Jatropha curcas Cytochrome P450s

(crop plant used for making jet fuel in Brazil)



Jatropha curcas Genomic contigs of P450s (538 sequences)

From http://www.kazusa.or.jp/jatropha/

by P450 keyword search


some are revised with ESTs from NCBI.

~270 are in finished form (not able to extend or complete some of these)


480 Jatropha sequences are here after removing 20 false positives

(at the bottom of the file) and merging some sequences.

Ricinus communis sequences are added for help in assembly.


150 of these are complete or nearly complete sequences.

330 are partials and about 210 of these need to be looked at to see if

they can be further improved or finished.


Sequences that are most likely from the same gene have been joined even if no

overlap is present. This is the case when there is only one gene in the family

or subfamily.


The sequences are sorted in to 10 P450 clans

CYP51, CYP71, CYP72, CYP74, CYP85, CYP86, CYP97, CYP710, CYP711, CYP727

and inside each clan they are sorted into families.


The Clans CYP51, CYP74, CYP97, CYP710, CYP711 and CYP727 have only one Jatropha

family each


The CYP71 clan has 22 families: CYP71, CYP73, CYP75, CYP76, CYP77, CYP78, CYP79,

CYP80, CYP81, CYP82, CYP83, CYP84, CYP89, CYP92, CYP93, CYP98, CYP701, CYP703,

CYP706, CYP726, CYP736


The CYP72 clan has 8 families: CYP72, CYP709, CYP714, CYP715, CYP721, CYP734,

CYP735, CYP749


The CYP85 clan has 13 families: CYP85, CYP87, CYP88, CYP90, CYP707, CYP716, CYP718,

CYP720, CYP722, CYP724, CYP728, CYP729, CYP733


The CYP85 clan has 4 families: CYP86, CYP94, CYP96, CYP704


The sequences below include about 300 that have been checked for overlap with ESTs

and other contigs to assemble them as completely as possible.  Many are too short to

assemble into full sequences.  Some are clearly pseudogenes and others might be

pseudogenes, but the genome is incomplete, so it is not certain.


This is a work in progress.  There are still about 200 pieces that need scrutiny.

The sequences are not named yet.


The automated assembly output tagged many sequences as /pseudo.  This does not mean

they really are pseudogenes.  Each one will need to be examined.


David Nelson

Feb. 10, 2012


484 Jatropha sequences after subtracting 31 Ricinus communis sequences and 20 false positives


109 named orthologs


David Nelson

Revised June 10, 2012


CYP51 clan


CYP51 family (only one gene)



JcCD0121598.10 +

GW613182.1, GW619602.1, GW617740.1


JcCB0430161.10 - 

86% to CYP51G1 Ricinus communis













CYP71 clan


CYP71 family (61 Jatropha sequences, 20 are complete or nearly complete)

10 Ricinus sequences




>CYP71B JcCA0015371.10 + short


55% to CYP71B10 Arab. 
59% to CYP71AS1 Citrus sinensis
97% to CYP71AS   JcCB0119211.20, 96% to CYP71AS JcCA0295881.10
96% to JcCA0060021.10
complete, one stop
71% to CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis











>CYP71B JHS05H19r.10 -


Runs off the contig end

97% to JcCA0015371.10
76% to CYP71B65 gi|255564484|ref|XP_002523238.1  Ricinus communis




>CYP71B JcCB0003071.10 - 

63% to CYP71AS1 Citrus sinensis


JcCA0228101.10 - 

76% to CYP71B76 gi|255570189|ref|XP_002526055.1  Ricinus communis











>CYP71B JcCB0119211.20 + 


59% to CYP71AS1   Citrus sinensis
FM890400 EST (3 aa diffs, two are adjacent and are errors that introduce a stop) 
72% to CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis











>CYP71B JcCB0480541.10 –  exon 1


100% to CYP71AS JcCB0119211.20
71% to CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis






>CYP71B JcCB0793041.10 +  exon 1


97% to CYP71AS JcCB0119211.20
69% to CYP71B64 gi|255564478|ref|XP_002523235.1 Ricinus communis








>CYP71B JcCA0079531.20 + exon 1


92% to CYP71AS JcCB0119211.20
70% to CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis







>CYP71B JcCB0682821.10 + exon 1, partial

BABX01098061 runs off the contig end at KGK

83% to JcCA0204311.10

100% to JcCA0079531.20
73% to CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis






>CYP71B JcCB0201851.20 +

BABX01066242 one frameshift at &

58% to CYP71AS1   Citrus sinensis
71% to XM_002523189 Ricinus communis, 73% to JcCB0119211.20
finished, complete
72% to CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis












>CYP71B64 XM_002523189 Ricinus communis, XP_002523235.1
74% to JcCA0021071.10, 73% to JcCB0443791.10, 72% to JcCB0119211.20



>CYP71B65 EE255099 Ricinus communis EST, XP_002523238.1
96% to XM_002523189 Ricinus communis










>CYP71B JcCA0021071.10 – one frameshift at &


78% to CYP71AS JcCB0119211.20, 74% to XM_002523189 Ricinus communis
58% to CYP71AS1 Citrus sinensis
74% to CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis












>CYP71B JcCA0060021.10 –


58% to CYP71AS1   Citrus sinensis 
70% to CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis











>CYP71B CYP71 JcCB0443791.10 +

BABX01082262.1 almost same as BABX01026019



58% TO CYP71AS1 Citrus sinensis
73% to CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis






AILM (0)






>CYP71B JcCA0094041.10 + one frameshift


90% to CYP71 JcCB0443791.10
75% to CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis












>CYP71B JcCB0095131.10 + 


94% to JcCB0000691.60, 83% to JcCA0021071.10


72% to CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis







>CYP71B JcCB0095131.20 -  pseudogene


46% to CYP83F1v1   Populus trichocarpa
93% to JcCB0443791.10, 80% to JcCA0021071.10
75% to CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis






>CYP71B JcCA0204311.10 + exon 1


83% to JcCB0682821.10 
79% to JcCA0079531.20
77% to JcCA0094041.10   + 
76% to CYP71 JcCB0443791.10 
no ESTs to extend the seq., finished

JcCD0092500.10 +

72% to CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis








>CYP71B JcCA0295881.10 + one frameshift


96% to CYP71AS JcCB0119211.20
71% to CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis














>CYP71B JcCA0045771.10 - pseudogene


57% to CYP71AS1   Citrus sinensis
98% to JcCB0443791.10
73% to CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis











