Histoplasma capsulatum P450s

(Ajellomyces capsulatus = the telomorph sexual form of this fungi)

 

D. Nelson

 

August 9, 2009

 

38 sequences + 1 duplicate of CYP51F1, 1 duplicate of CYP51F2

1 duplicate of CYP539D6P, 3 duplicates of CYP5128C2

3 duplicates of CYP5245A1, 1 duplicate of CYP5246A1P

1 related species CYP5266B3 Ajellomyces dermatitidis

 

>CYP51F1 Histoplasma capsulatum G217B, teleomorph: Ajellomyces capsulatus

96% to CYP51F1    Ajellomyces capsulatus NAm1

HCB02684.1 model is a fushion protein, top part deleted

MGLLADVVARVCAHCSTLSLWALLLAGSASFIVLSVIINVLHQLLWKNPNEPPVVFHWFPIIGSTISYGIDPYKFFLNCR

EKYGDIFTFVLLGKKTTVFLGTKGNDFILNGKLKDVCAEEVYSPLTTPVFGRHVVYDCPNSKLMEQKKFVKYGLTSESLR

SYVTLITDEFNQYIKTSPAFQGDKGVLDVCKSISEITIYTASRSLQGKEVRSKFDSSFAQLYHDLDMGFSPINFMLPWAP

LPHNRKRDAAQQKMTKIYTDIIRQRREAGGKKDSEDMVWNLMSCVYKDGTPLPDVEIAHMMIALLMAGQHSSSSTLSWII

LRLASCPHIIEELYEEQKQVLGEDLPPLTYETLQKLNLNSHVIRETLRIHAPIHSILRAVKSPMPVDGTRYTIPTTHNLL

AAPGVTSRLPEHFPNPMTWDPHRWENPAMAQEEDQSGEKLDYGYGLVSKGANSPYLPFGSGRHRCIGEQFAYVQLGTLLA

AIVRQLKLKKLDGETGVPATDYSPLGKPLVAWERRNPTQK

 

>CYP51F1  Ajellomyces capsulatus NAm1

         XM_001540158.1

         63% to CYP51F2 A. fumigatus

         74% to CYP51F1 A. fumigatus

MGLLADVVARVCAHCSTLSPWAFLLTGSATLIVLSVIINVLHQL

LWKNPNEPPVVFHWFPIIGSTISYGIDPYKFFLNCREKYGDIFTFVLLGKKTTVFLGT

KGNDFILNGKLKDVCAEEVYSPLTTPVFGSHVVYDCPNSKLMEQKKFVKYGLTSESLR

SYVTLITDEFNQYIKTSPAFQGDKGVLDVCKSIAEITIYTASRSLQGKEVRSKFDSSF

AQLYHDLDMGFTPINFMLPWAPLPHNRKRDAAQQKMTKIYTDIIRQRREAGGKKDSED

MVWNLMSCVYKDGTPLPDIEIAHMMIALLMAGQHSSSSTFSWIILRLASCPHIIEELY

EEQKQVLGEDLPPLTYETLQKLNLNSHVIRETLRIHAPIHSILRAVKSPMPVDGTRYT

IPTTHNLLAAPGVTSRLPEHFPNPMTWDPHRWENPAMAPEGDQSDEKLDYGYGLVSKG

ANSPYLPFGSGRHRCIGEQFAYVQLGTLLVAIVRQLKLKKLDGETGVPATDYSSLFSK

PLGKPLVAWERRNPTQK

 

>CYP51F2 Histoplasma capsulatum G217B

94% to CYP51F2  Ajellomyces capsulatus NAm1

two identical sequences

ABBT01000205.1 Ajellomyces capsulatus G217B 481620-479996 (-)

ABBT01000207.1 Ajellomyces capsulatus G217B 78633-77009 (-)

HCB05685.1 identical to HCB06140.1

MSWSTIGTFGVLAFVAAVAFNLVYQLLFHFLNKTRPPLVFHWIPFLGSTIRYGTDPYKFFFSCRQKHGDIFTFVLLGRPT

TVYLGIKGNEFILNGKLKDVNAEEVYSTLTTPMFGPDVVYDCPNSKFIEQKKFIKYGLTQEALESHVPLIEKEVMDYLDS

SPNFLGASGEVDISAVMAEITIFTAGSALQGEEVRSKLTAEFAVLYHDLDKGFSPINFMLPWAPLPHNKKRDAARALMHA

IYLDIIEKRRRAARNANGSQTQDMIENLMQCTYKNGQKLPDKEIANIMITLLMAGQHSSSTTSSWIMLHLASEPAVAEQL

YQEQLDNLPRTGPNGSLAPLQYGDLDRLPLHRNVIKETLRLHTSIHSLLRKVMNPMPVAGTPYVIPPSHIVLSAPGVTAL

SDEYFPNPTMWDPNRWETQEPKVDEKEDMVDYGYGAISKGTSSPYLPFGAGRHRCIGEKFAYVNLTVIVAIMVRHLQFSS

IGGKTGVPRTDYSSMFSGPMKPARINWKRRTAKSG

 

>CYP51F2  Ajellomyces capsulatus NAm1

         XM_001540591.1

         70% to CYP51F2 Aspergillus fumigatus

MSWFTIGTFGVLAFVAAVTLNLVYQLLFRFLNKTRPPLVFHWIP

FLGSTIRYRTDPYKFFFSCRQKEASRLFQHGDIFTFVLLGRPTTVYLGIKGNEFILNG

KLKDVNAEEVYGPLTTPVFGPDVVYDCPNSKLIEQKKFIKYGLTQAALESHVPLIEKE

VMDYLDSSPNFLGASGEVDISAVMAEITIFTAGSALQGEEVRSKLTTEFAVLYHDLDK

GFSPINFMLPWAPLPHNKKRDAAHTLMHAIYLDIIEKRRRAARNANGSQTQDMIENLM

QCTYKNGQKLPDKEIANIMISLLMAGQHSSSTTSSWIMLHLASEPAVVEQLYQEQLDN

LPRTGPNGSLGPLQYGDLNRLPLHRNVIRETLRLHTSIHSLLRKVMNPMPVAGTPYVI

PPSHVVLSAPGVTALSDEYFPNPTMWDPNRWETQEPKVDEKEDMVDYGYGTISKGTSS

PYLPFGAGRHRCIGEKFAYVNLTVIVAIMVRHLQFSNIGGKTGVPRTDYSSMFSAPMK

PARINWKRRTAKSG

 

>CYP55A14 Histoplasma capsulatum

73% to CYP55A13

HCB04560.1

MCVCLSARSKSAIPARSAIVARNQRCNMSTEAAPPKFPFSRPSGAVPPLEYAKLRATNPVSRVTLWDNSQPWLVVKHKDI

CSVLTDSRLSKERTRAGFPEMNPGGKEAAKNRPTFVDMDPPDHGRQRNMVASLFTRESSETMRPHIQATADALLDEMIKQ

GCEKPVDLVEKFALPLPSYIIYGILGVPKEDLAYLTECNAVRSNGSSTAAAASNANKELLDYIGNLADKRLEKPGNDMIS

KLVVEQLKPGHIDRLDVIQIAFLMLVAGNATLVNMISLGIVTLLQHPKQLADLKANPSLAPKFVEELCRYHTASAMATRR

VAKEDIMLGGHLIKAGEGIIAATQSGNRDEDIFPNPDVFDMHRTRGSEVALGYGYGEHVCVAEGLARTELEVVFSTLFRR

LPNLKLGIPLSEVKYSPPDADVGITELPVVW

 

>CYP61A1 Histoplasma capsulatum G217B

77% to CYP61A1   Uncinocarpus reesii

ABBT01000205.1 Ajellomyces capsulatus G217B 1837477-1839379 (+)

ABBT01000210.1 Ajellomyces capsulatus G217B 225529- 227431 (+)

Two identical sequences. Note 51F2 also has two identical sequences

One of them is also on ABBT01000205.1 and the other is on ABBT01000207.1

HCB06044.1 identical to  HCB06499.1

MDTLNGSFASPVADVGLASSVARDPAGLLMSIYNGMTLWTTIFTTLLLLVTYDQVKYIWLKGSIEGPRFKVPFMGPFLQS

VNPKFPEYQAKWASGELSCVSVFHKFVVIASTRDMSRKVFNSPTYVKPCVVDVAHKLLGKDNWVFLDGKEHVEFRKGLNG

LFTRAALTNYMPQLEDVYDRFYNMFVQRSEELNMKPEPWMPHFRELMTALSCRTFVGHYMSDEAVKHVADDYYLITAALE

LVNFPIIIPFTKTWYGKRSSDMVLREFTKCAAKSKVRMAKGEKVTCIMDSWVKNMLDSAAYREKIAKGLPVEDSEKPAHI

LRDFTDYEIAQTIFTFLFASQDATSSASTWLFQLLSDRPEILDKVREENLRIRGGDRNVPISMELLDQMDYTRAVVRETL

RYRPPVIMVPYMVKKDFPVTDTYTLPKGSMIIPSVWPSTHDPEAYPDPETFNPERWLNGEADKAAKNFLVFGTGPHYCLG

QTYAQLNLMAMIGKASMLLDWEHHTTPTSEDIRVFATIFPEDDCPLVFRRRPE

 

