQAVIKEALRMHPATGL

PLERVVPEGGATICGRFFPEGS (0)

TIVGINTWVAHRDTRVFGQDANSFNPDRWLTAESERLSMMNRYYMP (0)

FGLGSRNCIGRHVSMLEMSKLIPRIIRDFDFSLDSSLQHQNWHTQSYWFVKPLDFKVRIQPRVLEKQRV*

 

>CYP5080A8 Fusarium oxysporum

58% to CYP5080A2

FOXG_17521

MSDISVQFMILGLIGAFDLVKLASLVHGCLF

STLKSIPGPFLARLTDVWYLWHLCKGHFETDNLALHREH (1)

GPVVRYGPRRYSINDPAAVKAIYGLEKAFPKSTWYDAWVAPGKVSLFADRDTRRHSHHRKLFQNNYS

MSSLISYEPYVNECADLFVQRLSEISQTGLPMDMGHWLQCYAFDVIGLITYGKRLGFLDSGKDIGGVMEALEAFLSYAAP

VGIYSKLHPFLFSMKNYVAGSGGTGRAYVISFTRSRVAESMKTPTAVMAGKKTTSAEPFLIKFLEKHEQSPDKFTSTNVT

MGCVANMVAGSDTTGITLSAILYYLLENPLCLAALQQEIDLYYIEGKLSEKPTFQETQQMPYLQAVIKETLRLHPATGLP

LERVVPKGGATISGRFFPEGSIVGIKTWVQHRNQSIYGLDADIYRPERWLITDEEQLSIMNRHWIPFGLGSRTCLGRHIS

RLEVSKLIPRIIREFNYELDGDLAQKGTKWSTFNYWFVKPKGFMVRISSRYKS*

 

>CYP5080K1 Fusarium oxysporum

49% to CYP5080J1   Coccidioides immitis

FOXG_04631

MALGGLLEATQTQYLPLVFTSCFLVWYFHLLIHSLSSPLRSVSGPPLARFSRVWYFRQVWTGRFPWTNIELHRKH (1)

EGPVVRIAPNEYSVDDPSAVKTLYGHGTAFTKGPWYDGSTNLKDEKSNLFANRDIKTHAAERRKVASLYSMSTLVKMEDAVNDCI

VRLEQRMRDLARW (0)

PINLQWWMQCYAFDVIGSIT (0)

VSKRFGFLDSGKDPMDLVSGLHDFLTHAARIGVYPDLHPILFKLGKLAGKFQSAGTNGIIRAFIFTRKQIGEYKA

MNKFLKSKADDEEAFLPRLLRLHHEKPESVTEEDVMRTCAINVVAGSDTTSISLTGVMWALLRNPKAMAK (0)

LRAEVDDKYSSGEIGDPISFGDAQKMPYLQAVIKEGLRL

HPAGGLPLSRIVPKGGATIAGHFFPEG (0)

NIVGINAWVAHRNADVFGHDADEFRPERWLVNGADTQRMDRYWLT (0)

FGHGSRTCLGKNIALMEISKLIPQ

LIRKFDIELADPQMKLETENVWFVKQTNVIVEIKERALSPNFSGS

 

>CYP5080L1P Fusarium oxysporum

47% to CYP5080C1, EXXR motif missing

FOXG_07410

MKSMSLYVLLVFCLTLGWFILTLVNVLRSPLRRVPGPFLARFTRLWLLKQVYFGTYPKTSIELHRKY (1)

GPIVRIAPNEYSIDDPAAAKIIYGSGRGFTK

SQWYYASGNPISPLPNIFAEPNPHIHAQARRKVAAAYSMTNLVQLEPFIDKCSAVLRDRLEEFARSGTSVEI

SHWMQCYAFDVIGMMT (0)

LGKRFGFLDSGEDIQGI MSSLSQYLVYCANVGVFPEWHKTLFRRQMRSQTVSGLTHVRGFANAQ

LEEKREKVKADDVPHPNVAEDFITKFLRVQAQDPTKITNADISSVCTMNIGAGSDTTSISLTSIIFNLIKHPRVLERLRAEIKEHESQGTISDPIKFVQA

(small deletion)