>CYP71B JcCA0126681.10 + 


56% to CYP71AS1 Citrus sinensis, 54% to CYP71B10 Arab. 
69% to CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis











>CYP71B69 XM_002523196 Ricinus communis, XP_002523242.1



>CYP71B JcCB0199391.10 - 

70% to XM_002522168 Ricinus communis

JHL01P16f.10 + 

BABX01066084.1 runs off the end, BABX01120767.1

No ESTs to extend seq, finished

72% to CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis







>CYP71B78 XM_002522168 Ricinus communis, XP_002522214.1  



>CYP71B JcCB0717711.10 - 

BABX01100561.1 runs off the end, no ESTs to extend


76% to CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis








>CYP71B JcCA0204781.10 +

BABX01011754.1 ,  no  ESTs

74% to XM_002523192 Ricinus communis


74% to CYP71B65   gi|255564484|ref|XP_002523238.1  Ricinus communis







>CYP71B65 XM_002523192 Ricinus communis cytochrome P450, putative, mRNA


97% to XM_002523189 Ricinus communis
99% to EE255099 Ricinus communis EST 1 aa diff at end
69-71% to many Jatropha sequences




>CYP71B JcCA0106771.10 -  

64% to CYP71AS1 Citrus sinensis


84% to CYP71AS JcCB0119211.20 
91% to CYP71   JcCA0094041.10

74% to Ricinus communis XM_002523192


73% to CYP71B65 gi|255564484|ref|XP_002523238.1  Ricinus communis






>CYP71B JcCB0000691.50 - pseudogene



48% to CYP71B34 Arab.
53% to CYP71AS5 Vitis
71% to JcCA0094041.10
64% to CYP71B65 gi|255564484|ref|XP_002523238.1  Ricinus communis



      GLPFSRHHIKALLM (0) 17769



      (50 aa deletion)



>CYP71B JcCB0000691.60 -


second gene runs off the end of the contig

58% to CYP71B34 Arab.
73% to XM_002523189.1 Ricinus communis
83% to JcCA0021071.10
no ESTs extend seq
73% TO CYP71B64   gi|255564478|ref|XP_002523235.1  Ricinus communis








>CYP71B JcCA0074451.10 +   


96% to JcCB0201851.20
70% to XM_002523189 Ricinus communis
no ESTs
70% to CYP71B65 gi|255564484|ref|XP_002523238.1  Ricinus communis







>CYP71B JcCD0057194.10 + pseudogene


97% to JcCA0074451.10
71% to CYP71B65 gi|255564484|ref|XP_002523238.1  Ricinus communis


1176 GISI & 1187


1239 DWRLPNDMKE 1268


>CYP71B JcCB0220681.10 + possible pseudogene or seq errors at N-term part


93% to JcCA0021071.10
72% to XM_002523189 Ricinus communis
no ESTs
72% to CYP71B65 gi|255564484|ref|XP_002523238.1  Ricinus communis




147 KAMLM (0)



>CYP71B JcCD0055407.10 +



66% to XM_002523192 Ricinus communis

65% to CYP71B65 gi|255564484|ref|XP_002523238.1  Ricinus communis






>CYP71B JcCB0278621.10 - pseudogene


94% to JcCA0126681.10
67% to XM_002523189 Ricinus communis
67% TO CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis




>CYP71B JcCB0471061.10 - pseudogene N-TERM


42% to CYP71B19 Arab.

52% to JcCB0003071.10
54% TO CYP71B76 gi|255570189|ref|XP_002526055.1  Ricinus communis







>CYP71B JcCB0282671.10 - pseudogene


39% to CYP71AS JcCB0003071.10 mid region
36% to CYP71AS7v1 Vitis
46% to JcCB0471061.10 
41% TO CYP71B69 gi|255564492|ref|XP_002523242.1  Ricinus communis







CYP71D subfamily (68 sequences, 22 are complete or nearly complete )

In Euphorbia lagascae DD025978 (patent) CYP726A1 is a Cytochrome P450 enzyme

associated with the synthesis of delta12-epoxy groups in fatty acids.

(vernolic acid) used for high temp lubricant


>CYP71D JcCA0123251.10 + runs off the end


49% to CYP71BE1 Vitis vinifera
51% to CYP726   JcCA0077481.10
59% to XM_002522857 Ricinus communis
finished, no ESTs to extend
56% to CYP71D329  gi|255563804|ref|XP_002522903.1  Ricinus communis








>CYP71D329 XM_002522857 Ricinus communis, XP_002522903.1



>CYP71D JcCA0298871.10 + pseudogene fragment, N-TERM


59% to JcCB0123521.10 
59% to CYP71BE6 Vitis
57% to CYP726A JcCA0309451.10
58% to CYP71AV1 
63% to CYP71D114 XM_003519575 Glycine max
no ESTs
57% TO CYP71D324 gi|255563520|ref|XP_002522762.1  Ricinus communis


5049 SLKKLAE 5069 &



>CYP71D JcCA0301341.10 - 

65% to CYP726A2 Euphorbia esula (Malpighiales)
66% to CYP71D338 gi|255544544|ref|XP_002513333.1  Ricinus communis
64% to CYP71D341   gi|255544556|ref|XP_002513339.1  Ricinus communis











>CYP71D JcCA0150621.10 -  pseudogene

BABX01005721 runs off end at ETAK

68% to CYP71D338   gi|255544544|ref|XP_002513333.1  Ricinus communis
97% to CYP71D   JcCA0301341.10











>CYP71D JcCA0019181.10 - 

64% to CYP726A2 Euphorbia esula (Malpighiales)
64% to CYP71D338   gi|255544544|ref|XP_002513333.1  Ricinus communis
62% to CYP71D341   gi|255544556|ref|XP_002513339.1  Ricinus communis











>CYP71D JcCB0836941.10 +

BABX01108106 runs off the end  at RRIC

93% to CYP71D   JcCA0019181.10
65% to CYP71D338   gi|255544544|ref|XP_002513333.1  Ricinus communis



>CYP71D JcCA0134061.10 +  N-term

98% to CYP71D JcCA0019181.10 allele?
60% to CYP71D338   gi|255544544|ref|XP_002513333.1  Ricinus communis

No ESTs to extend seq







>CYP71D JcCB0026731.10 +  

missing the N-term

65% to CYP726A2 Euphorbia esula (Malpighiales)
66% to CYP71D338   gi|255544544|ref|XP_002513333.1  Ricinus communis
finished could not extend

EST GO247167









>CYP71D JcCA0290321.10 + 

61% to CYP726A2 Euphorbia esula (Malpighiales)
62% to CYP71D338   gi|255544544|ref|XP_002513333.1  Ricinus communis