>CYP65V5 Histoplasma capsulatum

ABBT01000064.1 Ajellomyces capsulatus G217B

55% to CYP65V4

HCB02008.1

254348  MAVIVKIQALTQSPVILAATSLSIVVLYLISRFIYSVFFHPLRSFPGPTSHAMSQIPYIYKSLRGTLEFDILDLHKTYGD

IVRIAPNELAISGPGAWKDILGNRRSGEEQLEKFQQYYRPTGGKKATSIINADRDDHSRLRRQLAHGFSDKSMREQEPLI

TQHIDLLVKRFHERGRGGSKPFDLTQWYNYATFDVIGDLTFGESFGCLENAYFHPFVKLMLASGKIAVFLQCLSFFPLAKETFLNLIPR

SALKSQANVAKE

KILRRMQMGIERPDLIEGLLKKKDEWNMSLDALSGNARLILVGGSETTATLLCGVTYLLLSNPQTLERLTAEVRSAFKSE

DEINMSSVNDLNYMLACLDEALRVYPPVPLGLPRVVPKGGCEITGQFIPEDTVVAVHHWATYHNEKYFTDPFAYHPERFL

GDPKYASDKRDLLQPFHIGPRSCLGRNLAYAEMRLILARLIYNFDMRLAKESADWLAKQKVFLFYTKPPLNVYMTPVNSRE 256403

 

>CYP65Y2P fragment Histoplasma capsulatum G217B

C-term pseudogene of CYP65Y sequence 67% to 65Y1

ABBT01000195.1 Ajellomyces capsulatus G217B

HCB05094.1

ERFLGDPKFANDKRDMIQPFHVGPRNCLGRN (2)

LAYAEMRLILARLIYNFDMKLAPESANWMRKQRVFLFYTKPALNVYMTPVKR* 131686

 

>CYP65AP3 Histoplasma capsulatum G217B

ABBT01000035.1 Ajellomyces capsulatus G217B

68% TO CYP65AP1

HCB00649.1

MTVNALFTAVTTALLLPILIALKTL

32798 YFHPLSRYNGPTLWAITRLPYMLAFRSGKLAHKVKHFHEVYGDTVRVAPNEVSFI

NPSCVKDIYNRRPSSEFKSLPKDPIRQPPPQPGQPISILEAGDEDHARIRKSYASLFSSKALAAQEPLVSSYVHKMISQL

KLQTGESNTTVVDLQTWVSYCTFDIICSLS FGEDFGCLENNRYHEWVGMLVHSLKGKVQLAACRFYPWLFRLLLKRIPKS

AMSLMAKHQATTREKVDRRL

SSTVDRPDFLSHLQNSKHQLSHAEIVTNSTTFVFAGSHTLQTAITGILFHLLHNPESLAK

VTEEVRASFATTEDIEFRNLSKLPLLDAAITEGIRLSSPVPLGLTRLVPEGGHTINGEFFPAGTIVSYMQWAANLSASNF

ADPTSFLLDRWL HTDRDLFAN

DRRDAVQPFLQGPRDCIGQNLARMEISLILAHLLYQFNLSPPTGAGHAGVQRWEDQETY

AVWVKSPLPVRLSVR 34272

 

>CYP65AV1  Histoplasma capsulatum

39% to CYP65AZ2, 40% TO CYP65AF1

HCB02537.1

MGFVDSYITLTIFGVGLLLYVVGNAIYNIYFHPLSKFPGPKYLAVGRIPITLATLRGQKAQFRFNAHRKYGEIVRIASNE

LSFAHAQGWRDIYGTQAKLQMAKPASGIEEQEGAQSVVTAEGDTHVRQKRMLATMFTERMMKEKESLFISHADLLVKRLA

MLEGQPVALGDWYNFTTFDMMSDLLFGESLGMLSNSEYVPWVRSIHGFLKAFAFITVLNEYLWFRVLWAFFPSKILNTLR

ETHFLFTSQKVEHYLQLDEKTRAGMMGHLLDGGSRKGLNLGELHTNAPILIFGGSETSATQLRSLSFLLFKNPEKLGKLI

SEIRSAYTSSDRITYDSLLEHTYLNACIEEGLRYYPPCSNGLPRVVPKGGTTICGEFVPGGTNVSVATYALFRSPKYFTQ

PDSFIPERWLRESEGGSPVFATDQKGIALPFSYGPHNCPGKKMGYFELRLILAKVLWHFNLELLPEADGAEDSWDNMQNY

QTWSRRPLKVSAKPVRR

 

>CYP68L3 Histoplasma capsulatum G217B

ABBT01000111.1 Ajellomyces capsulatus G217B 382612-384420 (-) strand

57% to CYP68L2

HCB03354.1 revised

384420 MLLETMLNSSMPSTLGLAAIFILLPALFFQVTLPKKSRLPLINGKKLSEFSYTHSGKRFLK (0)

VNARILVDEGLGK

384118 ARAFRLMTDNGPKTVLSAGYADEIRSHPLLNFGAAIAKEFHADIRGFDTFKQGTRADEIFQDAVRMQLTH

HLGNVIEPISTEASIILERDWTNNHGWHDIVLKKSVLKIVAQLSSRVFLGEKLCRNPDWLRITISYTVNSYIAAQALRLW

PEIIRPLVANFLPSCRKLRREIEEARAIINPVLEERRQAKEGAIRVGKTPERYLDAMQWLEESARGRYYDPVVAQLSFSH

AAIHTTSDLLTQVLFNLCGRDELTQKLRDEIVTVTQAEGLKKTTLFKLKLMDSVLKETQRLKPVAVATMRRLAEEDIELS

DKTFLPKGELIVVACDKMWDPDTYPNPSTFDPYRFVKLRERPGHEMSAQLVSTSPEHLGFGFGKHACPGRFFAANEIKIV

LCHILLKYDIKLADGCEPRIRSNGLSLNADPIARISIRRRAD* 382612

 

>CYP68V1 Histoplasma capsulatum G217B

50% to CYP68N1

HCB01530.1

MATLEPTTSYIAELISTSNLPSITFVVTALTLAVFYILQRRKSTVPLINPKRWFEFSDYRIKQEFVHNAIPLVKKGFAAT

GNKPFRILADSGEVTVLPPDVANEIKSNDRMSFELNTAKHFFGHLPGFEVFNATGQNMKVSKSIVQRQLTTHLNKVTKPL

SDEASLSLQEILTDNKEWHEITLKNELLQIIARISSKVFTGDELCHDKTWLDITVNYTIMAFAAADSLRMWPPYLRSIVH

WFLPKCRASRAEVVRARTVIEPILKRRAEQKAALAAQGKKAPEINDAIEWFTSATTIEGFTLDPVIAQLGLSLAAIHTTG

DLSTQVILDIASHPEIIEPLRKEMIESLSEGGWKKNSLYKLKLLDSVIKESQRMKPIASISMNRLTTTNVTLSDGTFIPR

NTATAVSSHRMWDPSVHTNPDQWDGYRFYNKRQEPGQENLSQLVSTSPDHLAFGHGQHACPGRFFAANEIKVLLCHLLLK

YDLKIVEGSMIKPFPYSFSMNANPFAPLMIRRREDVIDLDALDA

 

>CYP504A19 Histoplasma capsulatum G217B

80% to CYP504A12 Coccidioides immitis

ABBT01000061.1 Ajellomyces capsulatus G217B

HCB01876.1

154004  MGLQTAVVAVIAVGFLLIRYLNRTDIPKISKLTEIPGIPIFGSLIQLGEEHARVAAGWVK  154183

154184  KYGPVFQVRLGNK (0)  154222

154380  RIVFANTFDSVKYFWITHQSALISRPTLHTFHTVVSSSQGFTIGTSPWDESCKRRRKAAA  154559

154560  TALNRPAVQSYMPIIDLESNVSIRELFHDSKGGTVDIDPNAYFQRFALNTSLTLNYGIRI  154739

154740  DGNIDNELLKEICHVERIVSNFRSTSNNWQDYVPLLRLWPSRNSEAKEFRIRRDKYLTLL  154919

154920  LDMLRERIKNGTDKPCITGNILKDPDAKLNE (1)

AEIKSICLT

MVSAGLDTVPGNIIMGIAYLASDHGQQIQARAYDEIMKVYPNGDAWEKCLVEEKVPYITALVKEVLRFFTVIPICLPRVS

IKDIPYEGAVIPAGTTFFMNAYAADYDATHFKNPHLFEPERYLSATDGSGTPHYAYGAGSRMCAGSHLANRELYTAFIRL

ITAFRMMPARDPRDHPILDALDCNATKTSLTLDPMPFKVWFRVRDAESLERWMRESEERTREL* 155999

 