GRVVPSDGATLAGQYFPPG

TVVGINAWVAHANTKVFGHDAHVFRPERWLDYPELVKEREAYFMT (0)

FGQGSRTCLGKNISLMELSKAVPQIVRHFDFVPDTESGYPEYVMENVWFVKIREFHCKVYSRNRH*

 

>CYP5133A1 Fusarium oxysporum

97% to CYP5133A1 on AAHX01000914 (10 aa diffs)

FOXG_06897, FOXG_16113, FOXG_14825, FOXG_16265 identical sequences

MAFLLLPILLLLLAREFLDTPHIEGLFRRSSSLVPTPSLFDALTIFFGLSGRDIHIFNHDRISAYEASVGFYTDHPDVSR

RIMEHQRQDFAHYLQGRNLVFVMERFKKNLASELSAASEVRHDWGRIPDLFSFLSNLILRANVEALYGEHLLRICPTFCQ

DFWNFYKAFPNISKGLPRWLVPSSYQARDEMHKNFDRWRTWCSENYNWDNDGLRDIEYEPIWGTQYVGKMIQRHEALGLS

NNGVAVVMLGYFFVAMANTVPAALWMIVHILLDASLLRRVRHQISPAFQSTEVGEQPDIKVLMKDPLLNSIYYETLRLRV

ASTVGRTSLDDQLCLAGGWKVKAGVPVMFTGWLAGLDVSCWNTGQDLSSGKPQHPLEAFWAERFLDCPGSSSISGPAKKK

RVQPARESPQRPTTHMGAEDARSRASVAGLRGHFFPFGGGAFRCPGETLAKQVIFASVAMVLQSYDLRLIDPEEARKIER

GHRELPFGLHSFDRPVPVEICKLSET*

 

>CYP5134A1 Fusarium oxysporum (temp 5134A2)

95% to CYP5134A1 Gibberella moniliformis

FOXG_11969

MFSPSPQTLGIVVAVFVLATLLIRRALLPKPIPGIVYREANAKKILGNAWELLQWKKKHGEMFGYLANLAVELNEPVFQI

FVHPLGKPWVIVADNREAFDILSRRTPKEFDRSRFLRSLFMPLVPEFHFHMPTGDRWKAHRKLVADTMSPAFLGGVAGPQ

MWKSTMKLIDLWRVKERLAKGRPFSVSTDIRKAAFEIIWAATFGFDSGSTNAQTELLETLPEFTNLGDMDHEVEFPVAPD

PPVFKAGLALNDAMNIGVQSLVPGLHLWLAYNLMPSLRAARSLKEAVIQDEIKKAINKFSNQTDLNWEDQGNLKRHMKSA

VDIVIAREIDSARKEGRTPELLSRTVQDELFSFMLAGNEIFTLTAWTLKFLTTHQNVQKKVREELREQCGAAVERGDAPT

VSEIMSARLPYFEAMIEESTRCGSVTQTNIRTTMQDVNILGHMVPKHTEILMLNNGPGSFMPPLTVDEEKRSESSKGTAG

KIGQWDVKGMRDFDPERWLVKDEEGRLTFNPSAGPRHSFGAGPRACF (1)

GRKWAALEVKIMMALIVWHFNLEQTPKPLSSFKPFPGVAHRPEMIYLRLSNV*

 

>CYP5255A1 Fusarium oxysporum

30% to CYP606B1

FOXG_02898

MAFLVFLASLLLVMAWFGWQRNTKNNSFYETI

PCVGIRKDEWFAWTRAQLRSFSKTEEWMKEGYEKA (1)

TNLYKYSRNNQPFIIPSFRKGKVLILPPAQLKAIYNKRENELKAHDPASEALSFEWTIRNREVY

PSNYTVDVIRKWITKRFDELAAELQEELCLAVDEQFGMSQEWREVKLWPAVQRIFTRGLN

RVLVGFPLCE (2)