>CYP71D JcCA0141621.10 + 

59% to CYP726A2 Euphorbia esula (Malpighiales)
60% to CYP71D338   gi|255544544|ref|XP_002513333.1  Ricinus communis












>JcCB0054381.10 +  pseudogene


59% to CYP71D338   gi|255544544|ref|XP_002513333.1  Ricinus communis
98% to CYP71D   JcCA0141621.10






(large deletion)



>CYP71D JcCB0821811.10 -  

61% to CYP726A2 Euphorbia esula (Malpighiales)
60% to CYP71D338   gi|255544544|ref|XP_002513333.1  Ricinus communis
missing N-term 39 aa










>CYP71D JcCB0665641.10 - 

BABX01097159 runs off the end at HPV

97% to CYP71D   JcCB0821811.10
61% to CYP71D339 XP_002513335.1  Ricinus communis

No ESTs to extend seq





>CYP71D JcCA0163731.10 + 

95% to CYP726A JcCB0821811.10
60% to CYP71D338   gi|255544544|ref|XP_002513333.1  Ricinus communis
runs of the end at PHH, missing 62 aa at N-term












>CYP71D JcCD0004812.10 -  pseudogene

BABX01139558.1 runs off end at LHP

1 aa diff to CYP71D   JcCA0163731.10







>CYP71D JcCB0303031.20 - 

56% to CYP726A2 Euphorbia esula (Malpighiales)
60% to CYP71D341   gi|255544556|ref|XP_002513339.1  Ricinus communis











>CYP71D JcCA0309451.10 + 

54% to CYP726A2 Euphorbia esula (Malpighiales)
70% to CYP71D330   gi|255580182|ref|XP_002530922.1  Ricinus communis
next best 61% to CYP71D326   gi|255563438|ref|XP_002522721.1  Ricinus communis











>CYP71D JcCB0521021.10 +

84% to CYP71D JcCA0309451.10
62% to CYP71BE1   Vitis vinifera
63% to CYP71D326   gi|255563438|ref|XP_002522721.1  Ricinus communis 











>CYP71D JcCA0116831.10 + 

52% to CYP726A2 Euphorbia esula (Malpighiales)
68% to CYP71D330   gi|255580182|ref|XP_002530922.1  Ricinus communis











>JcCA0296221.20 – N-term pseudogene


83% to CYP71D JcCA0116831.10

59% to CYP71D330 XP_002530922.1 Ricinus communis










>CYP71D JcCB0508101.10 +  pseudogene


86% to CYP71D   JcCA0116831.10
59% to CYP71D330   gi|255580182|ref|XP_002530922.1  Ricinus communis







>CYP71D JcCD0001888.10 –


96% to JcCB0040361.20, 96% to CYP726   JcCA0116831.10
69% to CYP71D330   gi|255580182|ref|XP_002530922.1  Ricinus communis
no ESTs to extend seq.









>CYP71D JcCB0442001.10 +


87% to CYP71D   JcCD0001888.10
71% to CYP71D330   gi|255580182|ref|XP_002530922.1  Ricinus communis








>CYP71D JcCB0021881.20 - 


61% to CYP71BE1   Vitis vinifera
89% to CYP71D   JcCD0001888.10
69% TO CYP71D330   gi|255580182|ref|XP_002530922.1  Ricinus communis









>CYP71D JcCB0040361.20 +


95% to CYP726 JcCA0116831.10
67% TO CYP71D330   gi|255580182|ref|XP_002530922.1  Ricinus communis 
no ESTs to extend seq.








>CYP71D JcCB0166851.10 +  

52% to CYP726A2 Euphorbia esula (Malpighiales)
66% TO CYP71D330   gi|255580182|ref|XP_002530922.1  Ricinus communis











>CYP71D JcCB0175211.10 - 

50% to CYP726A2 Euphorbia esula (Malpighiales)
64% TO CYP71D324   gi|255563520|ref|XP_002522762.1  Ricinus communis











>CYP71D JcCB0077881.20 +  N-term


70% to JcCB0123521.10
69% to CYP726   JcCB0175211.10
69% TO CYP71D324   gi|255563520|ref|XP_002522762.1  Ricinus communis



>CYP71D JcCA0316031.20 –

61% TO CYP71D324   gi|255563520|ref|XP_002522762.1  Ricinus communis 
50% to CYP726A2 Euphorbia esula (Malpighiales)











>CYP71D JcCB0054631.10 + 

51% to CYP726A2 Euphorbia esula (Malpighiales)
65% TO CYP71D330   gi|255580182|ref|XP_002530922.1  Ricinus communis
EST GW615837











>CYP71D JcCB0420261.10 -  

48% to CYP726A2 Euphorbia esula (Malpighiales)
60% TO CYP71D324   gi|255563520|ref|XP_002522762.1  Ricinus communis
missing about 9 a at N-term











>CYP71D JcCA0313091.10 + 

49% to CYP726A2 Euphorbia esula (Malpighiales)
63% TO CYP71D324   gi|255563520|ref|XP_002522762.1  Ricinus communis











>CYP71D JcCB0625131.10 –

BABX01094844   runs off the end at MGSW

97% to CYP71D   JcCA0313091.10




>CYP71D JcCA0267751.10 - 

49% to CYP726A2 Euphorbia esula (Malpighiales)
63% TO CYP71D324   gi|255563520|ref|XP_002522762.1  Ricinus communis











>CYP71D JcCB0166761.10 + 

52% to CYP726A2 Euphorbia esula (Malpighiales)
68% TO CYP71D330   gi|255580182|ref|XP_002530922.1  Ricinus communis
BABX01063925.1 frameshift at & possible pseudogene











>CYP71D JcCB0683541.10 +

BABX01098116.1  runs off the end at EID

96% to CYP71D JcCB0166761.10
78% to CYP71D330   gi|255580182|ref|XP_002530922.1  Ricinus communis

No ESTs to extend seq





>CYP71D JcCB0257541.10 + pseudogene


59% to CYP71BE1   Vitis vinifera
77% to CYP71D   JcCB0166761.10
83% TO CYP71D   JcCB0040361.20
67% to CYP71D330 XP_002530922.1  Ricinus communis









>JcCA0011081.20 +  N-term exon 1


90% to JcCB0166761.10

61% to CYP71D330   gi|255580182|ref|XP_002530922.1  Ricinus communis

no EST to extend seq







>CYP71D JcCA0304601.10 - 

50% to CYP726A2 Euphorbia esula (Malpighiales)
64% to CYP71D324   gi|255563520|ref|XP_002522762.1  Ricinus communis
note: same as JcCD0062548.10 but JcCD0062548.10 has the correct C-term seq (join)

