Fusarium verticillioides P450s

 

D. Nelson

 

August 8, 2009

 

138 Sequences + 3 duplicates CYP577A5, CYP581A3, CYP5266A1

 

>CYP51F1 Fusarium verticillioides

98% to CYP51F1 Fusarium oxysporum

FVEG_01123

MGLLQELASHPLAQQYQELPLAQQIGIGFGAFVVLSVVLNVLNQLLFKNRNEPPLVFH

WFPFVGSTITYGMDPPKFFRENRAKHGDVFTFVLLGKKTTVA

VGPTGNDFILNGKLKDVSAEEIYTVLTTPVFGKDVVYDCPNAKLME

QKKFMKIALTTEAFRSYVPIISSEVRDYFKKSPDFKGKSGIVDIPKKMAEITIF

TASHALQGSVIRNKFDESLAALYHDLDMGFTPINFMLHWAPLPWNRKR

DHAQRTVAKIYMDTIKERRAKDNDDTEHDMMKHLMNSTYKNGTPVPDHEVAH

MMIALLMAGQHSSSSTSSWIMLRLAQYPHIMEELYQEQVRELGADLPPL

TYDDLAKLPLNQAIIKETLRLHAPIHSIMRAVKSPMPVPGTKYTIPTSHTL

LAAPGVSATDSAYFPNPDEWDPHRWEADSPNFPRMANRGDDEEKIDYGYG

LVSKGSASPYLPFGAGRHRCIGEHFANAQLQTIVAEVVREFKFRNVDGGN

TLIDTDYASLFSRPLEPANIHWERRQQ*

 

>CYP51F2 Fusarium verticillioides

94% to CYP51F2 Fusarium oxysporum

FVEG_10277

MFSLLYYPLWAFASCLAIITLNVLYQKLPRNANEPPLVFHWLPFFGNAVAYGLDPYGFFVKCREK (0)

HGDVFTFVLFGRKIVACLGVDGNDFVLNSRIQDANAEEIYGPLTTP

VFGSDVVYDCPNSKLMEQKKFVKFGLTQKALESHVQLIEREVLEYIQAVP

SFSEKSGTVDVSKAMAEITIFTAARSLQGEEVRRKLTAEFAALYHDLDLGFT

PVNFLFPWLPLPHNRRRDAAHSKMREIYMGIINERRRGGGDLEKRTDM

IANLMSCAYKNRQPIPDKEIAHMMITLLMAGQHSSSSASSWIVLHLASSPDI

TEELYQEQVINLSASGALPPLQYSDLDKLPLLQNVVKETLRVHSSIHS

ILRKVKRPMQAPGPPYTITTDKVILASPTVTALSEEHFPDAQRWNPHRWDNKP

QEEAVTDEVIDYGYGAVSKGTKSPYLPFGAGRHRCIGEKYAYVNLGV

IVATLVRNFRLSTLDGKPGVPATDFTSLFSRPAQPAYIKWERRKA

 

>CYP51F3 Fusarium verticillioides

95% to CYP51F3 Fusarium oxysporum

FVEG_12391

MDALYTNWRSLPLSLSIPITAFLIIVIATITNVIKQLWFPNPHRPPVVFHIFPLIGSTVQ

YGIDPYKFFFDCQAKYGDCFTFILLGKSTTVFLGPKGNDFILNGKHADLNAEDVYGKLTT

PVFGREVVYDCSNARF

MDQKRLLKLGLTTESLRCYIPKFVKEVEDYIATSPYFKGNTGIVNITEVMA

EITIYTAAGSLLGNEVRSMFDSTFATLYRHLDDGFQPINFVMPGLPLPQ

NFRRDHARKVMEELFSDIIRKRREMGNQGDETDMVWTLMNAKYKDGEDLPN

HHAARMLIAILMGGQHNTAASGAWLLLNLAHKPHLVKELYDEQVEVLGS

PQEPLTWENLQKLTLNGQVIKETLRLHSPIHSILRQVKSPMRVPGTDWVV

PPSHTLLASPGTQARSEEFFPRPMEWDPHRWDKIESLDDAKNGETVDYGF

GMMSKSVSSPYLPFGAGRHRCVGENYAYAQLGAIIASFVRLLHIEQPDPK

APLPAPDYSSMFSRPMNPAVIRWTRRNAETG

 

>CYP53A19 Fusarium verticillioides

98% to CYP53A19 Fusarium oxysporum = ortholog

FVEG_03183

MAVVDILFTWWSIPIATGVLIATYLYSYFVTYGHLRDIPAPFPAQFTNLW

LLYVCRRGERYRVVDGIHKRLGPVVRIQPNHTSIADPDAIATIYGHGNGF

LKSDFYDAFVSIRRGLFNTRDRAEHTRKRKLISHVFSAKSISQFEPYIHA

NLELFVKQLDKLVASGQTTDKNGKRQALIDCLPWFNYLAFDVIGDLAFGV

PFGMLANGADVAEVRATPDSAPIYASAIEILNRRGEVSATLGCWPQLKPY

AQWLPDPFFSNGLNAVKNLAGIAIARVKARLDNPPSVERKDLLARLMEGR

DEKGEPLGREELTAEALTQLIAGSDTTSNSSCALLYHVTRTPGVLEKLQA

ELDEAIPADVSVPTYDMVRDLTYLNNVISETLRYHSTSGIGLPRQIPDNS

PGVTIKGHYFPPGSVLSVPTYTLHHSKEIWGPDADDFKPERWDSLNELQK

TAFNPFSHGPRACVGRNVAEMEMKLIAATWARRYTPELKQEVMETREGFL

RKPLGLDIALKMR*

 

>CYP53A20 Fusarium verticillioides

97% to CYP53A20 Fusarium oxysporum = ortholog

FVEG_01611

MALTELLISPWAPLALAVALVAWYILPWISNSNLRGIPAPFLAQFSNLWLLSTCR

RGKRYEIVDQVHKKLGVLVRIAPNHVSVADADAINTIYGHGNGFL

KADFYDTFVSIRRGLFNTRDR

AEHSRKRKIVSHTFAPKSVLEFEPYIRQNLDIFINQWDRIASNKEADGYGSVDCLNW(1)

FNFLAFDIIADLAFGKPF (1)

GMLSTGADIAEVKVSPTSPTIYAPAVEIMNRRGEVSATLGC

LPQLKPYAKYLPDPFFSQGLQAVENLAGIAIARVSERLERGGDSTRKDLLARLMQ

GRDEKGEPLGRDELTAEALTQLIAGSDTTSNSSCALLYHVVRTPG

VMQKLYEEISAVVPEDVAIPDYESVKHLPYLGHCINETLRIHSPSGIGLPREIPPNH

KGVTLHGRYFGPGTVLSVPTYTIHHSTEIWGPDADEFKPERWE

SLTDKQKNAFIPFSYGPRSCVGRNLAEMQMRLIAATWIKRYDVRLRQDIMETREGFLRKPMGLDVGLARR*

 

>CYP54C5 Fusarium verticillioides

90% to CYP54C5 Fusarium oxysporum = ortholog

FVEG_00258 revised

MGNTQSLLDLVANRWPLPVTALLACVLAAIGPRVANVLRLWSIPTIGEEL

GNTEKRRQAYLGGARKLYSAGYQKLTDDQFKDGVFLITTSRTSLTIVISPDFLPE

LKKLPDATLSMEAAVDESMETKYTKIETSVPIIPHTIKGKLTPSLSRLSL

TIATEVRDSMNLTIPPCDDWTEINIHRALLRIVGMVSGRLFIGPELCRSE

QYLDAAINYTMEVMGAQRAVQNMRPWLRTFRAQSLPEVKKLYQRISEAEA

FLDPVVRRRTDAMNDPSYEKPDDFMQWLIDGKDKFPDKNSQILAKVQLGL

TFAAVHTTTLTATNAFYDLAALPDLQIELREEVREALSQSGGQFTSNALQ

SMKKMDSFLKETLRVHPATMASFQRKVLKPFTLSNGQVIPAGVTIEIPAV

AVSSDSNVFPHAEKFDPLRFYRLRTEAKDGASVEKAANNQFVSVNHSSLT

FGYGRHACPGRFFAANEIKMILAHALLQYDVKNLGDATERYPNMEFAHMVS*

 

>CYP55A1 Fusarium verticillioides

96% to CYP55A1v2 Fusarium oxysporum

FVEG_10773

MASDAPSFPFSRAFGPEPPAEFAKLRATNPVSQVKLFDGSLAWLVTKHK

DVCFVATSDKLSKVRTRQGFPELSAGGKQAAKAKPTFVDMDPPEHMHQRSM

VEPTFTSEAVKNLQPYIQKTVDDLLEQMKQKGCANGPVDLVKEFALPVPSY

IIYTLLGVPFKDLEYLTQQNAIRTNGSSTAREASAANQELLDYLATLVE

ERLVEPKDDIISKLCTEQVKPGTIDKSDAVQIAFLLLVAGNATMVNMIAL

GVATLAQHPDQLAQLKADPSLSPQFVEELCRYHTASALAIKRTAKEDVMI

GDKLVRANEGIIASNQSANRDEEVFENPDGFNMNRKWPAQDPLGFGFGDH

RCIAEHLAKAELTTVFSTLYQKFPDLKVAVPLEKINYTPLNRDVGIVDLPVTF*

 

>CYP61A6 Gibberella moniliformis

AAIM01002518.1

81% to CYP61A6 Nectria haematococca

also Fusarium verticillioides FVEG_08786

29769  MTSIVSPRHEAAISNASSTLKEDISNG

29688  NGLLSSYLNGYSNAQILLAILVVLIAYDQCMYLWRKGPIAGPAFKIPFMGPFIRALYPKF  29509

29508  DHYLAQWASGPLSCVSVFHK  (2) 29456

29396  FVVLASDRDIAHKVFKSPTYAKPCIVPMAETLLRPNAWVFLQGKAHTEYRKGLNGLFVN  29220

29219  KALSTYLPVQEKVYDDYFGRFVAASEANKGKPMAFMRLFREINCALSCRTFFGDYISQDA  29040

29039  VEKIADDFYEVTAALELVNVPLSVYVPFTKCWKGKRTADAVLAEFAKCAAACKANMTSGA  28860

28859  EPRCIVDQWVLHMMESKKYNDRIAAGEEGVEKPRNLIREFTDDEIGQTMFTFLFASQDAS  28680

28679  SSATTWLFQVLAQRPDVLDRLREENLAVRNGNRHQPFELSMLESLPYTNAVIKELLRYRP  28500

28499  PVIFVPYEATKSFPVTPKYTVSKGTLIVPTCYPALHDPQAYPNPETFDPDRWITGDAESK  28320

28319  TKNWLVFGAGPHDCLARKYVPLTMAAMIGKASLELDWVHHATSRSEEIRVFATLFPE  (0) 28149

28084  DECQLVFTKRE*  28049

 

>CYP61A1 AAIM02000091.1 Gibberella moniliformis 7600

95% TO FUSARIUM GRAMINEARUM 61A1

99% to 61A1 F. oxysporum

also Fusarium verticillioides FVEG_07284

        MEAVNATSSGFSSVLAGTKYVNVALPPQVEYVIEAVSNAGVWTWVFTFIALCVAYDQ (1)

350695  IAYIIRKGPIEGPAMKLPFIGPFLDSMDPRFDGYHAKWSSGPLSCVSIFHK (2) 350847

350776  FVVIASTRDMARKVFNSPAYVKPTVVDVAPKLLGHDNWVFLDGKAHVDF  351054

351055  RKGLNGLFTRKALESYLPGQEEAYNTYFKHFLKMTKDAGGKPVPFMHEFREVMCAVSCRT  351234

351235  FVGHYISDEAVTKIAEDYYLITAALELVNLPVILPYTKSWYGKKAADMVLAEFSKCAA  351408

351409  KSKVRMAAGGEVTCIMDAWVLSMIQSERWREAEEKGEGHTVEKPAPLLRMFNDYEISQTI  351588

351589  FTFLFASQDATSSAATWLFQVTAQRPDVLDRVREENIKVRNGDPNAPITMDQLESLTYTR  351768

351769  AVVRELLRWRPPVIMVPYVTKKAFPLTENYTVPK (1)

        GSMLI  351948

351949  PTTFMALHDPEVYDNPSHFDPERYYSGDAEEKGSKNYLVFGTGPHYCLGQVYAQLNLALM  352128

352129  IGKASVMLDWKHHATPKSEEIKVFATIFPM  352218

        DDCPLTFEERKW*

 

>CYP62B3 Fusarium verticillioides

90% to CYP62B3 Fusarium oxysporum = ortholog

FVEG_04329 revised

MYIANYLNIPLLAGAFLAGIVLYTLVNAFKSPLGGLPGPWYTHFTHLILKYHILS

GNRVHYIHSLHQRYGPVVRVSPGEVAVSDLEAFSKVHKIGSGFLK

SGWYDGITPNREPGIFVMRDPHQHAARRRLFARAFSVSSLLSNWESEIRQKT

ELAVNNIKRDAQSTGADVFKWWTLMATDVIAHLSFGESFRMLELGKQT

PYIDAIQSSLLMSALRAELSWIYPLLKRLPFQGLKKLLNADSIVFEHGSI

AVRNMQSAGDGLSKANLFSQMLAESDSQEKTSLSTSSVQAEASNLIVAGS

DTTAVTLTYLIWAVLKQPQLQAELEREISELSDELTFDELKSAPLLNSVIE

ETLRLYGAAPGALPRVVPGKGLDVCGHYIPPGTIVSTQAFTLHRNENIFEDAQR (2)

FNGHRFMDKSTLTAAQKAAFSPFGAGSRICIGLHLAWMELRLGAALFFRECCGASLSPE

MTEAMMDMENRFLIAPKGHKCVVKL*

 

>CYP65R2 Fusarium verticillioides

95% to CYP65R2 Fusarium oxysporum = ortholog

FVEG_08438

MGPILVFIAILGLYLVGNAIYYVTLHPLANIPGPKICGITRIPYWL

ASLKGEDVKWMKGLHDRYGPVVRFGPTDVSYTAGEAWNDIHGPKVTEKAQEFSV

QPVNGVPSMLTTDTESHTRVRRLFSPAFSERALKQQEPLFKKYSDLLM

YKISEVGNDGAKPVEMTQLLNFTTFDVMAELCFGHPLNLLAQNEYSPWVRSI

FESLKMLPIASMINYYPILNAIFTRFEPKSVTQQRVTHCKHSEDRVNHRL

ENGSDQPDVWNLVMSAKEGKGLTLEEMHSNAELFMLAGSETTATLLSGCL

YNLLTYPEKMKTLLQEIRGKFTSTDDLTFERLAELKYMNACLKEALRVYPPV

PIGSPRVVQPGGQQILGKYIPPETRVSVHHYSTYHSESNFKDAESFVP

ERWLKTDSKYAGDMWEAHQPFGFGPRNCLGQNMAMHEMRLILATLLFKFDLE

LCEESRNWADQKSFALWIKTPLMMRAKPVATHTRLNI*

 

>CYP65S4 Fusarium verticillioides

94% to CYP65S4 Fusarium oxysporum

FVEG_14141

MGVLYTEALAELSFGSVFALLGISLFLYLVVSSTYHAFFHPLAKVPGPK

LHAITQVPYLYYLSKGDWVFHLAKLHERYGPAVRFTPKDVSFITAEASKKI

YGHKAAGQKSFEKDFRMYRQNRPCSSIVRSDQEDHRRMRRLLAHAFSSKAL

RGQGDVVDHYVELFMKGLTERAQRGEEIDIVAWYNFASFDLIAHLALGQ

PFGCLENGKYHPWVSRVFKGLKVLSYTQIYVRLGLQNWISWLSPPSLRKS

YEEHMQFAEHAALARIESNDTESQDFMSYVLRHNDEKGMSQLEIIENSGV

MIIAGSETTATLLSGTTYFLLKNPDKLEKLTNEIRSAFSSEEEITVTQVDQ

LKYMLAVFNEGFRMYPPVAIGLSRLSPTGGEFIDGYWIPENTAVSMPHW

PAYYSELNFRDPKKFVPERWLDDPRYASDNRAILSPFSLGPRDCIGKNLAY

TEMRLLLARMLWKFDLEAVPTEKNWYDQKIFFLWEKGALPIKLKEVVREKV*

 

>CYP65AH1  Gibberella moniliformis (also Fusarium verticillioides)

          AF155773.4

          fumonisin biosynthetic gene cluster,

          FUM2

          47% to 65L1, 45% to CYP65R1

also Fusarium verticillioides FVEG_00323

MYQITAICDARWWLCLAFTCMAMLALFSFGVVMYNIFFHRASKF

PGPTIAGATSFRYHWAMSTGNVAPWLREQHARYGEVVRIAPDMISYVSPDAWKDIYAY

KPGEKEQNGIDWTIPSRDDDVPSMFSEPNDAEHNRVRRLFLPAFSDRALKQQEPLLSK

YSDQLVHLIRRGIDDNRDQEFDAVKLYNFTTFDIMGDLTFGEPLGLLKNSSYSEWVQN

LFRDIKTAGIFLFIFDFPPLPWLVKKFSPPSIQRAHEIHKQHTVDRVNRRLEKGLDRP

DIWNLVLSQPEGRGLTHPQMHANADIFMIAGTETTATLLSGLTYLLLKNPEKLQRLVE

EIRGSFGSIEELTVENLARLPYLSACLSEGLRCYPPVPIGPSRVTPKTGGQVLGERVP

GRVRLTIPQCAAYYSDLNFKDPYSFIPERWLPGTGYESDRKGILQPFLIGPRNCIGQN

LAYHEMRLILCKLLWHYDIELCPDKGNWLLDQKMYIFWEKRPLMVKFTKARK

 

>CYP65AW1 Fusarium verticillioides

90% to CYP65AW1 Fusarium oxysporum = ortholog

FVEG_14125

MSRLLAPLVEFRSASFFISILFAS (0)

LLLYLVGKIIYNVFFHPLRKFPGPILWSMTQIPFSLA

WTSGAGHKKIYDLHQIYGDIVRVAPNELSFGYPEAWEDVMGHRKRGQAENG

KDPDFWRGNDIYTLVGSDRERHSRLRKILSHGFSAQAMMEQQPVFQRYVNTMMKKM

REASSGGQPVEMTQWLNWATFDMAGDLIFGESFGCLEKAQYHPW

VKLLYKHIDGFAISTALIRYPFADTIIKLMTPKHVAKDIKAHSDFTKAQV

GKRMAYENPRPDFMESMIRAYEKGQVNHAELLANAHNLIIGGSETTATTL

AGTIYLLATHRPILTKLYAELKERFQTEEEIEFLSVQRLEYMFAVLHEGLR

IYPAVPAAIPRKTSEAAMIGNHYVPAN (0)

TIVSIWPWPMFHNPKFFKDAESFVPERWLGDPKYEDDKRVAVQPFSVGPRNCIG

KNLAYAEMRLILAKLIWKFDIDIDPRSEGWLEKNTAFLLWEKPDLWVRLTPRSDL*

 

>CYP65AX1 Fusarium verticillioides

94% to CYP65AX1 Fusarium oxysporum

FVEG_12501

MLSVSILAGGVAATAVLCIGYVVYNIFLHPLRNFPGPLLCRASPLYRHYKF

LRGELLFETERLHKQYGPVVRIRPNELSFIDPEAWRDIYVAHGGSARLG

DFARYDRFYQWAGPSAPETFVSLDRPYHDSMKRQLSPAFSERSLQFQEPI

IQGYTDTLIRKLTEASKDGKPVNLREWFNHYTFDIIGNLGFGSDFGGLES

EQYHPWVKAVSQNVREFAIMQVLMYLGLQRIVHVLSGSSLLRGKILHEHLT

REKVEARIKVEKPRLDIFQPLLDRKPPLTFAQLMENATILITAGSESSV

TLLVAAVSLLTDNPAKLQKLSEEVRSTFKNEEDITIVSVNQLPYLAACLNE

ALRCFPAVPPALPRVVPHGGAVIAGHAVPENTVVAVASWATNHSERHFN

KALEYHPERFMKDPEFSEDRFDTFQPFGLGHGNCPGRNLAWAETRLALARL

VYNFDIESVPEGRGWTTKQKAYMLWDKQPFWAVLKAIR*

 

>CYP68J3 Fusarium verticillioides

95% to CYP68J3 Fusarium oxysporum = ortholog, 60% to CYP68J4

FVEG_09038

MASYLDLLLGNPQYAVFCGVTLFTLFVVRYSLLGHLTKFPVLNPKRSLELTSNRVTQ

DFIIDSKNILTNGRALYKDQPYRAYTDWGKVVVIPPQFLDALK

SHKQLDFTIPAEDDSHAYVPGFEPFVSDPNISKVVTKYLTKSLTKLTAPLSNEASLA

FRQVLTDSTEWHEMHPQHDIVRIVSRMSSRVFMGESLCRDDEW

VRASGDYTVQSFKTGDILRTYPRWSRPFVHWFLPSCWTLRKKLDEAIRCLKPHLERR

SVISAEAEAQGKPSPFDDSIEWYKKEGSTRNPALLQISLSLVA

IHTTSDLLMETLFNIAQHPELFQPLREEITNVLSAEGLKKTALYNLKLMDSVIKESQR

LRPVLLGSFRRQAMADITLPNGDLIKKGEKIVCDTTHMWNGD

YYEEAAKFDGYRFLRMREASEQDKHPHLVSTSFDHLGFGHGNHACPGRFFAANEIK

IALCHMLLKYDWKLADGVVPKPSGFGMMYLPDLQAKLLIRRRNE

ELDIDSIETQ*

 

>CYP68J4 Fusarium verticillioides

83% to CYP68J4 Fusarium oxysporum probable ortholog

FVEG_13755

MSAYIDTILQNPQYAVLSAISLITILVVNFSFLTKDEKYPFLIPKKPLELSDRR

VVKEFLANSKSLLANSRKVYKDQPYRAYTEIGKLLVIPPSWVEALK

SNRQLDFLMPTKDDAHQYIPGFDPFGFDPKMPTVINKYITKALTRVTGPVS

EESALAIRDCLTDSKEWHGVKPQEDLIRIVSRVSSRIFMGEELCRDEEW

TRVSSEYTLMSFGYGHILRTYPRWLRPYIHWFLPQCWAIRAKVNEARQC

LKPHIDRRNAIKQKALAEGKPCPFDDSLEWFEREYEKHDPAKEQIAVSIVA

YHTTSDLLAETLLNLCQHPELFQELREEIITVLTAEGGLTKGAMYNLKLMD

SVVKESQRLRPILLGAFRRTATADVTLPNGDMLKKGEKIIGNMSHMWDS

DTYDNALTFDPYRFVKMRQTGDDRKAHLVSTSTEHLGFGHGIHACPGRFF

AANEIKILLCHLLLKYDWKLPEGCKPQPYFSGFKLLGDFSSDILVRRRTEELDIDSLSQS*

 

>CYP504A14 partial Gibberella moniliformis cDNA DR661198 87% to 504A3

MSDQVIYLAIIIGLYMLYK  LANSTDQPKIKGIPEIPGVPLFGNLIQLGTDHARVA

QKWAKKYGPVFQTRLGTKRVIYVNSYEAVKHFWITHQSALISRPMFHTFHSVVSSSQGFT

IGTSPWDESCKNRRKAAATALNRPAVQSYMPILDLESLVSIEELLNDCKDGSKDLDPSPY

FARFALNTSLTLNYGFRIDGDVNSELLHEITYVEREISNFRSTSNNWQDYVPLLRLWGAQ

NSSAEEFRVRRDKYLSDLLANLKSRIDNGTDKPCITGNILKDPTAKLNDAEIQSICLTMV

SAGLDTV

 

>CYP504A20P Fusarium verticillioides

96% to CYP504A20 Fusarium oxysporum = ortholog with 3 frameshifts

FVEG_08703

MSDQVIYLAIIIGLYMLYKLANSTDQPKIKGIPEIPGVPLFGNLIQLGTD

HARVAQKWAKKYGPVFQTRLGTKRVIYVNSYEAVKHFWITHQSARISRST

FHTFQSVVSSSQVFTIGTSPLDESCKNRRKAAATALNRPAVQSYMPILDLESL

VSIEELLNDCKDGS &

KDLDSS &

PYFVRIALNTSLTL &

NYGFRIDGDVNSE

LLHEITYVEREISNFRSTSNNWQDYVPLLRLWGAQNSSAEEFRVRRD

KYLSDLLANLKSRIDNGTDKPCITGNILKDPTAKLNDAEIKSICLTMVS

AGLDTVPGNVIMGIAYLATEHGQKIQAKALKEIYKVYPNGEAWERCLVEEK

VPYVTALVKEILRFWTVIPICLPRESIKDIPYQGTVIPAGTKFFMNAYAA

DYDESRFANPYEFNPERYIDDKEVGTPHYAYGAGSRMCAGSHLANRELYT

AFIRLITAFEILPPKDKKDFPVMDCIECNANPTSLTTDPKPFKVGFKPRD

EAKAREWIAAGEERTQDIR*

 