DEAFLETMRRFAIDMPFQGLFITLVPKVLRPIFAPLISWNARRDTEAGIRYCTPIIQDFLEANRNPTQEKP (0)

INILQWIIEASAATGDPSQLDAHRIGHRIMILNFNLVQGGSIPFSTVLSDTCNGKHATSTFSQ

LRDEATSVLGSNKTWDRATISKLVLADSAIRESMRCSNFGLFALPRRVNSPGITLDNG

IQVPPGVHIEVPMHSIHMDNSFYADAGIFKPFRFADGTSMSR

SAVTLDESFLGFGYGKNACPGRFFGSHIMKVVLAYLVMNYDVEFGSEEPPMKTMWEYRIP

RESTAIRIRRRVQACN*

 

>CYP5256A1 Fusarium oxysporum

31% to CYP65AU1   Coccidioides immitis

FOXG_14590

MNQLSMDWELVASTWQTASPASRVIVTLSTLSLTALLISIIYELYFAPLSKFPGPKLCAISRIPHLIATASGHQLPWLIN

LHNKYGGVVRIAPDALTFTDERAWADICGASKAAKDGMAKDPRLAALVGGDLVNPDPAKPRSQQTHSIMRKAMVPALKRE

NVKKLESMINGHIEEYLSALQKASERKEAVDMRDMNSFLICDLIADLFLGESLHLFTDPEFIPWVHSFDRFARGVTILAV

LNRFPFLHKFLLFAVHRWGSGERESFMAPIFARFDRRVALTSARHDMLQMVLDGDSEGTGRQGTMPLDLLREFAPFLMLG

GCEAMPTVLTGFVYFVFRKTSADIRKKLLEEVRGAFSSDSDITMDRISQSQKDLPYLEACLQESIRCYSPAATGTDRVVP

TSGAQIAGHFVPGNTVVMMLHQVTYSVKHNFSRALEYVPERWLPEGKGRPQDCIDDTEFLCIAAGVV (2)

LSFYVLRLALCKLLYRFDIELTPESENWVEGQLTFGTRSKPPLMAYVKKASL*

 

>CYP5257A1 Fusarium oxysporum

34% to CYP627A2    Fusarium sporotrichioides

FOXG_02736. EST CK615609.1

MMLNLPYSYTTLALFAVGLELLRRVLKALIFGFTGPLSRIPGPLWNKLSPLPWRLAFLKGTAP

FLAQDLHHQYGDVVRV (1)

TPNLVLVSDPVSVHRVLVEWDLHKSPLYEKYRQNPHVATLFTERDKAKYRIR (0)

RRLLSNGFSMSYLKALEPLMHGCVQVLEDVLEDRCAAGGGTATVNIYDLLSSLAS (0)

DIMAECSFGGSFGLVRQGHHPLKTRITNYMKKAALYQTVPLLSLFGKPRDEQLDAIVQ

GIIDKRLHSQKESERRDLLDMLLEASAENPDKLSMEDIKAE (0)

AAPSDTSAVTATFCLMKLLENPAAHQALKRELDELLASSSDPIVDENTHNLPYLNAV

IHETLRMLPPAAG (1)

GFARQALEPVTVGDYVLPAG (0)

TLVTADTTALHRDSRVYPDADKFIPERWISGHAGEKAAEKNWYPFSAGSRVCIGKH (2)

FALKEVRLILAVLLRRFDLTIVPDQKIQYRHHSVLYIASGEYLVGVRKRVA*

 

>CYP5258A1 Fusarium oxysporum

35% to CYP65AB1, 37% to CYP562A1

FOXG_17730

MLSSFSFSSTSSWVTILGVTFIL (0)

CIFYIILHTIYNLRLHPLQKYPGPWWLAASRIPYTFYVLRGVAARKTKDLHHRYGHVVRISPDTLSFTSNRAWP (1)