JcCD0062548.10 - 

BABX01141191 runs off contig at NIID

61% to CYP71D324 gi|255563520|ref|XP_002522762.1  Ricinus communis
exon 1 100% to    JcCA0304601.10











>CYP71D JcCA0077481.10 - 

50% to CYP726A2 Euphorbia esula (Malpighiales)
58% to CYP71D326   gi|255563438|ref|XP_002522721.1  Ricinus communis



N-term does not match very well,

Better top

CYP71D329   gi|255563804|ref|XP_002522903.1  Ricinus communis












>CYP71D JcCA0137661.20 –


missing the N-term

52% to CYP726A2 Euphorbia esula (Malpighiales)
61% to CYP71D326   gi|255563438|ref|XP_002522721.1  Ricinus communis












>JcCA0149291.10 + pseudogene


87% to CYP726   JcCA0137661.20
54% to CYP71BE1   Vitis vinifera
62% to CYP71D326   gi|255563438|ref|XP_002522721.1  Ricinus communis







>CYP71D JcCD0049678.10 + 


nearly identical (3 aa diffs) to JcCA0137661.20 up to SVELK

98% to CYP71D   JcCA0137661.20 whole seq
92% to JcCA0149291.10
62% to CYP71D326   gi|255563438|ref|XP_002522721.1  Ricinus communis





>CYP71D JcCB0542951.10 –


GW876473.1 GW879708
51% to CYP726A2 Euphorbia esula (Malpighiales)
62% to CYP71D326   gi|255563438|ref|XP_002522721.1  Ricinus communis

JMS27L13r.10 - 

100% to CYP726   JcCB0542951.10 












>CYP71D JcCA0151631.20 +  runs off the end


64% to CYP726 JcCA0137661.20, No ESTs to extend the seq
77% to CYP71D326 XP_002522721.1  Ricinus communis









>CYP71D JcCA0241141.10 - 

BABX01015828.1 runs off the end at KST

50% to CYP71BE1   Vitis vinifera
86% to CYP726   JcCB0175211.10
63% to CYP71D324 XP_002522762.1  Ricinus communis
no ESTs to extend seq.








>CYP71D JcCB0254461.20 – exon 1


62% to CYP71D338 XP_002513333.1  Ricinus communis
94% to CYP71D JcCA0301341.10
no ESTs







>JcCD0049428.10 + N-term


96% to CYP71D JcCB0254461.20
63% to CYP71D338 XP_002513333.1  Ricinus communis

No ESTs to extend seq







>CYP71D JcCB0152991.10 - pseudo


69% to CYP71D   JcCB0420261.10

CYP71D324 XP_002522762.1  Ricinus communis

No start Met seen











>CYP71D JcCB0176751.10 - 


61% t o CYP71D324   gi|255563520|ref|XP_002522762.1  Ricinus communis
60% to CYP71D326   gi|255563438|ref|XP_002522721.1  Ricinus communis
62% to CYP71D   JcCA0316031.20
EST GT969884 joins exon 1 and exon 2
Exon 2 = JcCA0285071.10











>CYP71D JcCB0176751.20 –


BABX01088561.1 end of exon 1 is 100% to BABX01064550 (join)

Exon 1 = JcCB0537261.10
66% to CYP71D326 XP_002522721.1  Ricinus communis
61% to CYP71D   JcCB0176751.10









>CYP71D JcCB0123521.10 – N-term

BABX01061210.1 runs off contig at SLAD

69% to CYP71D324   gi|255563520|ref|XP_002522762.1  Ricinus communis
62% to CYP71D326   gi|255563438|ref|XP_002522721.1  Ricinus communis
68% to CYP71D   JcCB0175211.10

No ESTs to extend seq






>CYP71D JcCB0077881.10 +  exon 2


68% to CYP71D324   gi|255563520|ref|XP_002522762.1  Ricinus communis
70% to CYP71D322   gi|255587922|ref|XP_002534441.1  Ricinus communis
71% to CYP71D   JcCA0316031.20

No ESTs to extend seq






>CYP71D JcCB0401681.10 +

BABX01079674 runs off contig at both ends

69% to CYP71D   JcCB0175211.10
73% to CYP71D324   gi|255563520|ref|XP_002522762.1  Ricinus communis
66% to CYP71D326   gi|255563438|ref|XP_002522721.1  Ricinus communis

No ESTs to extend seq









>CYP71D JcCA0225871.10 - 


70% to CYP71D326   gi|255563438|ref|XP_002522721.1  Ricinus communis
61% to CYP71D343P   gi|255544568|ref|XP_002513345.1  Ricinus communis
87% to JcCA0149291.10

No ESTs to extend seq







>CYP71D JcCA0178191.10 – exon 2

BABX01008793 Runs off end just before DMFI

70% to CYP71D326   gi|255563438|ref|XP_002522721.1  Ricinus communis
62% to CYP71D343P   gi|255544568|ref|XP_002513345.1  Ricinus communis
93% to CYP71D JcCA0267751.10







>CYP71D JcCB0307111.10 – N-term

BABX01073328.1 runs off the end at KGAI

58% to CYP71D338   gi|255544544|ref|XP_002513333.1  Ricinus communis
71% to CYP71D JcCA0290321.10

No ESTs to extend seq







>CYP71D JcCB0222771.10 – N-term

BABX01067530  runs off the end at QEH 

No ESTs to extend seq

62% to CYP71D338 XP_002513333.1 Ricinus communis
84% to CYP71D JcCA0141621.10







>CYP71D JcCB0200201.10 +  pseudogene


82% to JcCA0285071.10
85% to CYP71D   JcCB0176751.10
70% to CYP71BE1   Vitis vinifera
72% to CYP71D322 XP_002534441.1  Ricinus communis




>CYP71D JcCB0835781.10 -  exon 2

80% to CYP71D   JcCA0290321.10
67% to CYP71D338 XP_002513333.1  Ricinus communis

No ESTs to extend seq






>CYP71D JcCB0472231.10 –


65% to CYP71D329 XM_002522857 Ricinus communis, XP_002522903.1
68% to CYP71D   JcCA0077481.10

No ESTs to extend seq







>CYP71D JcCB0733471.10 -  

BABX01101510 runs of contig at both ends

BABX01071742.1 = C-term

62% to CYP71D   JcCA0019181.10
67% to CYP71D338 XP_002513333.1  Ricinus communis
ESTs GW614558, GO246714.1
C-term end is not clear