>CYP539D6P Histoplasma capsulatum G217B

pseudogene

68% to CYP539D4 Uncinocarpus reesii

HCB02885.1

Second half of this model is like annexin (deleted)

ABBT01000091.1 Ajellomyces capsulatus G217B 86855-88176

GQRFHEEWREFLGDSIFATDGELWSRSRRLIRP

MFARDRIVDKENFEKHIQTLIPHLKGNNENPGKGTIVDVATLFFCFTLVAATDYLLGQSVDGLDDPKTIFAESFQYVLHRQSNS

CLPLCRPIRPLLSGKGFRLNLKKMDDFMQPLIDEVLPLSSEEFDKKLSK

KHTFLHALAHFTKDHKVIHDQLVAILPAGRDTAATLCFCLFELSHNPTVVAPEVLDRLGTSRKPSY

SDLKEMKFLTAVLNETLRLCPVVPLNV &

LPRGGGPDGHSSIGIPNNTRIFYSTTNMQRRRDLYDTPPLAPGNAGSDEKWPIPYFEPLL WIPERWTDGWQPRPWHFIPFNGGPRICLGQPFAMLDMGYTVSRILQNFSEIRAGGAGPAGQDQPFK &

FDVTLSPGEELNMVFVEAGKETG*

 

>CYP539D6P Histoplasma capsulatum G186AR

Supercontig 8: 874979-876322 +

88% to CYP539D6P Histoplasma capsulatum G217B

GQRFHEEWKEFLGDSIFATNGELWSRSRHLIRPMFARDRIVDTENFEKHIQKLIPHLEKN

NEKPGEETIVDVAALFFCFTLSAATDYLLGQIVDSLDDPKTIVAESFQYVLHHQSNF

CFPLCRPISPLLSSKGFRLNLKKMDDFMQPL

IDEVLPLSSEELDKKLSK

KHTFLHALVHFTKDRKVIHDQLVAVLPAGRDTAATLCFCLFELSHNPTVVAPLHTEVLD

RLGTSRKTSCSDPKEMKYLTAVLNEALRLCPVVPLNVCHALTDTTLPRGGGPDGHSSIGI

PNNTRIFYSTTNMQRRRDLYDSPPPAPGNAGSDEKRPIPYFDPFPWIPERWTAGWQPRP*

HFIPFNGGPRICLGQPFAMLEMSRILQNFNEIIADG

AGPAGQDPPFKFDVTLSPGEELNMVFVEAGQETG

 

>CYP541B6 AAJI01002279.1 Ajellomyces capsulatus NAm1

98% to Histoplasma capsulatum G217B

HCB04326.1

55% to 541B1, 47% to 541A1

98% to HCB08024.1 Histoplasma capsulatum G217B (anamorph)

10797  MTTPIPGPPGVPLLGNIFDINPKDTWGSLKSLADKY (1)  10904

10960  EIYKVNALGHQIVFIGSAALLEEICDETRFRKCVTGPVVEIRRAVHDSLFTAYHHEKSWDV  11142

11143  AHRIMAPLVSPSAAEAMFTQMVECAATLVSRWTSDPGQRIDVTSDLQRSDLQSVLACYFN  11322

11323  QAANYFGGPEPSMIAAMQNSTLEAMKRPNRPKLLTRLLYQRKFDKDIKTMRSFAAEIIAN  11502

11503  RKSESAPKSDMLHALLNNPDPETGEVLGEERVIDEIITIFIGSATAPCLVSFAVYYLLQN  11682

11683  PEEIVKARDEIDSILGANGEITSSNLSSFAYCEAILREAFRLSAVAPAFNIEPIPSDEP  11859

11860  DEVQLAGGKYQISRKQPMIAVLSAVNRDPAVFDEPEAFKPERMLGEAYDKLPSGVKKGFG  12039

12040  NGKRRCFGKVPAWQWCLITLISILRKVDLTLANKDYKLASNGAFCVRPLEFFALA GPRER*  12222

 

>CYP548R1 Histoplasma capsulatum G217B teleomorph: Ajellomyces capsulatus

45% to CYP548A2

HCB01307.1

MDTLFSLASQDGVNGLLAVFAVCSIVGIYRLTLHPLAKYPGPFSCKLSDWATLFNASSGDRHLREWKAHQKYGPIVRTGP

NTVSINSVAGFKAIHGSRLSNVRKSDWYLTVEGAVGTPMTQTILDRQTHAFHRRVLDVALSETALKSVEHMIIENVHSWC

AHLAEGISKPGDWSSPKNMADWATYLSYDIMGDLTFGKKFHCMDSDEHRFVPLLMLNATKMVYFIGLSPLAPLLRPFLGS

PIMNVVGGQMARDHLKYKRYSASQMKQRIEAETDDSKPTRKDLAHYLLNARDSQTGKGLTTEELYSESSLLIAAGSDTTS

IAISAIMFHLSHHPEILGKLTSIIRSTFSSLDEIQAKALNNLPYLRACLDEGMRLSPVVPSHLPRQVLPGGLTIEKHHFP

AGIVVNTPPYTINHNEEYYPDPFSYRPERWIVDPYALDGDIGSESQVAIARSAFTTFGLGPRGCAGKRLAYLELGHAFTR

LLFSYDMRVSPANETLGAGNPNHEHEGRRRPDEYQFEDYFLVTRDGPLLEFRPRCE

 

>CYP570J1 Histoplasma capsulatum G217B

48% to CYP570A1   Magnaporthe grisea

HCB00160.1

MRLLLLLVSSLAVAYLVVRRLQTWYRLRHIPGPRWCGWTDIWILWRAWTGSLYEDLGDLCQQHGPLVRVAPNYVVCGNPA

EVRRMWGVRSEWDRSPWYKGFQLDPPRDCTLSMRDNALHTVLRSKLAPGYSGKGIESLPESVDAQIAKFIRLIETKYLST

DTELRPVDIARKVQYLTLDVISTLAFGRTFGFLDEDGDLFDYIKTTEESLPLMQMIALLPWLVNVLQSRLFKAFLPSHTD

VVGVGKVMGIAKEVVSERYGDSKITKPDMLGSFVAHGLSQRDAEAESLVQIVAGSDTTATTLRISLLLLTTSPRTYATLV

SEIDTAISRGNISSPVTEAEARSLPYLQACIKECFRFWPPITGIMPRICPHEAEVCGVKVPGGTNVGWSARAVLRDKEVF

GEDAEVFSPARWLERADSKEGNRDGETERLGRMERTVELVFGQGKWGCLGKPISLLEINKVLVELFRRFDFAILNPAHPM

DTFNYGVSMQSGLFMKISRRTHI

 

>CYP578C9P  Histoplasma capsulatum G217B

pseudogene

ABBT01000030.1 Ajellomyces capsulatus G217B 99592-98639

51% to CYP578C7

HCB00216.1

AVIAVGILLPCLYK*FLYPVFISPLSKIPNTDISAPASPAWI &

RFRMQGNRTIYKAHQKYGPIVRLEPLEISVNYVDIRIQTVYAGGFEKHDWYPRVFGAYGYVICFDFSASVERPTEGTKPHSVQ &

ISQAIICRRLLPVLQRNIQFQANVEVHGCINAIAMDFVPAYIFGLASGTNFLEDIPTARDWLRVYQSRMPFEFFYQVPRMTYLAK

MLKIPLISNWSDKANQVMENWGLEMIDYAEKFLASTDSACEPVVYKQVKQSMLKQ &

TLKSLKxxxxxxxxQQRLELACEMLTILPLIMKVAQLPLLIFTGSY*GILICR*SFE

ELETLSPKIIAQSVLEIPTELPHPKAIDDLPLLG

AIVMETLRLHSPIPGIQPPITPAPSTTLAGYDKIPRKTRVNVQAYSLHRNHDVFPNPGSFLPDRWLKPMDSVELGNMRRW

LWAFGSGGRMCVGSNLAPQ

SEIKLVVAAIYSNFTSKIIDDDGIDPIDAYTVRPSNNRLVLKFERV

 