>CYP504B10 Fusarium verticillioides

98% to CYP504B10 Fusarium oxysporum = ortholog

FVEG_04417

MTIANLLVSLNNQVHENKGQSLLVTLLIGPLIYILINELIRHNARISNLKGPSGLPLIGNIWDIHI

NAAEKYRAWAKKYGPVYQIQLGNIPIVVVNSAAA

ARSIFGANAQALSSRPEFYTFHKVLSDTAGTTIGTSPYSDSLK

RRRKGAASALNRPSVATYVDHLDIETRDFVRELYEYGKGGNIPVDPMPMIQRLSLSL

ALTLNWGIRLKSQKDDLFSE

ITHVEEEISRFRSTTGNLQDYIPLLRLNPFNMHSAKAKEMRNRRDKYLTDLNNGL

DERIANGTYKPCIQANVIMDKEAKLNKDELTSISLTMLSGGLDTV

TTQVAWFVAYLSQHPEIQEKAVSEIRKFYSEKQPMCDEQDDQKCEYIVALVKESLR

YYTVLRLALPRASIRDIVYEGVTIPKGTVVFLNAWACNMDDQVW

SDPEVFRPERWFEQPDAPLFTYGVGYRMCAGSLLANRELYLVYMRLLNSLKIEKSDE

VDCHPITGSLDPTSLVALPRRYKAIFKPRNPEALQKALAVEN*

 

>CYP505A1 Fusarium verticillioides

98% to CYP505A1 Fusarium oxysporum CYP505

FVEG_07269

MAESVPIPEPPGYPLIGNLGEFTSNPLSDLNRLADTYGPIFRLRLGAKAPI

FVSSNSLINEVCDEKRFKKTLKSVLSQVREGVHDGLFTAFEDEPNWGKA

HRILVPAFGPLSIRGMFPEMHDIATQLCMKFARHGPRTPIDASDNFTRLAL

DTLALCAMDFRFNSYYKEELHPFIEAMGDFLTESGNRNRRPPFAPNFLY

RAANEKFYNDIALMKSVADEVVAARKASPSDRKDLLAAMLNGVDPQTGEKL

SDENITNQLITFLIAGHETTSGTLSFAMYQLLKNPEAYSKVQKEVDEVV

GRGPVLVEHLTKLPYISAVLRETLRINSPISAFGLEAIDDTFLGGKYLVKK

GEIVTALLSRGHVDPAVYGSDADKFIPERMLDDEFARLNKEYPNCWKPF

GNGKRACIGRPFAWQESLLAMVVLFQNFNFTMTDPNYALEIQQTLTIKPVH

FYINATLRHGMTPTELEHVLAGSGGTSSSNHNIKSAANSDVKAGSGKPM

AIFYGSNSGTCEALANRLASDAPSHGFSATTVGPLDQAKQSLPEDRPVVIV

TASYEGQPPSNAAHFIKWMEDLDGNEMEKVSYAVFACGHHDWVETFHRI

PKLVDSTLEKRGGTRLVPMGSADAATSDMFSDFEAWEDTVLWPGLKEKYKI

SDEESGGQKGLLVEVSTPRKTSLRQDVEEALVVAEKTLTKSGPAKKHIE

IQLPSAMTYKAGDYLAILPLNPKSTVARVFRRFSLAWDSFLKIQSEGPTTL

PTNVAISAFDVFSAYVELSQPATKRNILALAEATEDKATIQELERLAGD

AYQAEISPKRVSVLDLLEKFPAVALPISSYLAMLPPMRVRQYSISSSPFAD

PSKLTLTYSLLDAPSLSGQGRHVGVATNFLSQLTAGDKLHVSVRASSEA

FHLPSDAEKTPIICVAAGTGLAPFRGFIQERAAMLAAGRTLAPALLFFGCR

NPEVDDLYAEEFERWEKMGAVDVRRAYSRAADKSEGCKYVQDRVYHDRA

DVFKVWDQGAKVFICGSREIGKAVEDVCVRLAIEKAQQNGKDVTEEMARAW

FERSRNERFATDVFD*

 

>CYP505B1 AF155773 Gibberella moniliformis fumonisin biosynthetic gene cluster

also Fusarium verticillioides FVEG_00317

MSATALFTRRSVSTSNPELRPIPGPKPLPLLGNLFDFDFDNLTK

SLGELGKIHGPIYSITFGASTEIMVTSREIAQELCDETRFCKLPGGALDVMKAVVGDG

LFTAETSNPKWAIAHRIITPLFGAMRIRGMFDDMKDICEQMCLRWARFGPDEPLNVCD

NMTKLTLDTIALCTIDYRFNSFYRENGAAHPFAEAVVDVMTESFDQSNLPDFVNNYVR

FRAMAKFKRQAAELRRQTEELIAARRQNPVDRDDLLNAMLSAKDPKTGEGLSPESIVD

NLLTFLIAGHETTSSLLSFCFYYLLENPHVLRRVQQEVDTVVGSDTITVDHLSSMPYL

EAVLRETLRLRDPGPGFYVKPLKDEVVAGKYAVNKDQPLFIVFDSVHRDQSTYGADAD

EFRPERMLKDGFDKLPPCAWKPFGNGVRACVGRPFAMQQAILAVAMVLHKFDLVKDES

YTLKYHVTMTVRPVGFTMKVRLRQGQRATDLAMGLHRGHSQEASAAASPSRASLKRLS

SDVNGDDTDHKSQIAVLYASNSGSCEALAYRLAAEATERGFGIRAVDVVNNAIDRIPV

GSPVILITASYNGEPADDAQEFVPWLKSLESGRLNGVKFAVFGNGHRDWANTLFAVPR

LIDSELARCGAERVSLMGVSDTCDSSDPFSDFERWIDEKLFPELETPHGPGGVKNGDR

AVPRQELQVSLGQPPRITMRKGYVRAIVTEARSLSSPGVPEKRHLELLLPKDFNYKAG

DHVYILPRNSPRDVVRALSYFGLGEDTLITIRNTARKLSLGLPLDTPITATDLLGAYV

ELGRTASLKNLWTLVDAAGHGSRAALLSLTEPERFRAEVQDRHVSILDLLERFPDIDL

SLSCFLPMLAQIRPRAYSFSSAPDWKPGHATLTYTVVDFATPATQGINGSSKSKAVGD

GTAVVQRQGLASSYLSSLGPGTSLYVSLHRASPYFCLQKSTSLPVIMVGAGTGLAPFR

AFLQERRMAAEGAKQRFGPALLFFGCRGPRLDSLYSVELEAYETIGLVQVRRAYSRDP

SAQDAQGCKYVTDRLGKCRDEVARLWMDGAQVLVCGGKKMANDVLEVLGPMLLEIDQK

RGETTAKTVVEWRARLDKSRYVEEVYV

 

>CYP505G2P Fusarium verticillioides

53% to CYP505G1, pseudogene, possible orthoog of CYP505G1 Fusarium oxysporum

FVEG_11770

MSKQIPNPKGYPFIGNVLDVNPDHPQESLAQISESYGPIFRLYLPAERIFVANY

ALAKDLFDEARFEKAVIGPLEQVRNATKDGLFTAYPGEHNWEVAHR

TLMPAFGPLSIQNMFG (small deletion here about 26 aa)

DFTKLTLDSIAL (2)

CAMGERFNSFYHDDNHPFVGAMNNMLVESFARSRRPAFASAVMKASNA

RYESDIAELENISRELLEARRQNP

VDKKDLLNAMINGRDPKTGEGLGDDAIIRNMITFLIAGHETTSGLLSFLF

YLLLETPSALRRAVEEVDRVLGSQLITVAHLAKLPYIDACLKETLRLYPT

APGFTLRAKGDQVLNNEYTIKDKECVTILLARLHRDPDVYGPDAEDFDP

SRMLPDKFNKLPANTWK (0)

PFGHGVRACIGRPFAIQEAILATATILQTFHITKDNPSYQLQIRTA

LTIKPQGFKIRAKLRNPSFLEGAELGHGSGSGNAASSKTPSKAHAAKQE

GNSEPISIFFGSNTGTCEALAQSVASSAEENGYAPKVDSLDNAISSLKPNV

PVVVITGSYEGQPPDNAAHFVEWLASLSSGELSKVPYAVFGVGN (1)

EEWHNTYQRIPSLIDEQLEKAGATRLVSRAAIDVAKTNCLETIEEWQESELW

PALQKNSGKSSRTASGGARELKLDY&VLG &

LRQSLLRQDVMTAQVSRDAAADQAWAA*ESVTWYRLPSETT*PGCDYLAVLPLN

HPDVVHRVMRRFHLPWDTTVCIDGSKSTSLPTGKPFSVQNLLAGMLELGQPVTE

RQALQLTETIPDKTKSDELKERVKQGNLSKLNTTLLDLLEDYPSAT

YSFGQYLAALPALHLRQYSISSSPVASASPSECSLTYSVIDAPAKGNSQGHRYLG

ASTYLERLQPGDHIQVGVRPSRSGFHLPAESKTPIVMACAGTGL

APFYGFVAERAVKKSQGLTVGTAQLFYGCNGPDEDDLYRGQFDEWERDGVVKVYRA

YTFAPEKSENCKFVQDRMWFDRQDIVTSFREGAQFYICGAGIVG

SSIQKVLAKIRAEAADCDQESASVWLDSMKGERYWADVFA

 

>CYP505H1 Fusarium verticillioides

94% to CYP505H1 Fusarium oxysporum = ortholog

FVEG_12598

MAAKQKSKKHDEKHKGQIPGPKGLPVIGNLLDIDVTNSLQSIIDMAKDY

PKLFALNVGGNTEIMICSRDLMDELADESRFHKLVVGGVEKLRPLAGDGLF

SAQHNNQEWAIAHRILMPLFGPLTIREMLPDMRDISEQLCLKWARLGSSA

TIDVANDFTRLTLDTIALCTMGFRFNSFYSNEKMHPFVESMVAALVDADK

QSMLPDVVQSFRLRAQSHFKKNAAVMKTTCHDILDQRRKNPVEGKDLLNA

MMSGKDPKTGMGMSDGNIVDNLITFLVAGHETTSGLLSFAFYYLLENPEK

LQKAREEVDEVLGDDAITADHLPKMPYINMIFRETLRLMPTAPGFYVTPF

KDEVIGGQYNVSAGDPLFLFLHMIHRDPEVWGPDAEEFRPERMADEHFNK

LPKNAWKPFGNGMRGCIGREFAWQEAQIVTIMLLQNFDMVKADPNYQLK

IKQSLTIKPDGFNMKVKLREGRDLTNLFKNPSMASSKQPSLSSRKNLNISQ

KDLKPISIFYGSNTGTCEALAERLSADCATFGFMPSKPLPLDDATRNMS

KEGPNIILAASYDGKPSDNATEFMKWAEALQPGELEGTQFAVFGCGHKDWV

STLYRIPKVLDKCLADAGADRLVDIGLTDASTGRLYPDFDDWAHSKLFP

ELASRHGITLDHEPDSLELSVTVNQSQRNDIGGNFQRAEVVENTLLTSPGV

PRKYSLLLKLPKDMAYTPGDHVLILPKNPPQLVERVMTCFGVDDDTVLTV

SSQRPTFLPTGTPILASSLFSTLVELSQTVSRTSLKRLVDFAGNEETKAE

IQSLAGDRYDVEIDEQRMSILDILRKYPSINMPLSTFLSMLPQMRPRTYS

FASTPEWKPGHGSLLFSVVEATEASGSSLARPGGLATNYMAQLRPGDSVL

VEPRPCRVELRTAMTTELNVPIVMIAVGAGLAPFLGFMQKRYLQKNSGQL

SNSSSTLFFGCRGAKMDDICRDTLDEYSRAGVVTIHRAFSRDWDSPHKYV

QHLVAKHADTLARLWGQGAIVMVCSGKKVSDDVFDVLGPILHSEDRRLNT

TRASDWKTWREGVSKERLILEVFG*

 

>CYP506A1P Gibberella moniliformis 7600

AAIM01003201.1 cont2.3201, whole genome shotgun

Note this seq has only 1 aa diff to 506A2 at 10017, but then a large gap

Like a pseudogene

77% to 506A2

also = Fusarium verticillioides FVEG_09850

10017  DMQIEYTHFGGPAEYVIHAIKANLTGSL (1)

       FHDKVLR

10311  LIATNNARVFQGTTASLDEEWLAASTGYVLACFDCIRALKQWHPYLRPLVYRFIPERAAI  10490

10491  KDQWAKGRKRVMASMRERQEKGGNLEDPPTMLDHLSNGRNEHIRDDVELQLLHQMTLI  10664

10665  AVGTVTTFSSTTQAIYDLVAHPEYIPILREEVESVPRDENGNFTKESTVAMDKLDSFLKE  10844

10845  SQRFNSPDL (1)

       TTFQRAAIADMTLPDGTFVPKGTKLEINTCSIHK  11024

11025  DHELYENPEEFNGLRFHEWRKEPGKEKKYMYSSSGTDDLSWGFGRHACPGRYLSAINI  11198

11199  KLIMAELLINYDIKLPDGVSRPENIEFEVLV  11291

       SLNEMVLGSVADVGSAPLNRISRSFSRIGIIRWNGVCLVR*

 

>CYP511A2P Fusarium verticillioides

78% to CYP511A2P Fusarium oxysporum

FVEG_03770, probable ortholog to CYP511A2P Fusarium oxysporum

WSPTSTSW

NIISCTTLAFGAFAFYWLCLVFYRLFLHPLRNVPGPKIAAATSWYEFYQDVILDGHYIKD

YPKLHEIY (1)

GPIVQMSPNRVHINDPKLLPQ (0)

GVFYGTKFLREPAMFRFAGELDALPFIMDPAAHRVRR

(large deletion here about 140aa)

GRQTVFDAILDAEPDHSTKGLVDVAFSLVIGGTETTVTTITYGVWCILKNPNVEKKMLEELRTVETNSDGLVEYPNLMNLPYLTAVIHKT

LRISSPAPGILTRLVSSGGTKYGSHFLPADTSVSTAQRLIHYDPVLFPEPETFMPERWLDNSDKASKKNLIPFGKGPRMCVGLNLSYMQAYVFLGNLIRR

FDLSLQDKDQGILRWKDCIALHIEDDVLIKVNGLR*

 

>CYP526E3 Fusarium verticillioides

92% to CYP526E3 Fusarium oxysporum = ortholog

70% to CYP526E1 Fusarium graminearum

FVEG_13054 revised

MLSRLIELSERAPKDFTLALGFSILGALYLLRRWLLPKPIPGIP

YNENAVKSFMGDIPEFRDAPNRREWWAQQPARHQSPIVQVF

MRPFGAPWVFVADYFESSDICMRRLKEFDRSDVTWEQFNGVVPGHHITLKSS

DPKFKKNKELIRDLMAPTFLQQASAPEIYDKFSVLLKLWDRKLDLSGG

RPFDIAQDIHNSALDIILGASFGIDSGDGQIGRQLEELKARNVSGGEDDL

FEFEDVSIDEEQSCFTTLADSVGLSMRSPLPTIHHFLYRNLSPKMR RARA

GRDRLRDREIAKSIERRESGQPQRCALDNMLAREDAIAEKEGRKPNYRSQ

TIMSELMGYLVAGHETTSAVLRWGMKYLTANQRVQSLLREAIGNAHSQAT

KDNRIPTAEEILKAHIPYLDAVIEEMLRHSRVAPVTLRQATTDTQILGRF

IPKGTTVGFLGNGPGLVMPSIPVSPEKRSEAALAHMERTQLFDDEDLAQF

VPERWLTSNVNDKGEEETVFDPQKRPAQAFGLGPRGCFGKKLAYIEIKIF

ITLFFWVFKLEPIKPELATEDEMLALTRSPKNVYVKLAKV*

 

>CYP526F3 Fusarium verticilloides

93% to CYP526F3 Fusarium oxysporum

no gene model

MSLLDALDSSSTRILLGCLLLAGIAYTLYRSMLPRPLADIPYNVSATNRILGDLPDVKAF

GSLTDWLATQAVQHQSPLFQAFIRPFGKPWVVVADHYEAAEICTHRVKEFDRGTSSTAIF

HCVVPRAHITLTSSDPQFRKNKELVRNLMTPSFLSE (0

VSAPEIYDKFSRLIELWGMKTEYANGQFFSASKDVHNAALDIIVCAAFGLDTQHTQLV

KEIQELTPDNDTTSSKTDGEVAFKELPLNEELNALATVAESVAKIIKTPSPPLFHWIYRT

FSAKLKNAFVLTKQLQDREIANGIKRRANGEAMKCALDEISVREEALAKKEGRAPDYYSQVITSE (0)

LMTYLIGGHETTSSAVRWGLSYLSVEQRAQSELRNALQQAYPQAKLERRPPSLSE

ILQTRVPYLDAAIEEILRLSYPFGMTLREVQVDTQILGARVPKGTTVVFLSNGPSILSPP

IDFDDSRSSEWVKSRKPRPLEKDYDYSSFKPERWLKTASGLDGKEEVSFDSQAFPIQAFG

LGPRGCFGRRMSYLEMKIFFTLVIWTFELLPLPGDVAKPKPVSSLTRNPDRVFIKPRKVVL

 

>CYP526G1 Fusarium verticilloides

78% to CYP526-un1 Fusarium oxysporum, 40% to 526E2

FVEG_11760

MSFILYLSSMSWIELSAGGLSIVLLLFCLYNLALPKPIPGIPYNKNATKRLLGDLPDLIEYQ

KKNGQQRKWFRLQNQKLNSAISQVFVRPFGKPRIVLTDFREMHDILGKRFKEFDRSDRAREA

FAGIIPHQMLSMQTVDPRFKKHRELMKDLMTPKFLHQVR (0)

NSAPEINRKVNTLVKLWHEKCVHANELPFDGKRDIQRATLDVITATSFGLDDENSATKRQLDDM

LARSNAGVKFTQPGKKVVDFPIHPLTKELDATLTIVESSAVGFSSPMPRWHYWILSQFPY

LKNAARIREEWTRREIDKAVAAIPKDGSENTLAMRSALEFMVLREAAAAQKAGRPPRFHR

RRIYDE (0)

LFGFIIAGHDTTAATLEWGVRYIADAPHAQAKLRSALQNAFSTALAEHRQPTIDEITSTS

IPYLDAVIEETLRHSVVLPIVSRVAMKDTTILGHAIPKGTFVFFILNGPSLMKPAIEVPE

TARSEASQGTKNRYGEWRADDIEKFLPERWIDVDDKGVETFNALKGPFMTFGSGPRGCYG

RRLAYLQLRIFWVLLIWNFEFLPIDPELRTQDVVEHVGVEPCQSYVRLRKVAL*

 

>CYP527E2 Fusarium verticillioides

92% to CYP527E2 Fusarium oxysporum = ortholog

FVEG_11734 revised

MDFSYISDLSSSSGIGIAAFCLLSSWGFITTFLAWYRPSHVPGPWFAGL

SYIWIGRTAYSGKQHHVFVALDEKYGSLVRIGPEVLLTSDVELVKRMSATK

SSYGKSSWVDGVRFNPYHETMFAVRDPRQHDRAKARLAPAYSGRDTPNLE

GAVDQQVNNLISLIRRRYLSEPAAGVFRTLPLLNVLSYFTLDVISKVALG

TEFGCCTSDSDPYRFYEGLDEHMPLMALTSDVPWIRAIMYSTTFLKYFGP

RETDDHGIGPLMKVTNDNVRQRYSQDQTEKTDMLSSFKVHGLSEGNAQSE

TLFMFVAGSDTTASAIRMTLFYLMSSPRVYRKLKEEIRDAIRDGRASSPI

TAAQARELPYLQAVIYEGLRMRPVTTGQQAKEVPAGGDTINGYFIPGGTS

IAINFSAILGSKALFGPDADVFRPERFIGLSASDLAEMRRNVEMNFGHGRWMC

AGKPLAFMELQKVYFE (0)

LLRAFDFQLTEPLSPMRSESYALFRDFGLKVRATAAEDMEQLSE*

 

>CYP527F1 Fusarium verticillioides

89% to CYP527F1 Fusarium oxysporum = ortholog, one frameshift

FVEG_06713

MASPFLERGLVWLPYFIASLFTWLIVSSIVSWYRLRHIPGPFAGKFSYLWVAYITITGTQ

HDHLVNLNRRYGPIVRVGPNEVLVDDPDLVRRVSSTKNTYTKGNWYLGGKFNPYHDPMFQ

ITDPAQHDRLKSKLSPAYSGRDAPSLEAVVNRQVGNLIQLIKEKYISTQGDFRPM &

EGTRVSHLFTLDVISNLSLGREFGYLKADSDFHGIVKALNEHILIMTLATDIPWLRNLIF

SPMFLKLFGPTENDTKGIGPLMKVANTIVRDRYAPEADDQRDML (0)

GSFKRHGLRLEECQAESLFMFLAGSETTASVMRVILLYVIASPHIYQ

RLKQEMAEAISQGRASSPITDVDSRQLPYLQGVIYEGIRIR

PATTGMFFKDVPAGGETMHGKYIPPGTSIGINASALLRSEALFGPDPEVFRPERYLEVDKETSAQMKRDVEIVFGYGRWMCAGKPIAFMELNKVIFELLR

VFDFQLVEPGVAMKSESYMVFHDERLVLRVTETVHEQG

 

>CYP527F2 Fusarium verticillioides

90% to CYP527F2 Fusarium oxysporum = ortholog

FVEG_12563

MLLEHFTSNHWYAAALAIFTWYILSSIIAWYRLRHIPGPFLAKFSYLW

LARLALSGKQYETHLELNKKYGPIVRVGPYEVFTDDLELLRKINSTKSSYAK

GASYSGSRLNPWHESLFMMRDPVAHDKLKAKLIYGYSGKETAGPEAAIDE

QIMNLIHLIQDKYISKPKEFRPLVWSKTAGLFTLDVISRLALGQEFGCLK

RDEDIHCFFDTLNDYLPVVALTTDVPWLRNIAFSPFFLQLFGPSIKDKKG

IGKMMGLTNKVVEEFYHGDGQVKRDMLSSFKKHGLTKDECEIEAIFMFVA

GSDTTASVIRAGMLYILATPHVYSRLKREIANTIREGRASRPISNAESLS

QPYIQAVVYECLRIRSVSTNMSFKEVPAGGEFYNGAFLPAGTNIGVNFSG

LLRSETLFGKDAHIFRPERFIEVDDKTSAKMKRDVELTFGLGRWSCLGKP

IALMELNKIFFELFRHFDFQLAEPHQAMLFDSYMLFRDKGLVLRVTESDLEDL*

 

>CYP530A11 Fusarium verticillioides

96% to CYP530A11 Fusarium oxysporum = ortholog

FVEG_13927

MMLTVQLFWVAVAAIFVRLLFTGRRPKNYPPGPPTLPILGNIHL (0)

MPTKDAHLQFRKWADEYGPVYSLILGTKPFIVLSS AQAVKDLLDKKSALYSDRQEMYVGQILGS

GGLRLLMMGY

GPTWRSFRKLVHSLLNVTTAKSYVPYQDLENKQMLYEMIVQPDQFLHSIRRYSNAL

TTTMVFGWRSPIYRDPKLMQLFDGFAEFAEINQT

GI AALLDSFPVLRKLPDFLLPVQKKAKELHKKEKDLYLSHWLKAKQDIADGSIKPCFCVGLAE

AQEKEKFDDAQAAYISGTLLEAGSDTTSSTLYAFVQA

MLLYPEVQRKAQDEIDKVVGERMPNMEDEHSLQYVRACMKETLRWMPTTIL

GAVPHAVTQDDTYNGYLIPKGAGVLNNVWGIHMDPERHPNPRQFNPDRY

KDDFQSLADAAANPDAAKRDQFTFGAGRRICPGIHVAERSLFLGISRILW

AFNIKPTVNKNDKPVLPDPDKLTQGFVCMPEEFPARIIPRSEEKKALVIK

SWKAAEKDVLDPGTKQWR*

 

>CYP530A12 Fusarium verticillioides

53% to CYP530A3

FVEG_08430, not found in F. oxysporum genome

MSFSASVYLLIPVLILGLW

RLSTVGRRPAGYPPGPPTLPIIGNLHQIPNRKRHIQFQKWAEEYGPIYSLILGRKVMIVL

NSDQTVKDLVDKRGGIYSSRPESYIGQDVLSGGYRILFMVY (0)

VWKMARKLVHRILGVTAARSYIPYQDLESKAML (2)

NAVRFLKSSDDFVDHLRRYTASLTTQITFGSRTTSIQDERFKEAFD (0)

IFDRSSEMIGSR (0)

TAALLDLVPALRRIPDFLMPIKKEGRKIHYRELSLFRGFYLAAKKGLE

GGSAKPCVCVDLVKLQKEEGFSDTFASYLSGSLLQAGSETTASILIG

FVQAMVIFPDVAKTARGELDRVCGDRLPNLDDTPDLPYIHACMKESLR

WMPGFMLGIPHATTQHDSYLGYHIPKGATVIINVWAIHNDPKRHPSPRQFDP

MRYINDQQTSIEAANNPDPTKRDHYVFGAGRRRCQGMHIADRSLFLAI

SRLLWAFNFDRDVSAETGKAIIPDAEDVIEGIMSIPSPFPVRIVPRSTKRAE

AVAAAWSQAVDLLDEHGQWKVVPEDLLWTIPES*

 