>CYP71D JcSR432238r.10 - 

BABX01120440.1 runs off the end at IGE

BABX01020522 runs off the end at EKFN

88% to CYP71D   JcCB0176751.10 
73% to CYP71D335 gi|255547540|ref|XP_002514827.1  Ricinus communis

No ESTs to extend seq




>CYP71D JcCB0741061.10 +

BABX01102121.1 runs off the end at SLT

60% to CYP71D341   gi|255544556|ref|XP_002513339.1  Ricinus communis
66% to CYP71D   JcCB0303031.20 
EST GW879869.1







>CYP71D JcCD0082551.10 + pseudogene

BABX01143592 runs off the end at DMNE

59% to CYP71D   JcCB0542951.10
61% to CYP71D341 XP_002513339.1  Ricinus communis









>CYP71D JcCA0132211.10 + pseudogene


78%  to CYP71D   JcCA0141621.10

CYP71D338 XP_002513333.1  Ricinus communis





DV &






>CYP71D JcCB0285551.10 –

BABX01071742.1  runs off the end at CEL

68% to CYP71D   JcCA0019181.10
75% to CYP71D342 XP_002513342.1  Ricinus communis
EST GO246714.1





>CYP71D JcSR377678f.10 –

BABX01120300 runs off the end at LHM

47% to CYP71BE1 Vitis vinifera
53% to CYP71D JcCB0303031.20 N-term
53% to CYP71D341 XP_002513339.1  Ricinus communis 
no ESTs to extend the seq








>CYP71E JcCA0265271.10 –

54% to CYP71BC1 Vitis vinifera
47% to CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis
70% to CYP71E7 AY217351.1 Manihot esculenta cytochrome P450 protein CYP71E










>CYP71E JcCA0245461.10 + pseudogene

small deletion of 8 aa at frameshift &


95% to CYP71 JcCA0265271.10
46% to CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis
69% to CYP71E7 AY217351.1 Manihot esculenta cytochrome P450 protein CYP71E










>CYP71E JcCA0282051.10 - 

54% to CYP71BC1   Vitis vinifera


EST GW877052.1
47% to CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis
70% to CYP71E7  Manihot esculenta  AY217351











>CYP71E JcCB0047811.10 + 

54% TO CYP71BC1   Vitis vinifera


70% to CYP71E7  Manihot esculenta  AY217351
47% to CYP71B64   gi|255564478|ref|XP_002523235.1  Ricinus communis
Ricinus does not have a CYP71E in the available genome sequence











>CYP71E JcCB0345071.10 +

BABX01075737.1 , last exon

98% to JcCA0282051.10
97% to JcCB0047811.10
93% to JcCA0265271.10
92% to JcCA0245461.10
56% to CYP71BC1 Vitis
no ESTs
78% to CYP71E7  Manihot esculenta  AY217351




>CYP71E JcCA0196161.10 + 


98% to JcCB0247451.10
96% to JcCA0282051.10
93% to JcCA0265271.10
93% to JcCB0047811.10
92% to JcCA0245461.10
54% to CYP71BC1 Vitis

53% to XM_002523196 Ricinus communis

N-term, runs off the contig
72% to CYP71E7  Manihot esculenta  AY217351






>CYP71E JcCB0247451.10 - 


98% to JcCA0196161.10
59% to CYP71AS6v1 Vitis
57% to CYP71BC1 Vitis
N-term, runs off the contig
69% to CYP71E7  Manihot esculenta  AY217351







>CYP71AN JcCA0022181.10 + short, missing C-term, runs off the end


47% to CYP71AN1 cottonwood 
78% to JcCA0272141.10, 73% to Ricinus communis XM_002531819 
no ESTs
finished, missing 113 aa at C-term
72% to CYP71AN23 gi|255582142|ref|XP_002531865.1  Ricinus communis








>CYP71AN JcCA0272141.10 - 


48% to CYP71AN1   cottonwood
69% to Ricinus communis XM_002531819
missing the C-term 70 aa
69% to CYP71AN23 gi|255582142|ref|XP_002531865.1  Ricinus communis










>CYP71AN JcCD0055514.10 -  pseudogene


68% to JcCD0065698.10
68% to Ricinus communis XM_002531819
68% to CYP71AN23 gi|255582142|ref|XP_002531865.1  Ricinus communis









>CYP71AN JcCC0123581.10 -  pseudogene


53% to CYP71AN1 cottonwood, 73% to JcCD0065698.10 
76% to JcCD0055514.10
71% to CYP71AN23 gi|255582142|ref|XP_002531865.1  Ricinus communis




>CYP71AN23 Ricinus communis XM_002531819, XP_002531865.1












>CYP71AN JcCB0575541.10 -  possible pseudogene, or 2 seq errors


Runs off the contig end

Two frameshifts

78% to Ricinus communis XM_002531819
no ESTs
missing N-term 16 aa
78% to CYP71AN23 gi|255582142|ref|XP_002531865.1  Ricinus communis








>CYP71AN JcCA0124441.10 +  2 adjacent genes


80% to JcCB0575541.10
no ESTs
77% to CYP71AN23 gi|255582142|ref|XP_002531865.1  Ricinus communis




>CYP71AN JcCA0124441.10 +  2 adjacent genes


77% to JcCB0575541.10

runs off the contig end


69% to CYP71AN23 gi|255582142|ref|XP_002531865.1  Ricinus communis











>CYP71AN JcCB0354411.10 - 


83% to JcCB0575541.10
75% to Ricinus communis XM_002531819
73% to JcCD0065698.10 
55% to CYP71AN1 cottonwood 
55% to CYP71AS6v1 Vitis
no ESTs
75% to CYP71AN23 gi|255582142|ref|XP_002531865.1  Ricinus communis




>CYP71AN JcCD0065698.10 +  /pseudo


76% to JcCB0575541.10
67% to CYP71AN23 gi|255582142|ref|XP_002531865.1  Ricinus communis






>CYP71AN JcCB0534051.10 +  pseudogene


70% to Ricinus communis XM_002531819
93% to JcCD0065698.10
76% to JcCB0575541.10
70% to CYP71AN23 gi|255582142|ref|XP_002531865.1  Ricinus communis