>CYP584L3 Histoplasma capsulatum G217B

ABBT01000202.1 Ajellomyces capsulatus G217B

64% to CYP584L1

HCB05383.1

586513  MLSLIHVVVGAFGCFFLYQVYLYFTVGAARRKLVKEHACRPPPAYPHKDPIFGLDLTMKLRGHKQ  586319

586318  KNILLQESVKRYRIFGNTFSLI (1)

586149  AISTCEPENIKCVLSLKFSDYEINALRKTAFHGVFGQGIFTTDGPQWEHSRTMLRPNFNRAQVAELAIFEAHIQ

NLIQVVPTDGSTVDLQPLFFDLTADTATEFLFGESANTLHKNFKPSTEENFAEAFTYCTTEIGNSLRVGLLDRYFKTDKR

FERDRKLIHDFADRYVKKALENHANEKYGSGPLPEKGRYVFLQELAKQTQDPIALRSETLNILLAGRDTTASLLANVWNI

IPKRPDVLKKLRAEVDQLGGRKPTFEELKNMKYLKYVLNECLRLWPVVPNNARAAIRDTILPLGGGPDGKSPVFVKKGTT

LAYSVYAMHRRQDIYGPDAAEFRPERWETIRPGWEYLPFNGGPRICLGQQFALTEASYTTVRLMQHFRTIESRDPEPWTE

WVTITCASHHGAKVSLKP* 584657

 

>CYP586E1 Histoplasma capsulatum G217B

ABBT01000222.1 Ajellomyces capsulatus G217B

45% to 586C3

HCB06858.1

MSVSPFQTASPLLIICAASVPLLVFFLYSRLKYYRFHQFSHFPQAPPDLFFGHLKIVNETIAEEPGRHHGMIHL (0)

VSKASAMFKYSVPKSPTAGMLIPIVGKKSIILTNDETWKHGRKKFNAAFASSNLVTFMPKILDKTMEFLALLDGYVESGEEFCLAE

PCIQVTFDIIGLAVLNIDFKSMQGQDKVSVIVRAFRSLLSTFPRTFAFDNWFTNPKGHYRRIALVKTLTASLTPIVKEKF

DMAHNNIRLDNKVVDRSVMAMGLRQVHTLTPQVLEECVDAVKSFLFAGHDTTAVLLQWSIYELSRTPRALAAMRKELDEV

FGLDADPKSVAKQLLEDSNKLQNLQYTSAVIKESLRLYPPAGSARMVAPGSDFRLNTKDGPLDVGGMVLYVCHYAVHRDP

TVYGETADVWIPERWLGQTSTTSEDYAPSSVDKDKNSSTAGAEGQKIPISAWRAFERGPRNCIGQELANLEARAILAMVA

RRYDFTKIGIGSLALKDGKPVLNQHGQFEVTKPLFGAKNVDLGHLAYSGSSSDREGRMSARSVVYQVDSKVPINDV

 

>CYP620D2 Histoplasma capsulatum G217B

ABBT01000228.1 Ajellomyces capsulatus G217B

73% to CYP620D1 but N-term is not detected

HCB07277.1 (fusion to another protein)

Upper part of fusion protein seq is alpha 1,2-mannosyltransferase (deleted)

LPPGA & KPHP

416149 ILGNLK DFPPDGVPEYQHWLKHKDLYGGISSVTVLGLTLVVI

HDRKTAHELLEQTSSKTSGRPTMVMANKLCGYESIVLCQSYTPTFRRYRKYLHRELGTKVSAAQFRSVQEIEVSRQLVRA

LNEPGKWLERRGER (1)

ATVLKTAYGYTIEPHRPDPLVDLIDKMMTEFSLAAVPMAWAVDIIPALR

YLPENFPGATFKNTARRWKKSILDSAYIPYRFVRRQMAGDHTNQPSYVSKLVQQLR &

GEDAKLEHEDEQAIIWTAASLYGAAADTTIITLTIFTLAMIKF

PHVQRKAQEEIDRVVGTDRLPNFDDRSQLPFIDALVKEAVRWWPIAPMGFPHTATTEDVVHNDLHIPQGSLLLPAFWWFL

HDPDVYAGPEAFDPDRFLAPRYEPDPTADAFGYGRRVCPGRFLADASLYLTIAQF (0)

LAAFNMRKAVGEDGREIEVDVRPRLGILTYPTKFDFRIEPRSERH

VQLIRQLERRYPWEPSDAELLESVDDFEAG* 417698

 

>CYP623D1 Histoplasma capsulatum

45% to CYP623B3

HCB03238.1 model is short at N-term

MLGFWLESPPDHGLNAAG

FLLSVSTIVLIFITYFAYAHASCGGNIPRLREPSGKKHFSLKTRWAYYTDCAGLFNDAYNN (0)

FSKKGLPVWIPSLGTRNDIL

MPHKDLAWVLAQPPNIISIRHAYNDINGIKRSLGSSKYMLDNWQGMLVSKELNKVLDGIVLSLNDELKYVLESRLGRDTV

NWKVLDLQQTVQMMIVQATSRFHVGKPL (1)

CRNEEYLHLILNIMDEMIFSAAVTGAFPAILQPLINPVASWRLRRLISRVRK

LIEPRFEECMAHDTADDKCTDFFQMLFRFARKERPDELNIWDLTNRLCMANFEAIHQTSMAITNMILNIVSSDAEYDTIS

ILRRETTAHLGCGSGNSREYLDDDTKWTKAKIAKLVKADSIARETMRLHSFANRGLFRKVMADGVQTEDGISLPKGSILS

FLSQPLHTDGDIFGDPLKFDPWRFSRAREQCESATASPATVEAAGTHSLVSTSQLLSFGRGRNACPGRFLVDFEVKMIVS

YLLLKYDIRFPEEYGNQRPQNRWLAEASVIPKDARVMVRRRK*

 

>CYP628E1 Histoplasma capsulatum G217B

ABBT01000077.1 Ajellomyces capsulatus G217B

43% to CYP628D1

C-term seemed too long so removed a possible intron

HCB02359.1

MLQVVCTAGTLLGIISHLLIFKHGEWERYTPTLTALYAFAIGLLSPAVTLTLTVLSIPSTLLLVSAFWVSYMTGLFGSIG

LYRGWLHPLRDFPGPLAWRLTALWSIKVSVPEFKFPVKVQQLHEEHGDFVRIRPREISINHADAIRDIHGPGTVCVKGPF

YDLNYPFRSLQMLRDKGDHARRRRIWDRGLGIKALTTYEPKILGHCADLINQLIARSRNGKPIEIGPWMNYFGFDVIGDV

AFSKPFDMVKNGKAAQILETFEMSRPIAGSLVCVPWTFILLKRLPVLRDVWSARVKDHSRKVVERMKLGTACKDLFSYLL

DDSPGSPATSAPFVFPEFSVPGDLVCDSELAITAGSDTVAATLTALIYILATHPDKQALLQQELDTLLTGIDDISYQKLS

136153 IPNGSPMLEGVILETLRLYPGAPGGMQRMTPPEGARIAGRWIPGNTLVSTPTYTLHR (1)

DPRNFEHPTTFIPERWSPAAANLIKHKEAFNPFLIGANSCAGKAMALMELRLVTALIFRAFTVRLHA (0) 136645

KPGWRDYFTAKPPPFEVLLERRA*

 

>CYP629A2 Histoplasma capsulatum

ABBT01000202.1 Ajellomyces capsulatus G217B

58% to CYP629A1

HCB05376.1

MAGLKEFSGLGGPQLAGLFTVAVLTLCIWRRYLSPI

SDIPGPFAASFTRLWHIHRILKGDQNLELIRLHNQHGHFVRVAPNEVSVSHPDAVRKILGTMLHKDKWYKI

IAFPDGRFENPMSATDPKVKLELSKHLAPAYTLSNLLINEPSVSETIKLLLGWLDKFASSGEPIDLGKYFTFATSDIVGD

AVFSKQFGFLREGRDINNTIANATPQTAYVSVAGYFRWFHVLFLSNPVITWLNITPWGHLIDTAMTAIKERQKNPDARID

AVAHWFRMLNQHPDRMKLHEIHSAAFNAVAAGNETVSSGLQAFVYYMIRHPNAWDRARAEIDAAGLKDPVISYMEAQKLP

FLQACIKETLRIFGPAPMGLPRIAPEGGLTIGDRTIPQGTVVSVSIWVMHYSKEIWGPDAGEFNPDRWLGEDAARLTKYY

IPWGMGYASCPGQHLARIELYKICAALVRDYNIRQVDPKQEWTWKAYFTVVPHNWPCIVEKRNKETTP

 