>CYP531A3 Fusarium verticillioides

80% to CYP531A3P Fusarium oxysporum, probable ortholog to the pseudogene

FVEG_11028

MDNLSIFTAIALCAALIWWVISTLMSPLRQYPGPFLAKWTNVWRLYQVRSQKYQWTIQELHKKYGPV

VRIGPNLLDLDYPELIKTIYGTDNRWLKFYLNNSTIVGGKISHNIFGTTSPAEHTQMKKPMAKYYSS

SNVLTLESKMNQVIEELCKQIDDRFLKGTESFDLAEWFSLYTWDIIGFLTFSQSFGYMIKGHDFDET

IMASALSVEYFAQIGQVPFMDRLLNKNPIVRIGPPDMSHITHFAITQLQRRLEQRDQDIHLEEPDF

LDHFIDGMNRNPDSVDASLVLNFLLGNILAGADTTSIALRAIFDFLLQNPHAMAKLKAEILAEGFDD

DAVVPYSTARSLPYLDAVVRESLRMHPSVAMPLERYVPDTGLTLPDGSFVPPGVSVGLSPYIIGRNE

RVWGEDANEFRPERWLKTEDEDDEDYQRRLRKMNSADLTFGGGSRICIGRHIALIQIYKVVATLVSR

YEIQLADLNVRMKIISGWFPRQTGLFVKMHKR*

 

>CYP531A4 Fusarium verticillioides

83% to CYP531A2, 49% to CYP531A3P

FVEG_14002 revised, no ortholog in F. oxysporum

MPSIHSTSYLHTLVQRSDWKRISAAFVFVPVLSIATWWIVTYFTSPLRKYPGPRLA (1)

GWTNLWRLWTVRKGSYHIRIKELHDQYGPVVRIGPNTLDLDIPELINTLYGTDGKWKK (0)

TEFYHNNSAVINGKITYHLFSTTDQAEHARMKRPIVKYYSQSRVIGLEPL

FDGLISEFCDHLEQRFMSGPEPTGFDFGEWIGFYSWDANGAASFSQRFG

YMDKGYDYDNTISIADKALDYFAAVGQMPFLDFLLDKNPIMRIGPPNLANI

TRISLEHLISRLQGKDENFDPKVPDFLNHFIESKKTNPDLVNDGIIMGY

LLVNLLAGADTTAITIRAFFWYTLHSPSVYSKLEKEILAAGIDNVASFSS

ARALPYLEACVREAMRMHPGVCMLLERYVPESGLKLPDGSFVPQGTAVGI

NPYVAGRNKGVYGDDADSYRPERWLQNEGETEEEYNKRIRLYNAADLT

FGSGSRVCIGRHLAQLELYKIIATLINKYEISLVDPAAPWVVTGSWFPRQRGLDCYLKKRA*

 

>CYP531A5 Fusarium verticillioides

62% to CYP531A2 Nectria haematococca

62% to CYP531A4 Fusarium verticillioides

57% to CYP531A3P Fusarium oxysporum

FVEG_06505, no ortholog in F. oxysporum

MTLNVILLNYSLTTLLFGGITALLAAAIIWLVFSELTSPLRSYPGPF

LARWTNLWRLYQVQTQKYQWTIKDLHEKYGPVVRIGPNLLDLDHPELIKTIYS

TDGKWCKTEFYHNSSAVINGKITYHLFSTTDQAAHARLKRPIVKYYSM

SNILNLESHVDTVISDFCDHLETRFMDKQSQEKQFDFGQWIAF (1)

YTWDMISSATFSQRFGYMEKAYDFDGTIH

TADQVTDYFAMVGQMPFLDYLLDKNPIKRIGPPNLGNVTRISVEKMMSRVDK

LDEIDRKPAEELDFLDHFLNAMKKSPDLVDTSVITGYLQVNMLAGADT

TAITLRAIFNFLLENPRTMTRLKEELLSLDYDGTKEKIVSYKSARAVPY

DAVIRESMRMHPGVGMLLERYVPDTGLQLPDGSFVPGGTAVGLNPYVIGR

NKGIWGDDADEFRPERWLPKTGEGDEAFQQRLRQMNGADLTFGGGSRICIG

RNLALLEIYKVVATLVSRYEILSVPGQKMKIISTWFPRQSGLICQLRKR

 

>CYP531D5 Fusarium verticillioides

98% to CYP531D5 Fusarium oxysporum = ortholog

FVEG_03740

MDLSSFDLSYVLYVGVAFVVARIFYDLLFSPLRRIPGPLAAKYTDFYRAYLATKGNV

DGHMRAWHRRWGSAVRVGPNTISISDPDLIRVIYTTRNPWRKT

NMYRPNDVVVNGQRMQNIFNTADEDFHTKYTKPIRGFWTLPKMLEAEPI

MDETLCELITHLDNRFASTGYVCKMDEWVAYYAWDAAANISFGRNYGFMDQ

AADVENIIAESTAGLKYFTPVSQIPWLDEWLDKNPIWRIGPRPLVNGVLYT

IKILTEYQQQVASGAAKRKPVDLFIDKYNSLKETVDYVDDQQILNWLML

NVLAGGDSTAGAMRAPAYHLLKNPSVCEKMVAELRSANLTLPVPQWKEIS

QLPYFDAVMRESMRISPAVGLILEREVPKEGLELSDGRFIPAGTKVGINP

CVITRDVGVFGEDVDTFRPERWLRSKGESEQGHAQRVRRMHECTEMMFGHG

SRVCMGKHMSKLEMYKMFATLYVNFDVRITDPNHRWKYDNSWFMYHKDI

PCTISRRQMS*

 

>CYP532A8 Fusarium verticillioides

98% to CYP532A8 Fusarium oxysporum

FVEG_09894

MHSGLVETLLSALAQHWVLVLTSLTVAWLVKNRYHHGLNKYPGPFLASLTDWWRF

WDVYGQRPEVTLQKLHAKHGDIVRLGPNVLSFADPAVLKSIYGLS

KGYVKSDFYIVQQSVVKGHRLASLFSTTDNDFHSQFRRCVNSAFSMSALV

QYEPFVDNTTKLFLEQTEKLFAKRADVCDFTQWLQFYAFDVIGEITYSKR

HGFIEKNEDVEGIVAYLGKLFLYVAPVGQIPFLDLIFQKNPIYLKLSQWGL

FDSTIAVARFARARMAERLIPELKSVDSLPISNLKKQPLGQDLLSKFIA

ARESRPEFMTDTLVQTMAVSMAFAGSETTAITLSAVFYYLLRNPECYQKLK

NELDEAAKAGVFSDYETGLVTFAEAQKFPYLHACVQEAFRMHPAPGLPL

ERIVPPQGAEIGGEFIKGGTIVGVSAWIIHNRPEIFGNDTHVYRPERWLPDP

NLDAEEEDKRIKKMTGMMFQFGMGSRTCIGKNISLLEIYKVVPSLLRR

FEINFEDPSKEWRIINAWFVKQTDFNVKFTRRELVQPEFSEKQE*

 

>CYP532H3P Fusarium verticillioides

90% to CYP532H3 Fusarium oxysporum

no gene model, missing C-term

MILEHIVPQSFKAAVPWLTGIILTRLMYNKYGYGLSHVPGPWFAGFTDLWRLLIVRGRRA

QEVHIELHKKYGPAVRLGPQAVSIADTDALKVIYSPRAGWSK ()

FYLVQQALAKGKRLKAIFNTDNDSYHARL*RSVSNAYAMSTLVTFEPFVDSTSAEFIR

QLKLRFSGNTSNAGICDFGALLQFYAFDVIGELTF &

SKRLGFVEKGVDIDNIIRDLEGFLNYVSW (0)

IGQIPFLDKLLIKNPIKIWLVKYGFL ()

NSSAPVAEFARKHLVERQLEEASDVPKAPKDFLNRFKEAHNKDPDFITEQLVLELTVANMFAGSDTTG

 

>CYP532H4 Fusarium verticillioides

97% to CYP532H4 Fusarium oxysporum

FVEG_13640, AAIM02000185.1

MPCVSPVQQTINKSGKRLITLFTSQDERFHSQLRRSVSNAYAMSTLVQF

EPFVDSTTTEFFKQLDQRYANQNDILDFGTWLQYYAFDVIGELTYSKRLGF

VDHGKDVDNIIGNLEWLLNYAAPVGQLPILDSLLLKNPLRLQLTKWGFTNS

SSPVAIFARNRMLARVDPEKLGDMKFNQDNGRRDFLSRFLEANQKDPEF

MNNDRVLALTVANMFAGSDTTAITFRAIFYYLMKNPDDMKTLMSELAEEEK

AGRFTREDGLVSWNEVRDLPFLNAVVKEALRCHPAAGLMLERIVPARGL

EVNGHHIPGGTIVGVNAWVLHRNKDIFGHDADQWRPSRWIEASTEQKRRM

ENYMFAFGAGSRTCIGKNISLLEMYKMVPALLRRYE (0)

LEFPSADNTWHLNN (1)

AWFVKQSNFNVRLRRKHKVSFLADERQY*

 

>CYP534C3P Fusarium verticillioides

61% to CYP534C3P Fusarium oxysporum

no gene model

VFTLRVPYREGHEGFTSRRDVFLVESPGILFLVV*NADAIRKIFSRREHIPKCAPKHEKL

RQFSYDVFAAEGEIWRYKEMQYRVLSKIDTALLLRSLIQKAQVLVEM

GTGERDSGTITTLNQNRMRQTTNFIPFPGFGIY*ISPG*SLLSKADPKMTKYRYLRSI &

IATTIAAASTNILVLP & PEHTGL

TIVLLPFARTQIAGKSSREFG*YMEKLIDERIIEVRQSERTDDM &

LQFNC*SWQTTQVPQRSLRGAINEICGDGYPSLCDYENLINISMASMSGVCINDTP*MTY

ISAVFEIPVEVSPKQGQTITIDNKSHL

SKTFMPSCRNPRWWPGRLSLINGCKDDINEWVSELRHRKSRESIARSTGS

GRQPRNEEFGSPATSTHLFRPEVDSFI

PFSEGPRSRLGRRISEQGIIATLVVLIKEYFLELATDDWTSDEK

MNREARRK VYAKAQSSSNTK

 

>CYP537A6 Fusarium verticillioides

96% to CYP537A6 Fusarium oxysporum ortholog

FVEG_07101

MLGAAALLVVTHLIIRLTSATAKVPGPLISNFTSLVLKWHELNANRTVYIHELHKKYGTVVRIAPNEVSFTSIDALKEIY

GSGGSGYDKTEFYDLFQVYGKR (2)

TMFSTLVKGD (0)

HAKRRRMIGDRYANSNVMKQAPLAGIQERSKRFVERCVDSPDKTADVF (0)

LTKPALHAYACDCVTHQLFHPYGSNCLQNKDDEEMMHQVAADDSLQ (1)

NRLVQYYSPILHRLGSSILTSFAKPRLIPLADNFVIENAKEDGAADFTVLNRL

KEKDSVLDTIDMAAECLDHMAAGIDTTGDVLCFLMWELSLPRSIKYQRLLRQEFRSKPDA

NFDELPMLDAVLNEGLRCFPAIPMSLPRYVPHGGRVIDGFSLPQKTVVSCQALSVHRIND

HVFPEPDRFYPERWLEADGDADRRRHQWAFSSGGRGCIGKH (2)

LAMAEMKTLLRDVYSRYETEPDESMKCESMAMDDQLISSRPLGKRCLLK

FVPVKG*

 

>CYP537D2 Fusarium verticillioides

94% to CYP537D2 Fusarium oxysporum = ortholog

FVEG_08745

MAVLSISLFAGAAALIFIGVLIVRLRSPLASLPGPRLGLLTPWQLRYHELRGKRTQYVHQ

MHQKYGNAVRVAPNEVVFSSLDAMKEIYLSKGSGFDKTSFYNLFSQFGLRTMFSMLLKGP (0)

HSQRRRVIADRYANTNVNREDSLHGIQERSRNFITRCRDAPKQELDVY (0)

MFLHCYAFDCVTHHLFHPHGSDSILQASDEETLHEAVFDNSLVRK (2)

LLNYYHPTLGSVTGKLGLFGKSRGIPRATELVLNGVKKGGVA

DFTLVSRMQEEKFGMGIFDIASECMDHMLAGIETTGDALCFLMWQ

ISQPGYTFIQERLRDEFRANPDVPFDQLEYLEAVVKEGLRVFPSIPMSLPRCVPEGGATVDGHWIP

GGTIVSCQPYSMHRMDEEVFPRPDSFEPQRW

LEEKGSAERNRLFFAFSNGGRACIGRH (2)

LAIVEMKTLLRDIYSRYRTAPADGMTCDMSMDDQIFTSRPKDQKCIMKFIEWD*

 

>CYP539A7 Fusarium verticillioides

97% to CYP539A7 Fusarium oxysporum = ortholog

FVEG_01415

MGVVEALLEQISVKTAFIVLFIAYVVHSIICRIGEHRRIRRLGRYGPQLKTYAP

WSLDLVVRFVRSTVKHNNLASWRDGIFGPLNSWTAEARLLGVRTIF

TADPANLKAILATQFVDYGKGQPFHAEWKDFLGDSIFTTDGPSWHASRQLI

RPQFTRDRVSDLHCFEAHMQTLFKAIANRGPLQGEGQFVDMNNTDGKVL

DISDLFFRYTLDVATEFLLGWDVKSLTTPKQEFAEAFNEVQHIQNIIARVG

KLRHIIPKYRFWRGLNTVNHFINFYIERALRLSPEELASKTKDDHSYTF

LHALAGFTRDRTVLRDQIIAVLLAGRDTTAATLSWTLYELGRYPNAVKRL

RAEIISTLGTERTPTYEDLKSMSYLKAVLNETLRLYPAVPFNVRLALKDT

TLPRGGGPDGSEPLPVLKDSPVAYSTLVMQRRSDLYPPISDTFADPQIFS

PERWAHWHPKPHDYIPFNAGPRICIGQQFALTEMSYVLVRLFQKFDRVES

QMKDIDGGEPLLKADIVLSPGQGVKVAFWEAQD*

 

>CYP539H1 Fusarium verticillioides

50% to CYP539F1 Aspergillus fumigatus, not found in the F. oxysporum genome

FVEG_05544

MSDTVISLVDSSIYMLHAAIHHPYRLALYIIVIYFTRRILNRLLVPPP

ISVAPRIPTYLPFGIDFIVWSSYYNSTNQDLKLWSMIFRRYGRGTAPYTAEV

VLGGDRVIFTADHENIKAVLATKFSDYGKGPKFYHDWKEFLGDSIFATDGR

LWQDARGLIKPLFLRQRIEDLAVFEKHTVKLTRMLQGPEGQPIGVDVKD

LFFRFTLDVATDFLFGQAINSLDNPREQFAVAFAEIQRVQRLITVSGPL

QSFVSLKSYHSSLNTINKFMEVFISETLSLERDELEKLTKSDRGYTFLSAL

ALYTRDAKQIRDQLVAVLLAGRDTTAATLSWVLHELSGHPDMVRRLRQEIA

QHVKPGQNPSFAELKAMKYLQAILNETLRMYPAIPFNMRIALDDTSLPR

GGGSDGNQFISVKKDTIIAYTPLVMMRRNDLYPATYNNGDKFPDPNTFD

PERWLHPSVLHTAEKGADASETKASGVNNKEWSPRPWTYIPFNGGPRICLG

QQFALTEMGYTLVRIFQQFARVERRMEPDEMGILSANIVLTPKNGVRVAFFKEEED*

 

>CYP540B15 Fusarium verticillioides

99% to CYP540B15 Fusarium oxysporum = ortholog, only 3 aa diffs

FVEG_07621 revised

MATKRFHLMGEDPSTAQEIEIPTSLDEQGLQHLVASHFAIVDPS

GIGFVTESDALTTVADVLAADDISITIDGKAVREVPGPKGLPLVGNYFEV

YPDHLGNHQRLFEKYGPLFKTTNMGSTIYHTNDPKLANIVF

GETDFFSKRIIEGHPLFPIKNKEAGVFLGDTDTEEWKEVHKFLPPAL

GPKAVRHYAPTMQKTVEDAFKVFDELDERDEAWNVYPYMLKLGSQAVGKLVLG

MDFQHFTSPDARPHAMVMRIAQSLELNKKITSMGSWYKNLPFGDPQRLRDAR

AHMELMMKESVENASKGEGDLELQDAAVQAENMVDYVLRASDSKGNKL

SRERIMEPLVVATGAGFTTTSSLLSWLLYGLVAYPGMQERLLQEMVDNGF

DENTQITADLTNKLTFLDKYIKETQRRHNPSYQPARTASVDMILPGGYKL

PKDSIVIPALHHIHNNTKIWDNPALFDPDRWDTDRVKNRPNASYIPFATG

PRMCVGFNFALQEVKVFLPKLVYRYKFSLAQDGPVEYDPMFQLIRPNNLY

VRAERRIKWPSKSD*

 

>CYP540B16 Fusarium verticillioides

96% to CYP540B16

FVEG_13789

MSTKHFYLLGEAPSTAREIELPPAVDFEELQNIVASHFAIVKPNGVGFVHD

DKRLNAVSEVLDKDELIAVSVNGNAVRDVPGPAGIPYFGNYLEIYPDHL

GNHQRLFEKYGPLFVTNSMGNRLYQTNSAELSNIFLAEDHYFTKDIVPGHP

LHPIKNQEAGVFLADTDTEQWRLAHKFLPPALGPKAVRHYAPTMQRTVE

QSYKVFDELDEKGEAWNVYQYMLKLGSQAVGKLVLGMDFAHFEEVDAPL

HEMVLKIAENLELNKKVSSMGAWYAKMPFGDPKKVRDTTARIMEMMMESIA

RASKGKEDLELQDAALKAENVVDYFLRAKDNKGSKLPPSQFAPTLLVATAAG

FTTTSSLLSWLIYSLVKYPGNQERLLQELIDNDWDDDTQVTAETTNKL

SFLDKFIKETQRLHNPSFQPARTAKVDMILPGGYRLPKGAVVISALHHMH

NNKDVWENPGRFDPDRWDTEQVKNRPPGSYIPFATGPRMCVGFNFALQEI

KVFLPKLVYRYKFSLAQDGPIEYDPYFQLIRPNNLYIQAEKRVKWPPKSE*

 

>CYP542B3 Fusarium verticillioides

98% to CYP542B3 Fusarium oxysporum = ortholog

FVEG_02379

MASNTFMAVQETIAALTWQQTGCLLAGIWLIYVVQLVIWRLWLSPLAHIPGPKLAALTQYY

EFYYDFVLGGQYTYKIIDMHEQYGPIVRINPWEVHVGDPEFFSDLYTGPSRRRDKWTFYTQQ

SGAPRTRVPHPTALAGPKTATEGSLAAIDHSLHKLRRSALSPFHSTQTVRELQPVIEERVEALLGAF

LNYAEVSNGQPLDVMYPYSAFTNDVINEYAFARSDHLVE

KPDFGAEVTNDLLIGTHMGPCVQQLDWVLTLVNALPESISNRCMPGWGGFLKMKNDILEQI

HSVDPPQSSGKWMMDGGHPTMLSTKTRSVRDKTASRQTQ

ESQITVQGGTLTTSWAMSLATFHLLNRPETLRKLRDELFDAIPDAYETTPLSKLEKLPYLR

GVVKEALRLAIGTSSRLARVAPDEALVYHDRENDEEWNL

PPGSIVGMSPYKTVMDEKIFYDARGFHPERWVEDGERLDKYLDIFCSGSRICLGMALAHAE

LYLTLAKLFRRWGSGGVVYGSDDGDQRFGDVGYLSIFET

RVRDCEIDADYFMPIPYKGSEGFRFVFETY*

 

>CYP544A6 Fusarium verticillioides

94% to CYP544A6 Fusarium oxysporum = ortholog

FVEG_02317

MHYLSFVLGQPIVLSVTLLLFLYLLGKKSPKPTRNGKPLRKPPNSLPLVGNGIIFL

QPRQRLFSWFHRCERLYGYETLHITVPTLPPGVIINNPQNLEFI

FRHEGIFEKGDFFKQRSWDLFGHGIINVDGEFWRLQRKAGLRFLSTAALK

TLTSDRLPEYLEQAIHVLEGKEAGRDVVDLQAVVHEVTTQLMGRMAYNME

MHADDDFTVAFEHASGATAERFQNPLWFATEMFFGTRMRRSIRTVKAYGH

RIVQSAVADRKGMEGKTQSDAPGSLIQSLLDAIGDDDLVADAALNYLSAG

RDTVAQALTWTLYLLMKHPEVTNKLCQSIQDLRDEVSDRDRPEDDPELLT

PARLPYVLAVFYETLRLRPPIPFEIKQAQQETILPDGTFLPKGAVVLWCA

WAMGRSHTTWGPDADEFRPERWLTTSPSGDVTVMQRSAAEFPVFNGGPRVCLG

KKMAELVAVQTLARLLPLFDFRPAFEGERVSKSSLTLPMEGGLPVYVHARTTSET*

 

>CYP547B3 Fusarium verticillioides

95% to CYP547B3 Fusarium oxysporum = ortholog

FVEG_11844

MAVVSKLLGFPNLTLAAVIESFIAIKVFPDYYDSKSHLAAVFTILLVN

YAFGIVFWGFLYPVFFSPLRHIPGPRDYLSAAHRSIAVKDRPSGDLFVDIAN

RYPGEDLLTLNSFRTHIMVTNPLLLADLLVHNCYDFTKPKRISAFLRH

ILGDGLIIVEGEPHKFLRKNSTPVFHFRHIKELYPMMWEKSQSLARAIQQDM

TTSRSSVVELNSWASKVTLDIIGIAGLGRRFDAVEKKKDPLADIYEGLL

EPSREKLIFSGLALAVGLPFVRLIPWKMNQVFNYLTGTLNELCYPMIQEKK

TAILEKGDDHFDVLSLLIKSGNFSDEALKDQLLTFLAAG

HETTSSAITWACYLLTKHPQYQAKLREEVRNGLPEDLATNPTVDLAGILEQLPYLNGVIQETLR

LYPTVPLTMRQAIRDTRIGDQFIPEGTDIMVSIWYINRSEAIWGPDATDFKPERWITDDG

KPNQNGGASSNYNFLTFLHGPRSCIGQGFAKAELRCLLATMVRSFEWTLSMDDKLVMPRGVIT

IKPENGMYLDLKAL*

 

>CYP548A5 Gibberella moniliformis

DR630735 DR651021.1 DR621844.1 cDNA

90% to CYP548A4

also Fusarium verticillioides FVEG_04704

MTFNLTHLLVYLGLLVGGLVLYGFSIVVYRVFFHPLAKYPGPFIAKITDGYQLYHAWKGD

RHLEFWRMHQKYGPVVRFGPNSLCFNSNKALKEIYGFRTNVRKAEFYNAFVHPTANTHNT

RDKEVHARKRRVMSQAFSESAMKEMQRYILGNVRTFCEQIGMLEGSGEETKGWTKPRKMS

DWCNYLAMDILGDLCFGKAFHMLESPTNRFALGLVEAATTRHLLCGTMPIVNKLNL

DKILFPGLAAGRARYMGYSKGQLAERTKLGEETDRRDFFYYLLKARDPETGQGFSTPELW

SESNLLIIAGSDTTSTAMAATLFYLVRCPRALERVTEEIRS KFNDVEEICQGATLASCTY

LRACIDEAMRLSPSVGGILPREVLSGGITVEGRAIPEGTIIGVPHYTIHHNESYYPSPYE

YVPERWLVGALNPLTGEKTTEDEVALAASAYCPFSIGPRGCIGKGLAYVEMTNTLARTMY LYDMRKAIGIVDPAEGNPKNEWGRHRPSEMQLVDTFTSAKNGPMIEFRKASHIQA*

 

>CYP548E2 Gibberella moniliformis

AAIM01001130.1

76% to fgenesh1_pg.scaffold_5000761, 42% to 548A4, 39% to 548A3

also Fusarium verticillioides FVEG_03837

1931 MAIINSVTVFSSSQIFWGIVF

1994 LSFCYVAAVVVYRLYFHPLAKYPGPFWARISAVPAYYYTLRQDRHVWFWQLQEKY (1)2158

2221 GPTFRITPNSVLINTPTGLKTLFNNKANVKKAEYYKTYPRNVHVMTTWNTIDKAMHARKR  2400

2401 RVMNHAFSDKALRSCEPFIHSNIDRWIELLDQEIGEKKWSPSLNMARWADHLIFDTLGE  2577

2578 LCFGKSFGMKEHDSELRHIPTLMTDFMSTIHP (0) 2673

2725 IAYSPFAPLWA  2757

2758 WLKPRGLDFLLAAAAPPAFSKWQAFVEQCFTERVQVENNMRGLWEKGESRKDFFHYLFQA  2937

2938 VDPDTGKGYSKDELFGESESLIIAGSDTSAISLAAAFFYLSRYPHIQQKLAEE  3096

3097 VKSAFSTVDDIKGGPALYSCQYLRAVIDETLRMSPPVPADLSREVQEGGILVDGEY 3264

3265 IPEGMKVSTASYCMHHNPDIYPEPFKFRPERWIVDEKSECGVSPESVSLAESAFMPFSAG 3444

3445 PRGCVGKNLAYLEISLALAKTVYHFEIRRDFSSNLGGGSPNAIEGRRTVDQYQLRDIFVA 3624

3625 IRDGPMVQLAKRS* 3666

 

