LOCUS       NC_007517              20000 bp    DNA     linear   BCT 13-APR-2006
DEFINITION  Geobacter metallireducens GS-15, complete genome.
ACCESSION   NC_007517 REGION: 1..20000
VERSION     NC_007517.1  GI:78221228
PROJECT     GenomeProject:177
KEYWORDS    .
SOURCE      Geobacter metallireducens GS-15
  ORGANISM  Geobacter metallireducens GS-15
            Bacteria; Proteobacteria; Deltaproteobacteria; Desulfuromonadales;
            Geobacteraceae; Geobacter.
REFERENCE   1  (bases 1 to 20000)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C.,
            Glavina,T., Hammon,N., Israni,S., Pitluck,S., Di Bartolo,G.,
            Chain,P., Schmutz,J., Larimer,F., Land,M., Kyrpides,N., Ivanova,N.
            and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of Geobacter metallireducens GS-15
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 20000)
  AUTHORS   .
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2005) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 20000)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C.,
            Glavina,T., Hammon,N., Israni,S., Pitluck,S., Di Bartolo,G.,
            Chain,P., Schmutz,J., Larimer,F., Land,M., Kyrpides,N., Ivanova,N.
            and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (11-OCT-2005) US DOE Joint Genome Institute, 2400
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CP000148.
            URL -- http://www.jgi.doe.gov
            Source DNA and bacteria available from Derek Lovley
            (dlovley@bio.umass.edu)
            Whole genome sequencing and draft assembly at JGI-PGF
            Finishing done by JGI-PGF
            Quality assurance done by JGI-Stanford
            Annotation done by JGI-ORNL and JGI-PGF
            Contacts: Paul Richardson (microbes@cuba.jgi-psf.org)
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..20000
                     /organism="Geobacter metallireducens GS-15"
                     /mol_type="genomic DNA"
                     /strain="GS-15"
                     /db_xref="taxon:269799"
     gene            261..1613
                     /locus_tag="Gmet_0001"
                     /db_xref="GeneID:3739696"
     CDS             261..1613
                     /locus_tag="Gmet_0001"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein, DnaA"
                     /protein_id="YP_382976.1"
                     /db_xref="GI:78221229"
                     /db_xref="InterPro:IPR001957"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:3739696"
                     /translation="MEDVWLQAQSNLAKVLTHQTFTTWIEPIRFAGAHKNTLLLEAPN
                     QFIRDRVRESYLPMILESVRSLTDSHFQVELQVAARQQEKTAKSPRKSHTEDELGPVE
                     SEKCAPAEFSTNLNAKYTFDTFVCGGSNQFAHAAALSVANNPAGKYNPLFIYGGVGLG
                     KTHLLTAIGNQVLTKNRKARVCFYTSEKFMNELINCLRYQKMEQFRNKFRKMDLLLID
                     DIQFIAGKERTQEEFFHTFNALYESHKQIVVTSDKFPKDIPGLEERLRSRFEWGLIAD
                     IQPPDTETKVAILSKKADSDGIRLPDDVALFLASSASTNVRELEGMLIRLGAVASLTG
                     KNITLDMAREVLKDIIVDKTKEVTVEMIQKYVADHFNIKVAELKSDKRLKALVVPRQI
                     AIYLCRDLTKASYPDIGEKFGGKDHSTIIHSVKKVDKLLSQDFELKSTIETLRKGLLN
                     "
     gene            1837..2958
                     /locus_tag="Gmet_0002"
                     /db_xref="GeneID:3739904"
     CDS             1837..2958
                     /locus_tag="Gmet_0002"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III, beta chain"
                     /protein_id="YP_382977.1"
                     /db_xref="GI:78221230"
                     /db_xref="InterPro:IPR001001"
                     /db_xref="GeneID:3739904"
                     /translation="MEFKIDKETFSRALQKIQGIVEKRNTMPILSNVLIEAHADRIEL
                     TATDLEVGMKSSYETTVTREGRITVSAKKLYEIVKELPEEAISFATKENDWVEIRCGK
                     AHFSIVGLSPEEFPYFPKVNEESLIRIEGALLADMIEKTAYAICFDETKYNLNGTFVK
                     ATVEDDKPILRMVATDGHRLSIAEKEFHGAVGPEMAKGVIFPKKGIFELKKICEEATT
                     EELALGFMDNSAVIKKGNTVVVMRLVDGEFPDYTRVVPVANDKIVTVARDPFLHSLRR
                     MSILSSEKFKGIRMEINGEQMIISSSNPELGEASEELDAAYSGPPLSIRFNAKYLLDV
                     LAVLNESEVALVLRDELSPAIVKPAAVDGFTAVIMPMRL"
     gene            3041..4138
                     /locus_tag="Gmet_0003"
                     /db_xref="GeneID:3739905"
     CDS             3041..4138
                     /locus_tag="Gmet_0003"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="RecF protein"
                     /protein_id="YP_382978.1"
                     /db_xref="GI:78221231"
                     /db_xref="InterPro:IPR001238"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="GeneID:3739905"
                     /translation="MFVTKIQISSFRNIAAAEIRFDRRFNVLHGANGQGKTSVLEAIY
                     LLGTMKSFRLAKTPDLVSWNTPHALLRGWAERDGVGREIALYLGKEGRKARVDQKPVT
                     RLADFFGNVNAVVFSPEEIAMARSGPDLRRRYLDRAIFSGDLGYLLLHHEYHRLLKQR
                     NALLKRGSREGLDIWTGQLAEAGTRLMVKRMGYLAEIEPLVQRFYREIAGGEEEAGLA
                     YRPHLTTPDLVSREGTDALLALFGAHEAEELRRGTTVVGPHRDDVDFVLNGRVIRTHG
                     SQGQQRSFVLALKMAEIEYLERLNDAPPVLLLDDISSELDPQRNANLMTFLREKRMQV
                     FITTTDVSTLRLAGIATHASFHVSRGTVTPL"
     gene            4149..6536
                     /locus_tag="Gmet_0004"