>CYP638B1 Histoplasma capsulatum G217B

ABBT01000036.1 Ajellomyces capsulatus G217B

38% to CYP638A1, ony 25% to next best hit

HCB00815.1 revised

65285 MLTFAAFILAVFVTYLFTLCRFHFQLRKNQRGQRQNPASLPYLLPWIGNGFQFACYPHALFHFAR (2) 65479

ARLGPSH

MYIITGAEYVKAAFGSSKNLTFDSRTIQIMEQVYGLPAGDAAPYKHSPGKAKELVSKLDQLYIANLANRECTAAMIRQFV

KSLNAQVGCLRNDKGTEVMIGTCLRRLMATASISALFGDAIIEKNATFVQDYWIFSKDFKRLLYGMPKLFCRKGVHARDR

MLKAIKAFILDALQDDVREMEPKSPTVESSPPYVSLVVRETNKFFTEAGFSVEGRASEALSLVFAINDNAIPTTIWMLLE

ILKSPGLHKQIYEEVQTSVVPDQNGNGRNCLDLSKLLTLPLLNSLYSECLRYHLSAQLARHLKNDIEIDGYLLKKGNLVV

APTLTAHREPEVWFRPNHLPSEVWPERFLHVRNIKPSNYFPYGMGAISCPGRVYAKTVILTSVATMLLTFDFEVLGFVDD

KGKACHRAPKPVAQGMGVSLPDREPLVKLKPRFSQGIM*

 

>CYP657D1 Histoplasma capsulatum G217B

43% to CYP657C1P

ABBT01000229.1 Ajellomyces capsulatus G217B

HCB07501.1

176305  MERVFGAQENTRNLTREDFDAQCRLMEFQMREPFALNCSSIALRQIEQNIPNMLSFCSSIV

DQSLWERMSAVSLVSDGNGQACEVNLYTLVRNFAAVTVMSAIMGEDFMEALPNTPD

DIRTFNNNFNAIVLGIQRWVPFPGLPTSYRSRRRLLQGMEAFHSAFEVAENGHDPGFDWRQIDEASEFIQSHCRTWKNAG

LAASSMASESLALLWAMDTKLNTIICWNLIYILADGPTHSQVMKEIAPYSRAGRPNSGEAGFQLPEPPRLSLDADRLVDS

CPLLKATYYETLRLHSCPVTYQKITEDFKLTESAADAKIANRKQQTYEFRKGEYIAIPHALHNTDSHYFGDPEEFYPERF

LMQKD

(heme region is missing )

VDSNKPSGKGATSEKR

ESLSQPELKIPEIWTVESGGGDTVIQDGK  177525

177526  FAERVTLGFVSGLLAMWDIQPVKGMGWKIPKQSTGGLVYEPKTDIRVRIKSKV*  177687

 

>CYP661C1 Histoplasma capsulatum G217B

47% to CYP661B1

HCB03363.1

MALLACVGAAAVLFAITAWWYLRVPSHMPKNIPTVPFYVSSIAHFVDLGQDKIYDLWLREPLEKYGAVKFWVSSQWTVLL

GKPEYINDLLRNEQVFPKAGNHKRIPFSVIGTFLGNNIISAEGETWKLYTSIMKAGIQRRITDTSKLLGRSRQLVRGILQ

SQQAATANFGIDLESLVQMYAIYVVGEHFFQTDFQRLECNEATRLAKYQTAIRGNVFSPLYFSFPILDKYPYIFQSRKRA

FRIVKEYEDLLYEIVRVPRPRETPEDPMNQYERQVIDDLRDALDCRKITEVQFRANVKIIFVAGHEDVQHLLNSAFYEMG

AKTDIQQKLRLEVLNTGSIDPTPEIVDSLPYLAAIVFELLRLYPPLQQIINRKASETAVLGDEIVISPNTLIGWTAIGAH

TNKSVWGGDAREFDPERWGTTVDTIRAKFRRENARGAYIPFNAHARKCLGQGFALLQIKIALFELVRNVEWVLDPGSKMK

LARVSNYKISKAASPHRITINQSCVTGFIEAYRL

 

>CYP682K3 Histoplasma capsulatum G217B

60% to CYP682K1   Uncinocarpus reesii

HCB05195.1

MLNEAGHLTFTQGVLVSICSFFIIYLTGGVIYRLYLSPLAKFPGPKLAAATLWYEFYYDAVRRGRYTFKIKELHQKYGPI

VRISPYELHIDDPDYYRVLYSYSSPRDKYPYYLKPFGFPLSAFGTENHYQHRRRRGALNPLFCNRKVAQREGLVHQLVHR

LCEYLEQFRVTGKTVSLSLGYTCLATDLIVSYVLDENQQWLDAPEWLPHWRWALRTLSEMVMVSRQVTWLLEILKHFPRA

WVASSNPGLGLFFELEERFRRKIDEIQIDRGRISQRAETEISKGYTLIDQILDSNLEVEEKTPERILQEIRSTTTAGIET

TSNALTVITYHLLDNPDKLQKLQNELSILEDGGNSEQQVHELGKLPYLTSVILEGLRLSYGVSTRLQRKSPEQAIQYKNY

CIPPGTPVGMTSVLMHHNEAIFPDSCKFVPERWLDLQERKRLERYLVSFGKGSRRCVGQRLAETTLLIAIATIFRKFELQ

LWGTLKNDIEISHDLFVPRPKNTKSIGLQVRVLKKY

 

>CYP5078C1  Histoplasma capsulatum G217B

44% to CYP5078A3, 41% to CYP5078B1

HCB01854.1

MASGISAFALNLQFDNLHTYSILVAFFFFVSCIWTRYSPGLRNVPGPFVASFSNLWKIYRVLKKDMAWRNIEVHEKYGPL

VRIGPNHVSASDPEALKTIYNFTNIFPKSEFYSIGEGLYEGKKLPTLFTTRSNEYHARLKRASAKGFSMTALSELEPYVN

GCIELFLKRVEERSNDGKIALDIGPWMQFFAFDVLGEVNFSKSLGFLETGVDVDNNIAAIDQFLSYVSLIGQIPTAHYFL

LGNPILPLIFSNYEKLNKIQEFAIAMVKERRQNPVDRKDILASLFEVHDSSPSKLSSREIVAITTTNIL AGSDTTAITLR

AVFYYLCKNPSTYRKLQREVDSAVEEGRLSKPATYKETTTLTYLGAVINEAMRIHPPTGFILERVVPEGGLTLGGTYLPK

GTVVGVNSWVINYNKQVFGMDVGVFRPERWLEGDPEELADRNRNMF AFGAGPRVCIGKHISLLEMRKLVTEFVRHFNFEL

EDPKAELNIQAGWFVKQEGLKLKFKRRA

 

>CYP5128C2 Histoplasma capsulatum Nam1 teleomorph: Ajellomyces capsulatus

Supercontig 1: 6516655-6517422 (+),cont1.647

GenEMBL AAJI01000647.1 (WGS section)

             48% to AAIL01000498.1 Trichoderma reesei, runs off the end

             39% to AAGI01000270.1|    Phaeosphaeria nodorum

             40% to AAID01000197.1   Botryotinia fuckeliana

             41% to AN1703.3

             38% to Aspergillus   terreus

HCB01869.1 3 aa diffs to CYP5128C4, 5128C5, 5128C6

5 aa diffs to CYP5128C2

MATGIVATAHNAFPSPPSIPI

STTVVVVVVVVPVVLLLVKLHTDSLRYIPGPLIARLTPLWLWTLTHRGIECRLAAL

HSRYGPAVRIAPNEVDLSDAAALYPLCAKNGGCAKNPVYANYDIDGFATIFSAVDPVQRA

AKAAAVAPLFAQRAIVEGRELGARRAVAHGAPIDVLDLFRYLAIDVVS

LYLFGESFGGLGSKAPLAAMPFVDAFAAGGRFFYVPGWLFRHVDHWAGKFEKGARSIAAS

TAVVKEFAARV (sequence gap)

 

>CYP5182C2 Histoplasma capsulatum G186AR teleomorph: Ajellomyces capsulatus

Supercontig 4: 1885071- 1886719 +

MATGILATALHAFPSPLSIPISATVVVVVVVPAVLLLVKLHT

DPLRHIPGPLIARLTPLWLWTLTHRGIECRTLAALHSRHGPAVRIAPNEVDLSDGAALYP

LYAKNGGCAKNPVYANYDIDGFATIFSAVDAVQRATRARAVAPLFAQRAIVEGRPTMQAV

VDAAVAELGARRAVAHGAPIDVLDLFRCLAIDVVSLYLFGESFGGLGSKAPLAATPFVDA

FAAGGRFFYVPGWLLRHVDHWAGKFEKGPGSIAASTAVVKEFAARVVDRSIAGEKAGVAQ

TSTYQGRLLRAGISREETIAQVLDVMFAGTDGIAMTMSVLCWNLARLPD (2)

RYTRARHELLNNPSPLNGQSLPYLTAI

VKESLRLSMANPTRLPRIVGAEGLHVPGLPTLPAGTSVGLGAYVLHHDPAVFPQPREFMP

ERWLACTPEMLRNSVPFGVGARMCIARNLAVAVLRWT

AEALIRADVLGKNNNIHDGGVGD

GVRGVVQDGIEIMEWFNAKVVAGKIEIY*

 