>CYP548J1 Gibberella moniliformis 7600 chromosome 11 cont3.130

26kb from a PKS

AAIM02000130 revised

Also Fusarium verticillioides, FVEG_10545

45% to CYP548H1, new subfamily in CYP548 CYP5115 may belong here too

41% to DR630735 DR651021.1 DR621844.1 Gibberella moniliformis cDNA

44% to XM_001273103.1 Aspergillus clavatus

43% to XM_001402423.1 Aspergillus niger

      MPMSHMKTHWLPYAIRISRSITPPPLLIILLLAALSP (0)

      VIGYVVYYAFFHPLAKYPGPFWGKFTGLRAAYHAWIGDVHIDMWKCHEKY

      GPYVRYSPNYLLMNTTQAYK

57293 DVYGHNKNVRKSLAYLAMVHKTPSTFTLMDRHEHAWKKRILSQKLSDSAIRSFEPKITGM 57114

57113 IDRFCQYVCPPASTGKENTVSKPFNMSEMC (1) 57024

56947 DYLFFDLVTSIVFGENFDLIRSPWYRHIPPALARSNERISVIVQWPYVVWRRMDKVLFRN 56768

56767 SVAGRKDFLRFAHNLVTERVQRGSGDDVLSGLLDAADPTTGNKLTQDEIVAESILML 56597

56596 VA ()

      GSDTSSTLLASLFFYLTRNPDKKDRLTREVRSKFSTREEICLG 56417

56416 PALNSCRFLYACIMECLRLTPPVAAAPFREVLKGGMIVDGHYVPEGTNVGTGLFSIQHNQ 56237

56236 EYFYSPFEFIPERWLSEGKNAGPHNPDAHVPFSIGPRVCLGRALAHAELSL 56084

56083 AMAIICWKMDFNVVESMKDIGAGNENAEYGRHRPGEFQLYDHITCARNGPMVEFRERSF* 55904

 

>CYP550B4 Fusarium verticillioides

93% to CYP550B4 Fusarium oxysporum

no gene model

MELSPIYKNALATLGSLPLAYKVLCAVLVIFAFSKAFSGAERNGYKKNLPKYAPIELAIA

SYILSGDGIGRRIF (2)

SALSRYGGSLFGLTSGHQIVVDLPGVERL

LAQSHHTFNSDPAQYSLCTLVFGSTDTPELRAKFDTSLKDLVPPLERTFLNDAASTANVE

KSRVAERGASLVTFSSNPKEMVRWELSAGIKVLQPETSHSPGKVEANLQSLTRDFGACMS

VPLIYGQDILDRNPRLLDDFWTFDNDLFPLLMVGVPKWAPFRMMQDGLKARSRIIDSLEA

VYRRVDQYEKGEPIDFGADMSDVSMMLRERNKIYNRDGWTFPERAAADLGTFWGLNANAQ

PVLFWFLLYVYSTPGLLKRIRDEISPYIILSDGDKPEIKSMDFPSLFRKCQLFKACIFET

YRLVNEPTSIRCITQPVSLNDGNHKHELQEGTYISVPLALKNKNSSIYEDPDTFIPNRFL

ETDPETGKATARYGKLKPWGLGAAMCKGRTFAEKEIISLGSAVISLWDISPAEGEWKLPA

MIPGTGVKRPVNDIRVVISRRSPFKS*

 

>CYP552B4 Fusarium verticillioides

92% to CYP552B4 Fusarium oxysporum = ortholog

FVEG_01613 revised

MADASWSVIHGALTSLTAQDWTVAFISCWFV

FKVLQALYNVSPLHPLSKIPGPKLAAATYLPEFYYDVILVGRYTHAIKQMHEKYGPIVRINPNE

LHCADMSFSDEIYAVGGRKRDKPFHQVNGSAAGTGNAFGTPDHDIHR

ARRAPVAKFFSRAMIARLEQEVHDLAQKLCNKLLAENKDEKDRKPFEIAHAYSCFTSDAISSYCF

GEAFGLLSRSQWQPNYREATLAVLKPVFFFRFFPI

LVSSVKLGKYFVNILPTDIALLIRTLQIDIPSRVQKTKNELDA

GIVYDRPTIFADLLQSELHDSEKKQDRLVEEAVTIVNAGTETTSWALAVITYFLLSQPETLAKLQ

DELKQVVDDPCHLPSWTTLEQLPYLGAV

INEGLRLSYGVSSRTARVPTAEDLVYRGEFNKKPTTLVLPRGYAIGMSAAIAHHDESVFPDSYTFA

PERWIDEDNKIRKDLEKSMIAFSKGSRGCLGKNL

ALCELYLSLAALVLRVMPCMRLYETTEKDVRYDHDMFVPMTESGSKGVRVIIES*

 

>CYP559C2 Fusarium verticillioides

95% to CYP559C2 Fusarium oxysporum ortholog

FVEG_04255

MTVLGDIFTEVTFTRVLLFGSLFLLVSFIVDLLTQPRYPSEIPVLGHSSE

KWFSRIRNSLAYFTQHQAWIGEGYEK (0)

YGKNGLPFIAPAPISRPPDVILPRSQIAWM

MDQPDRILSASHAHDKILYTEYNFLGKDLAAEPFANRVMHKYLARNLSSAIPAVEDEVNGAVEHALETMMKAAAEKDAKN

VDSEGYTKVNLWDLWLAIVPRVTNRLLVGNPACQNPDILKPM

VSFTDNVVMNSFLLHGFPQVLHPIIGRLITIPNYLHWRKASRVLLPIIEQ

RLKDMQRQEAGDPEMKNYTPPEDFITWDIRLAMAEKKP

FELNPIVISKRLLPINFAAIHTTVLTGQSWMLDFLSSPPSVLETLRDEILEHKPSVGHWTKQALSSLVRVDSSIRESQRL

SNFAANLIERQVIAPEGLHHPDYGWTLPRGAFVTVNLQGTHHDDEIYEDAMSYDPWRYSRVREEWEAKSAEEKQEREDEA

KKIRGLGMVTTSDAHLAFGHGRC (2)

GRFFVAHELKLIMAAFLLNYDIKALEKRPKPQWMGATIIPPLDACIEIRRKKST*

 

>CYP567B2 Fusarium verticillioides

81% to CYP567B2 Fusarium oxysporum probable ortholog

FVEG_12172

MAASFSIILGLSCLL (0)

GVIWFLNAIYRLFFHPLAKFPGPKLAAVSD (0)

LWYGLKWTSGRYPFIMEETHRKY (1)

GDVVRIAPNELSFATVQAYKDIYGHATKDKKKFIKGDWYETAGDHPGIVSVRDPAQHSRQRKYLSHAF

SAKSLRGQETVIHRYVDMFIGQLRKLGSPEGSGINVEEALNWLTFDIIG

DLAFGESFSAVAEGRPHFWVSMIIDAAYFKALSALRKRLPIINLYLPFVMSKDAGEMH

RKHMELTRQKMMKRLQMPNSEERGDFFSHLLSKGGNDVPEQELCQQSNTLIVAGSETTA

TCLTGIVYCLLSNRSCLEKLTDEVRSRFHSEDEITADATAELKYLPAVIEEGLRIFPPAPFGLPRISPGAVIDGHY

ISSGVVVSVDPWTTKHDGRYWKEPYSFIPERWIHESFSDVKQASQPFSLGPRSCLGINLAYLEMRIILAKMVYNFDWELVNNDVDLFRDAKLFLLWKKPA

LMVRFYPRT*

 

>CYP567F2 Fusarium verticillioides

92% to CYP567F2 Fusarium oxysporum = ortholog

FVEG_14083 revised

MILFNRKFERHNSEV

FVSWIIGVIIYRLYFHPLAKFPGPKIAACSE

FWFLRSWASGRYINYMGDLHRKYGDVVRTATNELSFRSPVALRDIYNHVSKDRPTFLKSD

TFYTVDPSIPRPDIVFTRDPQDHRLQRRSLAHAFSAKALRDNEESVQFHVKLLLERLGQN

AGPGTAGANMSEVFNWLTFDVI (1)

GDLTFGESFDSLNQWRPSEWVTWILGFISSLTFLPFINRFRISMTLAVSVMPSYLKQKIDMHT

TEKVKKRVAMGNSRDREDFFAYILRKESHNLDLVHLREQAKVLMIAGSETTANLLAATTYYLLKNPDKLANLQAEVRSVFSSRDEITGDAVAHLPYLNGV

IEEGLRIFPPVPFGPPRVCPGATIAGHYVPKGVVVSVDGFATTHDERNFIRPDEFLPERWIGKGFGDRKEASKPFSLGPRGCLGINLAYMEARVTMASLA

WKYDWELASQDLDWLASVRLHLIWQKPKLTVRYHPRDEVAAT*

 

>CYP570C5P Fusarium verticillioides

99% to CYP570C5 Fusarium oxysporum = ortholog, only 1 aa diff

both species have stop codons in the same place, both are in ther EXXR motif

FVEG_13512

MGLIHLDGRAAALVGVVFVLWYVVSTIRQWAHLRHFKGPAIAGFSQLWLISRVGGGRTYL

DLWETCKKY (1)

GDIVRVGPNDLI

TSDPDLMKHMLNVRTRYKRSSWYDAMRLDPTKDNVLSQRDDDLHASTRSKMAAA

YSGKEVDNIETTIDENVERLLDLLDTEYISKDIPFDFGYKAQYFTLDVISAL

AFGEAFGDLETDSDVNGYITAMEESMPTIITTTVMPWMIKLLQLPIFRSMLPSD

KDKAGVGRVMAIAKKVAAERFGPNPKVQRDMIGSFVSRGLLQHEVE

SEILMQILAGADTTATAIRATLLYIISNPRVVQAMRAEIDNSKLSHPIVTDAEAR

AMPYLQAVIKEGL*IHPPVVGLMSKEVPQGGDTFKGQYLPEGTKIGYCAWGIFRR

TDIWGEDSDEFRPERWLHSSVDSLRLMEGTLELVFGYGRWQCLGKNIALMELNKVFVE (0)

LIRRFDLAVVDPIKPWLSINVGVFLQSEYWIKGYERASLA*

 

>CYP570C7 Fusarium verticillioides

FVEG_09330

90% to CYP570C7 Fusarium oxysporum = ortholog

Note: possible mutation TGA to CGA at normal stop codon extends gene

Also one frameshift = & in first exon, possible pseudogene

MAEASFLDHMREIVGDVRPSIAIAGLVAIFVVLWSVLSTWQQYNRLREFKGPRLAA

LSKWWLIKKVGGGRAYLDFWE &

VTKQY (1)

GSIARVGPNDLLTDDPELIRHI

LNVRTEYRLSDWYDGMRFDPGNNNILPWRDEDEHFKLRSK

MSAGYRGREVEHLEPKIDKNILSFMKLLGKYADEKKPVDFGRRAQFFTLDVISDLAFGE

PLGFLETDSDVYKYIQITEEMLPAVMVTTIIPWLVKVLSSP

VFKSLLPSEKDRLGFEKLMGIAKQVTAERFGPDKKVQKDMLGSFIAHGLTQKEAESEILLQT

VAGSDTTATAIRLTMLHIITNPLVHPTLRAEISKTHFS

EPVIPDAIGRDLPYLQAVIKEGLRIFPPVAGLMSKQVPPPQGDTWKGKFIPDGTKIGYCAWG

IFRREDIWGSDAGEFRPERWLESKGEKLRERESALELI

FSYGRWQCLGRPVALMELNKVYVK ()

LLRRFNFTICDPTKPWTVFNCGIFSQSELMARVHRRD

RIVESHLITATETYTMDGPQWTRWIPVCTVIVYFQLRLLRSLCL*

 

>CYP570D4 Fusarium verticillioides

94% to CYP570D4 Fusarium oxysporum

FVEG_13355

MSGESDTSAGFLRDVWQAVAKHPRAVIATAVLGLVVLFVADTLRTWYRLSHVPGPFWA

GFSKAWMVRQSFKGIQPYAIQQANEKYGSLVRIGPNELATDD

PKLLKRMMSSRSAYTRGPWYNALRFEPGKDNLFSMRDDDAHAKLRNKMAAGYS

GKENESLERTIDEHIAKLIKLLEAKYLSTNQDYRPVDFAQKIQFFTL

DVISDLAFGQGFGYIEQDDDVFDFIKITKSYFPITLVMANIPSLVSLLH

SKLFSGALPKESDKLGFGAFIGVANKKVAERFAPGAESRPDMLGSFIRHGL

TQEEASRESLLNVVAGSDTSATTIRLIMLSLLSNPIMYLKLQKEIDDAV

KAGSISSPITDAEARKLPYLQAVIQEGLRIKAPAAGPLFKQVPPQGDEIDG

KFIPGGTQIGQSPFAVYHSKEIFGQDASLFSPERWINADPTQYEAMAEVV

SLVFSTGKYQCLGKPVAFIELNKIFVELLRRFDFCMTRPERPLHIMNAGI

WLIEDFPVRITRRGA*

 

>CYP570E2 Fusarium verticillioides

93% to CYP570E2 Fusarium oxysporum = ortholog

FVEG_00415

MGFLTDQPLTKICLQVTLVLLVAQLFRVVRRWSRLRHIPGPASAGWTSWWQ

CRGALSGRYHEHLKNAADQFGPLVRIGPNEVLSTDPVVLRNMSAVRSTY

TKGDFYSSGRIVPGVDNVVSERDEAKHKFMRAKMAPGYSYKENEGFGFEAG

IDRQLLNFISLIDRKYLSTTSESRPLDLAEKTQFFALDVIGNVSFGEPF

GYLTKDEDLYQYNEINASSLPVLNLVSVYPWLGRVVHQWPLNLLLPREED

QVGFGRLMGFARHFVRKRLSEGVTTRKDMMQMHISNGMNEEELIQQAFIS

IIAGSNTTAHALRMIILSLITNPNAYRSLIAEIRKVASSVSNPISWAQTQ

TLPYLQAVVREGLRMWPPVAGLGFKQVPPEGDTVNGFFVPGGTQVGQGFY

AVGRSRLVWGDDADVFRPERWLLADEDRLRDMIAALDTHFGHGKYSCLGK

PIALMEIHKAVFELFKRYDFAIFNAERPIKTQTSVFLFASDFWITIIRRDDEEN*

 

>CYP573A8 Fusarium verticillioides

97% to CYP573A8 Fusarium oxysporum

FVEG_10612

MAVLSFVNVALLGAGYIAFCGLWQIIRYRFFHPLRKFPGNFWGSVTR

LWITYHNVKADECATFQELHKKHGPIIRITPTMLLVSDATQLPKIYNRHANKS

KHYITGSFGKDESLFNMQDSVMHAKYRKIAAPLYSLTNIKKMEPLIDS

NIENWMARLQREFASTNKPFDFAPWAVFMAYDIISEVGFGAPFGFVKEGKDV

EGLIQGFHDGLTPFGIMARLHPFTNWVKSTFLGKYMVASPEQDSGIG

LMRFRDRLIDQRFKDIENGATDGRVDLLQTFIEAKDEDGNPLDINYIKAEIL

LVLLAGADTTGTAFQAMMIHILTNPSVYKKLMTELDDATLAGQLSEMPQ

YDEVVENCPYYIACVKESMRLNPSAPNIFPRIAPPGGLEICGQFVPGGTEV

TCNPWLVHRDPNIYGDDAEIFKPERWLDEDKAKVYNKYSMGFGYGARVCLG

QDVARMELYKGPLQFLRSFKVEWVDEKNRGTYVVKGGVSYFENMNITIQRREVVA*

 

>CYP577A5 Gibberella moniliformis

AAIM01003330 GC boundary at CVGM

Same as CYP577A7

2400 MAILPIAAAVLAVVLFIKHIFLDPLILSPLRHVPGPKSFAATKWRLAYEDWKGTRTRTIF 2579

2580 KLHQLYGPVVRIGPHEVSFNSLSALRTIYGPGSRYGRTTFYRMFDVYGEQNLFTFHSPKE 2759

2760 HGDRKKLLSHAYSKSVVLKPPTAKMVERRVRQYLDLIEAEPENISEIFSTLHYYSLDNIT 2939

2940 AFVYGKYGQTAAIRGSKIHRELIADILHPSRRKLSWSIVHLKTLTQWLYRQSGLMGQLVK 3119

3120 PVLPMQQPTTYTGIRGYALRAFEAFRADVEKITHSE (1)

     DEHVS 3293

3294 IVENLWQHHESQKPGGLRDLQMASECADHFLAGIDTTSDTLMFLVWALSLPGNEKYQEKL 3473

3474 REEVMAISGDGLNQWGNPRAEASDRCTYINAVIKETLRLYAPLPSTEPRSIDIDSVIDGY 3653

3654 SIPGNTVVGMSPWIMHRNEKVFKDPLVFNPDRWLGPDAAELNRWFWGFSSGGRMCVGM  (2)3827

     LAMAEMTTLTATMYRQFRTTIAPGFEDTTPAITARVETFYDDRFPK (0)

     ESKCLIKFTKLKE*

 

>CYP577A7X = CYP577A5 Fusarium verticillioides

98% to CYP577A7 Fusarium oxysporum

FVEG_13880

MAILPIAAAVLAVVLFIKHIFLDPLILSPLRHVPGPKSFAATKWRLAYEDW

KGTRTRTIFKLHQLYGPVVRIGPHEVSFNSLSALRTIYGPGSRYGRTTF

YRMFDVYGEQNLFTFHSPKEHGDRKKLLSHAYSKSVVLKPPTAKMVERR

VRQYLDLIEAEPENISEIFSTLHYYSLDNITAFVYGKYGQTAAIRGSKIHR

ELIADILHPSRRKLSWSIVHLKTLTQWLYRQSGLMGQLVKPVLPMQQPTTY

TGIRGYALRAFEAFRADVEKITHSEDEHVSIVENLWQHHESQKPGGLRD

LQMASECADHFLAGIDTTSDTLMFLVWALSLPGNEKYQEKLREEVMAISG

DGLNQWGNPRAEASDRCTYINAVIKETLRLYAPLPSTEPRSIDIDSVIDG

YSIPGNTVVGMSPWIMHRNEKVFKDPLVFNPDRWLGPDAAELNRWFWGFS

SGGRMCVGMHLAMAEMTTLTATMYRQFRTTIAPGFEDTTPAITARVETFY

DDRFPKVQESKCLIKFTKLKE*

 

>CYP578A3 Fusarium verticillioides

92% to CYP578A3 Fusarium oxysporum = ortholog

FVEG_03904

MGLILVTALGLLPVFLIHRYIIYPVFFSALSRLPAPHWTCHISPLWILAARK

RRRENTSLYRAHQRLGPVIRIGPDEVSVDGLEGMRTIYQGGFEKGHWY

SVFDNYGVPNMFATGNSKSHSLRKRMISNVYSKSYIQSSQASKLQMAEILVSR

LLPALDGSLKSSHKSISTDYNDVEVFGLYLATAMDLITAYIFGLSNA

TNFISDEPYRRDWQDMYLARANYPFWTQEVPKLTSFCKRWIPWLKLYPQWVDQS

NKKLSDWNWELCENVRKTSKATRSPSSSQDIQRSDEPVVYNSLLAG

IDREFKTNGEKSILYTTSILQRDRAIASEVMDHSLAGQETAGIALTYATWHIS

KSPELQRQLHAEVQLLKPSLVINPKAASGLTNTSALPDPKEVDSLPL

LHAIVTETLRLHAPIPGPQPRQTPEHGCNIAGYYIPGDVRIASLAYTLHRDKE

VFPEPEEWKPERWISPTPGKSPDYEGKHREMQRLFWAFGSGGRMCVG

SNFAMNEMKFILAFIYANFETSIVDDEGIEQEDAYTARPIGEKLVIRFTPLKK*

 

>CYP581A2X = CYP581A3 Gibberella moniliformis 7600

AAIM01003085.1 cont2.3085, whole genome shotgun

64% to 581A1

     ERNVEKYVARSDPDMLTLLMQTGHF

77   SHQDLVEQTVHFFAAATETVAGSTCWAIHLLSRHPDIQDRLRAEIREHITSPRSDVSQSQ  256

257  LHSLKYLNAVTNEVLRYHSINTLLWREPTQDITLAGEPIPKGTKIVFSPWALNRDPA  427

428  HWGPDARLFNPSRWLDNPSGGADHAYSFLTFGGGPRRCVGEQYARDQLSCFVASLVG  598

599  RYKFTPVDLQNGSDEGREIGDDFALTLFKILSGWKLNVEVVPGW*  733

 

>CYP581A3 Fusarium verticillioides

94% to CYP581A3 Fusarium oxysporum = ortholog

FVEG_11655

MSLSTYLTKPSWIFPILAVVATVLHCIKRLFIKPHFSPLKHLPSPKQGPLLFRLIHEPKV

SEIEAWMDELPHHGLIRYMGVFNQERIYVASPGAAQELLASNAYKTIKPELQWIL

ANNIAGHGLLIQEGEQHKQARKRFNPVFSPAQMKKWFPTIWNLAVDAVDLLPQHIKREPFAPH

GVVAIIELVSAASIDIIGRFGFSTEFQTLQRVTSRESTKGSSDPKVRFGKAYIEMFK

TTKRGQTTLRAASLIGPKIALKLPLRAVKTIDSIMALVRATAE

DITTDHERNVEKYVARSDPDMLTLLMQTGHFSHQDLVEQTVHFFAAATETVA

GSTCWAIHLLSRHPDIQDRLRAEIREHITSPRSDVSQSQLHSLKYLNA

VTNEVLRYHSINTLLWREPTQDITLAGEPIPKGTKIVFSPWALNRDPAHWGP

DARLFNPSRWLDNPSGGADHAYSFLTFGGGPRRCVGEQYARDQLSCFV

ASLVGRYKFTPVDLQNGSDEGREIGDDFALTLFKILSGWKLNVEVVPGW*

 

>CYP584D4 Fusarium verticillioides

93% to CYP584D4 Fusarium oxysporum = ortholog

FVEG_02372

MFSLLLFKFLEQHLLATIVLLFLPVPLGVLETYLRRWRLAQAQGCKEATRKVAV

KDPIVGFDFLYKIFFEKSPERYLDSTWQAFKEMGTTYIEKRWSWQC

VYTCDPQNFKHILATAYHDFDLPEFRTSVIGHIFGQGIFVLSGHPWKQARAVLRQ

SFRKDNHAPFLDTLERNFQSFLQHVPTDGSEVDLQPLFLALTMDI

STEFLMGHSTNMLIQNADHTREQQFVDDYMVCSEEIIQQMQLGPLHSLKFNFAAKK

ARKRVYEYLDAFIQESLNKSEDGSGSSFLTEMMDVANDRTALSH

HILHILLASRDTTSGLLGNLFFFLAKKPAIYAKLRGEVLSVAGQEPPTASQLKDMT

YLKWCVNESLRLHPVIPTNARVAVRDTTIPRGGGIDGESPLFVP

KGTAMFYNVYAMHRNEDVFGPKAEEFTPERWKDLRPGWGYLPFNGGARACIG

QQYALLETHYVVARMAQAYSEIESRDDEEWMELYALALCSKNGCRVATKR*

 

>CYP587B3 Gibberella moniliformis, Fusarium verticillioides

AAIM01002228.1

FVEG_10439

4962  MWLLGLQDDGASLLTRLLRFSGVILVALLVHAFRKGYRVRKKFQALKDQGI  (0) 5114

5167  PIMKHSMILGHLEVIGKLVSTLPSDAHGDYLMLKIQENWRELFPQCTKCPPVAYIDTWPF  5346

5347  TAPMVISLNAHVSAQFTQEHSLPKAYEQKHVLYPLTKNRDLASMEGPEWKVWRKRLSPAF  5526

5527  SIQNINSRLPDILEEVEDFANVLKSKAGKNGEWGEVFPLGDATANLTLDVIIRLFL  (2)5694

5762  NIRFHEQWGKSSPVCAALLDTISRMYFFVNPANFIQYCNPWRHFKLWQNYRTLVKSFTPV  5941

5942  LQERMNKLQQDRTAKGKTLVDLIVQALDAERAEQKGAGQDDKDQLNMELDADFLEMAIG  6118

6119  QINTFLFAGFDTSAATIAWLFRLLSEYPDVLAKLREEHDAVLGPNAWGVAGVIRENPQLL  6298

6299  NQLPYTLAVLRESMRYHTNVGSMRRGEPGFFLVGPPGSDPGFEGKKLPTEDFIVWDGTYA  6478

6479  IHRDPEIWHRAWEFLPERFLVTDPEDPLYPPPNGWRSFEAGPRVCIGQHLATLEMKLAMV  6658

6659  LVARCFDIECAWEEWDQIN(2) 6715

6779  GTTNSEKARPTVWDDRCYQVGTDSPPRVKDGMPVHVRTRGL*  6904

 