                     /db_xref="GeneID:3739906"
     CDS             4149..6536
                     /locus_tag="Gmet_0004"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase, B subunit"
                     /protein_id="YP_382979.1"
                     /db_xref="GI:78221232"
                     /db_xref="InterPro:IPR000565"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002288"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR011557"
                     /db_xref="InterPro:IPR011558"
                     /db_xref="GeneID:3739906"
                     /translation="MADELNNDYGADKIKVLEGLEAVRKRPAMYIGSTASQGLHHLVY
                     EIVDNSIDEALAGYCNEVNVTIHLDGSITVVDNGRGIPTEMHPTEGKPAAEVALTVLH
                     AGGKFDNTSYKVSGGLHGVGVSVVNALSKKLELGIRRDGKVFQQSYAYGAPLTPLEIV
                     GETKKRGTRITFLPDDTIFETTEFSFDILSQRLRELAFLNAGVRITISDEREEGKHHD
                     FHYEGGIVSFVEYLNRNRTVLHPKPVYFRGERAGIDMEIAIQYNDSYDEKVFTFANNI
                     NTHEGGTHLVGFRAALTRSMNSYAAANELTKKEKVSISGEDLREGLTAVISVKIPQPQ
                     FEGQTKTKLGNSEVKGFVESLMNEQLAVFLEENPKIAKDIIGKSIEAARAREAARKAR
                     ELTRRKSALDISSLPGKLADCQERDPALCELYLVEGDSAGGSAKQGRDRKFQAILPLK
                     GKILNVEKARFDKMLSSQEIGTLITALGTSIGKEDFDVAKLRYHRIIVMTDADVDGSH
                     ILTLLLTFFFRQMPEVVERGHLYIAQPPLYKVKRGRKELYLRNEAAMQAYLLEEGTED
                     MVLFLENGEKTYTGKQIIPILKQLVEYRTILDKVVRKGINEELIRVFLRLGVKAGIED
                     MEQLVPYLANISRVYEGGDSSPLDDGRAIVRLGNLRIALDQHTLDIIGSYEYGLLAES
                     FRKVREMFGDGRAVVSSEGKELFATAIGLDLLSFFMDSAKKGLSIQRYKGLGEMNPDQ
                     LWETTMEPTNRTLLQVKIEDAIEADTIFTILMGDQVEPRRDFIEKNALNVSNLDI"
     gene            6570..9143
                     /locus_tag="Gmet_0005"
                     /db_xref="GeneID:3739907"
     CDS             6570..9143
                     /locus_tag="Gmet_0005"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase, subunit A"
                     /protein_id="YP_382980.1"
                     /db_xref="GI:78221233"
                     /db_xref="InterPro:IPR002205"
                     /db_xref="InterPro:IPR005743"
                     /db_xref="InterPro:IPR006691"
                     /db_xref="GeneID:3739907"
                     /translation="MLEQTLNKTAVNIEDEMKRSYMDYAMSVIIGRALPDVRDGLKPV
                     HRRCLYAMYDMGNDYNKPYKKSARVVGDVIGKYHPHGDTAAYDTIVRMAQDFSLRYPL
                     VDGQGNFGSVDGDSPAAMRYTEIRMEQLAHELLNDLEKETVDLGFNYDGSLTEPLVLP
                     SKFPNLLVNGSSGIAVGMATNIPPHNLSEVIDGIIATIGNPHISFEELLALVPGPDFP
                     TGGFIYGREGILQGYRTGRGIVQMRARASIETHKKTERQSIVVTEIPYQVNKANLITK
                     IAELVREKKLEGISDIRDESDRDGMRIVIDLKRDENPQVILNHLYKQTQMQTSFGINM
                     LAIVAGRPKVLTLQDAIGHFIDHRREIVTRRTIFDLKKAEARAHILEGYKIALDWLDA
                     VIELIRGSKTPAEAREGLMSGLFSDEEWLQKMGLPLPAIHSQYQKPVRLTEVQAQEIL
                     NLRLHRLTGLERDKILQEYEDILKYIARLKEILASEAEILKIIVGELRELKEKFGDER
                     RTEIVDRSAEISLEDTIVEEDVVVTVSHTGYIKRTAVSQYRSQRRGGKGKTGMKTKEE
                     DFVEHLFVASSKDFMLFFTDAGKVYQIKVYEIPEGGRATRGKAIVNLLNLQENEQITA
                     ILSVKGFDDERNILMATRLGVVKKSPLREYANIRSGGIIAVNLDEEDKLIAVALTDGR
                     QDVLLASRNGKSIRFHEEDARPMGRVSRGVRGMTLEDDDVVIGMEVINPSATGSTIFT
                     VTENGFGKRTELDEYRVQSRGGKGIITIKTTERNGCVVDIMQVTDENDLMLITDQGKI
                     LRIPVAPFSVIGRNTQGVRLMTAEQNERIVAVAKLAEKDEGDEGPDSGDDLPEAEVVE
                     E"
     gene            9171..10790
                     /locus_tag="Gmet_0006"
                     /db_xref="GeneID:3739908"
     CDS             9171..10790
                     /locus_tag="Gmet_0006"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_382981.1"
                     /db_xref="GI:78221234"
                     /db_xref="GeneID:3739908"
                     /translation="MMRIFRPRVPGPRFPPMKSNRSIDTSLRERHTILNLLEELTRET
                     VTTDELTRIGTTLRAAGRRALSPLFRRLWREKNEAVISRYTTLLSFFEDDGWLEQLIQ
                     VALTRKDLEGPARSALIQALAGYGVDVSAPPFAQAVDGSGGSLRLAVPRLLDRGEEGL
                     IVFMEEFAAYGLEAQKAIVRELCFVDDPRVVDLFGVLLAFDEPDTHREIIETLGRVRF
                     PGAARLLRRYLAEAHEEHRSLAERSLRRLGFLGVDAGDGGAEPQLPFHATWASPPDAA
                     GLSCLLVARWTASNRLDVLFMELHETDGMRDAWGWSGLTPDEYGDIVRENAVEETLVA
                     VDPGYAADLIGDALERSHASGFYLPPEFYVRQRILSGLDVTPRPYVPSFGGMELAGAD
                     RPDVVAGSAGLLDDWFFDGWFFFDSRTRLLADELERFGDEPFAREDEAAVDRFLEQWC
                     SQEVAPRLERIVRRLFLTADLMVRAGREEHPVAQTVACAVSLSRGIIPLHRHPFLRRW
                     LLELIGMVREARAEGYQFPPTPWDDEDGEWD"
     gene            complement(11025..11564)
                     /locus_tag="Gmet_0007"
                     /db_xref="GeneID:3739909"
     CDS             complement(11025..11564)
                     /locus_tag="Gmet_0007"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_382982.1"
                     /db_xref="GI:78221235"
                     /db_xref="GeneID:3739909"
                     /translation="MSFFGSPTHPRGMGPLIRLCLHNDVEPWFIPMAEPWRNGMIEKF
                     NDRYQQRFLGKVIMTSEEELKVGSLTFEQRHNSKYRYSKLKGSTPLKALATSHVQLRF
                     PTEDEPPRHRLKKPEVGKYHAVRLIRSDLKLNIFGECFSVPPETALEYVVATIDVKEQ
                     KLKLFLDKNQVEEFDYKLR"
     gene            12343..13350
                     /locus_tag="Gmet_0008"