    SILL (0) 253






>CYP71AN JcCB0202231.10 +

53% to Ricinus   communis XM_002531819
51% to CYP71AN1   cottonwood


53% to CYP71AN23 gi|255582142|ref|XP_002531865.1  Ricinus communis











>CYP71AN JcCA0088631.10 -  pseudogene or two frameshifts


64% to CYP71AN2v1 cottonwood
51% to Ricinus communis XM_002531819
50% to JcCB0202231.10
46% to CYP71AU4 Vitis
45% to CYP71AU  XM_002511252.1 Ricinus communis
51% TO CYP71AN23 gi|255582142|ref|XP_002531865.1  Ricinus communis













>CYP71AP JcCA0223841.10 + 

75% to CYP71AP1 cottonwood


73% to CYP71AP11P gi|223550411|gb|EEF51898.1  Ricinus communis











>CYP71AP JcCB0501871.10 - 


95% to JcCA0223841.10
91% to JcCA0063931.10
89% to JcCB0353311.10

runs off contig end

no ESTs


70% to CYP71AP11P gi|223550411|gb|EEF51898.1 Ricinus communis




>CYP71AP JcCA0063931.10 + 


runs off the contig end

92% to JcCA0223841.10
91% to JcCB0501871.10
93% to JcCB0353311.10
no ESTs


75% to CYP71AP11P gi|223550411|gb|EEF51898.1 Ricinus communis




>CYP71AP JcCB0353311.10 –


93% to JcCA0063931.10
89% to JcCB0501871.10
86% to JcCA0223841.10

no ESTs 


71% to CYP71AP11P gi|223550411|gb|EEF51898.1 Ricinus communis




CYP71BF like (2 sequences)


>CYP71BF JcCA0311741.10 + 

57% to CYP71BF1   Carica papaya


70% to CYP71BF7   gi|223550412|gb|EEF51899.1  Ricinus communis











>CYP71BF JcCD0110401.10 -  pseudogene


47% to JcCA0204781.10 
53% to CYP726 JcCB0040361.20
56% to CYP71AS1 Citrus sinensis
62% to CYP71AU4 Vitis
64% to CYP71AU XM_002511253.1 Ricinus communis
64% TO CYP71BF5 gi|223550414|gb|EEF51901.1  Ricinus communis





>CYP71BF JcCB0695641.10 + 


65% to CYP71AU4 Vitis
76% to XM_002511253.1 Ricinus communis
61% to CYP71AR1 strawberry
63% TO CYP71BF JcCA0311741.10
56% to CYP726 JcCA0116831.10 
55% to JcCB0021881.20
runs off the contig end
no ESTs
76% TO CYP71BF5 gi|223550414|gb|EEF51901.1 Ricinus communis




>CYP71BF5 XM_002511253.1 Ricinus communis


52% to JcCA0311741.10
60% to CYP71AU4 Vitis, 56% to CYP71AU3 Vitis
56% to CYP71AU5 Vitis
100% TO CYP71BF5 gi|223550414|gb|EEF51901.1  Ricinus communis



>CYP71BF6 XM_002511252.1 Ricinus communis, EEF51900.1

62% to CYP71AU4 Vitis, 59% to CYP71AU3 Vitis

60% to CYP71AU5 Vitis,



>CYP71BF9 XM_002511247.1 Ricinus communis, EEF51895.1

62% to CYP71AU4 Vitis, 59% to CYP71AU3 Vitis

59% to CYP71AU5 Vitis,






>CYP71BG7 JcCA0153521.30 - 

70% to CYP71BG1 Solanum tuberosum
76% to CYP71BG7 gi|255547910|ref|XP_002515012.1  Ricinus communis










CYP73 family (only one gene and one pseudogene)



JcCA0130751.10 - BABX01003495  
JcCB0175681.10 + BABX01064470   

86% to CYP73A5 Arab.


95% TO CYP73A104  XP_002523952.1 cinnamate 4-hydroxylase Ricinus communis (ORTHOLOG)
63% TO CYP73A105 Ricinus communis












>JcCB0463761.10 +  pseudogene


72% to CYP73A Jatropha

90% TO CYP73A105 XP_002534996.1 cinnamate 4-hydroxylase Ricinus communis











CYP75 family (probably just two genes CYP75A and CYP75B)


>CYP75A53 JcCA0080681.10 -  short missing C-term

78% to CYP75A17   Glycine max
82% to CYP75A28 Vitis
no EST match to C-term
77% TO CYP75A53P XP_002526066.1 flavonoid 3-hydroxylase Ricinus communis










>Populus trichocarpa CYP75A13 XM_002313967
83% to JcCA0080681.10











>CYP75B JcCB0126071.10 – N-term

77% to CYP75B32v1 Vitis

78% to CYP75B63 XP_002514665.1 flavonoid 3-hydroxylase Ricinus

probable N-term to JcCB0573441.10







>CYP75B JcCB0573441.10 – I-helix to heme region

end of this seq is poor quality, use the EST


82% to CYP75B32v1 Vitis
80% to CYP75B63 XP_002514665.1 flavonoid 3-hydroxylase Ricinus







>CYP75B EST GW615118 C-term
79% to CYP75B32v1 Vitis
76% to CYP75B63 XP_002514665.1 flavonoid 3-hydroxylase Ricinus
96% to JcCB0573441.10   - 






>CYP75B63 Combined seqs. JcCB0126071.1 (exon1), JcCB0573441.10 (exon 2 first part)

GW615118 exon 2 second part


78% to CYP75B32v4 Vitis, 79% to Ricinus communis XM_002514619
78% TO CYP75B63 XP_002514665.1 Ricinus communis (ortholog)












>CYP75B63 Ricinus communis XM_002514619, XP_002514665.1
70% to CYP75B1 Arabidopsis thaliana
missing N-term











CYP76 family (31 sequences, 5 are complete)


>CYP76F BABX01005733.1a (+) strand

JcCA0150491.30 + 

53% to CYP76B4   Medicago sativa (alfalfa)
72% to CYP76F35 XP_002509652.1  Ricinus communis (partial seq)
68% to CYP76F36 XP_002509653.1  Ricinus communis











>CYP76F BABX01005733.1b (+) strand (no Jc number)

pseudogene first exon does not continue with second exon


62% to CYP76F36 XP_002509653.1  Ricinus communis

61% to CYP76F35 XP_002509652.1  Ricinus communis








>CYP76F BABX01005733.1c (-) strand

pseudogene fragment between other P450 sequences

JcCA0150491.40 –

50% to CYP76Y1   Vitis vinifera
54% to CYP76F36 XP_002509653.1  Ricinus communis


>CYP76 JcCA0148701.10 – exon 1


94% to CYP76 BABX01005733.1c

41% to CYP76 BABX01005733.1a

43% to CYP76F2 Vitis

41% to CYP76B4 Medicago sativa
no ESTs to extend seq
43% to CYP76F35 XP_002509652.1  Ricinus communis