>CYP595B2 Fusarium verticillioides

90% to CYP595B2 Fusarium oxysporum

FVEG_06528

MAFLASPFGLGVSIIAILIGAIIFAKKKPKFPIINKYPKDFFHRQAHHE

YKTNTRKLLKEGAAKYGDEPFTILVPNGIKTILPPSCVGWAKNNKDLDHQQ

LVRDEYFASYPGFDVQHVLHHPNRMIINMVQGKLSKTDKTLPVMDEHINV

GLLDIWGECKSWKTLNWEDGTTGVISRAAASIFVGPELAADPEWQKVSRA

YVLDYFGAVGEMHLWPSWLRWLVVWCLPGPAACRAGLKRAREMVNKVVQK

RRQEEEEANKQGKEPPAYCDALAWTLESPLGNEFEPADVQLALAMAALFT

TSELFRQILIEVARRPEVVEHLRREIEDAAPDHDFTSTSLVKMQLLDSVM

KETQRHIPSQVILERLVIRDTRLPDGTLLEKGTHIAIDSREMYDPTKFEN

PEEFDAWRFYKRRQAGDNTSLFVQSSPEHAQFGMGKHLCPGRFFAGSELK

LCLAHIILKYDIRLKDGCLGKPMSFGFLSATDPYTQLEVRRR*

 

>CYP602B3 Fusarium verticillioides

97% to CYP602B3 Fusarium oxysporum

FVEG_07386

MENVSSLAASPIGVDYQLPQFVSEGHCTGYYITITIFLIAVWFFFPKKQT

SHLEIPFYKASKTKWIFDAETLIKDSYTKFRDRVYQIKATEGVQVIVPAR

LVGELKGLPEDILSATEAVSDALQSKYTKFSPGHNGELLALLVRTKLTQN

LTRVVPLLKKELEHLLATEFPTCEDWTPVKWQPFSLRAVARLSGRAFVGP

SINRDEKWMDTSINFAVHVFTACVKLQFIPEWARPVGQHLVSELRQIRKD

IKIAKEMLKPILEERLHDMEFSNGGDAPDDMIQWLIEALPEEEKADLTTQ

AELQLIIAAASIHTTNNLLCECLCDLAAYPEVQEELREEAYCILEVDNGW

ENKESMAKLKKLDSFMREVQRLSGNI (1)

TNHDIASFIRKVMKPISLSDGTKLPVGTK

VLAPQAGIALDERYFPDPERFDAFRFYKLRQESAEASNRWQFTSLNDTYI

NFGAGKHACPGRFFASNEIKLVLAHILINYDIRLKAGEDRPKAMAVVMAK

APSPDTELEFRRRSWAA

 

>CYP606B2P Fusarium verticillioides

90% to CYP606B2 Fusarium oxysporum = ortholog, frameshift and 5 aa deletion

FVEG_12187

MANPVLEFLSRPAIAAPLILFVSYIIYQLFLKPSNLPDLPVIGARKGDWFPILQAKIRNS

LDVKAALNSAYIQYRNQAAIFPLIDGGNIIYLPRSDTKFASEQPTNMLS &

QQDLQTDYTTMDPSLTHDPIHLELVTTTLTKEVGNLIPDLAEEIEHCVSKQLGKSTD

WSEICVMESAQKMLSGITNRAFLGLPLCRNEEM

LKLGVAFAQNIPLSSMLMKLFPSFIKPLVAPLVTRSNRIHTREFEKILEPEIKARLAEYDSQDEHTESDRNDYLQWLIEQ

AKEIGNPKNWQVSALAQRVLLLNFASIHTTTFAVTHALLDIAASSPDFILELRDEVDSVLRQHDGKWNKRAVAQLEKLDS

AIRESQRKNSIVSIGVSRTVIAEKGVTFPSGTHVPKGLRIAIPGYSVLQDSKIYPKPKTY

KPLRFYNTRQNEADKYIKSARNALPTATQDFLAWGLGRNACPGRFFASNKIKMLIACILL

KYDIEHLTKRPRNTWIAQNRIPPMKATLRIRKRIRS*

 

>CYP614A2 Fusarium verticillioides

94% to CYP614A2 Fusarium oxysporum

FVEG_07580

MISPVYAFGGLLLAYVGLSTLQLLYNYKKARAIGLPVLITPIDPSNVPYLL

CSSFLEPLLRKILPFGLGNFVEYNSRDWNYEQIHDLQERIGDTFIIVSP

KQIRVFTGNAKASDDLCRRRRDFVKAVALYKPLEIFGRNVVTTEGDDWV

RHRRITTPPFNERNSALVWDESKRQATDMLKMWASNPKGVVNPQSDTMVLA

LHVLTAAGFGRSYTFGSGLESTLENHSLTYRDSLSLILGNLFTAVFTATLN

LPTWMLPPKFKQVQDAVVNFRQYMAKMVAEEREAMDTGAEEQDNLMSIL

VRASENQNKEGKGTRHLTDSEIYGNLFSYNLAGHETTSNTLAYATILLAA

NPEWQKWAAEEVDQVTAEIDLKDLDYETYYPRLKRVLAIMHETLRLFGAA

RAVPKTTLVDQTLKVNGTSYTIPKNTFVGVNLAGLHTSTASWGNNALQWL

PSRWITADEKLATMPAGSFLPWAAGPRVCPGKKFSQVEFVAVMACLLKDY

TVEPGEGDQAAARALMEEAKQSSFNFLLKVKHPEKIRLRCVRRV*

 

>CYP616A3 Fusarium verticillioides

90% to CYP616A3 Fusarium oxysporum = ortholog, possible gc boundary at VEY

FVEG_06280

MTSLLSLVPYLSMGLVILGMLVMGIIAFNVFVYPFYVSPLRHLPGPKDNAFFLGQTAKF

LQVPWFPELLCKWSREFPNAPIIRYLNFANGETLFVNSIEA

YKQVLQTKSSYFVKPAFAKQFAHEFIGDGLPFVEGKLHKLRRAAISQPFSAARL

RAFSPVVQQKAEQLIDVLTQHRNENGNVEIESNIWKAVLDVIGLET

FGLDLNHLESDESPLFDTFTTMMQPSTFGHVINYLNSLIPIRQYVPMK

ACIEFSQSCARVREFIVGLMTIRRNQYEQGLVSPEKNRDALQCLLEHSDPDWNDKSVVEY (0)

VLNLLILGHDTTACSITWAVHELSRRPDCQQRLRDE

IAGMDSTCDMPGFSDIDKLPYLHNLVREVLRLYLAMAPRQATDDVE

IDGIMIPKGAVIQLSPAVMNMHPLVWGQDAQEFNPDRWNDLAGDATSAYAFETF

HNGPRMCIGKQLSFMEMKIMLVEMVRKFKIEKPLGSQDKQVEVAGPAFTLRPKENLVVRLVAM*

 

>CYP617A3 Fusarium verticillioides

96% to CYP617A3 Fusarium oxysporum = ortholog

FVEG_01179

MGLPWERITATAAIGTLSLAWAQNNWVRLQLLGRFTELWIAGLAICGVWTVWIYPLFVSP

LRHLPGPSGNHWFMGQAQ KIMAEPSGVPMREW (2)

ASKIPNDGLLCYRGFFNQERVMVCSPKALAEVLSTNSYAFPKPSHFRWSIGRILGIGILLAEGEE

HKMQRRSLTPAFAFRHIKNLYPVFWSKAREVTRTMMAEFGGEGEGEVHVEISSWA

SRATLDIIGLAGMGRDFGAIQDPQNTLAQTYKQIFKPSRQAQ VLAFI

GMIIPMQFITKLPFRRNEDIAKAATDIRAVCRDLIREKKAKIANKEQADVD

ILSVALESGGFTDENLVDQLMTFLA AGHETTASAMTWAIYMLSKHSNIQ

SKLRDEVREYLPSADSDVDITSLDIDRMPYLNAVCSEVLRYYAPVPLTMR

DAAYDTTILGHSIPRGTRVVIVPWATHFDTELWGQDAGQFKPERWLPSGG

ESGSADRKAASGGASSNYAFLTFLHGPRSCIGSSFARAEFACLLAAWIGR

FEFTLANPEEMDEKKVEIRGGITARPAKGMHVKIKTVSSY*

 

>CYP617B2 Fusarium verticillioides

95% to CYP617B2 Fusarium oxysporum = ortholog

FVEG_07585

MPRIAVFLSYYRPWAVCALAFAIYTQILHDKDYSIRHAPFYMGKYLLAFLSVWAFYLVFLYHWFFSPLRHLPQPK (0)

GASFLNGHWAESVSQPAGLPFRHWSRTIENNGLIRYK (2)

HLFNQERLVVTSPEGLKEVLGQNSYDYVKPHLLRAMVGKILGYGLLLSEGDVHK (0)

LQRKNLMPAFSFRHIKELYPVFWSKAQELVHGIGKELKEESTSEIDIVDWASRAS

MDIIGSAGMGHEFKSLADPSIEDTMKMYGSMVKQSRGAKLLTVLQLVLPSI

ITDYLPFQRNMGVLAASKAARETSQRLINAKKVQMAAKEKLSPDIISTALESGHF

TDEGLVDTMMTFLAAGHETSAAALTWTMFLLAKNHDIQDRLQEEI

RQNVDGLTDDVDAKKLDSLSYLHAVCQESLRLYAPIPFTVRDALKDTRILGTFIPK

GTMVILCPWAINRAHELWGPDADEFNPERWMAPGQANSGGSKSN

YAFLTFLHGPRGCIGQKFSLAELMALTCALVGRYRFDIDKDYEVRDIADGIVAKPSKGLKVFVEEVQGW*

 

>CYP617F1  Gibberella moniliformis (also Fusarium verticillioides)

          AF155773.4

          fumonisin biosynthetic gene cluster,

          FUM15

          46% to 617A1, 43% to 617B1, 42% to 617D2, 37% to 617C1, 32% to 617E1

          possible GC boundary after GNRE to remove short intron before heme

          signature (lower case seq)

MRGLNNIAVALALSAIWSFGLDLGRHGTSGSSLLLALFRTLCKA

YPFVVISHFVWSAIIWPTFFSPLRQLPNVPSDGWLSKETLRLVSEPRGVPQSDWINSL

SNRPVDLARYRSFLGFERLLIISPKALAEVLTTKSYDFRKPGLIVSELKQATGMGVLL

AEGSEHKSQRKALQTAFNYRHIKNLYPVFWDVAGEFATVLEKQIPTGTPRTSDTTAVI

DIVDWASRATLDIIGRAGMGQGFDAIQNDDSRLHQAYRMIFEPSRGAIFLALLRLIFP

ERLVNWLPLRRNKRMRHGIQVIRSKCQELIRERKEKIKRQKAGVDNSGNDILTVALLN

GVFTDEQLIDQLMTFLAAGHETTATALTWAIYILCKQPEVQNRLREEIRMHFPNPKGW

PRSERPSSNTLQQAIDFKLPYLNVVCLEVMRYFAPIPLTMREATCDTTILHTFVPAGT

RIILAPRVTNRDSALWGPDANNFNPDRWLSPKNGNRE (0)

ARSNYADLTFLHGPRSCIGQSFARVEFAILLATLIANFEFQIEDESL

LDERNISISRGATSRIVGGLKVRVRPIAVV

 

>CYP617J1 Fusarium verticillioides

90% to CYP617J1 Fusarium oxysporum

FVEG_05955

MIETWQIILAGATVSGYLLALLYPDNQNSIFLLGFLATLCTETALWC

FYRILIRPRFISPLRHVPTPEGNHWLWGHG

MKLYREPYCSPVREWNETVTNDGFLRYLGFFNAERIVLTSPDALHE

VLVTQNYSFPKPASLRETAGRFLGIGLILSEGDAHKLQRRSLNPAFAPRNIKAL

YPLFWDKTREMVERITADRLETVEVVEWASRITLDLIGVAGLGRDFGAIQDAKSEMVETYNIVFQPSAQAR MLHLIESLVPAWVLTALPIKFNSDMSQAARLIRETCRDIISSKQKKLKE

KKLDDMDIISAAIWTGTFTEDGLIDQAMTLLAA (1)

GHDTTGAAFTWGIYLLAKHPEVQNRLRHEI

RQRLPPLTQAKEFPISSVNIDSMPYLQAVCSEILRFYAPVPQTLREAAHNT

TILDQSIPKGTRIVIAPWATNRCSKLWGNDAHLFRPDRWLG

ESAHGGAESKYGFLSFLQGPRACIGQGFARAELACLVAGWVGSFEFELR

DRGLMDERNVDVKGGLTARPAGGLHVKVRKLEEW*

 

>CYP618A3 Fusarium verticillioides

87% to CYP618A3 Fusarium oxysporum = ortholog

FVEG_10106

MWLLSISLVRAVTLVILALCLHFIIKTLLRPSFLQLRHLPGPKNHQFLVG

HALRILRGSGPNDLYLQWMRRWPNAPFIRSLSWLNSEVLLVNNIEACREV

LQTNAYRFAKPAFFHTLVGEFLGVGLLFSVGDQHKRLRRITAGPLSRPSI

RKLFPTFVTYSHKLNSEIDAAIQRSSNGVLELEDLFTRVTLDIIGVSLVG

KELRRFRSKTSPLSFEQCYNGILAQPLAGQIISFINPFIPLRWLPVSANL

NFIKAKSALKSMMTELIEQRTSEVARAKELGTDTTLSDDLLTRMIEASSV

ESQKLSRDELIDITMQVIAAGHETTASALLWTIYALSKDQKSQDRLRAEI

LGLNDDDTTAKAIDVLPYLDNVVKEALRVYSPTLIIPWEALEDIEILGVR

IPKGTTVQLVPAMTQLNPEIWGPDVETFIPDRWDRLSADALSPYAMETFS

NGPRMCPGKALALLNMKVLLVGLIRDFRIESVGDEEVEFRNPSLTLKSKK

PLRFKVRRVSEGS*

 

>CYP620A2 Fusarium verticillioides

84% to CYP620A2 Fusarium oxysporum = ortholog

FVEG_13148

MSTSIVIVTAILASLSFLLVKHTLRPKKPPLPPGPKGLPLLRNIRDLPPPGTL

EWPHWQSHKEKYGPITSVSVLGQNFVILHDRQVIMDLLETRAMKSASRPKLVFAGDI (2)

VGYDGVMGLMPYNRTFRMHRKLTATQVSPKSITRFEPIQELEILRLLKRLHQDPNSQKLPDHLNQ (0)

VSGSIMLRILYNYETDSDKNDHIVTMANLVMGEFSEATTPGAWMVDFIPW

LRHIPEWMPGAGFKKTAKLFRHHLLKNVQDPYQYVRDQMT

NGKGDVSYVAGLIKYIHRKIDPEEESIIAWTAASMMNAGTDTTGATLLAFF

AAMVIYPKVQKKAQEEISRATGDSRLPSFTDKPNLPYTTAIAQEVLRWH

TLAPMGFPHMTTEDDTYRGYFIPKNTLLFPAVASLTHDPEVYHDPMEFKPE

RYFEPYNEPSPSDLVFGFGRRSCPGRWIAEQTLFLSIAQTLAVFRIERE

VDAEGREIESRLTKTP*

 

>CYP620B3 Fusarium verticillioides

97% to CYP620B3 Fusarium oxysporum

FVEG_08749

MGLLLLPAVVLAAIVVYYVLYPKKKTGLDLPPGPKPLPIVGNVFDLPPAGTA

EYKHWAKFKDLYGPISSINVLGTPLVVLSDREALHDLLEKRSTKTSSR

PWSPFASELCGYSVFLPVIPYGKKFRYFRKLVHQQMGTKLICSEFRDTQD

LESLRFLVRTIERPEEFQKHIKTEASAIILRIIYGYNIEPKKVDPLVSLI

EKMMINFSDAFVPLSWAVDIVPSLARLPDWFPGTSFKKTAREWRNTTDQA

LNTPYNFVMDQMGSGTNRPSYVSQLMSSKSFKNDNGTGEPTKEDIEAVKA

TATIMYGGGADTTVSTISSFVLAMIAFPEVQKKAQAEIDSVTGGERLPTF

EDQDRMPFINALCKEALRWMPVVPTTTTHVTEEEIEYRGYRIPKGTYLIP

STWWILHDPKIYANPDAFDPERFISPRDEPDPSDFAFGYGRRICPGRYLA

EDSIFMTVARLLAVFDMRKAVDENGKDIDVVIDGTPGLISHPVEYAYSIT

PRSAKHVEMVRAAERVHPWEESDSSLLKKDSPV*

 

>CYP620C2 Gibberella moniliformis

DR662816.1 EST

AAIM01003167.1 50% to 620D1, 51% to 620B1, 54% to 620B2

Also Fusarium verticillioides FVEG_10070

2136 MLSAVLILVGVALTILYIRTKPRKNLPPGPKPLPILGNVKDMPDGTIPEYQHWIKFK 2306

2307 DLYGSISHVSVLGQSLIILHDRQAANAILEKTSTKTSGRPQFVFGNEMCGYNQILPFKPY 2486

2487 GKLLKQHRKLVHQQLGTKTAASRFRDVLDVESRRLLLRILETPEKLFEHIQT (2) 2642

2695 EASAIILKMTYGYSLEPRKPDPLALLIEQMMHNFSLAFVPMSWPVDVLPILRYLPESLPGM 2877

2878 SFKRIAREWNANMRMVVDVPYTFVKRQIAKQSNRPSYVSSLIKQHDDDMDEETDAAIKQT 3057

AAVMYAGGSDTTVSAICGFVLAMLLFPEVQRKAQQEIDSVVGTERLPQFEDRDNLPYVDALTKESL

RWIPVAPMGAVHTADEDIHYKDFVIPKGASLLPATWWFLHDPEIYSDPTSFDPDRYLEPR

NEPHPNFASFGFGRRVCPGRFLADESLFISISRLLAAFEIKKAVDGRGNEIEPQISVTPG

LISHIRDFPYDIEPRSEKYAAMMRQVEDDHPWEQADATFLNMDGSLESEKV*

 

>CYP620E4P Fusarium verticillioides

84% to CYP620E4P Fusarium oxysporum = ortholog

FVEG_11206

MFEASVFFAGFALECLIYTGLQILGNVSKRPPLPPGPNRLPLIGNLNDLPPPGVFEVHH*LKH*LKFKDLY (1)

GPISSITVMG*TIIIINNWKLASQLLDKRSAQHSSRPKIMMAGEM (2)

VGWENSLGFSLYNDRFRTHRIN

MARIIGSKRAAAKYDRLQEAEVAHFLLHVLDDPERSMDHIRT (2)

EAGPVILKIAYGYTAEPFKEDILIDMAGQAMDNVTAASVPGAFLVDTLPL (1)

LPYVPDWVPGANFKRLAKKWSSELDDLTEMPYAFAKHQHALGKQDNSFASRLLEIEDSTEEARFTTKWSALSLYAAGADT

TVSSISLFFLALILYPDVQKKAQEEIDGVI

GNERLPNCSDWTILPYANAVVKEILRWNPVVPMGLPHTSTEDDV

FEGYFIPKDALIMPNIW (2)

YFAHDPEVHQDPMRFEPERFLSTDGNQPEQDPHTYTFGFGRRVYPGRVL

ADNALFLNIAQSLAVLHIRKDENGAQPKLLFTPGMISHPEPFKAAITPRLPQHEQLIRSLEQEFSWEQSDNHIIEKMQRQAS*

 

>CYP620L1 Fusarium verticillioides

87% to CYP620L1 Fusarium oxysporum = ortholog

FVEG_12380

MELATLITYTCVITPVLICVTKLIAKTSRNAQLPPGPRGLPLIGNVLDLPRAGQFEAHHWARHKDLY (1)

GNISSVTVFGQTLVIINDAKLAQTTLNDHSAKHSSRSKMTFAGEM (2)

VGWDKTLSFQPYNEQLRRHRRKAHLCLKSEASIR

SNDTLQEIEVGHFLLHLLRDPGRLVEHIQK (2)

QAGSVIVKVVYGYAAEQFKPDPLLSTVRKVVDEFGIAAKPGAFMVDLIPILKHIPDWFPGAGFKTTAKQWRTNLESSVEDPAAFVQHQMANGKDNK

SFLSQLMQKKGLTDEEASENKWLAASLYAAGADTTVSAITTFFLAMTLFSKAQKKAQWEIDEVIGSERLPALSDRQSLPYVNALVKEVLRWHPVGPMCLP

HTTSQDDIIDGHLIPKGAMILPNIW (2)

QICHDPALYHDPMAFKPERFLGSEAETDPGRFVFGFGRRICPAQGMADKTLFLNMAQTLAVFEITGKEGGEMPKAEFTS GVVSHPKPFETAITPRSSQHRKLIESIERMHPWQKSDADTLANPHR*

 

>CYP621A3 Gibberella moniliformis

AAIM01001458 79% to e_gw1.5.1476.1

Also Fusarium verticillioides FVEG_06100, one stop codon

I propose a 1 nucleotide MICRO exon agggt for the joint At PK/G/TVV

This is needed to preserve the length and seq in this joint

The phase (1) and phase (2) boundaries do not fit otherwise.