                     /db_xref="GeneID:3739910"
     CDS             12343..13350
                     /locus_tag="Gmet_0008"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent glycerol-3-phosphate
                     dehydrogenase-like"
                     /protein_id="YP_382983.1"
                     /db_xref="GI:78221236"
                     /db_xref="InterPro:IPR003710"
                     /db_xref="InterPro:IPR004455"
                     /db_xref="InterPro:IPR006109"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="InterPro:IPR006168"
                     /db_xref="InterPro:IPR011128"
                     /db_xref="GeneID:3739910"
                     /translation="MGEKIGVIGAGSWGTTLANLLAKKGLDVTLWAYEPELVAEMRAT
                     RVNTLFLPGTELAAGLAFTNSLEEAAAGKDVLVLVSPSQVMRSVLTQLAPLLKPGVTL
                     VNASKGIELDTLMTMDQVCGAVLPPAVAGRFCVLSGPSFAREVAQEMPTAVVAASADL
                     EAAAQVQRLFTAPYFRVYTNSDVVGVEIGGALKNVIALAAGISDGLGLGHNTRAALIT
                     RGLAEMNRLGRAMGADPATFAGLAGMGDLVLTCTGDLSRNRTVGMKLGQGMRLAEILG
                     EMRMVAEGVKTAESAWRLASQMGVDMPITEKVYQVLYEDKPARQAVLELMTRDPKAER
                     G"
     gene            13386..15677
                     /locus_tag="Gmet_0009"
                     /db_xref="GeneID:3739911"
     CDS             13386..15677
                     /locus_tag="Gmet_0009"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS/PAC sensor signal transduction histidine
                     kinase"
                     /protein_id="YP_382984.1"
                     /db_xref="GI:78221237"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR008358"
                     /db_xref="GeneID:3739911"
                     /translation="MNLRLTIRNKLFLATLLILFISYAILIQTTVTSINTSLEDNLAK
                     ELAENLRYAKDQYFSRAEHLKYALLLPASAQTVQERVERRDRVWLQETARRWKTSLPF
                     AEPFLFVDPQLKVIAGDGESVPENVRELAPIVERALREKRPVSATELVSDRFLCSAGV
                     RDFCSRPPYGDGSVMMITVVVPVLAEGGEALGAIVAGEVIDRDVKQAAGTQEIFGKQV
                     VVAVIRGNRLAPAGVNPAFPYPAAIAPDILDKLERGQSFGGDVTIGGKAYKTAISPLT
                     NSRGDYVGSLYVALSRDDLKGILGDSLKNILVSAAIGIVLTFLTAFHVARRLTMPLNA
                     LAGGVRKIESGDLRQRVEVTTADEVGELGEAFNRMARSLEERDRTIRATAHEQAELNR
                     KLQEMNEHLEENVSERTTALQMEMGRLEAILTGMAEGIAVTDREGKVILFNPAAQRIF
                     EMVPPRVMGHTLEELCAGGEFCALADYVRTMKETDDLTPRRDVEMSMKGKKLTISLSP
                     FCDQGGALAGVVMSVRDVTGEEDVDRVKTEFISTVSHELKTPLTSIKGSLQFIHDRGE
                     GFGGMEGELLSVCLRNTDRLIRLVNDILDIARIESGRLEFVPEPQDVRTLVTHSIEEL
                     AGYALEHDVSVENRCGQDLPPIYGDRDRLVQVLTNLLSNAIKFSPRGERVVVTAERTS
                     NYVAISVGDRGREILWSDRGKLFKKFQLLDNSDRRQHGGTGLGLAICKEIVEHHHGRI
                     FYNEGTGGGNVFTFTVPVYEEQS"
     gene            15674..17200
                     /locus_tag="Gmet_0010"
                     /db_xref="GeneID:3739912"
     CDS             15674..17200
                     /locus_tag="Gmet_0010"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="multi-sensor signal transduction histidine
                     kinase"
                     /protein_id="YP_382985.1"
                     /db_xref="GI:78221238"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:3739912"
                     /translation="MNNLKILIVDDEADIALILKLQLEDAGYRTTRARDGLEALEMLA
                     REHYDLILLDIRMPRLDGIEVLERIRQEWPELVVVMMTAHGSEDIAVEAMKKGAVDYI
                     SKPFSSDDMKKRVERAIEYNRTRLENERLQREVEEERRKMEAILQGMAEALVAVDRQG
                     LVMSINRTAAELFGVDAAAVHARPVEELLSAAIPADRLPCRVVLATGEPCLDVAYDLR
                     LPGRIVPVLSSAAPLANAAGEMIGSVEIIRDISALKALEQEREDFVSMLSHDLKTPIT
                     AIIGSIDLVKEGRLGPVNPEQSMYLDAAVESCAEMVDMIDTLLDVHRFEAGRMVTTLV
                     EEELGPLLQRTVGRFEPVARHSGLELTLSLPGAPVTFLVDRKQFGRLLGNLLSNALKF
                     TTEGGIEVRAELPENAAAAAQGITPGAYPTERLPREGRYLLVSVSDTGAGIPADSLVT
                     IFDRFVQARNRKMGKSSGTGLGLAFCRKVMDAHHGFIWAESEPDRGSTFRMLFPLGTD
                     "
     gene            17225..18676
                     /locus_tag="Gmet_0011"
                     /db_xref="GeneID:3739913"
     CDS             17225..18676
                     /locus_tag="Gmet_0011"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS/PAC sensor signal transduction histidine
                     kinase"
                     /protein_id="YP_382986.1"
                     /db_xref="GI:78221239"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:3739913"
                     /translation="MKLPYHTMPFRIAAYYALCAGLWILLSDRLLGVAVRDPDLITSL
                     ETAKGWLFVAVTALLLHVVVRRFVDEVMRREELLRERNEELCMVEEELRQQLDESERA
                     QQELRESEENYRLLFSSNPHPMCVFDLETLAFLEVNGSAIQHYGYSREEFLAMTIKDI
                     RPPEDVPSLMAIVKRVDSGPDRVGVWRHRKKDGTIISVEITSHMIDFAGRRAKVILCN
                     DVTERIRAKEEILRLNAELEQRVRQRTAELEQANREMESFSYSVSHDLRAPLRHIDGF
                     SRVLLEDCGDQLNQEGKGYLTRICAAANRMGQLIDDLLQLASVSRSELQRRPVDFSNL
                     ARTIALELKQTDPEREVTFTIAGGVSAQGDPVLLRVVLENLLGNAWKYTGKNHRTAIE
                     FGAVEGEEGRVYFVRDNGVGFDMTYVGKLFTPFQRLHAMDEFEGTGIGLATVRRVVER
                     HGGRAWAEGTIGAGATFYFTLGESHRLAEGDEG"
     gene            18680..>20000
                     /locus_tag="Gmet_0012"
                     /db_xref="GeneID:3739914"