DIYGPGQPGGRGNIPKDSRYYPESHL (0)

KVFNDKTHRRLTQCHLTPSH

HEACLRKHTNLFISKLQQSQYQSETKEVDLSHWLHLLTTDIAGDVILGEKFGGLENGQCR

PIIAAIPCLARAFTSAVELTQYPGIRYMMNTFWTWFNRAPK

SPKTPMTVPKQTESHIKENKPISRILDGPEDQQ (2)

LSPVEKEAITMALIIAGSET (1)

TATLLAGSIYLLLKHQVYLKRLTSTLRTQFHTSSDMTLSALKEQQYLNAILKESLRLYPP

APGNLFRRTEKEGHVVMGEVIPSNTTLTMNIWAANRSALNFHLPDNMVPERWIQPRSAEY

QDDDRSAMRPFSIGPQDCPGRN (2)

FAWAEARLVLAYTLWNLDLELVSESQDWMTWQKVFMFWMKPPLRVRCTPAQTRVE*

 

>CYP5259A1 Fusarium oxysporum

36% to CYP530A11, most similar to pseudogene CYP530A6P, 52% to C-term

FOXG_11876 revised

MPSRELTIGLAVLSLLLVLVQKAITRRRESKALLPLPPSP

PSTNIIAGHLPTVLKAAKEHRQHLLFQKWAEEYGEVFFVQ

LGTIQEYFINSDQAVRAIFDKAAAQTSERPRWIVSNEQICNR

LNLLLLSSSEKAWKSQRKATTFGLTNLNLADAGLPFLHFETLKFLNDIA

QNPNKGADPQSLWSSIGRYTYSTFSSQIFGLDVPDDNSPVIDYIFETGL

AQILGMLPGYYLVDTFNILDKLPLFLKPWERDAKSRHKRDYEWCCDKLE (0)

RVKSLIDAGEAPPHMTFIRRVIEDPNHLGLDSLEDAAYLGMMLIIGASDT (0)

SRISTWSFLEAMLTFPNVCNKARKVI (1)

DDAVGDRVPVYEDLERVPYIRQVMKESWRWRPPVAL

GHPHTTTRDIIYKDYRIPKGARIHLNAW (2)

AIHRDPKRYPDPDRFIPERFEGDTRS (0)

SQESAASPDVSKRDHFVFGAGRRIC (1)

SPGYHVADRSFAVSVMRILWAFDISLKPGTKLPLDPQSFPGDMPGNPGL

DLPVSLTVRSPERLATIQKEFEGAVQGRAKMEPLAG*

 

>CYP5260A1  Fusarium oxysporum

33% to CYP5095A1 Aspergillus oryzae, 34% to 682D3 Uncinocarpus reesii

FOXG_12398

MFRVSDIGSSIDRTKLFQYLVIFFVSFKAITYIQRLFFHTLSKFPGPRI

CAASRLYEFYWDSYQHGRFWAKLPDLHRRY (1)

GPVVRIGPNEVHIEDSEYFDTIFGFRPLNKEAMMAKEFGINHALFGVEDY

KTYVKKRAAFGNAFSRTRLSKIQGQINEEIQKGCTWVEENSKNGGPVDLA

FLFRAVPAEIITKYLFGQEYGFLQHVQTTK

NLYDKRMDRLFGFSHLGRFIPKEIPLFLSLFRQLILRALGYNDPGSAFLDYFL

LAKKLVQKVVAQHNHSNRNAEGITQHT

VFDDFLDSSLPQEEKEKGPLTQQAVAIWSGGWDTVGFVLTMAAYQLLQNPQVEQRLYQELKEAWKDPTEPPEITTLENLP

YLTAVVKETFRLSPGALCRLSRVNPGGFEQYGDWEIPPGTIISMSIPDVLSDEAIWGSDAAVFKPERWLSGGADLDRYLV

TFSKGTRVCPGIELAWIETRLVIASLFRRYEMSIAAEAGISDDDIMPYYEGFTPAVKNWISRLPVKVKPRD*

 