5016 MIEHYLSQALIGLTLAIATVLLFALAHWRSRPTLPLPPGPPSEFLLGHSRVIPKENAAAVYAKWSKEY 5219

5279 DSDIIHVRSLGRSTVVLNSADVARDILDKKGANFCDRPRFTLLEV 5413

5490 MGWGKTLTFLPFGQRWQMHRKFLQTSFSNTNVRRWHTLQITEARRTIQNILKKPETWETS 5669

5670 LRRLAVAIVLQVSYGTQVLEDDDPYIQIANDAMYATGNGGVPANSIVDLVPF 5825

5889 VRYLPDCIVRDWSLRFARQWRWAIKKLHDVPFAAAQAEN (0) 6005

     HRYDYYTNTSLAHH

6132 LLREYKDKESRGQEQQWSLDDIKGAAGAVFIAGTDT 6239

6294 TWATCVIFILNMVLHPEIQEKAQQELDAVIGSDRLPDFSDRPALVYIEHIVQEIYR 6461

6522 WSPLAPL 6542

6601 GIPHKSLHDDIYKGMLIPK (1)6657

6775 G (2)

6790 TVVYANAYAIAHDERVYKNPHNFNPDRYEAGEPFPVGNFGFGRR (2) 6921

6995 VCVGRFLADNSVWIMVATMLSVLRFCKKMSSDGKPIEPRVQFTNGGTC(2)7135

7273 HPEHFDCVIRPRSLATEALVNSD* 7344

 

>CYP623A2 Fusarium verticillioides

93% to CYP623A2 Fusarium oxysporum

MAVYLFVAVFLAAVYLVQHKSFQKLPSSLPRLERHSYLPFKLQWAYLTDCRQLFLEAYQT (0)

FTKHGKTCVLPSMGFKDEIHLAHHHTQWAASQ-PDAVLSPIEGFREIDKGDWNSGHASYI

QDPWQSIIIKKEMGRFLEILAAAVDDELQYAIPEYIKPGDGDEVDVYEAMKWIVAQVSSR

FTVGLPL (1)

CRNKAYLKDSLAFADLFILNSGLLIYTPSLLKPLIGFLVTLPTRYRRWKIQKHIQPLYEER

TKKLLNPGLYEKGDEPTDNLQMMMRYAIDKHGSQVSPSQISDRLCLANLASFHQTAVAIS

NVLINISASDAEFNTTTIIRKEMADVLAESGGVFDKASVSKMIRTDSILRESMRTHGFGN

RAMIRKVVAPGGLKTPDGHTLPNGSTMSILSYPVHQDPDIYENPEKFYPFRFSDMRTDPD

GKDANPTLSFVSTSSTYLPFGHGKHACPGRFLVDFEMKMILYHVLSRFDIELLPEHNGVR

PESQWVTEAVMPPVGVKLRFKKRE

 

>CYP623B4 Gibberella moniliformis

Genomic seq = AAIM02000051.1 PKS ortholog to PGL1 starting at 437510

There is a CYP623B4 seq at 468-470k 72% to 623B1

94% to 623B4 Fusarium oxysporum

Also = Fusarium verticillioides FVEG_03709

470403 MPYTAE

470385 LGLLARVVSPLGIASIVVIGVIAIYVIDKLTSVPYPPDIPLIREQKGARRFSLRTRWAYL 470206

470205 TDCQALFYEAYHE (0) 470167

470120 YLKKGKPVVIPGFGVRIEVLLPHSQMKGVLNQPEDVLDMEQAFAEVDQVRWSLGHEKYV 469944

469943 VDAWQGLVVKYDLNRAIEIIANNMKDELHEVFDEQFGTDTENWRRIDLTKTVKMIVAQAA 469764

469763 SRFTVGLPLC(2)

       RNKEYLNLALEMNDLFIMNAGLTGGLPCILQPIT  469584 

469583 GTLFGQIVNTKVNKMKKWIMPLLKHRFDRINNHPDEPQPQDQVQMMINYALRHRQHEVND 469404

469403 MESLARRVVAQNFGSIHNTQIQIVNLILNVLGSDAEFNTIATLRDEMDRILGTDDSVNWT 469224

469223 KSGIQAMTRADSVARESIRLCSFGGRAVFRKVMVDDFKTEDGHHVPKGSIISFMGHPAQT 469044

469043 DNEFYEDGLKYDPFRFSRIRETAASRDETAPPVTFVTTSPEFLTFGHGKHACPGRFLIDF 468864

468863 EMKMILAYALRNYDIKLADEYEGKRPPNYWIAEANNPPSGVQIMVKRRERK* 468708

 

>CYP626A3 Fusarium verticillioides

90% to CYP626A3 Fusarium oxysporum = ortholog

FVEG_12256

MFLSLIPILSIVLLAFVLRAAFNYYRGPLSPLPGPWYTHFTGLPLLYTRA

VGTSRQHLRHIHKVHGPVVRVGPKEVSINSVDGYYKVHGVGSHCLKAPVF

DHIRFSHSSMLFTMRDPRIHSERKRIIGRGFASMKEEQEVKIQRLASKAV

ANIKNEAEKGQADVYKWWRCLAVDVVSEMSFGKSFNLLHSGGKGLPLYTA

LSNAGPCVVFQAVLPRGLISLFKWSPVTWLRDVGQVSETIFNRVTAALGE

LRSSSNCGPSIARHLLSKEVKGKTPSLNDDELSSEIGMLLVAGSDSTAAT

LTYATWEIVRDPQLRRQIEEEVGSLPVNFTAKDVDILPLLNSVLEEVLRM

YNPAGALVERLVPPSGISVHDWDIPGGIMVYTTGWLVSRLEDVFPEPDR (2)

FIATRFLNPTPEIKRAHVPFNIGARRCVGMHVARMEILVTLAMLFRECRG

LKLHHGMTNEMMTQVGEFFIVPKAGQCNIGI*

 

>CYP627A4 Fusarium verticillioides

83% to CYP627A2 Fusarium sporotrichioides

FVEG_11079 not found in the F. oxysporum genome

MESTPLQYPLGLKTDSLVKQVSEVLKSLTVTKAVGAFIVLFIIIPKVF

DFLRNLFSPVTSIPGPLINKFSPWPLEIATFKGKSHRFARALHRKYGPIVVL

APGMISIGDSKEIKRIIQSEDWVKSEAIYGNFRQDFHRPTLLAFTEKKAYS

RRKRMLSSMFGIRYIRSLEPLMKSCVDAGVAHLNKLCDNPSKSTIINLQ

HFIHGLAIDTIGVTTFGGSFHVVENGSHPLPSRLKAGMKISAVMQLISW

IKYIPFLPKRDPYIEKFTFDIVDKRRKEAGAVKHQDLLQHLVDVCDDSPGS

EFRTSDVQDESVILLAAGSETTANAELFTVIQLLKHPEKMKKLIAEVDKW

YPPSEPDRATECAYSQTGMTYLQACIDETMRLIPGQATGSPREASKQEVL

LGYKIPRGTTVFPNTQEAHLDGSIWEQPEKYIPERWLEIYSRNQTSAMPY

WPFSAGSRICVGKNFAFQEMHISLTTLLRKFTFEYVPGQDETTVFRIAQQ

LEADSYKVRVKKRF*

 

>CYP628A3P Fusarium verticillioides

83% to CYP628A3P Fusarium oxysporum

no gene model

MYPTSLAIGTGASSGVLAHLLIFRKGEWDLYTIKILQGLLMVFGLLALSFRRLGATEDGSPYSLLDPS &

IASIYMVSFMVSGAFCSIFIYRISFFHRLYKFPGPFMARAFNLYLTKRSVASFQLYREIQDLHRRYGDIVR (0)

GPSALSILDAKVFHAIHSNTSPCSKGPWYN

IEQPAISLHMSRDKNDHARRRRAWDRAFSSK ()

ALRDYEPRVVK

YTSQLLDRLVQTQDIPIDIAKWFKFYSFDTMGDLAFGESFNMLTGGVKHPFMALVESHMA

MAGSFSQLIWMFPLFRAMPFLGRADAIFQKWLENQVRHQEQ (0)

NKPDLPNIFSWLLEGYKSQIHPKERDWLNLQADMQLIAVAG ()

DTTSVTLTCLFFLLATNKDACVRLQEEIDNLFSSFSQPNHSSFSNLTYLQACIDETLRLF

PPVPSGLQRMTPAEGLRVGDIFIPGDTIVTVPSYTLYR ()

DERYFTSPDDFVPERWTTKPEMVKNESVFAPFSV

GRYACVGKQLGLMEVGYATCMILNRFDIFLSGEGPTSKSAFLKGLRDHFTLDALQLKIVLTARK

 

>CYP628A4 Fusarium verticillioides

86% to CYP628A4 Fusarium oxysporum = ortholog

FVEG_10685, FVEG_10685 join

MLLTEAHLETRQAFGAAFMLGVLVHIFILRKGEWDLWTVKLIKAWATYEVTVSLFLTQLYSF

SVWQALSVTNKWFTSFVTGLSISILTYRAFFHRLNRFP

GPFLARLSTFYATYLTVDEEHMYLEVQKLHEKYGDIVRIGPTELSIATPSSFRPIH

APSSPVIKSPFYGITHPCVMLLSERRKKEHALRRKSWDRAFTTK

ALRDYEHRVLKYTKLLNDRIDEAKGEPFNIALWVNFYTFDIMGDLAFGKSFDMLESGV

EHNFFTESHKTQGFMGAFRRLVWFFPLVSSIPIVNSSFLAFQ

AYIRNQVETRRKNKPAEPDVFSSILEDYDAMEKPTQQDFDNLCGDAHLIVIAGS (2)

DTTSSSTTCLLHNLVLHPDVLAKLQAEIDEYKNTHDEYDLVSLSKLQYLQACIDESLRLY

PVVPSGVPRMTPPEGMQLDGVYIPGDTIIHSPSYTMYR (1)

DERCFEKPNEFIPERWTTKPELIKDASAYAPFHT (1)

GRGVCAGKQLGLMEMRYVLMDILSRYDIAFTPG

TNPQAFIDGLRDCYTLELPRLDMVFTPRTGGNAKA*

 

>CYP628B1 AAIM01002625.1 Gibberella moniliformis 7600

47% to 628A1

same contig as CYP5055A2 about 16kb apart

also Fusarium verticillioides FVEG_04308

7029  MITLSNIQLESLSALCCVALCGVATHLAIFRIGEWDVAVHRIIASFSLIYASIFGLLAYYGDFERQ

6851  SLLNAWYIASELLAAFIAGLYGSMVLYRFFFHPLRQFPGPTFAPLSALCAISMSMKKFHM  6672

6671  FLEVQKLHKTYGDFIRL (1) 6618

6558  GPSEISVASPSAVATIYQNSSPCKKGPWYNVFVPTISLHATRDRQEHTLRRKVWDRGL SAK (1) 6376

      AMRDYEPRIEKYTGLLMNQLQQRCGRPVDITDWCGFYGF  6205

6204  DVMGDLAFGKSFNMLNDGVKHYYMELTQMSTLWGSPIGRASWLYLLVKDIPILNRQIVQFLK 6019

6018  WLRKHVDQRTK (0) 5986

5933  NEPHLPDLFSWLLGAYKEQSVHTKQDDLNLLGDAHLIVVAGS (2)

5756  DTTSTTMTCALFELARHPQVYQKLQNEVDEFMKQGDSPHSHSALAKLKYLQAIIDETMRL 5577

5576  YPAIPSGLQRITPPQGLQIDGTFIPGNTIIQTPTYTLNR (1)

      DERCFVRPNDFIPERWTTQPDLVRDASAFAPFSI (1)

      GRYSCAGKQLGLLE 5217

5216  VRHVLAQIASKFNIRLAPNQTVEAFQEGLADGFTLLCPKLEMVFEARVS* 5067

 

>CYP628F1 Fusarium verticillioides

91% to CYP628F1 Fusarium oxysporum = ortholog

FVEG_13835

MMVEPKSPEALAVSFASGCLLHILFYRRGEWDSLALRIFQTYATLPIIVIGLL

RLAEFQGWQHGNNLSAASVLLLEGAHILGLMTSILCYRTVFHPLNKFP

GPLSARISNFYPTYLTTKNTHLYEEVEQLHQQYGDFVRL

GPTQLSITHPKAIEAIYSAKSPCTKGPFYNILNPRISLHMIRDHKEHSTRRKIWDRALSSK (1)

SLRDYEPRVTKYTTQLLDRLNEMQCTTINASDWLNFYSFDVMGDLAFGKSFNMLRD

GVNHYFLSSLHGSMKMVGALAHISWVIPILKLIPAVNSEDRQFWAWISGQVEERSRMKP

DNPDVFAWILEEYERNPKTYQAKLNVEAEAYLIAVAGSDTT

AATLTGLLFELATNPSQIIKLREEIDQYFMDREHADHTSLSNLIHLNAVIDE

SLRLHPPVPSGLQRVTPPQGLMVGDTFIPGNTIVQVPMHTIQR (1)

DERNFARPSEFIPERWTTSPELTKDKGVYAPFSI ()

GRYSCVGKQLGLMEVRYVIAHIIRAFDVRLGEGQTPE

GFLQAKMDTFTLATPNLHLVFTPRPTK*

 

>CYP628G1 Fusarium verticillioides (temp CYP628G2)

66% to CYP628G1, 51% to CYP628A3P Fusarium oxysporum

FVEG_05671

MAALHAHPYPAYYCLSFVL

GVLAHLFVFRRGEWNLYVFNILQAFAVLESILVYIVARAVEGGDSPVWKVTAISSCFTLS

ALMGSSISMLIYRGWCHRLSRFPGPFYAKLSNFYITFHAFKRFRLFEEVQQLHRKYGDIVRI (1)

GPSELSIIGPRALQALHSNSSPCTKGPWYSIEHPIKALQMTRDKEEHAYRRKAWDMAFSSK ()

ALREYEARVAGYTTQLVEQIEASQGTPIDASSWFNFYSFDVMG

DLAFGRSFDMLKNGTSHPFMELVHSNMLMAGSLTHLPWIFPLLKRIPVLNRKNLEFQGWL

KQQVDWRHK (0)

NKPDLPDVFSWILSDYDALNKPTAQDTINLRGDAQLIAVAGR (2)

SDATAASLACLFFELAANPEACLHLQRELDQYY

ADHGKPDHSTLSKLRYLQACINESMRLYPAIPSGLQRMTPPEGLDVGSTHLPGDTVVTIPTYTFNR

DERLFTHADKFIPERWTTKKELTKDPSLFVPFSI (1)

GQYSCVGKQLGLMEIRFVASQILLKFNVELTHQDVARDFVAGLRDGFTLAMSSLHLVFTRRTT*

 

>CYP630A4 Fusarium verticillioides

96% to CYP630A4 Fusarium oxysporum = ortholog

FVEG_11857

MIGFVLLGAGLAGLFIRLVIYPIILYFIDPKGLRKYANFSWLSPLTDL

RHCYLSHTGTRSETLAAEHDRRGEHILRIGPNALSFSHPQAVRDIYGHQTKC

TKDHKETVLAGTHRNLFDVVDKSDHSRKRRLLSAAFATRNLEKWEFKVQYTT

QRLLDAFDQRCTGPLKPNTNPDPEDLTVDFNHWINLWTIEAINYIALS

SKMTLLETGTDEVIAEKPDGTLYPARYRQAQNAAAMCKSVFVWEYELYPW

LARISKVVPNKWKSYWATSAPWGDICYHQAKDRLRRYEAGEKLDDFFSCL

MVNKNGVPNDLEWGEIVAETSAIIDAGAETTAIALTHILQLLISHPKQMQ

RLRDEVAAVMDEEDVISPFDKVKDLPYLKACLDEGLRLIPPVSSGLPRRT

PPEGAKIMETWIPGDTSVSMTIWSAHHNEDIYPEPYVFKPERWLDLEERK

RMEPFFIPFSAGARGCIGRNISYLEQQIVLATLVHRYEFAMPTKDFTVDR

FEAFNLIMGKLPIKIWRR*

 

>CYP630B17 Fusarium verticillioides

95% to CYP630B17 Fusarium oxysporum

FVEG_01518

MSASIASLGSAPYAAAVGVAVIIYFIVYPFIAYLKDPKGLRRFPNMSTFSGMSN

LPFMILAHGGARSTHLAKLHKTKPIIRTGPNSLSFAGGQAIKDIYG

HGTPCIKDESYIVGAGTHFHLADVVDKHEHARKRKVLSSAYALKNLEGWEY

KVADKVQRMMNHFDKVCTAPLPKGAKFPDPQDVNLDFRAWSNFFSLDAI

ADIGLSEKLGLLDQGHDRVEAQQTCGTVYKANLRECLYPTARKQSYLLWTYDH

YKLLNKISNIIPFYRKMSNSAKGWDDIVLRRAQIRLDRYQRGEKLDD

FFQALMEDKNGNSHELEWGEIVAEINIMMNAGSVTTAIALANILYQLILNP

RVMELLRQELDSVLEPDEAVAPYEKVKHLPYLRACLDESLRLWPPTPQN

LGRQTPPEGLTIMGQYVPGNTSVGVSALVAHRDESIYPESEKFIPERFLGE

KGKELQSHFITFSAGARGCIGRNISYLEQAVCLASIVHRYEFALPAGFE

LKREETMNHILGPMPVKVWKRNLEE*

 

>CYP634A5 Fusarium verticillioides

93% to CYP634A5 Fusarium oxysporum

FVEG_13169

MNSQSLLTSLVDYRVANVTILSTTVLAAIVALALLNRLLTPRI

DPREPPVVKPSIPWVGHIIGIIRHQADYPRIIH (2)

NENPHVQIATLPMLNGKVYAAFDPALLQTLLRNKTASFEPFVFDYAK

KTFALKQETFEKVKVPGVYDEFTEAIHASFQVRHLQQMNVHFLGSIAAKLNTATIRADAINAGKE

TVTNGRLHVENLYLWCRDVMSLATTRSLYGDTDPFNRDPSLIEDMWLFE

ESVPYFLLSLFPSITMPKAYKARSTLQNIACKWYAQDHDIHDPSVSALVRN

RAGALRKNGLTGYEIGKFEVILPNVATLNAVPTFYWLLLYILDRPDLLTRI

RAEAEDAAVIEENNGKRSATFNIVDFEEKMPLLVSCYRETLRLANQTLS

MRRILQDTSITTPEGTTYILKKDTDLQLPAGVAHYEDSVWGADVNVFNPERF

LPASKGSAEDERKRKAAYIPFGGGRHLCPGRNLAFAEIVGFASALLLG

FEIKAVDMGFGDVKKLGPQLAGGTVRPERYGAGLGAEIQMRRGWEDVEWRFEC*

 

>CYP636A2 Fusarium verticillioides

92% to CYP636A2 Fusarium oxysporum = ortholog

FVEG_07578

MALSNLTIGVVCCVAVAIVALSTRKKPDAREPPYVKETVPYFSHIYGLLKHG

LRYFDLVSAQQPHPIFTIDMSGQKNYIVTSPELVQAVQRNTTSLSFSP

AMIPAFRRMMGFDEAGIELIFRDAHTENGMYGEIHRVQKASLLPGTESL

DELCTLIRAKLLNIVNELPSSQTIDLYAWVQDLFMRTNNSACFGEKDPFTL

DPSLNSTFWAWEANIKVLLLGVPWFLSPKKHSTAQRTRKELVDAFLEYL

NDDGLDTACSFITELSGLGIRRGLSNENNARALLGSILAIVGNTIPTTFWL

LISIFSRPDLLKEIRSELEATLEDSSSGTISLDYNTIREKCPVFMSTYDE

VLRMTSGIATVRYTNEDTLIQDRWLLKKGAQVQMPTAFIHADPITWGADA

DVFDHTRFLKSKVLTKDQKTRRAAAFRPFGGGNTLCPGRHFASYEILTFVG

SVLLGFDMAPTTKTFNVPQMDRSKLPLTSLKPASNIKVDLLRRRGWGEARFR*

 

>CYP637A2 Fusarium verticillioides

97% to CYP637A2 Fusarium oxysporum = ortholog, C-term is extended

FVEG_13702

MLREAVYSIAGFVLLAYAAEWILSLFDDPREPKRLQSKVPLFGHLWGMMKYSSGYHGITR (2)

SKQTNEEMYT

VAIFNTKLYIAKTSRLIPLIQKTSKTLSFRPFMQTAAKLMGDAKPETFEVFGTE

WVDSFSHAHKNGLATGPFLDEQNLRMGDRALIDIEQLLPTEKDGVSKINLLEWAQ

YAVVQASACGIFGVEHPFLDPKVDQAFW

KWQSYLPLHMVNLDITGKGYAARQIVFDAFRKYNKNLPSDVSFIY

KERLRSMQEAGIDEDDICKQQATFGTAAFANTVPIMYWTIYELFSRPDLLEEVRK

EVIEQAVSGDKESGFKVDVAALKTKCPLALSVFQETQRLRHVHAN

IRKVTEDTLLDGKYLLKAGHYVMMPGQPVHTNTSTWGPTADQFDPYRFTKDSSDRK

ASSFVAWGAPPHLCPARQFATTEILIVIALLAVRGDITPVKGEW

VKNPALNTGDMATVYTPKKSVEVEVRKREEWD

GEWSLRMGESKTRISLASG*

 

>CYP638A2 Fusarium verticillioides

94% to CYP638A2 Fusarium oxysporum = ortholog

FVEG_07581

MMNAPFLNTSASSIALVAVLLFLSTHSITTIRYSVQRFCDRRYKGKEPSTLPYVLPGVGSALSLIRNPHGFFNSIV (2)

QKVDNGEPIRMRLGNVHAYLIHGTRNVQQVFRCSKELTFEEFALRVAHKVKRL

PAKDAALVAKDISGSSRLPLTETREEDRIWRKFHEIYEAHLIG

TNAVSALTELFINTMIDELSTVGTQGPIEIGIDEFMKHHMFRASTI

ALAGRKVFDIDPNFADVFWDYDEDFMSLLYGIPKFLCRKGSNARDKCLETVKGY

LDQGWKNLDWRACHQQNPYWEPNFGSKLVREREVAMEKYGIGLDGRASFQ

MGLIWSINSNAIPMTSWIIIEILRRPEIFKSIQEEVATVFDKDTKQVDIV

ALKKLPLLNSVYFECLRLRSSVFVVRKLRNSIELDGYTLKEGNLVLAPSY

LAHNAPEVWSSTTHPPEEFWPERFIKKGNSGISAGNYFPYGGGAAMCPGR

NYAKQEILSAVVLFFAHFEMEPLRFVDRDGKTSERGPEVGNEARGVARVDRDLLVRLRRV*

 

 

>CYP639A3 Fusarium verticillioides

90% to CYP639A3 Fusarium oxysporum = ortholog

FVEG_12894

MHQPMSASNLNPLNASRRFTMNAKTAAANPASATETTTYLKLVSLAIL

PFIVTYILTSFGNKGYQHGQSAREPPRVPYWIPYVGNTIGFAFYTEGFLSSI

LSKFGNVPLRIFVGAEDMYFIPHGQPIIELFKASRHLTTKSLGVMTVRDAFG

LPECDMPIYVDDDSQFGHVDPLKRFDFVQHRDLHALLTGGPLNSMTAK

FVEVYSDIIEKDTKLSENEWTEVDDLYEWLKNNLFRAAVTALCGDKFLEI

SPSFLEDFWLFDYRLPSLFKRMPRWLVPGSYAARDKCVESVLKYHEHGNK

LFDFTDEDGIIKMDWTPEFGTKLMSARQKMFQSVGLTPRGGAALDLGLMW

AVNANAIPAGMWILLDILLDKDLKDRVMAEMQPSFIDKSLSFDIEKLCSG

PLINSIYLETLRLRVASPVGRTSIIPNLKFGKWQMKQGVGMLSSSWAGGH

DPAFWNTGHVQPGGIEEHPVESFWAERFLVYENDSTSGPVRPTAAAEKPT

KRTSEEDRKARPTIDGTLGYWYPYGGGTKMCPGRFFAKQELMAAVAVALR

AFDIELVDPEAASKVRPNMDYFPFGTIPPKEKVAARIRRRKL*

 

>CYP640B1P Fusarium verticillioides

68% to CYP640B1 Fusarium oxysporum

no gene model, supercontig 19 373448 – 373945 region

IRADMTQTSSRKFYSEVLLELD

 

YPRSRSV*DSRDAAIDSLEWCFEMPQD*RRDAALFVIKAEDEMRKLGVSNGHISAVLCKLYQA

INGNSSVLAFWLLARSLCTPHLMEDIKRGVAPAPK

EGIHHQPDVE*LKECPKLNATYYETKPLHSGSSSFRRLVRDTHITIAGLRLKTGNDVIM

PYRQLQLDKKYWGENS*HLDIGRFIDNPKLYSTRECKLFGGGTTLCPEMTLSAASVYL

ATLVTLYEIQPVQRCESQPFPEANDKVRMLGIISPEPGYDVKVSMRYV

 

>CYP641A3 Fusarium verticillioides

93% to CYP641A3 Fusarium oxysporum = ortholog

FVEG_11589

MDSLEALRERLNETLIPHAQRYPLQAILVTTIILFITTRLFTGSSSSS

RKDGSKTPPLAPFWVPLFGHAPRIFLSPSSALTRFRDRYVQGVFSLRLFQSI

HSFVFRPSLVARLLEQPGSIADKEYVARRIMMTNFGLEKKDLAAYDKAAP

EVYQITREYLSGSHLDTLANAALRDLDDNAADAISFNSYPTDQMDWERGA

NAELLENTGDEKIMAVDFFELMKTFVARTATISVFGTDFVEVYTDIWPHL

WIFNDAFHSLAMGVPVWAPFPSSQRARFALKRLLTFMREYHTELDKFLSD

EEPATKWQDFHTISPLVRARTEVYRKHGLSIDVRAAFDVALLWATTVNST

SLISWSLFELYQDQVLLSQIREQITPFVKIVQPKNEFGGAVWIPPQVQKL

DLEGLVTKCPLLQGVYLETLRLYGGGWSSRYLKEDVILKDKEDSFVLKKG

TVAHIVNDLHHSDPRSFTDAKVWQVGRYIEDTVDKKGVKTQKVDPYTVRA

SDGTLTMCDDSEFTLRKVAMYISVFISLYELEPAGSERWPSPPVVKGVASA

QPWGSVRLWAKRRSPQPQ*

 

>CYP642A3 Fusarium verticillioides

94% to CYP642A3 Fusarium oxysporum ortholog

FVEG_09657

MSSILPSQALSSLTINLIPTLILFSVSIYVLPAPTRHILKFLSSPSSFKEKSSINDTPSISNLPRLSGVVPWLGHLFGLT

IDSTRYINRLIKSTTAPIFTINIPFARITVCHPSMDRVLSRHVNDTGLAQVLVYVGPRLFGLKEETIKAVFGYNPQPLHK

QKFGHAENIVSLNQRSSNNIRERVMKMSETNEVLVGRWVFELAVSATASAVWGVANPWSMDQDFSNEFMKLSETFDTLGR

PIAWLTANSAWNSRKYLLARLREFHLEHREARVKTTAHSINVVAHSDPNWENNPDYYHIEMVSALGLLATTSTLAVWLTR

HLLTDPELMKVILNEVQQLKHVEGEDKPRLDLTNVRSECPWLMASWYETLRLHMTGVARIARHDFMLNLPDSDPIAVPQG

EIFMLPMCASNLDVDNWGPDAATFKASRFINKVGEVSGSAVRKVRAFGVAGNMCPGRVFGTDIVFSVVATMLRTFDIEAA

PGEEFRVPTLRGGFNVGFERYGDDVKVLLRKKGVA*

 

>CYP643B2 Fusarium verticillioides

70% to CYP643B1, not found in the F. oxysporum genome

FVEG_12349

MASFLVITEYSPLAFLAPAAAALVTVQIVRATYMLYFHPLSKFPGPRSAAISRKWQAKIVDKGFPEKEYKRLHREF

GTRALRIGPNHLHISDTSLYKVIYSQV

NAFPKEKAFYDTFESHHTTFSETDAQLHKQRRRLLSPLFSRSGVSKLEPLILEKVKETIEKVQRISQRGPINAWPAFR

CMTIDIISEFSFGTCINLINEDPDTFSSEYLAAMEIAS

DVPFLRYYSTTQRLLAKFIPLSVAANFNPVLSQLQRLVGIIGHSYDNFTH

RTNDSRFPVLFDNLQAIPPDMQKAEAINTFIAGSDTTAFTLVTALCHILR

LPEVEKTLTKSLDEIFGEHQATPSLLQLEQTKYLRACINEALRLAMSVPGI

LPRVVPTRSQPFVVDGKVVPPG (0)