     CDS             18680..>20000
                     /locus_tag="Gmet_0012"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="multi-sensor signal transduction histidine
                     kinase"
                     /protein_id="YP_382987.1"
                     /db_xref="GI:78221240"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:3739914"
                     /translation="MDDLHLRILLAEDSEEDAFLLLRELERGGYTVECERVQTRSAMK
                     KALVSRQWDMVISDYRMPRFSAPQALETLKESGLDLPFIIVSGKIAEDMLVDAMRAGA
                     NDYFMKGNLSRLIPAIERELREAAERRIRRRAERAIRQGKMEWEAAFDAVSDLVLLTD
                     LYSTVIRCNNRVIEAFNATYSDILGRNITELFYGSPDAGESIFDQCTDLKADNGDVRF
                     PKLTGWYKASCFPMHPTENEHGFVYVIKDVTKRKKMEEEKELATLELLRSRQALRENL
                     EEMKRANMELGRLNAAKNTVIGMASHELKTPLTSIIGGLQFLFHYSGLEMTPEQKEMM
                     ESVYEGVTQLRGIVDDLLSISRIETKGFAVTKRMVNLLNLCREVRHTLLLPLSERDIE
                     LSIAEDTCSIPADEGFCRLVTRNLLENAIKFTADGGRITISGELTSLDDLLPQADSLR
                     CFYREFPSNIEGHPAFYRLDIADTGIGIPPEERVRIFEKFYGVGDLAYHSSGKTGFMS
                     KGSGLGLSIVKGIMDAHGGMVWVGPGENGSGSVFSLLFPMDNTCVIPPREGRR"
ORIGIN     
        1 tgtctcttta gctgatattg caaagagagt atctttaatc acagcaacca ttgtctgtca
       61 agtacaaatt tacctcccta cggtacattt ggccttgcaa acgcccctct cctctgctag
      121 tctcctctat cctgaggcta catccagcct gtccagaata gtagcttttc cacttccaat
      181 acctcaattt atcaacaaaa atccagttat tcacacctgt tgacaaccat gtgtataact
      241 ggtccccgag actaccctct atggaagatg tttggctcca ggcacaatcc aatctggcca
      301 aagtgctcac gcaccagacc ttcaccacct ggatagagcc gatcaggttc gccggagccc
      361 ataagaatac tctcctcctg gaggccccca accagttcat cagggaccgg gtcagagaga
      421 gctatcttcc catgatcctc gaatcggtcc gctccctcac cgactcccac ttccaggttg
      481 aactccaggt ggcggcccgg caacaggaaa agaccgcgaa aagcccacgc aaaagccata
      541 cagaggatga gctcgggccc gttgagtcgg aaaaatgcgc gcctgccgaa ttttccacca
      601 atctgaacgc caagtatacc ttcgacacct ttgtctgcgg cgggagcaac cagttcgccc
      661 atgcagcggc cctgtcggtg gccaacaacc cggccggcaa gtacaatcca cttttcatct
      721 acggcggcgt gggtctgggg aaaacccatc tcctgacggc catcggcaac caggttctga
      781 ccaagaaccg caaggcccgg gtctgtttct acacctccga gaaattcatg aacgagctca
      841 tcaattgcct ccgttaccag aagatggagc agttcaggaa caagttccgc aagatggacc
      901 tcctcctcat cgacgacatc cagttcatcg ccggcaagga acggacccag gaagagtttt
      961 tccacacttt caacgccctc tacgagtcac acaagcagat cgtggtcacc tcggacaagt
     1021 ttcccaagga catccccggc ctggaggaac ggctccgctc ccgcttcgag tggggactca
     1081 tcgccgacat ccagcccccg gacaccgaga ccaaggtggc catcctcagc aagaaggccg
     1141 attccgacgg catccgcctt ccggacgacg tggcgctctt tcttgcctcc agcgccagca
     1201 ccaacgtgcg ggagctggaa gggatgctga tccgcctcgg cgccgtggcg agcctcacgg
     1261 gaaagaacat cacccttgac atggcccggg aggttctgaa agacatcatc gtcgacaaga
     1321 ccaaagaggt caccgtggag atgatccaga agtatgtggc cgaccacttc aacatcaagg
     1381 tggcggagct taagtcggac aagcgcctca aagcgctggt ggtgccacgc cagatcgcca
     1441 tttacctctg ccgcgacctg accaaggcct cgtacccgga tatcggggag aaattcggag
     1501 ggaaggacca ctcgaccatc atccactcgg tgaagaaggt ggacaagctc ctctcccagg
     1561 atttcgagct gaaaagcacc attgagaccc tgcgcaaggg gctgttgaac taaaggggac
     1621 aaccctgtga atggagggac cctttgtgga caaccttcct atccttgacc gtccgctccg
     1681 ggataacccg gcagccgtca acagggaagt actgataaaa attgtgttac tatcgtgagt
     1741 taccgggtta tccccggatc cacagcccct attgcttcta ctaagcttta aaaaagcata
     1801 aacatactaa tctgcatctg ttgacaagga ggagcgatgg aattcaagat cgacaaggaa
     1861 accttctccc gggctctcca gaagatccag ggaatcgtcg aaaagaggaa caccatgccg
     1921 atcctctcca acgtccttat cgaggcccat gccgatcgga tcgagctgac ggccacggac
     1981 ctggaagtgg gaatgaagag ttcctacgag acgactgtga cccgggaggg acgaatcacc
     2041 gtttcggcca agaagctcta cgagatcgtc aaggaactcc ccgaggaagc catctctttc
     2101 gccaccaagg agaacgactg ggtggaaatc cgctgtggca aggcccattt cagcatcgtc
     2161 ggcctttccc ccgaggagtt tccctatttc cccaaggtga acgaagagag cctgatccgg
     2221 atcgaggggg cgctcctggc cgacatgatc gagaagaccg cctacgccat ctgcttcgac
     2281 gagaccaagt acaacctgaa cggcaccttc gtgaaggcca ccgttgaaga tgataaaccg
     2341 attctccgga tggtggccac cgacggccac cgcctctcca tcgccgagaa ggaattccac
     2401 ggggccgtgg ggcccgagat ggccaagggg gtcatcttcc ccaagaaggg tatcttcgag
     2461 ctcaagaaga tctgcgagga ggcgaccacc gaagaactgg ccctcggctt catggacaac
     2521 agcgccgtca tcaagaaggg gaacaccgtg gtggtgatgc ggctcgtgga cggtgagttc
     2581 cccgactaca cccgcgtagt ccccgtggcc aacgacaaga tcgtgaccgt ggcccgggat
     2641 ccgttcctcc actccctgcg gcggatgtcg atcctctcca gcgagaagtt caaggggatc
     2701 cggatggaga tcaacggcga gcagatgatc atctcctcca gcaaccctga actgggggaa
     2761 gcgtcggagg aactggacgc ggcctacagc ggccctcccc tttccatccg gttcaatgcc
     2821 aagtacctcc tggacgtcct ggcggtcctc aacgagagcg aagtggcgct ggtcctccgg
     2881 gacgagctgt cgccggccat cgtgaaaccg gccgcggtcg acggtttcac cgcggtgatc
     2941 atgccgatgc ggctgtagga aacagtaacc ggcaggcacg gaaggcgaag gcccctcccc
     3001 gggagaggcc ttttgccgtt ctttcggcta tagaaacacc atgtttgtga cgaagatcca
     3061 gatcagttcc ttccggaaca tcgccgcggc ggagatccgc ttcgaccggc gcttcaatgt
     3121 cctccacggc gccaacggcc aggggaagac ctcggtcctg gaggccatct atctcctggg
     3181 gaccatgaag tcgtttcgcc tcgccaagac ccctgatctt gtcagctgga acacccccca