>CYP5182C2 Histoplasma capsulatum H143 teleomorph: Ajellomyces capsulatus

Supercontig 4: 1916858-1918502 +

MATGILATALHAFPSPLYIPISATVVVVVVPAVLLLLKLHTDPL

RHIPGPLIARLTPLWLWTLTHRGIECRTLAALHSRHGPAVRIAPNEVDLSDGAALYPLYA

KNGGCAKNPVYANYDIDGFATIFSAVDPMQRAARARAVVPLFAQRAIVEGRPTMQAVVDA

AVAELGARRAVAHGAPIDVLDLFRCLAIDVVSLYLFGESFGGLGSKAPLAATPFVDAFAA

GGRFFYVPGWLLRHVDHWAGKFEKGAGSIAASTAVVKEFAARVVDRSISGEKAGVAQTST

YQGRLLRAGISREETIAQVLDVIFAGTDGIAMTMSVLCWNLARLPDR (2)

YARARHELLNNPSPLNGQSLPYLTAIVKESLRLSMANPTRLPR

IVGAEGLHVPGLPTLPAGTSVGLGAYVLHHDPAVFPQPREFMPERWLACTPEMLRNSIPF

GVGARMCIARNLAVAVLQWTAEALIRADVLGKNNNIHDGGVGDGVRGVVQDGIEIMEWFN

AKVVAGKIEIY*

 

>CYP5182C2 Histoplasma capsulatum H88 teleomorph: Ajellomyces capsulatus

Supercontig 2: 3175396- 3177043 +

MATGILATALHAFPSPLYIPISATVVVVVVVPAVLLLLKLHTDP

LRHIPGPLIARLTPLWLWTLTHRGIECRTLAALHSRHGPAVRIAPNEVDLSDGAALYPLY

AKNGGCAKNPVYANYDIDGFATIFSAVDPMQRAARARAVVPLFAQRAIVEGRPTMQAVVD

AAVAELGARRAVAHGAPIDVLDLFRCLAIDVVSLYLFGESFGGLGSKAPLAATPFVDAFA

AGGRFFYVPGWLLRHVDHWAGKFEKGAGSIAASTAVVKEFAARVVDRSISGEKAGVAQTS

TYQGRLLRAGISREETIAQVLDVIFAGTDGIAMTMSVLCWNLARLPR (2)

YARARHELLNNPSPLNGQSLPYLTAIVKESLRLSMANPTRLPR

IVGAEGLHVPGLPTLPAGASVGLGAYVLHHDPAVFPQPREFMPERWLACTPEMLRNSIPF

GVGARMCIARNLAVAVLQWTAEALIRADVLGKNNNIHDGGVGDGVRGVVQDGIEIMEWFN

AKVVAGKIEIY

 

>CYP5171B1 Histoplasma capsulatum G217B

47% to CYP5171A1

HCB06783.1

MVFTVFSVGITLSLSFFIYKLVSFVRHYIQARRSGLPIFISPVLSKSIPW

MVLGPYLQPFFQKHLPALLYDRLDIVTHGWEYRRGREFHERLGNIFALVTPDECLIWVADPAVGASILQRRNDFPQAPIV

AKILGLYGPNVFSANGDEXMFAANLDERISKTVWTESCRHASEMIKYMLKNPGNKTLDGLRSIAINVIGQAGFSQSGVWA

PTMRNRTGKATTGKAAFWETFSLTTEMLLEGAFLPTKVMRLPFMPPTLRLMGYHMERAPIYIKEVLDEERKAVENATGRR

NNFLSFLLKLSDEEKNSGDNGFSLTDDEISGNLFVFSTAGFETTSNTMGYAVAHLAVYPELQDWIREELRTLDPDPSKWK

YEEVFPKCRRTLALMFEILRFFPPVLHSNRSVFKPQQIVDGNKTRLLTPPMDILICQLSMHLDPTIWGADASEFRPSRWI

DESGQLITPPKGAYIPWSSGPRICPGIKMSQVEFVATLTTLFRSARCDPLPTAGIEEPEALRQRLLRVTLDSVSKLSLQI

RHANEVHLRWTAV

 

>CYP5234B1 Histoplasma capsulatum G217B

ABBT01000117.1 Ajellomyces capsulatus G217B

45% to CYP5234A1

HCB03660.1

MSAVANLLTYLHCEFQLGWPLIAISILSLMILNICRSMY

RTINSPFPGPKLAKFTSLWLRWHELR (1)

DGILNTTHRAHRNYGPIVQLSPKMISFCHPDAIKDIYTGPRGGLDAID

532319 LVWFFERYGSPNVVSTVDAELHLIRR

KNVAGLYSSPVAASPAFQAHIKTTIDTLMNEIEAEAGSEQVLSWTVDV

FPMMRWLTADIMIGLTYGREKPLNLLSNPDSRAQMNELLTPTLELVASPLMTAFQWLPLPIMKLLSPLINPGSKLTTFGM

SLVQESLNSLPLQSKDDDGRKANTHLQHLLCLFKKDGPSLAIPNINYIASDTLDHFSGGTTTTADFLSALLYHLSLPENK

HHQNKLRQELRAVNNGSCPASSTEHIPLSQLQALPYLNGVLRETLRISPPIPFSLPRVVKTKDQDVTVMGLKINPGTIIS

IQPHTLHRDPDTFPNPDVWDPERWQVPITSPAHRQMQRMLMPFGYGQRMCTGMNVAWAIMRQVTASIYREYETSLD 533854

EGVWFEADGELASKDVKHENRRRKKKNLFPDGGVQPIVFRRV*

 

>CYP5240B1 Histoplasma capsulatum G217B

40% to CYP5240A2   Coccidioides immitis

39% to CYP5240A1   Uncinocarpus reesii

ABBT01000077.1 Ajellomyces capsulatus G217B

HCB02347.1

94504 MLSSIQFNTTLEMMLCIFIVLVSPFLTTWLITNVKARNGSWQKGEPPLIPYIIPWLGHALSFRRGTTRFSSWVK (2)

EKYHNVPVSRTLMAGNNLYTIFDPKLAREVDRRPKIFTFDPVVLLVNKAFGAPQADLNILERGYLGPTQRTTSNSDGQGMIAELHR

QHFPYLNGPNLPAMISKFGAILSANLENVFQRKGSCDTSDTWITLDFREFLMRQFTLASIPMLMGTRILEIWPLAFKDIW

EFDSWALVLTMNLPSIFIPEAAASRDAMVSALERWEEEASRHRKFEDVESEDP

AWDEYWGARLVRQRHRTFLNNGISKRGRAVFHLGLLWA (2)

TNANAIPAATWMLIHCVL

DTQLQCRVRHAIISSKRKDGTVDIESLAANKLVKSLFLEILRVYVSSPSVRLVLETTELGGYVFHKGGTIFIPGREMQND

PNVWSPNGSFPDASEFWAERFIDEEQDDN

GRIGKEING (1)

YGQTLSADAMTIPGRTRSKSLRDRMYS

MRPFGGGTSFCPGRNVAMYEIVVAVVVILSAFDIEVDKEALASNGIPQPNFDLSGTMGPDRQFVVRMKRRTAAK 92543

 

>CYP5245A1 Histoplasma capsulatum H88

Supercontig 1: 6824213-6826226 –

ABRJ01000082.1 Ajellomyces capsulatus H88 118177-116161

HCB06665.1

MALLTAGLVPAKWLAADFIHQLSYL

QLACLVNTAGVVLLSIYCWFSAAKYPSIPRVRDGMKARFSLKTRLAYYTN

CEGLYKEAYET (0)

YLKKGQPCLVPGLGLRTEILLPKGTLRW

LVTQPDKVLNIQEAFREVDQIDWAADHHKYVTDPWLAM

ILNRDVNRNFDRYLGPMGKEMQNAVERWIPNKDEWEEIPLWDTLKLVIAQFSS

QFTVGEPLCK (2)

DEEYLRASSKFVDLFATNAGLVPFIPVPLRPVLCPLLYLPFRLNFWKLERILKP

VIKGRLDRFLKHQHSE

KIKSEPHHGINSGQNEPEDLLQLMLRFAQSDRSKE

DLHDLHSLAYRICINNLG

SFHQTTATATNLIFNIIASDKEFNTIALLREEIES (0)

KTGGWSKASVAKLVLMDSVMRETVRTHSFIHRSVTRT

VMDDNVHSPVIE

GEAGSGEASTISVL

LPKGAMVSILSRGSYCDPDIFDDPMKFNPWRFAQPKRDHNSEQSNGTGATPARPTFTVTSANNLFFGHGRHACP

GRFIADAETKMLLACLLMNYDVDLVPVPGPDGKGEVAVRPTSPWVLEVIMPPIGGRIRTKRRACERV*

 