>CYP5261A1 Fusarium oxysporum

35% to CYP630D1 Aspergillus oryzae

FOXG_09802

MFSLPINAAELAFLIPLTLVAFLVLKPLLYYLLDPLDL

RKYPSPSFLAATTHFWILKETWLQRRSRSIHRQHERLGDVIRIAPSLIIFNIPKAVPDIY

GHAAARKLVKDTFYDKISGEERDIVNVIDHGDHSQRRKYLSNSFALKTVTD

MEPVIGQNFQRLLDHLDGVADQSTNIPSGQTIDIRRW (2)

FNYFTLDVIGDMAFGLPMGFLGNGGDATRVKSAGRQEYCIPST

IDTLHRGTRLSTTLAQLSSIRCVKLVKRLCNTTNWLKQSTGAQGIEDFDNVCIDQLSERLGNGSPDRSQQDFMSKILKDR

EGKDRGLSFERLLSESIVFMNAGSETTAAALSSTLYFLLSNRKCFEKLRAEIDARLGPNHNGIVSYDSAKDLPYLRACID

ESLRLRPPIAYALQRLVVCPQGAIIAGHHIKQGTTVAVSPWTIHRNRKLYKNPDEFDPERWFDPEQLSNLRRYYIVFSQG

PRQCLGRHIAIVELQILISTLVRRYNMYLADQEMNFVIFDRFNSNPGPLSVKVERRVFVD*

 

>CYP5262A1 Fusarium oxysporum

34% to CYP625A1   Fusarium graminearum

FOXG_13424

MPSPPEHTLFYTLTVQALCSTLAVVFIVLIYAWLAYLLGNGSLRHVPGPWYCKVSNIPLSIYEILCRRSDIILDLHKKYG

PVVQIAPNEVSVADLEATKQIYGTKDRWAKSDYFDHFMGYGRRSIFATKPYEDHRIKRKYTSSFYQAKAIYKLPEIEEHI

KSRSLAVLDQVRNGEDVDALSLTSWYALDNITFLVLGPNHGTHSVDQTCTERGILEGLKYQQFIGPFRYRCPRLYNYASL

LLQRASSRFRYLSADGKFPTWCEKKLFAALKDPRLNETHSLVRHLWELKQDDTNTGSIDVPYMAAEVLDNIDAAEATIGV

TATYLIWKLTEAPEWQDKIRQELSALPKQDDGCPSFADIDTRVPSLEACLREVYRLHPSSSGKNERLVPLGGCTLAGVFV

PEHTVVTSSVLALHYDGEVYSDPDRFLPCRWIDGSEEQRKVLDAQLIPFGYGGRVCLGKALATMELKLLIASLYLEHESL

ATLATNAVSMKQCSTHDAVPRGLECVVRFRRMKDNATLE*

 

>CYP5263A1P Fusarium oxysporum

45% to CYP639A3, 41% to CYP5100A1 Aspergillus flavus

C-term pseudogene fragment, no upstream P450 sequence is found

FOXG_15578, FOXG_16037 identical sequences

SIAGWTFPKDQPIMISTFDTARKPSVWNQGTPDEPHPVDEFWPERFIVEP

KDPTSGPTLSQTRLPETKDEWSKPYFTLDGTVGSWIPYGGGSR

MCPGRHFAKKELIVTMAMFLTAFDIELEPRDDWIRNDAKYFMFGVMHP

KGPIPARVRRRTPNV*

 