     3241 tgcgctcctg cggggatggg ccgagcggga cggggtcggc agggagatcg ccctctacct
     3301 ggggaaggaa ggccgcaaag cgagggtcga ccagaagccg gtgacccggc tcgccgattt
     3361 cttcggcaac gtgaacgccg tggtcttctc ccccgaggag atcgccatgg cccgcagcgg
     3421 cccggacctc cggcgccgct acctggaccg ggccatcttc agcggagatc tggggtacct
     3481 gctcctccac cacgagtacc accggctcct caagcagcgc aacgccctgc tgaagcgggg
     3541 aagccgggaa gggctcgata tctggaccgg acagctggcc gaagcgggta cccggctcat
     3601 ggtaaagcgg atgggatacc tggccgagat agagccgctg gtgcaacggt tctaccggga
     3661 gattgccggg ggcgaggaag aggcggggct tgcctatcgt ccccacctca ctacccccga
     3721 cttggtgagt cgggagggaa cggacgcgct tctggctctc ttcggggccc atgaggcgga
     3781 ggaactccgc cggggaacca ccgtggtggg cccccaccgg gacgacgtgg acttcgtcct
     3841 gaacggccgg gtgatccgca ctcacggctc ccaggggcaa cagcgcagct tcgtcctggc
     3901 ccttaagatg gcggagatcg agtacctgga gcggctcaac gacgccccgc cggtgctgct
     3961 cctggacgac atctcgtcgg agctggatcc gcagcgcaac gcgaatctca tgaccttcct
     4021 ccgggaaaag cggatgcagg ttttcatcac caccaccgat gtttcaaccc tccgcctggc
     4081 ggggattgca acccacgcgt ccttccacgt ttcacgtgga acggtgacgc ctttatagag
     4141 ggagaagtat ggctgacgaa ctgaacaacg attacggagc ggacaagatc aaggtccttg
     4201 aggggctcga agctgttcgc aagcgccccg ccatgtacat cggctcaacc gcgagccagg
     4261 ggctccacca tctggtctac gagattgtcg ataactccat cgacgaggcc ctggccggct
     4321 actgcaacga ggtgaacgtc accatccacc tggacggctc cattacggtg gtggacaacg
     4381 gccggggtat tcccaccgag atgcatccca ctgaagggaa accggcggcg gaggtggccc
     4441 ttacggttct ccatgccggc ggtaagttcg ataatacgtc atacaaggtg tccggcggtc
     4501 tccacggggt cggcgtatcg gtcgttaacg ccctgtcgaa aaagcttgaa ctgggaattc
     4561 gccgtgacgg gaaggtgttt cagcagtcct atgcctacgg agcaccgctg actcccctgg
     4621 aaattgtggg ggagaccaag aaacggggaa ccagaatcac tttcctcccc gacgacacca
     4681 tcttcgagac cacggaattt tccttcgata ttctttccca gcggctgcgg gagctggcct
     4741 tcctgaacgc cggggtgcgg atcaccatct ccgacgagcg ggaagagggt aaacaccacg
     4801 actttcacta cgagggggga atcgtctcct tcgtggagta cctgaaccgg aaccgaaccg
     4861 tgctccatcc gaaaccggtc tacttccggg gtgagagggc ggggatcgac atggagatcg
     4921 ccatccagta caacgactcc tacgacgaga aggttttcac ctttgccaac aacatcaaca
     4981 cccacgaggg tggtacccac ctggtggggt tccgggcggc actcacccgc tccatgaact
     5041 cctacgccgc ggccaacgag ctgacgaaga aggagaaggt ctccatctcc ggcgaggatc
     5101 tgcgggaggg gctcacggcg gtaatctcag tcaagattcc ccagccccag ttcgaggggc
     5161 agaccaagac caagcttggg aactccgagg tgaaggggtt cgtggaatcc ctcatgaacg
     5221 agcagctggc ggtcttcctg gaggagaacc cgaagatcgc caaggacatc atcggcaaat
     5281 ccatcgaagc ggcccgggcc agggaagcgg cccgaaaggc ccgggagctg acccggcgta
     5341 aaagtgccct ggacatctcc agcctccccg gcaagctggc cgactgccag gagcgggacc
     5401 cggccctctg tgagctctat ctcgtcgagg gtgactccgc cggcggctcc gccaaacagg
     5461 gacgggaccg gaagttccag gcgatcctgc cgctcaaggg gaagatcctc aacgtggaga
     5521 aagcccggtt cgacaagatg ctctcctccc aggagatagg caccctgatc acggccctgg
     5581 gtaccagcat cggcaaggaa gacttcgacg tggcgaagct ccgctaccac cggatcatcg
     5641 tcatgaccga cgccgacgtg gacggctccc acatcctgac gctgcttctc accttcttct
     5701 tccggcagat gccggaggtg gtggagcggg ggcacctcta catcgcccag ccgccgctct
     5761 acaaggtgaa gcggggccgc aaggagctct atctccgcaa cgaggcggcc atgcaggctt
     5821 acctcctgga ggaggggacc gaggatatgg tcctcttcct ggagaatggc gagaagacct
     5881 acaccggcaa gcagatcatc ccgattctca agcagctggt ggagtaccgg accattctgg
     5941 acaaggtggt gcgcaagggg atcaatgagg agctcatccg ggtctttctg cggctcgggg
     6001 tcaaggccgg catcgaggac atggagcagc tggtgccgta cctggcgaac atctcccggg
     6061 tctacgaggg gggtgattcc agccccctgg acgacgggcg ggccatcgtg cggctcggca
     6121 acctccggat tgccctggac cagcacactc tcgacatcat cggatcctac gagtacgggc
     6181 tcctggccga aagcttccgg aaggtcaggg agatgttcgg cgacggccgg gccgtggtct
     6241 ccagcgaggg gaaggagctc ttcgccaccg ccatcgggct cgacctcctc tccttcttca
     6301 tggactccgc caagaagggg ctctccatcc agcgctataa aggtctcggc gagatgaacc
     6361 cggaccagct ctgggagacg accatggagc ccaccaaccg gacgctcctc caggtgaaga
     6421 tcgaggacgc catcgaggcc gacaccatct ttaccatcct catgggagac caggtggagc
     6481 cccgccggga cttcatcgag aagaacgccc tgaacgtgtc gaacctcgac atctgatgac
     6541 cgatattagt aattatccga ggaaacagaa tgcttgaaca gaccctgaac aagactgccg
     6601 tcaatatcga agacgagatg aaacgctcgt acatggacta cgccatgagc gtcatcatcg
     6661 gccgggccct ccccgacgtg cgggacggcc tgaagccggt gcaccggcgt tgcctctacg
     6721 ccatgtacga catggggaac gattacaaca agccctacaa gaagtcggcc cgggtggtcg
     6781 gtgacgtgat cggtaagtac cacccccacg gcgacacggc ggcctacgac accatcgtcc
     6841 ggatggccca ggacttctcc ctccgctacc ccttggtgga tggccagggg aacttcggct
     6901 ccgtggacgg cgactcgcct gcggccatgc ggtacaccga aatccggatg gagcagctgg
     6961 cccacgagct cctgaacgat ctggagaagg agactgttga cctggggttc aactacgacg
     7021 gctccctcac ggagccgctg gtgctcccct ccaagttccc gaacctcctg gtgaacggct
     7081 cttcggggat cgccgtcggc atggccacca acatcccccc ccataacctc tcggaggtca
     7141 tcgacgggat cattgccacc atcgggaacc cgcacataag cttcgaggag ctcctggccc
     7201 tggtccccgg tcccgatttc cccaccggcg ggttcatcta cggccgggag gggatcctcc
     7261 aggggtaccg gaccggccgc ggcatcgtcc agatgcgagc ccgggccagc atcgaaaccc
     7321 acaagaagac cgagcgccag tccattgtcg tcaccgagat tccctaccag gtgaacaagg
     7381 cgaacctcat caccaagatc gccgagctgg tgcgggagaa gaagctggag gggatcagcg