>CYP76F BABX01005733.1d (-) strand, exon 2

JcCA0150491.50 - 

55% to CYP76Y1 Vitis vinifera
runs off end of contig
57% to CYP76F36 XP_002509653.1  Ricinus communis






>CYP76F JcCA0019761.10 -  short

52% to CYP76B4 Medicago sativa

JcCB0900091.10 + 

58% to CYP76F2 Vitis
100% to JcCA0019761.10 
73% to CYP76F36 gi|255537173|ref|XP_002509653.1  Ricinus communis










>CYP76F JcSR522923r.10 - /pseudo needs more work

98% to JcCA0019761.10
76% to CYP76F36 gi|255537173|ref|XP_002509653.1  Ricinus communis




>CYP76G JcCB0125441.10 + 

67% to CYP76G1 Arabidopsis thaliana

missing C-term, no EST for the C-term

cannot extend

75% to CYP76G11   XP_002528643.1  Ricinus communis
71% to CYP76G12   XP_002528644.1  Ricinus communis










>JcCB0960601.10 + /pseudo needs more work

48% to CYP76G1   Arabidopsis thaliana
45% to CYP76G   JcCB0125441.10

may be a false positive

51% to CYP76G11   gi|255575483|ref|XP_002528643.1  Ricinus communis



>CYP76A JcCA0141361.10 –

50% to CYP76A3 Petunia 
71% to CYP76A32 XP_002528653.1  Ricinus communis











>CYP76A JcCA0272121.10 +

49% to CYP76A3 Petunia


73% to CYP76A32 XP_002528653.1  Ricinus communis











>CYP76A JcCA0078231.10 + pseudo


75% to CYP76A32 XP_002528653.1  Ricinus communis
73% TO CYP76A   JcCA0272121.10 










>CYP76A JcCA0072481.10 + runs off the end at HQN

BABX01029086  no EST for N-term cannot extend

69% to CYP76   JcCA0272121.10
71% TO CYP76A33 XP_002528654.1  Ricinus communis











>CYP76A JcCA0007951.30 + pseudo NTERM + C-TERM


66% TO CYP76A29 XP_002528649.1  Ricinus communis
4 AA DIFFS TO CYP76A JcCA0072481.10








>CYP76A JcCB0573211.10 +  pseudogene

same as JcCA0007951.30

BABX01090940.1, BABX01029886.1











>CYP76A JcCA0315921.10 –

52% to CYP76A3   Petunia


GT981524 EST 99% to CYP76 JcCA0315921.10 (2 aa diffs)
94% TO CYP76A JcCB0089621.20
97% TO CYP76   JcCA0110571.10
66% TO CYP76A28 XP_002528647.1  Ricinus communis











>CYP76A JcCB0089621.20 - 

52% to CYP76A3   Petunia


66% TO CYP76A28 XP_002528647.1  Ricinus communis











>CYP76A JcCB0044461.20 –

55% to CYP76A3   Petunia
98% to CYP76 JcCB0089621.20
identical to CYP76 JcCA0110571.10  
67% TO CYP76A28 XP_002528647.1  Ricinus communis


EM &





>CYP76A JcCB0882341.10 +  pseudogene


70% TO CYP76A28 XP_002528647.1  Ricinus communis
77% TO CYP76A  JcCB0044461.20
runs off the end at LEK






>CYP76A JcCA0110571.10 -  runs off the end near SIEDD

96% to CYP76  JcCB0089621.20
67% to CYP76A28   gi|255575491|ref|XP_002528647.1  Ricinus communis




EM &






>CYP76A JcCB0044461.10 – C-TERM



69% TO CYP76A28 gi|255575491|ref|XP_002528647.1  Ricinus communis
100% TO CYP76   JcCA0110571.10




>CYP76A JcCA0232431.10 -


43% to CYP76A3   Petunia
97% to CYP76  JcCA0110571.10
71% to CYP76A28 XP_002528647.1  Ricinus communis
runs off the end at QWL









>CYP76A JcCA0004661.10 – N-term


88% to JcCA0246041.10
89% to CYP76   JcCB0089621.20
88% to CYP76   JcCA0315921.10
62% to CYP76A28 XP_002528647.1  Ricinus communis 
no ESTs to extend seq





>CYP76A JcCA0246041.10 +  N-term


91% to CYP76A JcCB0089621.20
90% to CYP76A JcCA0315921.10
88% TO JcCA0004661.10
63% to CYP76A28 XP_002528647.1  Ricinus communis
no ESTs to extend seq





>CYP76A JcCB0958511.10 + 


76% to JcCA0004661.10, 78% TO CYP76A JcCA0315921.10
67% TO CYP76A28 XP_002528647.1  Ricinus communis




>CYP76A JcCB0215111.10 + 

51% to CYP76A3   Petunia
73% TO CYP76A27 gi|255575487|ref|XP_002528645.1  Ricinus communis









>CYP76G JcCB0895001.10 -  pseudo N-TERM


42% to CYP76G1   Arabidopsis thaliana
62% to JcCB0044461.10
50% TO CYP76G11 XP_002528643.1 Ricinus communis









>CYP76G JcCB0044461.10 +  pseudo


47% TO CYP76G11 XP_002528643.1  Ricinus communis


FIRST 56 AA 100% TO JcCB0895001.10









>CYP76F JcCA0005432.20 -  C-TERM (EXON 2)


78% TO CYP76F36 XP_002509653.1  Ricinus communis


94% TO CYP76F JcCA0019761.10, NO ESTS EXTEND SEQ







>CYP76T JcCB0199131.10 +  pseudogene


59% to CYP76T1   Populus trichocarpa
72% to JcCA0111381.10
2 aa diffs to JcCB0477351.10, deletion after DWKL








>CYP76T JcCB0477351.10 –

60% to CYP76T1 Populus trichocarpa, 60% w/o the AE repeat
89% to JcCB0199131.10
45% to CYP76F36 XP_002509653.1  Ricinus communis
AE repeat seems wrong
runs of the end at both ends, no ESTs extend the seq







>CYP76T JcCA0111381.10 +   C-term

65% to CYP76T1   Populus trichocarpus


Runs off the end at VLV, no EST to extend seq
58% to CYP76F36   gi|255537173|ref|XP_002509653.1  Ricinus communis
59% to CYP80C5 EEF51432.1 (S)-N-methylcoclaurine 3'-hydroxylase Ricinus communis