>CYP5264A1P Fusarium oxysporum

36% to CYP633A1 Fusarium graminearum

note CYP561E1 is about 3000bp downstream

PERF in green, no heme signature, probable pseudogene

FOXG_17452

MLQQQHAASDRELPTAFLIGLLTVTIICIAALERVTRVSVESREPPLLKPRIPIFGHILSFIRKPSEYFIELRQKHNVEV

ATLQLGHAKVYVVWSPAVVQSAFRSKALSHDKYSLDFAQKVFGLSKETIISLRSPEAVQERIQQRLIEAIHEGLIGQSLR

NMTARALDYLNEQVSSLAVDNQRLEIPNLYVWLRNHITLSVSNTLYGAKNPFREDPSLIQSLWDFEGDFTRLLLGSFVGK

FLAPGAFNGRRRVQSAMIDFYASNSELNDDVTPFIRARAQLLRQAGIPAEEIGRMEMSFMFVATTGSVPTIFWLLANVLQ

DQNLIQELRMEIEPLVLRERNVAELRVSAINENSCPLLISCWHEAIRISNQFLGTRHPLEDMIVSNKEGQNYLLKKDVPV

IWTARALHASTDAWGGDATTFRGDRFVNLQGKDKQKKKASFVSLK

(missing the heme region here)

PASVKMGPTRLGEGVMKPLHEGQDSSCMVKRREGWETVGWRMVF*

 

>CYP5265A1 Fusarium oxysporum

39% to CYP609A1 Magnaporthe grisea, 39% to CYP5193A1 Mycosphaerella graminicola

FOXG_17455

MALFYVNTSWYLAILSTALIAIIYLFALFFHRPQFPKGAPPRSFEDWPIIGSPQFFTQHGDFNLRGL

AMSASNHFSFYLGKHQVVSIGASGRKTYFENHHLNAGEG (2)

YAALFTGTPHRQSGAEVAIDNGEYQSKFGKTLILLFKKAYLSRRTPILAADVKGI

MESLIRKASNQNATMKPFEDIYRIVWQQTNRLVGADEIAASPEKLDHIMRLFEDISQGASPLRVMFPMLPTFDHIKRTVA

GARLYGMLQGLVNDRKRLGRQEDDALQFLMDAGEDIAGITGFLAGGLFAGQLNTGVNAAWLLIYLATNKTWYNKIQKEVD

SVLARHGVDQRRETCKIIDILSRFGLEEWISEFPLIDLCLKETIRFQLPGTFCRKNTSDKSITIVGSDEIIPKDAFAVYL

TDNCHFNPDIYSEPLKWDPDRYATGRAEDKKGQYAYLGWGVGRHSCLGMTAARMEVTMVVAFFVTLFDFHLLDEKGKRTD

TVPMPDRNRFGAGKPKNWNPQLKYTLRS*

 

>CYP5266A1 Fusarium oxysporum

no gene model

Supercontig 19: 668959-670705 (-) strand, frameshift

MAVDLATTVQAFLPRVVVYTIIGTTAAWLLHLMQPAFQAALSKDYQKFNWAGDTK &

SVGIFMKASYEVALKSQEYFKETHRK (0)

ILEAGHGGIQLVPILHCSTGFMLMVPKQLLNEYVKQPENDISLKRYTLQALVPDYTTLGP

HIVIHPVYRNVVHKELYQKVADKMPMVNEEMKAALDDNVASKLDSNGVVQINMWDTASAI

LSRSANRIISGQPLCDNKEYRDATAEYAATFFASALYARFIPPFLRP (2)

LLLPYMCRPLMRCIETAAKHATPVLKERMAIIDAAEEKDIEPDLP (0)

NDMLSAIILAAKKDPNGPSEYEPMVIVARMMVLNFVQSYTNLVTMTNLV

YDLISLPAGDYEAMISDLRAEISQEMAKGDAFSHEFFQRLPLMDSLIRESIRYNPIGETG

IERAVGKQGGFTFSNGIHVPQGAILAAPIKAYQRDERTYPGGFNPRRSMEDPEHPRMTDI

SPDFLNFGLGRGACPGRFFTSNLLKLTLTHLLMDYDFERLDERPENVRKVTIDEPCGRFL

ITLKKRNHA*

 

>CYP5270A1P Fusarium oxysporum

Supercontig 8: 131065-131663 (-) strand

No gene model, 85% to CYP5270A1 Fusarium verticillioides

AVIRETLRVYPPAPAPMP*VVPKSGFEFEGVSYPPD (0)