     7441 acatccgcga cgagtccgac cgggacggga tgcggatcgt catcgatctc aagagggacg
     7501 agaatcccca ggtgatcctc aaccacctct acaagcagac ccagatgcag acctccttcg
     7561 gcatcaacat gctcgccatc gtggcgggac ggccgaaggt cctgacgctt caggacgcca
     7621 tcggccactt catcgaccat cgccgcgaga tcgtcacccg gcgcaccatc ttcgatctca
     7681 agaaggccga ggcccgggcc cacatattgg aaggctacaa gattgctctc gactggctcg
     7741 acgcggtcat cgagctgatc cgggggtcaa agaccccggc cgaggcccgg gaagggctca
     7801 tgtcaggcct cttttccgac gaggagtggc tccagaagat ggggctcccc ctgccggcca
     7861 tccacagcca gtaccagaaa ccggtgcgcc tcaccgaggt ccaggcccag gagatcctca
     7921 acctgcggct ccaccgcctc acgggtctgg agcgggacaa gatcctccag gagtacgagg
     7981 acatcctcaa gtacatcgcc cgtctcaagg agatcctcgc ctccgaggcg gagatcctca
     8041 agatcatcgt gggagagctg cgggaactga aggaaaagtt cggcgacgag cgccgcaccg
     8101 agatcgtgga ccggagcgcc gagatctccc tggaggacac catcgtcgag gaggacgtgg
     8161 tggtcaccgt ctcccacacc ggctacatca agcggaccgc cgtctcccag taccgttccc
     8221 agcgccgggg ggggaagggg aagaccggca tgaagaccaa ggaggaggat ttcgtcgagc
     8281 acctcttcgt cgcctccagc aaggacttca tgctcttctt caccgacgcc ggcaaggtct
     8341 accagatcaa ggtatacgag attcccgagg gggggcgcgc cacccgtggc aaggccatcg
     8401 tcaacctcct gaacctccaa gagaacgagc agatcaccgc catcctctcg gtgaaggggt
     8461 tcgacgacga gcgaaacatt ctcatggcga cccgcctcgg ggtcgtgaag aaaagccccc
     8521 tgcgggagta cgccaacatc cggagcggcg ggatcatcgc cgtgaacctg gacgaggagg
     8581 acaagctcat tgccgtggcc ctcaccgacg ggcggcagga cgtactcctg gcatccagga
     8641 acggcaagtc gatccgcttc cacgaggagg acgcccgtcc catggggcgc gtgtcgcgcg
     8701 gggtgcgggg aatgaccctg gaggacgacg acgtggtgat cggcatggaa gtcatcaacc
     8761 cgagcgccac cggttcaacc atcttcactg tcaccgagaa cggcttcggc aagcggaccg
     8821 agctggacga gtatcgggtc cagtcccggg ggggcaaggg gatcatcacc atcaagacca
     8881 ccgagcgcaa cggctgcgtc gtggacatca tgcaggtgac cgacgagaac gacctcatgc
     8941 tcatcaccga ccaggggaag atcctccgga taccggtggc ccccttctcg gtcatcggcc
     9001 gcaacaccca gggggtcagg ctcatgaccg ccgaacagaa cgagcggatc gtggccgtag
     9061 ccaagctggc cgaaaaggat gagggagatg aggggcccga cagcggcgat gaccttcccg
     9121 aggcggaggt tgtcgaggag tagccgcgac ggacagcggc ccgagaccgg atgatgcgta
     9181 ttttccggcc gcgggtccct ggtccccggt tcccgcctat gaaaagtaat cgcagcatcg
     9241 acacgagcct ccgggagcgc cacacgatcc tgaacctcct ggaggaactg acaagagaga
     9301 ccgtcaccac cgacgaactg accaggatcg gcaccacgct aagggcggcg ggacgccggg
     9361 ccctttctcc cctcttccgg cgcctctggc gggagaagaa cgaagcggtc atctcccgct
     9421 acaccacgct cctgagcttc ttcgaggatg acgggtggct ggagcagctg atccaggtgg
     9481 ccctcacccg gaaggacttg gaaggaccgg cccggtcggc cctcatccag gcactggccg
     9541 gctatggggt ggacgtgtca gcccccccct tcgcccaggc cgtggacggg agcggaggct
     9601 cccttcggct tgcggttccc cggctccttg accgggggga ggaagggctc atcgttttca
     9661 tggaggagtt cgccgcttac ggcctggagg cccagaaggc catcgtccgg gagctttgct
     9721 tcgtggacga cccccgggtg gtggacctct tcggggtcct cctggcgttt gacgagccgg
     9781 atacccaccg ggagatcatt gagaccctgg ggagggtcag gttccccggg gctgcgcgtc
     9841 tgcttcggcg ttatctggcc gaagcgcacg aagagcaccg ttccctggcc gagcggagcc
     9901 tgcggaggct ggggttcctg ggggtcgacg ccggcgacgg cggggcggaa ccgcaactgc
     9961 cgttccatgc cacgtgggcg agtccccccg atgcagcagg actcagctgc ctcctggtgg
    10021 cacgctggac agcgtccaat cgtctcgacg ttctcttcat ggagctccac gagaccgacg
    10081 ggatgcggga tgcctgggga tggagcggcc tgacgccgga cgaatacggg gatatcgtgc
    10141 gggaaaacgc cgtggaagag accctggtgg cggtggaccc gggctacgcg gccgatctga
    10201 tcggggatgc cttggagcgg agccacgcga gcggcttcta cctccccccc gagttctacg
    10261 tgcggcagcg gatcctgtcg gggctcgacg tgaccccgcg cccctacgtc ccctccttcg
    10321 gggggatgga actggccggg gcagaccgcc ctgatgtggt ggccgggagc gccgggctcc
    10381 tggacgactg gttctttgac ggctggttct tcttcgacag ccggacccgg cttctggccg
    10441 acgagctgga gcggttcggc gacgaaccct ttgcccggga ggacgaggcg gccgtggacc
    10501 ggttcctgga gcaatggtgc agccaggaag tggccccccg cttggagcgg atcgtccggc
    10561 ggctcttcct cacggccgac ctcatggtcc gcgccggccg ggaggagcac ccggtggccc
    10621 agaccgtggc ctgcgcggtg agcctctccc gggggatcat cccccttcac cggcacccct
    10681 tcctgcggcg ctggctcctg gaactgatcg gcatggtccg ggaggcccgg gccgaagggt
    10741 accagttccc ccccaccccc tgggacgacg aggatgggga gtgggattaa gcgcaaaagc
    10801 tatttgaaac actgagcaac agagcaacgg agtaaaatct gagaaacaaa ccctgaaatt
    10861 ttaattgatt gcattagtag ggaacaggca ggatgtttcg aaaaagggtg ttttctcagt
    10921 tgctcagttg ctcagttgct cagtgttatt agttggttaa ctgttgagtg ccacgacatc
    10981 gtggacaact ttttgtgcca tgacatcgtg gacactcatc tgaatcaccg cagtttgtaa
    11041 tcgaattcct cgacctgatt tttatccagg aagagtttca gtttctgttc tttgacatcg
    11101 atagtcgcca ccacgtattc aagcgctgtc tccggtggaa ccgagaagca ttcgccgaag
    11161 atgttcagct tcaggtcact gcggataagg cggacagcat gatattttcc gacttctggc
    11221 ttcttcaggc gatgcctggg aggttcatcc tcagtcggga acctcagttg cacatgcgag
    11281 gtggccagtg ctttcagcgg cgtactcccc tttagcttgc tgtagcgata cttgctgttg
    11341 tgtcgctgct caaaggtcag tgagccgact ttcaattcct cttctgaagt catgatgact
    11401 ttgccgagga accgttgttg gtaccggtcg ttgaactttt cgatcatgcc gtttctccat
    11461 ggttcagcca tgggtatgaa ccatggttcg acatcgttat gcaggcaaag acgaatcagt
    11521 ggtcccatgc cgcggggatg tgtcgggctg ccgaagaatg acatggcatt gtcaacctgg
    11581 agtcgttctg ggatgcctag tcgtttccag acttcccaca aaccgtcaat gaccatctga