>CYP5245A1 Histoplasma capsulatum H143

Supercontig 2: 2329560- 2331651 +

MALLTAGLVPAKWLAADFIHQLSYL

QLACLVNTAGVVLLSIYCWFSAAKYPSIPRVRDGMKARFSLKTRLAYYTN

CEGLYKEAYET (0)

YLKKGQPCLVPGLGLRTEILLPKGTLRW

LVTQPDKVLNMQEAFREVDQIDWAADHHKYVTDPWLAM

ILNRDVNRNFDRYLGPMGKEMQNAVERWIPNKDEWEEIPLWDTLKLVIAQFSS

QFTVGEPLCK (2)

DEEYLRASSKFVDLFATNAGLVPFIPVPLRPVLCPLLYLPFRLNFWKLERILKP

VIKGRLDRFLKHQHSE

KIKSERHHGINSGQNEPEDLLQLMLRFAQSDRSKE

DLHDLHSLAYRICINNLG

SFHQTTATATNLIFNIIASDKEFNTIALLREEIES (0)

KTGGWSK & ASVA

(sequence gap)

LSRGSYCDPDIFDDPMKFNPWRFAQPKRDHHSEQSNGTGATPAR

PTFTVTSANNLFFGHGRHACPGRFIADAETKMLLACLLMNYDVDLVPVPRPDGKGEVAVR

PKSPWVLEVIMPPIGGRIRTKRRACERV

 

>CYP5245A1 Histoplasma capsulatum G186AR

Supercontig 3: 1482810-1484825 –

42% to 623B2, 35% to 623A1

MALLTAGLVPAKWLAADFIHQLSYLQLACLVNTAGVVLLSIY

CWFSAAKYPGIPRVRDGMKARFSLKTRLSYFTNCEGLYKEAYET (0)

YLKKGQPCLVPGLGLRTEILLPKGTLRW

LVTQPDKVLNMQEAFREVDQIDWAADHHKYVTDPWLAM

ILNRDVNRNFDRYLGPMGKEMQNAVERWIPNKDEWEEIPLWDTLKLVIAQFSS

QFTVGEPLCK (2)

DEEYLRASSKFVDLFATNAGLVPFIPVPLRPVLCPILYLPF

RLNYWKLERILKPVIKGRLDRFLKHQHSETIKSERHHGIDSGQNEPEDLLQLMLRFAQSD

RSKEDLHDLHGLAYRICINNLGSFHQTTATATNLIFNIIASDKEFNTIALLREEIES (0)

KTGGWSKASVAKLVLMDSVMRETVRMHSFVHRSVTRSVMADN

VHSPAIESEASSGEASTISVPLPKGAMVSILSRGSYCDPDIFEDPMKFNPWRFAQPKRDH

HSEQSNGIGATPPRPTFTVTSANNLFFGHGRHACPGRFVADAETKMLLACLLMNYDIDLV

PVPGPDGKGEVAVRPKSPWVLEVIIPPIGGRIRTKRRACERV*

 

>CYP5245A1 Histoplasma capsulatum Nam1

Supercontig 5: 1478881-1480888 +

C-term has many frameshifts

MALPTAGLVPAKWLAADFIHQLSYLQLACLVNTAGVVLLSIYCW

FSAAKYPGIPRVRDGMKARFSLKTRLAYYANCEGLYKEAYET (0)

YLKKGQPCLVPGLGLRTEILLPKGTLRWLVTQPDKVLN

TQEAFRELDQIDWAADHHKYVTDPWLAMILNRDVNRNFDRYLGPMGKEMQNAVERWIPNK

DEWEEIPLWDTLKLVIAQFSSQFTVGEPLCK (2)

DEEYLRASSKFVDLFATNAGLVPYIPVPLRPVLCPILYLPFRL

NYWKLERILKPVIKGRLDRFLKHQHSETIRSERHLGIDSGQNEPEDLLQLMLRFAQSDRS

KEDLHDIHSLAYRICINNLGSFHQTTATATNLIFNIIASDKEFSTIALLREEIES (0)

KTGGWSKASVAKLVLMDSVMRETVRTHSFVHRSVTRTVMDDNVHSPVIESEA &

SGEASTISVPLPKGAMVSILSRGSYCDPDIFEDPMKFNPWRFAQPKRDHHSE

TFTVTSANIFF &FGHG & RHAC & KMLLACLLM & NFDVDL &

VPVPRPDGKGEVAVRPESPWVLEVILPPIGGRIRTKRRACERV

 

>CYP5246A1P Histoplasma capsulatum G217B

ABBT01000025.1 Ajellomyces capsulatus G217B

HCB00156.1

468698 FFSPFRKVPGPILAKITGGWLLCVDLAGRRAMK

VHELHEKYGSVVQLGPNELSFSSAESIDMIYGTGTRFRKAPMYMTMGRPGVLHLSDPAAHRERRRLLNHAFSKQHLDDME

PEFRNSVKKIVARMERQGGEALDMKHWFKMYTLDNAGKAFLGATFGGLDSDESPRYVKDFDLFLLAWAFKSTFPIPAWFV

RKIPHPKIKFVFDAEARIYQYGIDRFNEYIEKYGRVSQRRDLLTKMIGRKENDPDALADSDIAVEISNLCFAATDTTGTA

LVYLFWELARNPHLAERLRSEIADLPLVDGVIQHQSVSNAPFLEALIIEGLRAYPPLPSGLLREAPVGGCVIDGIYVPQG &

TIASTHTWTTHHSPEYFPHPDKFDPSRWLEGNVCDGMKKLWMPFSKGPRNCLGRT

MGLFEMKILIATLVRRFHISIDDTMRDDAMDITDHFLLIPKGDKCLLRFTPI* 467088

 

>CYP5246A1P Histoplasma capsulatum G217B

ABBT01000049.1 Ajellomyces capsulatus G217B

The downstream PORTION OF THIS FUSION PROTEIN resembles siroheme synthase XM_001935421.1

3:34 PMhis part has been deleted

35% to CYP5049A1

MPISLLISPNLTTIALLVGAVTTFSYTVSRFLHARLSCRHLPQPPHSFWFGHLLEVDKINRAYPTNVYIHHTLISLSRKY

DLPELYYLDLWPFASPMVVLCKPELAAQVTTEQAFPKDPAVGRFLSPFLGKSSIISVNGPKWKGLHSTFVPAFAPAYIRT

LADGMLEEILIYHDNLAKFAKSQECFAMASLSIDLTFNVIGRAVFNSPFHSEDGRKLVRNFKNGLDYAFDGVLSTSNWLI

GMVPKWILVWKVNRYIEKRVIMRFAEMKREEASSVKKSRSIMDLVLRQKLDNPMGIAGDSDFMEMAVSNIKTFLAAGHET

TAHTLGFIFMVLSKHPEVLKKAREEHDSVFSPDLNRTVEMIRAHPEKLNDLHYTTAIIKETLRLFPIGSVARAKGDESMN

IMYQGKPLEITDQLIMICILAMHYDSESFPSPCEFQPERFLTQTIPKDAWRPFERGARGCIGQELAMMEMRMVLLVVLRS

FEFESLGINPHSNQTASYTTLDMVYGDLVYQKQSLTARPIGGQDMKVKFAKGHQAYVNGN*

 

>CYP5247A1P Histoplasma capsulatum G217B

38% to CYP587B4 Aspergillus terreus

HCB01044.1

MAITYGTPKLVAATGLAVFTASLVHFLARGIAARRRFYKMKARGIAIIEPYSPFLGHLPLLRSLKEGLPQDAHRVYTSIK

IVQNWQKYFPGAEKCPPLIYMDVWPFMAQPIIMVIDPELCSQLTQETPQPRHPIFGWALTPVTDGIDLISMNMPDHKIWR

SRLNPGFSSRNIIQNMPAALEEVSIYAQKLKDTADARSHEWGKMFPLYEGAVALTFDVVSRFALDLHPHEQTAGPGPLLN

ALRNLISRVKLKNVKTRLERLTPEFKSFVSQNAATMRDILFPQIQSRFSDTLDSKNQKTVIDLAIKDFKKSGQQPTPEFI

NILISNLKAFLFAGHDTTAQTICWIFYEINKNPDVLQRLRKEHDDVLGPDPKMAYQVLQQSPHKANELRYTAAVIKETLR

IHTLANTFRQGSPDFNFSLDGMLYPTYDCMIQTVPTMTHIHPDFWPHPTEFIPDRFLVPEDHALYPVKNAWRPFELGNTK

CIGQELAMLEMKLVLVFTLRELDFDFNYEQWDVVQKRDTTIVAADTINGERAYRCGEGIGTIKDGLPQNKTRDGEIERKR

KTNAHEIINGRKRGREGGERWMKTWT

 