TVISAQPYTIHRSEGVFEGPNELRPECWLNLPSERKDRMYRAFVPFSTNQRG (2)

CIGRGLAWMHMMKCIARTLQEFDRFELAAGMTDYGMDLIERG

ALAKPRSTEMWVDAYAKAI*

 

>CYP6001C8 Fusarium oxysporum

fusion with diooxygenase, P450 (C-term) part may act like a hydroperoxide isomerase

gene model FOXG_12909

ortholog to CYP6001C8 Nectria haematococca

name revised for CYP6001C9

MAEHKNGVATNGYEKKSSPASSSTKSEAKPLPNSDKKDGIVKSFKQLRVASKRPLPKEMGDGSYRVVENRPGLKQDIRRL

RGRDLKTLLEIVKAKVKGETQQDDKTMIMERTIQLVANLSDHSKVQESLTNSFISQLWNSIDHPPMLYMGDKFRFRQPDG

SNNNPYLPQLGAARTPYSRTVRPKGMSLGAQPDPEAIFESVFARDAFRKNPNNVSSILWYWATIIIHDPNQNDSSSYLDL

APLYGSTEKDRDSIRTFKDGQLKPDCFADKRLIGNPPGVPILLIMFNRFHNHVATNLADINEGGRFSKPAEHLSPEAADA

AWKKRDTELFETARLVTSGLYINITLIDYVRNIINLNRVDTTWTLDPRQEMGVSVGTKDLSESGTGNVVSAEFNLCYRWH

SCLSEMDDKWVQDFYTELLGENYGPMNLQTMMKALKAFEASVADEPSERTFGGFKRGPDGKFNDDELVEALATAIEQPGG

AFGGRNVPRIMKPIEMLGIMRGRKWNLAGLNEFRKHFGLKAYETFEDINSDPSVADALRNLYQHPDYVELYPGIVAEEAK

TPMVPGVGIAPTYTISRVVLSDAVALVRGDRYYTTDYNPRHLTNWGYKEVDYDLKVNHGCVFYKLFLRAFPQHFKGNSVY

AHYPMVIPSENEKILTNIKRADRFDFSRPEPTATRINIIGYNAAKYILEDQQKYRVCWEEGLKHLMGEAGGRFMLSGDTA

LHAQQRKCMGKLLYNDTWRNAVKSFYATTAEKLLAEKSYRLAGKMQVDVVRDVGNVAHTHFVARMFNLPLKTSENPKGVF

SEQELYMILAVIFVCIFFDIDPAKSFPLRQGAREVAQKLGGIIEMNVKLANSIGVKGLFTSKPDKNDDPLARYGENMAKG

LKKAGLSTEDIVWSQILPTAGAMVPNQAQVFAQTLDWYLSPAGEKYRPELARIAALETGDETDALLLGYAMEGIRMAGTF

GLYREATGPDTIHEDDGRSIPVNAGDRVFVSFVQAAQDPKIFPNPGVVDPKRPLDKYIHYGVGPHACLGRDISQVALTEL

FRAVFRKKGVRRVPGAQGELKKVPRPGGFFVYMTEDWGSIWPFPTSMKITWDE

 

>CYP6002A2 Fusarium oxysporum

fusion with diooxygenase, P450 (C-term) part may act like a hydroperoxide isomerase