    11641 ccagctttgg accgagatga gtgcaacccg cacctgacgg ttgctgtatc gacaacattc
    11701 aggctgtaga agcgaattgg ccctgtcaga tagcatggac caacgagatc agcttggtgc
    11761 gtctggttcg gcaacgctga cggcagaact gggtaaagcg tccctttggc ttcgtatttg
    11821 ccggtgcgcc gatgtgtcag ttcattcctt gcaagaatcc gattgatggt tctggtagaa
    11881 ggcaacggct tgacacccag gtcctccaac tcccacagga tggcctgtgc accacagaac
    11941 aagcccttgt tgtagagatt gaggcgaacc attttgacga tttcttcaat ctctgccgtt
    12001 gtacggttcg gcatggattg tgggcatcgg gatcgctcgt cactccatac agggtcatct
    12061 ccattctggc gagcaaccca tttgtatagc caggaacgag acttgccgag tgatgtgcaa
    12121 attgattccg gggtttcgcc gtttctgaac cgttgaacgg ccaacacccg aagctgcttg
    12181 tttttatctt ccatgaacac ctccgagttt gatgtggtgt tcacagaatg ccgtggcgac
    12241 tattcgattg tcagagaact ttgtctacga tgtgctggca catttttctg tccacgatgt
    12301 cgtggcactc aacagttaac aaacatgagc gagggactgt ccatgggcga aaagatcgga
    12361 gtcatcggcg cggggagttg gggaacaacc ctggcaaatc ttctggcaaa gaaggggctg
    12421 gatgtcaccc tctgggccta tgagccggag ctggtggcgg agatgcgggc cacgcgggtc
    12481 aacaccctct ttctccctgg cacggaactc gctgccggcc tcgccttcac caactctctt
    12541 gaggaggcgg cagcggggaa agatgtgctg gttctcgtct ccccctccca ggtcatgcgg
    12601 agcgtcctga cgcagctcgc tcccctcctg aagcccgggg tgacgctggt gaacgcttcc
    12661 aaggggattg agctcgatac cctcatgacc atggaccagg tatgcggcgc cgtcctcccc
    12721 cccgcagtcg ccggacgctt ctgcgtcctc tcgggcccaa gctttgcccg ggaagtggcc
    12781 caggagatgc cgacggcggt ggtggcggcc tccgccgacc tcgaggctgc ggcccaggtc
    12841 cagcgcctct tcaccgctcc ctatttccgg gtctacacca acagcgacgt ggtgggggtc
    12901 gagatcggcg gggccctcaa gaacgtcatc gccctggccg cggggatctc cgacggcctg
    12961 gggctcggcc acaacacccg ggccgccctc atcacccggg ggctcgccga gatgaaccgc
    13021 ctcggccgcg ccatgggggc ggatccggcc accttcgccg ggcttgccgg catgggggac
    13081 ctggtcctca cctgcaccgg cgacctctcc cgcaaccgga ccgtggggat gaagctgggc
    13141 caggggatgc gccttgcgga gatcctcggt gagatgcgga tggtggccga gggggtgaag
    13201 accgccgagt cggcctggcg tcttgccagc cagatggggg tcgacatgcc catcaccgag
    13261 aaggtctacc aggtgctcta cgaggacaag ccggcacggc aggcggtcct tgaactcatg
    13321 acccgcgacc cgaaggccga gcgggggtag gaacccgagt ccccacaccc gtcggagggt
    13381 atgccatgaa cctgcgcctc acgatcagga acaagctttt tctggctacc ctcctcattc
    13441 tcttcatctc ctacgccatc cttatccaga caaccgtcac cagcatcaac acctcccttg
    13501 aagacaacct ggccaaggaa cttgccgaga acctccgcta cgccaaagac cagtacttct
    13561 cccgggcaga gcacctgaag tacgccctcc tcctccccgc ctccgcgcag acggtgcagg
    13621 agcgggtcga gaggagggac agggtctggc tccaggagac ggcgcggcgc tggaagacca
    13681 gcctcccctt cgctgagccg ttcctctttg tggacccgca gctgaaggtc atcgccggcg
    13741 atggcgagtc ggtgccggag aatgtccgcg aactggctcc catcgtggaa cgggcgctgc
    13801 gggaaaaacg gcccgtttcc gcaaccgagc tggtgagcga ccgtttcctc tgcagcgccg
    13861 gggtccgcga cttctgctcc cgtcctccct acggagacgg gagcgtcatg atgataaccg
    13921 tcgtcgtccc ggtactggcc gagggggggg aggccctggg cgccatcgtg gccggggaag
    13981 tcatcgaccg ggacgtgaag caggcggccg ggactcagga gattttcggc aagcaggtgg
    14041 ttgtggccgt catccgtggc aataggcttg ccccggccgg cgtcaatcct gccttcccct
    14101 accctgcagc catcgctccc gatatcctcg acaagctgga gcgggggcag tcgttcggag
    14161 gcgacgtcac catcggggga aaggcctaca agaccgctat ctcacccctc accaacagcc
    14221 gcggagacta cgtgggttcc ctctacgtgg ccctctcccg ggacgattta aaggggatcc
    14281 tcggcgacag cctcaagaat atcctcgtat ccgccgccat cggcatcgtc ctcacgtttc
    14341 tgacggcctt ccacgtggcc cgcaggttga ccatgcccct gaacgccctt gccggcgggg
    14401 tgcgaaagat cgagagcggg gacttgcggc aacgggtgga ggtaaccacc gccgacgaag
    14461 tgggagagtt gggagaagcc ttcaaccgca tggcccgaag cctggaggag cgggaccgga
    14521 ccatccgggc cacggcccac gaacaggcgg agctgaaccg caagctccag gagatgaatg
    14581 aacacctcga agagaacgtg agcgaacgga caacagccct gcagatggag atggggcgtc
    14641 ttgaggcgat tctcaccggc atggctgaag gaattgccgt caccgaccgg gaggggaaag
    14701 tcatcctctt taaccccgcg gcccagcgga tcttcgagat ggttcccccc cgggtaatgg
    14761 ggcataccct ggaggaactc tgtgccggcg gagagttctg tgccctcgcc gattacgtcc
    14821 gcaccatgaa agaaaccgat gacttgaccc cccgccggga cgtggagatg tccatgaagg
    14881 ggaagaaact cacgatcagc ctttcacctt tctgcgacca ggggggagcc ttggccggcg
    14941 tcgtcatgtc ggtgcgcgat gtgaccgggg aagaggatgt ggatcgggtg aagaccgagt
    15001 tcatctccac ggtgtcccat gagctcaaga cccccctcac ctccatcaag ggttcgctcc
    15061 agttcatcca cgaccggggg gaagggttcg gcgggatgga gggggagctt ctctccgtct
    15121 gtctccgtaa caccgaccgg ctgatccggc tcgtgaacga tatcctcgac attgcccgga
    15181 tcgaatcggg gcggctggag ttcgtgccgg agccccagga tgtgcggacc ctggtcaccc
    15241 actccatcga ggagctggca gggtacgctc tggagcatga cgtcagcgtc gagaaccgct
    15301 gtggccagga cctccccccc atctatgggg accgggaccg tctcgtgcag gttctcacca
    15361 acctcctctc caacgcgatc aagttttcac cccgggggga acgggtggtg gtgacggcgg
    15421 agcggacttc aaactacgtg gccatatccg tgggtgaccg gggacgggag atcctgtggt
    15481 cggatcgggg gaaactcttc aagaaatttc agctgctcga caattcggac cgccgtcagc
    15541 acggcgggac gggccttggg cttgccattt gcaaggaaat cgtcgaacat caccacggca
    15601 ggatcttcta caacgaaggg accggggggg ggaacgtttt caccttcacg gttcccgtct
    15661 atgaggaaca atcatgaata acctcaaaat cctcatcgtc gatgacgaag cggacatcgc
    15721 cctcattctc aagctgcaac tggaggacgc cggctaccgc accacccggg cccgggatgg
    15781 cctggaagcc ctggagatgc tggcccggga acactatgac ctgattctcc tggacatccg