TVVGMSAYTMNT DPQIWGQDAHSFNPDRWLGPNAKELETHLCTFSKGARQCIGIN (2)

VAYAEVTIALAHFFYHFKMELKTKELRIVDKFTTEASDP

GLLVDFKLRQHA*

 

>CYP645A2P Fusarium verticillioides

85% to CYP645A2 Fusarium oxysporum

no gene model, no introns

the second part after the heme signature resmbles a

phthalate 4,5-dioxygenase reductase subunit

MTCPFSNPRNLFKDLAIARETQSIEYSEKLGGYAISRYDDIVS

VLDNPSVFSSRPTVPDFPPQVKQIFANKVPERGTLLAYDNPDHDRLRKSVASFFVPRRLE

RFEPLLRATAHDPIDGFVEKGCADIKSNFALPLPLWTIVIVAGLDPSRWQWIGRCLSLFG

GITEMNEELSIEQRV*DVLDLHEYVAQVIQERKKDRRDDLISHIWNERDAGVVEMTDYEH

LSMIPGLLLAGHETTTNLLSMGISHILHHDL*DAATKDEKLRNTTIEELLRYEPAITGME

RLVKEESKIGDHTAQPGEKLFVAYNSGSRDTTKFENTDKPNFNRQHKYQNLGFGRGIHSC

LGAPFA*LLLRTELAVLKERLPNLRPTTPYEEIQYCKVHAGRGPERVEIRWDVSSLDEMR

ANVGQANANSTLRASAKTEELEMVVKNV*KVTERIIRLMLYPKDGEKVPKWSPGSHIDIQ

AGTIGYRQYSICSKHSEAQHLKIAVLRENDTGASNWIHKNTVKGSQVLIRGPRNHFSLEF

GSGKTIFIAGGIGITPIIPMAEAAKEAGVEYSILYLGRSKNNLPVI*

 

>CYP655D1 Fusarium verticillioides

96% to CYP655D1 Fusarium oxysporum = ortholog

FVEG_11928

MANSTGFMADLPGLFTDIPGFVADIPSRVDFTSILVILASTVAILAFT

SFIKYVAERQQEKAMGFGHVPTLWQWDPFYGVDAFIAMLLALKNNRYVPWLD

SLHAKMPKTFALTFLGGRQIWTIEPENLKTVANNLADFQVGPIRYNSKAGQP

FAEKGIVGADGKDWEFARALVKPFFMREWYANTERMEPFAERFFAGIP

ADGETFDMFPHLRTWSLNLNLQFLFGDYSDIVTEEETNKTTDAFITGLA

YARIRLLLHRVLWLFPWKTWYKVVGTIHSYVNKHIAKARAELKEREERISK

GLPVGPERRDVCWHMVRELPNDDEVRSHLCLLFVPNNETTLIFLSNVMWNL

ARQPEIWERLRQEVKGKELNFNSLRSMKLLQNVLTEAHRITPVGLFIAR

AAVRDTTLPRGGGPKGDQPVRVRKGNIVQINKAIMYRDPDYWGDDALEFNP

DRFNKMRPGLSLTPYNTGPRRCPGEMMTMNECGYMVARMAQMYKRLDCR

DPTPFVGVFRIGQLNKNGCQVAVYRE*

 

>CYP673B3 Fusarium verticillioides

86% to CYP673B2, possible ortholog

FVEG_12478

MADMSLKIESFTNWAIGLPMLLQTSTVVGFLLLGYIVYYRYLHPLAKYPGPPLASLTNLWKTYNLWNLHLPHTLVRLHEQ

YGEVVRVGPNDLSFRNPDAVNTIYKAGRQLQKTGFYDGFTAFNPNLFGTQDEEIHAIRRRQMAHAFSLQSIKEMEHFVDS

HILKLRKSLDNFCDTNQEFDLKDMIAFYVFDVLGELAFSRSFDSQNERDVSRLPPINDHIYLACLMGMTPEALPWIKKVL

PFIPNRWIKRLLNARAQLRDLTAACVRQRIEAGTSDRKDLLSSLLAAVDSETGSKLTELDINTEAFAMV (2)

VAGSHTTSGTLTLLFSHLLKNTEMLNKVIEELDSNLSSHTGQVIPFAALEKDIPYTMACV

HENFRINPVFTMPLPRKIMTLGGFTIQGQQVPQK (0)

TVVFALNHVVHHNPSVWGKDHDQFIPDRFLGPNGKELQSYLSPFSTGHRMCIGKNLAM

MNILKVLSTVLRNYKLEMLHPEERVETLSVGISEKKGGLMCKMSRR*

 

>CYP675C2 Fusarium verticillioides

57% to CYP675C1 Nectria haematococca

FVEG_09420, no F. oxysporum ortholog found

MIIDIILERFTCVSAPAALALLVSSTAALWLMTLLYSYYFHPYADIPGPFWAKL

SRFWLVRQVLRGDIHNTQRALHEKYGPIVRMAPDEVSISDPAALKV

IYVVNAGFTKTEFYTPFAPHLSPHEDLFTQRDEKIHAQRRRFVNNLYSLS

SILESESYVDACIMTFKAQLDEFVAQSDPFDLGLWLQMFAFDVIGELFYG

KQFGFMEDRHDYQGYIETLDTLLPAVATSCVLPFYLRPLQVLGHLIPPLH

KALKGYDDIVVAAKETVARRQRQVDKGTVQSRPRLKKYVLADPRI

RSDLLDKLFNIAASKGDFTLADVATEAWVSLFAGSD

TTAIAMRAILFNIIRNPKVYERLLAEIDQASAQGLLSNPAKYSEAIKLP

YFIACCKEGFRVHPSVGMSMPRHVPPAGVNIAGRYFPGGSRVGMSAHVVHF

DKGIFGQDADCYNPDRWLQPGAEVMERYLMHFGAGPRTCVGKNISITEIHK

LIPSLLQDYEFRLAEPNKDLKYSNYWFNKQIGLHVLVSQRKK*

 

>CYP684B2 Fusarium verticillioides

86% to CYP684B2 Fusarium oxysporum = ortholog

FVEG_13449

MDSQLGGGYLSLEATGHFVLLLCIVYLLCN (0)

VTFTIFFNPLSRLP  (1)

GPWISCWSDMIAKYHWLKGTRAQYVHDLHQQY (1)

GPVVRIGPHEVDISD

MTAVKEIHRVKDGYKKAAFYKNLVPNTNNLFNTLDVEFHRHHRRLLSS

PLSESSLKAVEPTVDAYVKMAIDSMKREMDERGAADVAKFWLFMATDIIVEL

SFGESFGILEHGKKSQYIKDLEGLAAKGSIRSTFPTLISLATKLPLPVFK

ETVAAAQRIKDYSAEAVARYKTNFTNNPAAAKPMLFRKLFEAGEDGLSDE

EIRAEAQAYIVAGSDTTATTLTYLIYSVCSYVDVQQKLVKELMELPDDFG

HSDLRDLPYLNNVIDETLRLYAAVPAALPRVVPNGGAHLAGYFIPGDTVV

STQAWTLHRDPRVFPDPEKWDPSRWEKGSKMMHDAVMPFGGGSRVCIGKH

LARMELRLAMARFFRAFPKAKVSSIEGMSEEDMELRAYFLLSPKGGRCLIQLE*

 

>CYP5040A2 Fusarium verticillioides

91% to CYP5040A2 Fusarium oxysporum

FVEG_10654

MMLSQSLAGYCLAACTALIIYY (0)

AVVKVKTALYGPLSKIPGPAVGRWTNLVVKYHTLSGRRMQYIDSLFSQY (1)

GPVVRISPTDIGINDPDAVKVIQKVSGGFKKSAWYDKTGPGMLG

MRDREKHARRRRLLAHPLSNSSLPAFEPLIRAKVDLAMSQMEKEYRSLG

YTDCHKWFSFMATDIIGDLTFGSSFRMLEQGRRSQYVEDLQAVMPTVNKRI

ELSPFFDLMFLLPLPQIKKFSERFQRILKYGEESIRRLQLAQLTGSLNTP

IFFDKIMNPKNKENALTELEMQQEAAELMITGTDTTSNTLTYLVWSVLQS

PGIRARLEEEVSVLSADFKDADLVKLPYLNAVVKESLRLYGAASGAHQRD

VPEGGWEACGYMIPDTATVFTQAFSLHRLPEVFPDPHR

FDPDRWLRPTAEMQDAYIPFGGGPR (2)

VCIGIHIAYMELRVTAAVFFLKFRDAQVHASMTDDDMELENYTLIAPKSHKCLITL*

 

>CYP5047A4P Fusarium verticillioides

89% to CYP5047A4P Fusarium oxysporum = ortholog

FVEG_03309

TNVIVATATPVDLIPWLWYIPGKWKSCVYK

MRDHMDKVWSQARAMVDDRRARGDRRECMIDMKLDEYEKNGWPMSQHAFNNLFGE

LMEAGADTTANQILTLILALAKYPQFREKARVEIDAVC ()

GTERAPVFSDFAKMPYVNAIVKEGLRWRPT*VYLEHGI

DDY*DGMLIPKGSTIFVGVWAMHHDKDYYGSHDTFDPDRYLSHTKLANEYA

VGPDYEKRDKSISSTVLRATS*LPVL

HHYGYGAGRRICPGIHLAERSMWRITAKLLWAFEFSEPIDPVT

GKVKPLDQDAYTSANLVCPLPYKVNIKPRSAAHVEAIKRELESAEAFLSQYN*

 

>CYP5049A3P Fusarium verticillioides

76% to CYP5049A3 Fusarium oxysporum = ortholog

no gene model

GPPHSWLLGHS

KVFSQVAALMPPNTHPQLFYAEMVRLYNLKEIFYLDLWPIGPSMVVIIDPKLMDNSTLPK

PLPIHPLTAVFMKPMLGEGTMAAINGALWRKIAAAVIPAFSMSHVLGITSIMIDECLLFQ

ERLDKSAVGGDVFSMDGLVAKLVFGIVSTVTLGESQHAQTVGSQILKDSRNLVNLARGET

DPLIAYNPMVQIPRR*KRHQIVRRLNSSLREKVDECVE*TVQEGIVFSRQNPRRLM ()

TRDASWCEHAEAVLEQKQRGVHGRSQLSESE*EILFSK

LRPMQLGGHSTSTNTLC ()

FLFMLLSKAPDVVEKMH*EQIEQLGASPQVTLLSNPNMFRRLLYTDA ()

RLYPLGPDLKHTPPGTTITAHDGRRLPIANGLIMTASPHTIHYDAHIYPDPAAFRPERWL

IQEKPIPGDYFRTFGGDGRTCPGQNMGMNILKIVMVMTMGKYTFECVRLKPNREPKTK

HTNFDLLFGDMAFQQLGLDGGPRNGMMMTVRKKA

 

>CYP5055A2 AAIM01002625.1 Gibberella moniliformis 7600

57% to CYP5055A1 runs off the end

AAIM01002626.1 Gibberella moniliformis 7600 = N-term exon 1

Missing exons 2 and 3

same contig as CYP628B1 about 16.5 kb apart

also Fusarium verticillioides FVEG_04314 revised

       MLLDIHTSIFRIAV

  322  LTLCALLVLKVAVSIIYNFFFHPLSKYPGPPLARISRLWSRIGNFQGRKSERIHEAHVRY  143

  142  GSVVRVGPNKLSFSTPTAVQAIYTSNDFTKEESFY (0)  38

       RAKRIFHENHLFSFR (2)

       DAEAHKTRRKNFSRGFSQSSMLDFEPHVSSKIKALLNQWATRANDGPIDVYPWCHWLGFDVI (1)

24778  YHLMFDEDPGSVPRGQPHQVMRYIKAWKPTYIY  (0)

       KEFLPQMEQYGVYVPGTIGGYFRDVRTWKK (0)

       YALKLIEEIRQKDSHTPFLRNVLSA  24419

24418  EKSGDAAQPLTNSELAEECMGGM  (2) 24350

       FGGSGTTANTFVYILWACLKQPNVVAKLRSELLQA  24178

24177  FPEPGLVPDYQ (0)

       AVINETLRRYPTIVARSPRTAN  23998

23997  NDTVIDGIPVPKG (0)

       TIVGTQNFTMHRNEDAFPSPEDFIPERWLA  23818

23817  ADGKETLKASWTPFSVGSRRCIGIN  (2) 23743

23692  LAQMELSKLTAAFFLRFDARVDEAMTEEDMRMYDTSNAGPAGARLFVHMREV*  23534

 

>CYP5057B2 Gibberella moniliformis 7600

AAIM01002904.1

55% to CYP5057B1, 40% to CYP5057A1

also Fusarium verticillioides FVEG_12405

5687  MSGLFDNILGLSREALLAVLSVSLCLVYVSIK (0)

5540  IVGRLLFSPLRHVPGPSSTKLSGAAVWLSTIQGRRVY (0) 5430

5370  KLEELHKKYGPIVRTGPNEVSISDWRHLRTIYLNNKGMIKNPDFYEAATFVGKDNIFQMI (2)  5191

5102  NVQQHAARRKMSSPPYSLQSVALLDPLIKGNARRLAQRLKSGTSSPVDAYTFCGLF  4935

4934  SLEVICQAGFAKDFSNDTNGAAALKLLQAMDGSALTLLFDGALPFVARFDIGTKLPGAIG  4755

4754  DSYLKREYWRKKSYEMVDHFLEKSADDEKYLLTPLATGVDGYLGRKLTHEELVEEAM  4584

4583  GYMFAGSGTTSSTLTYLLYELSKPENAAIQERLRTEVLAISDDDIVAIRNNAYINAVI  4410

4409  KETLRAHPTIISTIHRLLTEPLTLGQYTLPSGTVIGMQTWLHHRDTSVFPDPEKFIPE  4236

4235  RWLNETPEMKSALTPFSLGKRNCIGQNLAWQELYWSVSEVMRSGSRFRVAEE  4080

4079  MKDWEMEMEDRFNIAPRGRRLMLTVSQVN*  3990

 

>CYP5063A4 Fusarium verticillioides

55% to CYP5063A3 Aspergillus niger

FVEG_13079 no introns, not found in the F. oxysporum genome

MAVSSISVLVLGIVAGAALFYLWSPTGKYRKRPLKLPIIGDIHSSPIERPL

LRWDDWVKENGAIATSKLFGIVPVVVINTAEAATELLGRRGAWYSNRPR

SVGMEMITGAGPGKSRFTLMHDMDAHLKLHHRILSPSLGGIAAPHYQPVM

ELEAKQLVKHLVEISEQKSLVIASDDIFPLLERAQAIIILALHYGVRVPT

LDDPLYKRVRETQAKVTSYASKPGLPDIFPFLANLPAIISPWRKAADELF

NKQKDLNLHLLSLGDDNPGWNATKQSRSLAAKYTKEPISDTDLAFTLATS

VQGGIETSTRTILWLFIAATTGNKRFMKRAHDLLDAVVGRDRFPRFSDRS

SLCYIDAIISELLRWRPISPGGVPRRADKQDYFNGIRIVKNAMVLTNAWS

IGRDEAVFDQSLGGLDEFIPERWVDGESMDTDIKNQGELRTSLPLPVFGH

GRRSCLGKRVAVDGTFAQVATMIWAFDFERAEEVHEMEMKVVWFMTEPKP

FKFKLKPRGPWVLKVIEEEWRTADKELSNIMGNISDIES*

 

>CYP5065A3 Fusarium verticillioides

96% to CYP5065A3 Fusarium oxysporum = ortholog

FVEG_03262 revised

MAVKLILYAVVALGLVYIALIFPKLQQEWKLYSHRSQLPPGPKTIRTGIRKP

WLWFQELSQQYGDVVYLQLGPTPTIVLGSAQAAWDLLEKRGAVFSSRP

RFIMGGELLSGGMRGLMAPYASYWRRWRKLLHSGFMQRQSETYRPIQSLE

SKVLMFDLLKRPADFRMHLERYAASVIVTVTYGRRVEDVRSDIVVRRNAE

AMERLTMVNIPGKYAVERYPALKYLPSFLAPWKKEVLQQRQKDIQLYTEL

MDEVREKVAKGTAPTCFAKHLLEEQESLGMSDLEIAYTAGSPFGAGVETS

AGSLASFLLACVKFGPQFIPKAQEELDRVVGSDRLPTFDDLPKLEYVRAI

ASETLRWRPVAVLGGTPHASTADHVYKGMFIPKGSTIIAPLWTLHLNEAD

FPEPHEFRPERFMEKREYPGTLGHSAFGWGRRICPGMHLGAASVTLNIARI

LWGFEVNPEQDEKVRDIDVDI (2)

FAYSEGFNSSPLPFPCSITPRSVKHAQVIESEHDNALEDLMEYTAVTSKIS*

 

>CYP5078A8 Fusarium verticillioides

77% to CYP5078A2 Fusarium graminearum

FVEG_03329 not found in the F. oxysporum genome

MLSVNLSIVKATIFSLQS

HFVGSFFLLLALSYVYDRYRPGLSCIPGPPLAKWTKLWRLYDVYNG

QSHQTAIRLHKKHGPLVRIAPNIISVGDPAAIKTIYGLTGAFTK (0)

SAFYPIQSISWNKKPQMNLFSTRDTVYHREQKKKVAHAYSLTSLLGSEEAMDSCTELFTSRLD

EWATTDKPIDLGAWLQYYAFDVVGEVTFAQKLGFLETSADVDGMMETIEGILF

YAALCGQVPEMHPFLLGNPLFPYLIPAMESWNAVLTFTLKAINSRTTIQRDGE

LELNGDGGRDFLSKWAAVKKRDPLKMSTRDVITHLSTNVFAGSDTTA

IALRAIVYFLIKHPEKMRMVVEEIDTADKSGKLSDPISYKESTGHLP

YMGAVIKEAMRLHPSVGLLMERHVPPQGAEICGQFIPGGTVVGINPWVLHSDP

SVYKDPKSFIPERWLTADAGLLSKMEHSFLTFGAGSRTCIGKYISLME

MHKVVPQLLRRYTIKLEDPKAEWRTSNRWFVQQHGLICTLKKRT*

 

>CYP5080A7 Fusarium verticillioides

96% to CYP5080A7 Fusarium oxysporum = ortholog

FVEG_08540.1, FVEG_08540.2

MTSPIAVFAIPAVVFALLLRFIVQSFRSPLRTVPGPTAARFTDGWYFWKVWKGSFQDVNLDLHKRY (1)

GPIVRYGPNRYSFNDPEAAKTIYGLGTHFPKSSWYSAWASPGTWTIFSDQSVKRHNQNRKLYQATYA

MSSLVHYEPFVDDCADIFTQRLSEMSSISTHLPVDMRHWFQC

YAFDVIGLITYAKRFGFLDSGDDVGNVIGALEDHLGYATLVGIFPSLHKYLFKIRNWL

AGGKGTGRVYILNFTNERIRQAQVAPKPVAAESEVTMEDFLTKF

LAKHAASPDVFTQYHVLMGCTSNMVAGSDTTAISLSAVLYYLLKNPDCLQKLMAEI

DDLTARGELSKSPTFKESQQMVYFQAVIKEALRMHPATGLPLERVVPEG

GATICGRFFPEGTIVGINTWVAHRDTRVFGQDANSFNPDRWLTAESERLSM

MNRYYMPFGLGSRNCIGRHVSMLEMSKLIPRIIRDFDFSLDSSLQHQ

NWHTQSYWFVKPLDFKVRIQPRISEKQR

 

>CYP5080L1 Fusarium verticillioides

88% to CYP5080L1P Fusarium oxysporum = ortholog

FVEG_04340

MKSMSLYALLAFCLTLGWFIVTLVKFVRSPLRRVPGPFLARFTRLWLLKQAYFGTYPKTSIKLHRKY (1)

GPVVRIAPNEYSIDDPAAAKIIYGSGRGFTK (0)

SPWYYASGNPISPLPNIFVEPNPHIHAQARRKVAAAYSMTNLVQLEPFIDRC

SAVLRERLEEFSRSGVSVEISHWMQCYAFDVIGMMT (0)

LGKRFGFLDSGEDIQGIMSSLSQYLVYCANVGMFPEWHKTLFRRQMRSKTVSGLSHVGKFANAQLEE

KREKVKTDEEADGNAAEDFVTKFLRLQSQDPGKITDADISSVCNMNIGAG

SDTTSISLTSIIFNLIKYPRVLQQLRAEIQDRESRGIISDPIT

FAEANKLPYLQAVIKEGLRIHPATGLSLGRVVPPDGATLAGQYFPPGTVVGINAWVA

HANTKVFGHDAHLFRPERWLDYPELVKERELYFMTFGQGSRTCLGKNISLMELSKAVPQ

IVRHFDFAPDTETGEPEYETENVWFVKIREFYCKVHSRDRQ*

 

>CYP5085A2 Fusarium verticillioides

53% to CYP5085B1 Mycosphaerella graminicola

54% to CYP5085A1 Aspergillus fumigatus

not found in the F. oxysporum genome

FVEG_13316

MGLVQHLTSQAAKQ

QHMPFHYGIALLLVLTYGLYRMIQPKKKHNLPVFRLRDNNVLAVLTEAYKQVRHS (0)

YPTSAFMLELPGMEMAVLPPADVDTIRGLPESVVSIK (2)

KHHYDVFLGEYTYMGTKSDEFDSAMRNVLTRNTPAVLESFTDEVEYAIFNTIGPCKD

WTPIVARKAMCKVASLMSGRAFVGLPLSREPDWVEANVNYTADVSKAWMILKMIPQPIR

FFVAPFLPQVRSLKRQRKNNEAKLAPLLREKQDSSSATSASKEKPVGGDLLDWFISQYKT

TTTVQELGRDQLLATFASIYNLSNALTYIAFDLAATPEEDVEE

MRKELTEVLGEDGVIDKNSLAKLKKLDSFAKESQRLCPPSLVNIPRIVTSPEG

LKTSTGDVLPTGTRMTIMSHFINHDPKVYPDPEKFDPFRFSRLRQVP

GNETKYQHASTGLDNINFGHGIWACPGRFFASAQIKVVLAHLLKNYHVK

LKKGTDKPGQIHYGLAILPDAQAEIMFKSRK

 

>CYP5128C3P  Gibberella moniliformis 7600 chromosome 9 cont3.125

             GenEMBL AAIM02000125.1 (WGS section)

             probable pseudogene,

             63% to AAIL01000498.1 Trichoderma reesei

             49% to Aspergillus   terreus

             50% to AAID01000197.1   Botryotinia fuckeliana

             52% to AAGI01000270.1|    Phaeosphaeria nodorum

             44% to AN1703.3

             47% to Sclerotinia sclerotiorum

             43% to AAGI01000142.1    Phaeosphaeria nodorum

VKSPLCWNLAQLPKK

YDRIYKEVIENTELDAQSLPYLTRVV

KESLRLSMANPNRFPRIVPPGGMQVPV

LPNIPAGTSVGAGAFMLHHNPEVFPEPHQFMPERWL

463566 NPSQEMLRDSFYFGDGSRQCIARNLVSAGLWWAAEALIRSDVLRGAKV (0)

IVEWFNAKIVGEKI 463769

ELRCE

 

>CYP5134A1 Gibberella moniliformis 7600 chromosome 11 cont3.130

53kb from a PKS

AAIM02000130 revised

Also = Fusarium verticillioides FVEG_10550

Not highly similar to any known P450, 36% to 526E1, new family

      MFSPTPQTLSIIIVVFILTTL

83381 LIRRALLPKPIPGIVYREANAKKVLGNAWELLQWKKKHGEMFGYLANLAVELNEPVFQI 83205

83204 FVHPLGKPWVIVADNREAFDILSRRTPKEFDRSRFLRSLFMPLVPEFHFHMPTGDRWK 83031

83030 AHRKLVADTMSPAFLGGVAGPQMWKSTMKLIDLWRVKERLAKGRPFSVSTDIRKAAFEII 82851

82850 WAATFGFDSGSTSAQTELLETLPEFTNLPDMDHEVHFPVAPDPPVFKAGLALNDAMNIG 82674

82673 VQSLVPGLHLWLAYNLMPSLRAARSLKEAVIQDMIKQAINKFSNQTDLNWEDQGNLKR 82500

82499 HMKSAVDIVIAREIDSARKEGRTPELMSRTVQDELFSFMLAGNEIFTLTAWTLKFLTTH 82323

82322 QNVQKKVRDELREQCSAAVERGDAPTVSEIMSARLPYFEAMIEESTRCGSVTQTNIRTTM 82143

82142 QEVNILGHMVPKHTEILMLNNGPGSFMPSLSVDEEKRSESSKGTAGKIGQWNVKGMRDFD 81963

81962 PERWLVKDEEGRLTFNPNAGPRHSFGAGPRACF (1) 81864

81813 GRKWAALEVKIMMALIVWHFNLEPTPKPLSSFKPFPGVAHRPEMIYLRLSNV*

 