FOXG_16700, FOXG_16765 identical models

MSTDEFLQGLRKWSWSLPGDPEKWTFGGLTRLEDGRFPDAELVRLLQTGTENVAGKLFFKLKPYTTFADMNSDPSIAEAL

EAMYGHPDNVELYPGLLAEETKKPMEPGSGLCPGFTTSFAIMSDAVALVRGDRFYTVDYSPSNLTSFGYTEVSSDFDVAG

GGMMYKLLMRAFPGWYRANSVYALYPFTTPEANFEVFKKLGTSQDFDFNKPSFIGPPTPITSWQGVVDVLSDQEHFHVPC

EISLRNSNLSAEAHNSAGGNHTFQLTHHDYMLSGDTPTNTEQRGFVKQCLYSPESGLEEVRHFYESITAELFRQHSRKVG

ESYQVDIEYGAGSDSYTARALSDVLANLFGYVFLDLDTAASYKNRVVAAAETKSLGEKMQTTVAGIKAQRFPSLRHMLRI

ASSDGVLRSYGVELIDRLLESGKGVDEAVWTIIPTAAAACATQAQGYYSHWPAIQKLAMSDEPEAFEKLKKYALEGFRLS

TPAFGLLRTVVADKADLRDGPRVVSVKKGDTIFTDFVTAGLDATKFPDPYEIKLDRPDDLYIHHGWGPHACLGRPIVTVA

GASMLRVCARLGNLRRAPGQAGEMKSKRVNDAFKVYLAENGSKWGPFPVSKKVVFDKTTEM

 

>CYP6003A1 Fusarium oxysporum

fusion with diooxygenase, P450 (C-term) part may act like a hydroperoxide isomerase

Fox10645

Ortholog to CYP6003A1 Gibberella zeae

Name revised from CYP6003A2

MSFNEKFQAGESYGDSKEDPSSLLNNPEKLVADLMKDFAGVRSQASPAQLLGLVKELLQKGQPLDDKKGTTELLIGILTA

LPATSKARTALTNKLIDTLWGNLQHPPLSYMGGDVKYDVVNSDKPAHKHNCELYDTIEFKVPGTDVLLREQVPQAPDGLH

QYRMPDGSFNNILEPNLGRAGTPYAKSVKSEKRLHGVKPDPGLLFDLLMARDETTFQENPAGISSMLFYHAAIIIHDIFR

TNRTDMNKSDTSSYLDLAPLYGSSLKDQHEIRTMKEGKLKPDTFHEKRLLGQPAGVNVMLVLYSRFHNYVADILLKINEN

GRFSLSVPPNASEEDKAKAIAKQDHDLFNVARLITGGLYINICLHDYLRAITNTHHSASDWTLDPRVAIDKQFDGDGVPR

GVGNQVSVEFNLLYRFHSCISKRDEKWINNFFLKLFPGRKAEDLQDVSWTELGQALLTFEQNTPKDPSVRTFDGLERQAD

GTFKDEDLVRILKDAMEDPAGTFGARMVPKALKVVEVLGIIQGRKWQCASLNEFREFFGLKRYDSFSEINSNPDIANILE

KLYTDPDMVELYPGLMIEDIKPQRNPGSGIMPTYSVGRAVLSDAVTLVRSDRFNTIDYTVSNLTAWGYNEVQQDYKTLGG

SMLYKLIQRGVPNWFPFNSIAVMQPMYTKKANEQIAKEIGTFDQYTLDDPKAPPKVAVLTSGPAIKQILSNTKQYVVPWL

KPLNTLFPGKKDFGWFMLAGDQPQNYTHRANFSKAMSKIPNMHNAVHAFIEREGTKLINKETFTLKKGLDQIDIIRDVAI

PLNTQLLADLFYFDLRTDENPDGKLGVAELYRSLLDIRVWGVNNNDPAQAWNRRRRAQEGAKRMIETTKTIVAEADAGRP

RGIGLVSAVANRIGARSYLKKDSLRSCGLKLVEELLAQGNNVDQVTDNLWLTAFGGIGVPVTAFYEVLSFFLRPENEAIW

AEVQAIAQKGDDATLHAYVAEAQRMTSSQRNVRVATAPGEVQGQAIQPGTAVVLMLGEAGRNPKEVPDAGKFNPQRKKED

VSAFSYGQHECIAKDVALAFVTGLIKLVADLKELRPAPGQMGTVKTIQVGTEKAYLNDSWSYLGFDASTWKVHFNGHGKG

KFEGERVPTKSTPIQEYYYLLQKRKDEILGN