    15841 catgccccgc ctggatggca ttgaggtgct ggagcggatc cggcaggagt ggcccgagct
    15901 ggtggtggtg atgatgactg cccacggcag cgaggacatc gccgttgagg ccatgaagaa
    15961 gggggcggtg gactatatct ccaagccctt ctcctccgat gatatgaaga agcgggtgga
    16021 gcgggccatc gagtacaacc ggacccggct cgaaaacgag cggctccagc gggaggtgga
    16081 ggaagagcgc cggaagatgg aggcgattct ccaggggatg gccgaagccc tcgtggccgt
    16141 ggaccgccag ggactggtca tgagcatcaa ccgcactgcc gcggaacttt tcggggttga
    16201 tgcggccgcg gtccatgccc gccccgtgga ggaactcctc tccgccgcca tcccggccga
    16261 ccggctcccc tgccgcgtgg tgctcgccac gggagagccg tgcctcgacg tggcctacga
    16321 cctccgcctg ccgggccgga ttgtgccggt cctctccagt gccgcccccc tggcgaacgc
    16381 cgccggcgag atgatcggga gcgtggagat catccgcgac atctcggccc tcaaggccct
    16441 ggaacaggag cgggaggatt tcgtcagcat gctctcccac gacctgaaga cccccattac
    16501 cgccatcatc ggctccatcg acctggtgaa ggaggggcgg ctcggtccag tgaatccgga
    16561 acagagcatg tacctggacg ccgccgtgga gagctgcgcc gagatggtgg acatgatcga
    16621 caccctgctg gatgtgcacc gcttcgaggc ggggcggatg gtgacgaccc ttgtggaaga
    16681 agagctcggg ccgctcctgc agcggaccgt tggcaggttc gagccggtgg cccgccacag
    16741 cgggctcgaa cttaccctct ctctacccgg cgctccagtc accttcctgg tggaccggaa
    16801 gcaattcggg cgactcctgg gcaacctcct ctccaacgcc ctgaagttca ccactgaggg
    16861 cggcatcgag gtacgggcgg agctgccgga gaacgccgcg gcggccgcac aggggattac
    16921 ccccggcgcc tacccgaccg agagactccc ccgggaggga cgatacctgc tcgtttcggt
    16981 gagcgacacg ggggccggga ttccggccga ttccctcgtc accattttcg accgcttcgt
    17041 ccaggcccgc aaccgcaaga tggggaagtc gagcggcacc gggctcgggc tcgccttctg
    17101 ccgcaaggtc atggatgccc accacggctt catctgggcc gagagcgagc ctgacagggg
    17161 gagcaccttc cggatgcttt ttccgctggg gaccgactga ccactgagcg agggaacttc
    17221 gcccatgaaa ctgccgtacc acaccatgcc tttcaggatc gcggcgtact atgccctctg
    17281 tgcagggctc tggatcctcc tgtccgaccg gctcctcggg gttgccgttc gggatcccga
    17341 cctcatcacc agcctggaga cggcaaaggg atggctcttt gtggcggtca ccgccctcct
    17401 cctccatgtg gtggtccggc gcttcgtcga tgaggtgatg cgccgggagg aacttctgcg
    17461 ggagcgcaac gaagagctct gcatggtgga ggaggagctc cgccagcagc tggacgagtc
    17521 cgagcgggcc cagcaagaac tgcgggagag cgaggaaaac taccggctcc tcttttcgag
    17581 caatccgcat cccatgtgcg ttttcgatct ggagaccctc gccttcctgg aggtgaacgg
    17641 atcggctatc cagcattacg gatacagccg cgaagagttt cttgccatga ccatcaagga
    17701 catccgtccc cccgaggatg tgccgtcgct catggctatc gtgaagcggg tcgacagcgg
    17761 gcctgaccgg gtcggcgttt ggcgccaccg gaaaaaggac ggcacgatca tctccgtgga
    17821 gatcacctct cacatgatcg atttcgccgg aaggcgtgcg aaggtgattc tgtgcaatga
    17881 cgtaacggag cggatcagag cgaaggagga gatcctgcga ctcaacgccg agttggagca
    17941 gcgggtgcgg caacggaccg cggaactgga gcaggccaac cgggagatgg agtccttcag
    18001 ctattccgtt tcccacgacc tgcgggcgcc gctacgccac atcgacgggt tcagtcgggt
    18061 gcttctggaa gactgcggcg accagctcaa tcaggaggga aagggatacc ttacccggat
    18121 ctgcgccgct gccaaccgga tggggcagct catcgacgat ctcctccagc tggcctccgt
    18181 gagccgcagc gaactgcaac ggcgccccgt cgatttcagt aacctggctc ggactatagc
    18241 cttggaactg aagcagacag acccggagcg tgaggttacc ttcaccattg ccgggggggt
    18301 cagcgctcag ggagatcccg tcctcctgcg ggtcgtgctg gaaaacctcc tgggtaacgc
    18361 ctggaaatac acggggaaga atcaccgcac cgcaatcgag ttcggggcag tcgaggggga
    18421 ggagggacgg gtctacttcg tgcgggataa cggggtcggc ttcgacatga cctacgtggg
    18481 caagcttttc acccccttcc agcggcttca cgccatggac gagttcgagg gaaccggcat
    18541 cgggctggcc acggtgcgcc gggtggtgga acggcacggc gggcgggcct gggccgaagg
    18601 gacaatcggc gccggcgcca ccttttactt taccctggga gaatctcacc gccttgcgga
    18661 gggcgacgaa ggataagcga tggacgattt gcacctgagg atactgctgg cggaggactc
    18721 cgaggaggat gcctttctgc ttctgcggga gctggaacgg gggggataca cggtggagtg
    18781 cgagcgggtg cagacccgct ccgccatgaa aaaggccctg gtctcccggc aatgggacat
    18841 ggtcatttcc gactaccgga tgccccggtt ctccgcgccc caggccctgg aaaccctcaa
    18901 ggagagcggt ctcgacctcc ccttcatcat cgtctccggc aagatcgccg aggatatgct
    18961 cgtggatgcc atgcgggccg gcgccaacga ctacttcatg aaggggaacc tgtcgcggct
    19021 cattcctgcc atcgagcggg agctgcggga ggctgccgag cggcgcatcc ggcgccgggc
    19081 cgagcgggcc atccgccagg ggaaaatgga gtgggaggcg gctttcgacg ccgtgtcgga
    19141 cctggtcctt ctcaccgacc tctacagcac ggtcatccgc tgcaacaacc gggtcatcga
    19201 ggccttcaac gccacctaca gcgacatcct ggggaggaac atcaccgagc ttttctacgg
    19261 cagccccgac gccggggaga gcattttcga tcagtgcacc gatctgaagg ccgataacgg
    19321 cgatgtccgc tttcccaaac tcacgggatg gtacaaggcc tcctgctttc ccatgcaccc
    19381 taccgaaaac gaacacggct tcgtctacgt catcaaggac gtcaccaagc ggaaaaagat
    19441 ggaggaagag aaggagctgg ccaccctgga gcttctccgg agccgccagg ccctcaggga
    19501 gaatctggag gagatgaagc gggccaacat ggagctgggg cgcctgaacg ccgccaagaa
    19561 caccgtcatc ggcatggcct cccatgaact gaagaccccg cttacctcca tcatcggtgg
    19621 gctccagttt ctcttccact acagcggcct ggagatgacc ccggagcaga aggagatgat
    19681 ggagtcggtc tacgaggggg tgacccagct gcgggggatc gtggacgatc tcctctccat
    19741 ctcccgcatc gagaccaagg gattcgccgt caccaagcgg atggtgaacc tcctcaatct
    19801 ctgccgggag gtgcgccata ccctgctcct tcccctgtcg gagcgggaca tcgagctctc
    19861 cattgccgag gacacctgca gcattccggc cgacgagggg ttctgccggc tcgtgacccg
    19921 gaacctcctg gagaacgcca tcaagttcac cgccgacggg ggacggatca ccatcagcgg
    19981 cgagctcacc tccctggacg
//