>CYP5248A1P Histoplasma capsulatum G217B

31% to CYP660A2

HCB03239.1

MALYIPILVAVAVILLALAKIEQTPLIKTGYIEPPLVRVSLWQLWTHGTQILDQLAAKHIDDFPDGIFTVSIFGWKIYVV

NSPQLTLTIQARSKYTGLGWISVLVMASMGGQPKKATELLFKGVDRGDVGNGIGFVHDYHKVELRTMSLGNSLDAMRSDF

ATAWQPILESLRDSVNNGQKNVNIWHWLRMSVTVSVSRAVWGPTSPYCTKPELWEQFWTFNSGYNFLKYSFPRLFAWRGA

AAREKVVDAFVEYEKQGGFEHASALAQSRKAALDKTGLGIREVARMSLPQSVGQFDNAATVSFAVLSFILRDPKLQARIR

EELGPLTSTDHRGNPSVDLSRVELECPLLLSTFHEVLRLIAVGVTVRRVEQDYPLEVKTGGNQTQYFLRKGSFIWSSGIA

IHTSPKFYTNPEEFDPERFLGVRFPETQIPDIFRAFGGGGNICLGRHFARTIVPGAVASLLMCFDFEPVNGVPLCVPHRT

DLLLGHATPNPFGNTNINLKTRVLA

 

>CYP5249A1P Histoplasma capsulatum G217B

36% to CYP5183A1 A. niger

HCB07585.1

MTSPLVIALGLVPATYVFLSALLHLTQDAKEPPVIATQIPFLSPAVGFIMGMQKFLVKLRDKYNLPIYTLRLPGQRIYII

NSPALIPQLQRLIKTISFCPIEAQAADVVMGVGPEGNAIIGSDKMLDNDSYLSTFVPSIHPGLAPGPGLNAISSTAARGL

SESLEILSKSGPTTVDLYSWVRGEAFKAITESIYGPKNPFRDPALEEAWYTFEPGILPLMINIWPSLLARKSLHAREHLL

IPAFEKYFADKGHQQGSLLAQCRYEHNTSHGLRGRDIAATEIGQMIASLTNSLASAFWMVYHVYSDPIVLNECRAEAEQL

VELDDIDAQILDLAKIKSSCPILFSTWQETLRYVHIAVSTRVVMEDIIFDNKYLLKKGATVMTTSVVQNTDQSIWGPTLG

NFDHRRFVSQPGEKRKIPAAFRPFGGGSILCPGRHFVTAEVLSFVILLLLRFDLEPVTKDGKWFEPRREMTMTTSIPTPK

DRIHVKIVPREKQRGHVDISVSSKAAFY

 

>CYP5250A1  Histoplasma capsulatum G217B

ABBT01000198.1 Ajellomyces capsulatus G217B

37% to CYP582A1   Magnaporthe grisea

HCB05194.1 revised

273934 MDILKVVSISVVETYGFHIFDQVTTSFSRQVFWTLFIVQYAVLKIYWIWIYPLIASPLRSLPGPN (0)

YTQFLLGQTYNQITASCPNSIALAWMRKFPDADLIRYFAPGNHEVVLVNSPRAFREV

TFTHAYSFAKPRFFKRLVGDMIGGGLFFAEGDVHRKQKKLLA (1)

GPFLNQNVKHLLPVFEQNADELSSSIETLVVDSETGAIESKNW (1)

FSCLISKSL

LDIISQAILGLEL

DGHSIASELGRCYHTIFSSTTMSRVMLFLNT

CVPVRRLLPVKTNREYTDANIEIKQILKKHVQQRTQEITS

LWRERLKSKNKDILTLIIQEQLKKSDECPEDEIVDH (0)

LRTFLAA (1)

GLETVGTAMLWAFHALASHQDVQDRLRNEINAAGDGKSSELKYSDICKLELLDHFVKEVLRCYPP (1)

STCSMREAIHNVSICGQLIPAGTHVLMFPIMPQSNSIIWGRDPE

KFDPDRWKTLPTSARDGYTFQAFNTGPRACLGKSFAMLEVKVLVMKLVARWRFCHVSKPVVLQKIGLLFKPANGLELKIE

SAVLT 271867

 

>CYP6001C3 Ajellomyces capsulatus NAm1

fusion with diooxygenase, P450 (C-term) part may act like a hydroperoxide isomerase

MQFLHISSLAEYPTAQIIMWHPLSKLELCMDRAPRSLDPDVKTE

NNKLLRTPKNGHVNGKLKDAPLPVAKRSKGRRVERQEIEDTFAKYSEFSGDHSRMKKD

GSSGKFQEVRWMGWKGVRTLLEVVKSKTSGKLVDDRDYLMERIIQLVANLPPESSARE

QLTKTFVKSLWVSLPHPPLAYLGDEYRYRAADGSNNNPMFPRLGAANTPYARSVRPIT

IQPAALPDPGLIFDSLFARQEFKPHPTGVSSTDPRNQHISQTSSYLDLSTLYGDNQDD

QNQMRTFKDGKLKADTFSDPRLLALPPACSVILVLLNRFHNYVVEQLAQINENGRFTK

PHANLPPDQSAKAWVKYDNDLFQTGRLITCGLYINITLYDYVRTIINLTRSNTTWSLD

PRIDTKKVAAPESAESGVGNQVSFEFNLAYRWHSCIGQLDEKWINDIYHDLFGKSGED

ISMPELMVGMGKWKQKLPEDPSKRTFAKLKRQADGRFRDEDLARIITEATEEVAGTFG

PRNVPKALRAVEILGIQQARKFGCGTLNEFRKFFGLKQYESFEEINSDPEIAGQLRNL

YEHPDYVELYPGIVSEEPKIPMVPGAGICPTYTISRAVLSDAVALVRGDRFYTSDYNA

KSLTNWGYTETHYDLSINQGVPDSIYAHYPMTIPSVNKEIFAKLGRQSHFSWDRPALL

SPRIDLTSYNGAKTILQNSKDFRVTWEASLGSHLASQGFNESQAKVIDETFAQDSWRE

EVKQFYQDITQKLLKRNSVKIAGINQIDITRDLGNLTHVHFAASTFNLPIKTKDNSKG

VFTDHEMFMVMLAAFTSVFSDVDPTKSFPLRQVAREVGEQFGQVVESYVKSIKAFNPF

SSIIDRFQKDGNTLAKFGADATRRLLKAGLSVPQVALSYILPIICTAVPSQAQAFTQI

IDYYLSDEGKIHLPDINSLAKEDSLESDTKLLHYCMEGLRLNGPFSSYRDSNANILIN

DGGREVSINDGDTVFISSARDPNIFPRPDEVVLDRPLESYIHYTDGAFTCFGRDAQMV

ALSSMLRVVGRLDNLRPAPGPQGQLARISRPDGHFAYMREDWGGYSALPMTLKVHYDA

TEAQPIKIITNYLAVWLLSEQIMLTPSYDFIELLYCCTWYLFERGRFDISFSIAEKAV

EFAKRSLKIKEQAVADNALDKHHPQLANSYINIGVFIAGMNPRDAIRLHEKAIVIREG

SPKYADDQMQLLSLNYMNIGRCWWMVKGLDKATAAYEKSISIIKELEEATGAPFAQKS

WAMSALANVLIDKGKFDAAFDLFTQSVKVHQQVLGATHHKTVACYNKIAWFLRKQGEY

GMAM

 

 

Related species

 

>CYP5266B3 Ajellomyces dermatitidis ER-3 cont1.288

ACBT01000288.1

64% to CYP5266B1 Penicillium marneffei, N-term not clear

447023  IAGWLSQPWHVFLLQAVAGTFLITFAACLVHLLEPALLASFSPKYDGFTWVTGERGLGNF  447202

447203  FSVAYDCVFDAGSLFKVAYQK (0)  447265

        VRNTGSE

447352  IFLTPFPHSNTGFMMLLPRQFIAEYARQPEAIVSFNKYVRDVMHPKYSLFGANILDNNLQ  447531

447532  KPIVYRELYQKLGNKIEMMSTELVGALNDVLLPQLDENGEMKINMWDTATKFLSRTSNRI  447711

447712  ISGYPLCRNQD & 447744

447744  YLDATVHYAVNMFSRAVYIRFIPRFLRP (2)

        LLAPLVRRSLSRD  447923

447924  RKIVAKHAVPIIKERMRILETAEGKGIEADLP (0) 448019

448072  NDLLSQAIVAARREKHSYIEYDPMQIVSRLLAFNFLQSYSNTLIMTNCIYDLISLPKG  448257

448258  VFEETVADLCEEINRELAKGDPWSYDYIKRLDVMDSFIRKSLRANPIGEVGLERTIMSKE  448437

448438  GFTFSNGLHVPQGTTLAAPLKAIQRDKDNYPSGFDPKRSLRDPAKPKITTSSPEFLNFGL  448617

448618  GHPACPGRWFAASLQKLAFSHLLLEYDFVRVDQRPPGVRKVTLVEPCGRSLITLRKRKAT*  448800