>CYP5255A1 Fusarium verticilloides (temp 5255A2)

Supercontig 2: 646261-647922 (-) strand

87% to CYP5255A1

FVEG_01765 and FVEG_01766 join

MATFFLFAFVLLVIGWFGWQRSTKNSSFYGTLPCVGVRKDEWFAWTRAKLRSFSKTEEWMKEGYEM (0)

YSRHNQPFIIPSFRKGKVLILPPAQLKAIYNKREDELL

AHDPASEALSFEWTIRDREVYPSSSTVDVIRKWITKRFEEFAAELQEELCLAVDEQFGMS

QEWREVKLWPAVQRIFTRGLNRVLVGFPLCE (2)

DEAFLETMRRFAIDMPFQGLFITLVPKVLKPFLAPLISWNARRDTEAGIKYCTPIIQ

DYLKANQNSTSEKP (0)

VNILQWIIEASAATGDPSQLETHRIGHRMMILNFNLVQGGSIPFSTVLSDICNGAHAAST

FSQLRDEATSVLASTKIWDRATISKLVLVDSVIRESMRWSDFGLFALPRRVNSPGITLDN

GIHVPPGVHIEVPMHGIHMDESFYADAATFKLFRFADGTSPSRSAVTLDESFLGFGYGKN

ACPGRFFGSHVMKVVLAYLVMNYDVDFGDEEPPMQTMWEYRIPRESTAIKIRRRVQARN

 

>CYP5259A1 Fusarium verticilloides

Supercontig 14: 11152-13123 (-) strand

92% to CYP5259A1 = ortholog

FVEG_09969

MLSREMTIALAVLSLLLVLVHKAISRRRETKGLPPLPPSPPSTNIFAGHLPTVLKAAKNH

RQHLLFQKWAEEYGEVFFVQLGTIQEYFINSDQAVRAIFDKAAAQTSERPRWIVSNEQIC

NRLNLLLLSSSEKAWKSQRKATTFGLTNLNLADAGLPFLHFETLKFLNDIAKDPNKGANP

QSLWSSIGRYTYSTFSSQIFGLDVPEDNSPVIDYIFETGLAQILGMLPGYYLVDTFNILD

KLPLFLKPWERSAKARHKRDYEWCCDKLK (0)

RVKLQIDAGEAPPHMTFIRRVIEDPNHLGLDSLEDASYLGMMLIIGASDT (0)

SRISTWSFLEAMLTFPDVCNKARKVI (1)

DSAVGDRVPVFEDLDSMPYIRQVMKESWRWRPPVALGHPHTTTRDIIYKDYRIPKGARIHLNAW (2)

AIHRDSTRYRDPDNFIPERFDGDTRS (0)

SQESAASPDVSKRDHFVFGAGRRIC (1)

SPGYHIADRSFAVSVMRILWAFDISLKPGTKLP

LDPQSFPGDMPGNPGLELPVVLTVRSPERLETIQKEFEAAMRNRERMEPLAG*

 

>CYP5260A1 Fusarium verticilloides

Supercontig 15:  1333668-1335368 (+) strand

91% to CYP5260A1 = ortholog

FVEG_10960

MLRISDISSSIDRTKLFQYAIIFFVSFKIITYLQRLFFHPLSRFPGPRICAASRLYEFYW

DSFQHGRLWAKLPDLHRRY (1)

GPIICIGPNEVHIEDSQYFDTIFGFRPLNKEAMTAKEFGIDHALFGVEDYKTYVKKRAAF

GNAFSRTKLSKIQDQINEEIQKGCIWVEDNSKDGGPVDLA (2)

FLFRAVPAEIITKYLFGQEYGFLQHVQTTKNLYDKRMDRLFGFSHLGRFIPKEIPLFLS

LFRQLILRALGFNDPGSAFLDYFL (0)

LAQKLVQKVVAQHNHSNENSESVPQHTVFDDFLDSSLPQEEKEKGPLTQQAVAIWSGGWD

TVGFVLTMAAYQLLQNPQVEQRLYEELRKAWKDPNESPEITTLEGLPYLTAVVKETFRLS

PGALCRLSRVNPSGIEQYGDWEIPPGTIISMSIPDVLSDKAIWGSDASVFKPERWLSGSA

DLDRYLVTFSKGTRVCPGIELAWIETRLVIASLFRRYEMSIVPEAGISDDDIMPYYEGFT

PAVKNWISRLPVSVKPR

 

>CYP5261A1 Fusarium verticilloides

Supercontig 11: 1036601-1038275 (+) strand

86% to CYP5261A1 = ortholog

FVEG_08678

MFLLSINAADLAFIVLLALIAFLVFRPLLHYLLDPLDMRKYPAPSFLAATTQWWILKETW

LQRRSRSIHDQHERLGDVIRIAPSLIIFNIPEAVPDIYGHAAARKLVKDTFYDKIAGKER

DIVNVIDHGDHSQRRKYLSNSFALKTVTDMEPIIRQNFQRMLDYLDEIATQDTASQA

LDIRRW (2)

FNYFTLDVIGDMAFSLPMGFLAGRCDTTRVKSPGRHEYHIPSTLDALHRGTRLSTTL

AQLSSIRCVKIIKRLFTSTNWLKQSTGAQGIEDFDNVCTSQLTR (0)

RLNNGSPDRLQQDFMSKILTNREGETRGLSFERLLSESIVFMNAGSETTAAALSSTLYF

LLSNPKCFEKLRGEIDAKPGSSNEGIVSYDSAKDLPYLRACIDESLRLRPPIAYAQQRLV

VCPQGAIIAGHHIKQGTTVAVSPWTIHRNRKLYKDPDEFDPERWFDPEQLSNLRRYYIVF

SQGPRQCLGRHIAIVELQILISTLVRRYDMYLADQEMDFVIFDRFNSNPGPLPVKVERRVFVD

 

>CYP5262A1 Fusarium verticilloides

Supercontig 18: 139667-141223 (-) strand

86% to CYP5262A1, no introns, probable ortholog

FVEG_11855

MTSSSEKTLFYTLTIQTLFLTLAVVFIVLICAWIAYLLGNGSLRHVPGPW YCKVSSIPLS

IYEILCRRNDMILDL HKKYGPIVQVSPNEVSVADFEATKQIYGTKDRWAKSDYFDHFMGY

GRRSIFATKPYEGHRIKRKYTSSFYQAKTIYKLPEIEEHVKSRSLSVLDQVLNGEDVDVF

SLTSWYALDNITFLVFGPNHRTHAVDQMCTERGILEGLKHQQFVGPLRYRCPWLYNHASL

LLQRVSSRLRYLSADEEFPAWCQKKFFAALKDLQLHESHSLVRYLWELKADDAHNGSIDV

AYMAAEVLDNIDAAEATIAVTATYLIWKLTE APEWQDKIRQELSVLPKQDDGYPSFADID

TRVPSLEACLREVYRMHPSSSGKNERVVPLGGRALAGVFIPEHTVVTSSVLALHYDGE VY

SDPDNFLPRRWIDGSEEQRKVLDAQLVPFGYGGRICLGKALATMELKLLIASLYLEHESV

ATLATNAESMNQCSTHDAVPRGLKCEVRFRKMKDNVALE

 

>CYP5262A2 Fusarium verticilloides

63% to CYP5262A1 Fusarium verticilloides

FVEG_06501 revised, not found in the F. oxysporum genome

MLSTTASNIQGYLPSTEALWLGLIVLSVLLSYAWLLYPLLHGRFHHIPGP

WYCKISSLPLAFYDISCCRNEVILSW

HRKHGPVIVIAPNEVSVADLEGTRDVYKATGRWAKSSYFDHFQGYGMR

SVFATKPYEEHRKKRKYTSAFYQASTIYTVPEIEQHIKARSLAFLNQVGAG

QAVDVYSLTSWFAFDNITFLVLGPEYSTCSVDQLCPERGILAGLKSQQF

FGPFRHRYPQLYKFVSRILQTLSSSFYYLSADDALALWCQQQFYTVAQD

PCLSKSHSLVRHLLETEEIEADEGPAYLQYIAAEVLDNINAAEATVAVTAT

YLIWTLTQVPHWQQKIRRELSVLPRMDNGSLSFSDIDSQVPSLEACLREVY

RLYPASSGRAERIVPHGGRDLSGVFLPQGTIVTSSLLALHYDPQ

VYPDPSSFSPERWLEGDEKSQKLSDRYLMPFGYGGRLCLGKALATMELKM

LIASLYLEHESLPTTMTNAGTMKQCSTHDAVPKGLRCVVQFRKTELSN*

 

>CYP5266A1 Fusarium verticillioides

28% to CYP5195A1 Mycosphaerella graminicola

Supercontig 19: 108020-109773 (+) strand, & = frameshifts

97% to CYP5266A1 Fusarium oxysporum = ortholog

FVEG_12216

MAVDLATTVQAFLPRIVVYTIIGTTAAWLLHLMQPAFQAALSKDYQKF

NWAGDKKGVATFMKASYEVALKSREYFKETHRK (0)

ILEAGHGGIQLVPIPHCSTGFMLMVPKQLLNEYVKQPENDISLKRYTLQALV

PDYTTLGPHIVIHPVYRNVVHKELYQKVADKMPMVNEEMKAALDDNVASKLDSNGVVQINM

WDTASAILSRSANRIISGQPLCDNKEYRDATAEYAATFFASALYARFIPPFLRP (2)

LLLPYMCRPLMRCIETAAKHATPVLKERMAIIDAAEEKDIEPDLP (0)

NDMLSAIILTAK & KDPSA &

PSEYEPMVIVARMMVLNFVQSYTNLVTMTNLVYDLISLP

AGDYEAMISDLRAEISQEMAKGDAFSHEFFQRLTLMDSLIRESIRYNPIGETGIERAVGK

QGGFTFSNGIHVPQGAILAAPIKAYQRDERMYPGGFNPRRSMEDPEHPKMTDISPDFLNF

GLGRGACPGRFFTSNLLKLTLTHLLMDYDFERLDKRPENVRKVTIDEPCGRFLITLKKRNHA*

 

>CYP5266A1 Gibberella moniliformis 7600 chromosome 4

AAIM02000163.1 EST DR645966.1 Gibberella moniliformis

Seq in () fits EST, & = frameshifts

97% to CYP5266A1 Fusarium oxysporum = ortholog

21766  MAVDLATTVQAFLPRIVVYTIIGTTAAWLLHLMQPAFQAALSKDYQKFNWAGDKKGVATF  21945

21946  MKASYEVALKSREYFKETHRK (0)

       ILEAGHGGIQLVPIPHCSTGFM  22125

22126  LMVPKQLLNEYVKQPENDISLKRYTLQALVPDYTTLGPHIVIHPVYRNVVHKELYQKVAD  22305

22306  KMPMVNEEMKAALDDNVASKLDSNGVVQINMWDTASAILSRSANRIISGQPLCDNKEYRD  22485

22486  ATAEYAATFFASALYARFIPPFLRP (2)

       LLLPYMCRPLMRCI  22665

22666  ETAAKHATPVLKERMAIIDAAEEKDIEPDLP (0) 22758

       NDMLSAIIL(A)AK & KDPS(G) &

22821  PSEYEPMVIVARMMVLNFVQSYTNLVTMTNLVYDLISLPAGDYEAMISDLRAEI  23018

23019  SQEMAKGDAFSHEFFQRLTLMDSLIRESIRYNPIGETGIERAVGKQGGFTFSNGIHVPQG  23198

23199  AILAAPIKAYQRDERMYPGGFNPRRSMEDPEHPKMTDISPDFLNFGLGRGACPGRFFTSN  23378

23379  LLKLTLTHLLMDYDFERLDKRPENVRKVTIDEPCGRFLITLKKRNHA*  23522

 

>CYP5267A1 Fusarium verticillioides, Gibberella moniliformis

33% to CYP596B1 Nectria haematococca

FVEG_05584 not in F. oxysporum genome

MASLSYVLSLLQGVPIAAQVLTIIAAIPLAIYAYDWLRKERLFPGYPLISLDGKTPEESWINFPKETLVKGAQLCPDSPF

QIASYTGPKLILPQKYAEEVRVAENAHFTKSVTADLPWSLPGFKAFQLQHDHDRVLPTVVRTKLSLSLNQLTKGIVEETL

SVIEDLFGEQTRGGEWQTISIRGAAMQIVAQNTLRIMVGEKLCRDPELIDIHTRHAGAIFAAGSEIRAFPTALWPIVHWF

LPLPQQLRKQLKRAEEIMGQEVRRREQEARTAIASGKKMAKFGDSVAWHVDVPTSLGVKDYDQTAGQLAFTMAALHNTST

QLGGVMWELCEHPEWIDILRKEVISLVTEMGWTRQTLAKMDLMDAFFKETQ &

IYPRPLTTVRRYAEKDLVFHDGLTIPKGRRFFLMPLIRIDKQGEFDPYRWVKRRET

SDDPKGLLFVAAGLESQTFGLGKHACPG (2)

RFFAHDEMKVATALLILKYDWRKLPTTPKPYFGAKEDVAVFPDGVELEIKARKPEVDLS*

 

>CYP5268A1P Fusarium verticillioides

38% to CYP592A1 Magnaporthe grisea, pseudogene not found in F. oxysporum

FVEG_03368 revised

VDSMPFLANLPEALAHFKKEGRRLHEEELSLFRELQSDVRRALEKGYDTQSFTRTFLENRD

SYQLSDDEAAYVIGTLFEAGSGTTAAAMMSYCLTM*YFPEWQKKMQDELDEQ

VGDRMPEFEDIPNLPTVRAVIKEVLRWRPVTAG

GFPHQLTKDDEYEGFIFKKGTIFHPNQWAIHGDPTLYPGPNNFRPDRWLDPQFPTTYKEP

LSKFPNLQNYSCFGFGRRICPGQNIAERSLHILTARVACSGSIIKKRNVNGMELPLPLY

DYTKGFNIQPEHFDFDIIPRPQARLAAIRESLREAKSKWPA*

 

>CYP5269A1 Fusarium verticillioides

37% to CYP53A15 Cochliobolus lunatus, not found in F. oxysporum

FVEG_00023

MSIVESAYGPFSGRGLICGIMVL (0)

VLIQIVRY FLSPIHRLPGPATAKLSTFWLASQCQKVRRSEEVLKLHRKHGDF

VRIAPNHVSINTPDAIQQIYGHKTGFVKGPFYDAFHQVTPVVFNT

RNVSEHTRKRRYINPAFSARALSGFEPHMDTEIAAWKRQLLKISNGASPR

VDFSVWTNYLAFDVIASFAFGEHFGFIEKGEDEYGLIKIIDTRGEFMNAL

GSLSPFLRFVMRYNPFDSFWKDGFRASAGFAKIGKEAFEKRKSSDDNSRKD

LLSFLFNAKDPDSKQPIPEEEIIAESISFIVGGSDTTSSTMTNFIDFVA

RDEDLQLRIQQEIDIIFPGEPSDDWVPSEKKLNDLSLLLATLREVMRLRPTSATGLERVTPQGGKTIAGQFIPAE (0)

TLVSVPTLGVMMDPRIFESPETFRPERWLEPGADELMEYFYPFSTGPRSCIGRN (2)

FAWMEILKAVAVVFKLFHVKRINPKPTVIREG

FFNKAVECEVEIHKRSFNEACEM*

 

>CYP5270A1 Fusarium verticillioides

only 32% to CYP684B1 Nectria haematococca

FVEG_04347

MNYSTISSLDLHAYTHHLYKWLRVFATL

ALAIVLFKLIEFLCRVTYRLYLSPLCKFPGPRLAASSKAWEIYHSLT (1)

NDRFRAIHEMHEKYGNVVRIGPNQVSVASPEAFHHVFVTRCSSFLKTDFYATIQPGIGPN

YAGLFNYINHKQAMAERRDLQPLFSPGSLKHYEARFDEQLDILMEVAKQREK (0)

FFMLDVIGDLALNKSFGQVTSGKEHQYVIDFNNAFMVIGL (0)

QNTFAPIIPLIPYLPFKKLKNAYYGLQRVFSYSQ

ERVEDYLKQDMSKKQGSLMSGYLDPATGEPKDGYSAWSIALAGHGFI (2)

VAGSEATSITLTYIIWMLIKRPDVDQRLRQELSRLSKNYSNTDLANL

PYLDAVIRETLRIYPPAPAPMPRVVPKSGFEFEGVSYPPG (0)

TVISAQPYTIHRHEGVFEDPDEFRPERWLDVPSEKKDRMYRAFIPFSAGQRG (2)

CIGRGLAWMHIMKCIARILQEFHRVELAEGMTDYDMDLIERGALAKPRSTKMWVNAYAKAI*

 

>CYP5271A1 Fusarium verticillioides

only 30% to CYP511A1 Botrytis cinerea,

FVEG_05538 not found in the F. oxysporum genome

MSLLGRIHDLSPETTKDRLILFFLVYVTCYLTYWTGVVIYRITFHPLAKYPG

PFLCRTSWLYQTYYEAFLSGRMLERLPALHQKYGPVVRINPGEVHIKD

ASVFHQIYKQNTRFTKDPIAYTLGVPNAISMLFDISEHKKRRETLNPSFS

KRRILLLEDLMYEELEKVMSHAMPYIERKEPLPIQDAYYCFTADVISHFT

FGKSIDLISQPNFSRERVEQLRSFTNSIWILIHFGFIHKIVSALPRRVAA

FANEGYQMIVWFCEGLAQDAVRRHEHSDGKPKELGEETIFDRLLAGNNSK

ENEADMSRRKQAPKMAAQQIADESVGLLMAGTETTATMLAYGTYYFMTFP

EVQAKIMAELATVQRTESGRLPIQQIESLPYFTGFVKETLRFAHGVPGRL

TRVVPSGGLYIPSINDYIPEGYVVGMSHMMIHNDPEIFEAPNEFRPERWM

GEEGKQLDHWLLTFSKGSRNCLGMNLAYTEMHLMLANVFTRFDLSLIPGT

HEDMIWLDRAIVRNRGNLRVMAKLKSVK*

 

>CYP5271A2 Fusarium verticillioides

54% to CYP5271A1 Fusarium verticillioides

FVEG_05542 not found in the F. oxysporum genome

MAILNTITDVLGPLPETFQGRLVALVVAYTGFSLLYMLFLVIYRLTFHPLAPFP

GPFLCRISWLYQMYFEAIRGGKMLERLPGLHEKYGPIVRINPNEVH

IKDPQVFHEIYGQKTKFTKDPFAYSFGVPTAINVLLDPIVHRQRREMLNPS

FSKRRINMLEDLMYEELGRVFEKITEFVNQGRVIPIQEAYYCYAGDIIS

RVIFGKCLNLIEMPDFATEKIEEIRGFTKGVWISIHFGAIRNLMMNMPQW

LVRMMNESWVGIIDFTEAEASQAITDYHMEGREPKSAKDETIFDRLLDAN

QKSEKERGIKSKFGLKELTDEGVSLLIAGLETTATTITYATYYFHKYPHV

QSRIMAELNSIKLDENGRMPIQQIEAQPYFVGFIKETLRFSHGIPGRLTR

VVPRGGLTVPSAGKTIPAGSVVGMSHLMIHMDPDLFDSPQEFKPERWLED

GGLDHWLVSFSKGTRDCIGKNLAFTEMHLILANIFTTYDIELCPGSDEAM

VMTDRAIARPTSNLRVTAKLKARTV

 

>CYP6001C8 Fusarium verticillioides

98% to CYP6001C9 Fusarium oxysporum = ortholog

FVEG_11670

Name revised from CYP6001C9

MAEHKNGVATNGYEKRASPASSSTKSEAKPLPNGDKKDGIVKSFKQLRVASKRPLPKEMGDGSYRVVENRPGLKEDIRRL

RGRDLKTLLEIVKSKVKGETQQDDKTMIMERTIQLVANLSDHSKVQESLTNSFISQLWNSIDHPPMLYMGDKFRFRQPDG

SNNNPYLPQLGAARTPYSRTVRPKGMSLGAQPDPEAIFESVFARDAFRKNPNNVSSILWYWATIIIHDPNQNDSSSYLDL

APLYGSTEKDRDSIRTFKDGQLKPDCFADKRLIGNPPGVPILLIMFNRFHNHVATNLADINEGGRFSKPAEHLSPEAAEA

AWKKRDTELFETARLVTSGLYINITLIDYVRNIINLNRVDTTWTLDPRQEMGVSVGTKDLSESGTGNVVSAEFNLCYRWH

SCLSEMDDKWVQDFYTELLGENYGPMNLQTMMKALKAFEASVADEPSERTFGGFKRGPDGKFNDDELVEALATAIEQPGG

AFGGRNVPRIMKPIEMLGIMRGRKWNLAGLNEFRKHFGLKAYETFEDINSDPSVADALRNLYQHPDYVELYPGIVAEEAK

TPMVPGVGIAPTYTISRVVLSDAVALVRGDRYYTTDYNPRHLTNWGYKEVDYDLNVNHGCVFYKLFLRAFPQHFKGNSVY

AHYPMVIPSENKKILTDIKRADRFDFSRPEPTATRINIIGYNAAKYILEDQQKYRVCWEEGLKHLMGEAGGRFMLSGDTQ

LHAQQRKCMGKLLYNDTWRNAVKSFYATTAEKLLTEKSYQLAGKTQVDIVRDVGNVAHTHFVARMFNLPLKTSENPKGVF

SEQELYMILAVIFVCIFFDIDPAKSFPLRQGAREVAQKLGGIIEMNVKLANSIGVKGLFTSKPDKNDDPLARYGENMAKG

LKKAGLSTEDIVWSQILPTAGAMVPNQAQVFAQTLDWYLSPAGEKYRPELARIAALETGDETDALLLGYAMEGIRMAGTF

GLYREATGPDTIHEDDGRSIPVNAGDRVFVSFVQAAQDPKIFPNPGVVDPKRPLDKYIHYGVGPHACLGRDISQVALTEL

FRAVFRKKGVRRVPGAQGELKKVPRPGGFFVYMTEDWGSIWPFPTSMKITWDE*

 

>CYP6003A1 Fusarium verticillioides

98% to CYP6003A2 Fusarium oxysporum ortholog

FVEG_09294

Name revised from CYP6003A2

MSFNEKFQAGESYGDSKEDPASLLNNPEKLVADLMKDYAGVRSQASPAQLLGLVKELLQKGQPLDDKKGTTELLIGILTA

LPASSKARTALTNKLIDTLWGNLQHPPLSYVGGDVKYDVVNSDKPAHKHNCELYDTIEFKVPGTDVLLREQVPQAPDGLH

QYRMPDGSFNNILEPNLGRAGTPYAKSVKSEKRLHGVKPDPGLLFDLLMARDETTFQENPAGISSMLFYHAAIIIHDIFR

TNRTDMNKSDTSSYLDLAPLYGSSLKDQLEIRTMKEGKLKPDTFHEKRLLGQPAGVNVMLVLYSRFHNYVADILLKINEN

GRFSMSVPPNASEEEKAKAIAKQDHDLFNVARLITGGLYINICLHDYLRAITNTHHSASDWTLDPRVAIDKQFDGDGVPR

GVGNQVSVEFNLLYRFHSCISKRDEKWINNFFLKLFPGRKAEDLQDVSWTELGQALLTFEQNTPKDPSVRTFDGLERQAD

GTFKDEDLVRILKDAMEDPAGTFGARMVPKALKVVEVLGIIQGRKWQCASLNEFREFFGLKRYDSFSDINSNPDIANILE

KLYTDPDMVELYPGLMIEDIKPQRNPGSGIMPTYSVGRAVLSDAVTLVRSDRFNTIDYTVSNLTAWGYNEVQQDYKTLGG

SMLYKLIQRGVPNWFPFNSIAVMQPMYTKKANEQIAKEIGTFDQYTLDDPKTPPKVAVLTSGPAIKQILSNTKQYVTPWL

KPLNTLFPGKKDFGWFMLAGDQPQNYSHRANFAKAMSKIPNMHNAVHAFIEREGTKLINKETFTLKKGLDQIDIIRDVAI

PLNTQLLADLFYFDLRTDENPDGKLGVAELYRSLLDIRVWGVNNNDPAQAWNRRRRAQEGAKRMIETTKTIVAEADAGRS

RGIGLVNAVANRIGARSYLKKDSLRSCGLKLVEELLAQGNNVDQVTDNLWLTAFGGIGVPVTAFYEVLSFFLRPENEAIW

AEVQAIAQKGDDATLHAYVAEAQRMTSSQRNVRVATAPGEVQGQTIQPGTAVVLMLGEAGRNPKEVPDAGKFNPQRKKED

VSAFSYGQHECIAKDVALAFVTGLIKLVADLKELRPAPGQMGTVKTIQVGTEKAYLNDSWSYLGFDASTWKVHFNGHGKG

KFEGERVPTKSTPIQEYYYLLQKRKDEILGK*