CYP77 family (3 genes, 1 CYP77A and 2 adjacent CYP77B)


>CYP77A23 JcCB0013411.10 –


70% to CYP77A4   Arabidopsis thaliana

frameshift in internal seq

83% to CYP77A23 gi|255580098|ref|XP_002530881.1  Ricinus communis (ortholog)













>CYP77B13 JcCA0308661.20 +


71% to CYP77B1   Arabidopsis thaliana
87% to CYP77B13 XP_002518512.1  Ricinus communis (ortholog)













CYP77B second gene


>CYP77B JcCA0308661.10 –

BABX01023360.1 two CYP77B genes present

Runs off contig at PQL

75% to  JcCA0308661.20
88% to CYP77B14 XP_002518513.1  Ricinus communis
GT976824.1 spans the gap between first two contigs






>JcPR03EFLJT.10 + 

BABX01047264.1 runs off the end at RAK

65% to CYP77B   JcCA0308661.20
57% to CYP77B1   Arabidopsis thaliana







>JcCD0088070.10 –






>CYP77B14 Combined sequences JcCA0308661.10 plus EST plus two other contigs

71% to CYP77B JcCA0308661.20

88% to CYP77B14 XP_002518513.1  Ricinus communis (ortholog)















CYP78 family (7 sequences, 6 different genes, 4 are complete)


>CYP78A95a JcCB0739451.10 +  N-term

BABX01101991 runs off the end at RAAE

48% to CYP78D2   Populus trichocarpa
69% to JcCB0238121.10
72% to CYP78A99 EEF43444.1  Ricinus communis
92% to CYP78A95 XP_002533334.1  Ricinus communis (Ortholog)
(28 aa overlap at end)
No ESTs to extend seq






>CYP78A95b JcCB0239161.10 +  C-term

BABX01068741 runs off the end at RPRD

possible C-term for JcCB0739451.10

72% to JcCB0238121.10 combined
85% to CYP78A95 XP_002533334.1  Ricinus communis (Ortholog)
No ESTs to extend seq






>CYP78A96 JcCB0658201.10 -  end of exon 1

BABX01096755 runs off the end at LLRK

43% to CYP78A5   Arabidopsis thaliana
64% to CYP78   JcCA0262611.10
86% to CYP78A96 XP_002532268.1  Ricinus communis (Ortholog)
no ESTs for this seq 





>CYP78A97 JcCA0262611.10 - 

51% to CYP78D2 Populus trichocarpa
51% to CYP78A5 Arabidopsis thaliana
79% to Populus trichocarpa cytochrome P450 CYP78A20
78% to CYP78A97 XP_002527123.1  Ricinus communis (Ortholog)










>CYP78A98 JcCA0137911.10 - 

64% to CYP78A5 Arabidopsis thaliana
82% to CYP78A98 XP_002514632.1  Ricinus communis (ortholog)










>CYP78A99 JcCB0238121.10 + 

BABX01068664.1 runs off the end at TTAM

Total seq is 52% to CYP78A5   Arabidopsis thaliana

JcCB0028141.30 – C-term, possible end for JcCB0238121.10 (joined)

BABX01071418 runs off the end at GPEV

57% to CYP78A5   Arabidopsis thaliana
69% to JcCB0239161.10
total seq 50% to CYP78A JcCA0137911.10
75% to Populus trichocarpa cytochrome P450 (CYP78A22)
81% to CYP78A99 EEF43444.1  Ricinus communis (Ortholog)












>CYP78D5 JcCA0133671.10 - 

76% to CYP78D2 Populus trichocarpa


79% to CYP78D5 XP_002514920.1  Ricinus communis (Ortholog)










CYP79 family (24 sequences, 6 are complete)


>CYP79D JcCB0045301.10 + 

78% TO CYP79D1 Manihot esculenta

GW61520 only CYP79 EST

75% to CYP79D26 XP_002534163.1 Ricinus communis 
next best match 52% to CYP79D28 XP_002523441.1 Ricinus communis












>CYP79D JcCA0257981.10 +   


98% to CYP79D JcCB0045301.10
74% to CYP79D26 XP_002534163.1 Ricinus communis 












>CYP79D JcCB0007881.20 +

77% to CYP79D1 Manihot esculenta
74% to CYP79D26 gi|255587166|ref|XP_002534163.1  Ricinus communis
97% to CYP79D JcCA0257981.10
97% to CYP79D JcCB0045301.10












>CYP79D JcCB0045301.20 + C-term exons


98% to JcCB0089691.10, 98% to CYP79D JcCB0007881.20
80% to CYP79D26 XP_002534163.1  Ricinus communis






>CYP79D JcCB0643401.10 -  

BABX01095860 runs of the end at SEII

98% to CYP79D JcCB0007881.20 (5 aa diffs)
77% to CYP79D26 XP_002534163.1  Ricinus communis









>CYP79D JcCB0089691.10 + 

BABX01111691 runs off the end at VFA

98% to CYP79D   JcCB0007881.20 (6 aa diffs)
77% to CYP79D26 XP_002534163.1  Ricinus communis








>CYP79D JcCB0386341.10 – runs off the end at GELL


93% to CYP79D JcCB0007881.20
70% to CYP79D26 XP_002534163.1  Ricinus communis











>CYP79D JcCD0109805.10 +


67% to CYP79D26 XP_002534163.1  Ricinus communis 
94% TO CYP79D   JcCB0386341.10
runs off the end at DSV, covers end of exon 1



QDLL (0)


>CYP79D JcCA0009561.10 –

BABX01031693 one frameshift at &, no exons

54% to CYP79D1 Manihot esculenta
85% to JcCA0077011.10
71% to CYP79D31   = old CYP79A13 XP_002523435.1  Ricinus communis
71% to CYP79D29   XP_002523438.1  Ricinus communis
71% to CYP79D28   XP_002523441.1  Ricinus communis












>CYP79D JcCB0697441.10 -  C-term exons


95% to JcCB0931751.10, 89% to CYP79 JcCA0009561.10
76% to CYP79D27P   gi|255564902|ref|XP_002523444.1  Ricinus communis
74% to CYP79D31   = old CYP79A13 gi|255564884|ref|XP_002523435.1  Ricinus communis





>CYP79D JcCB0931751.10 + C-term exons

BABX01113920 runs off the end at VDN
95% to JcCB0697441.10, 88% to CYP79   JcCA0009561.10
75% to CYP79D31   = old CYP79A13 gi|255564884|ref|XP_002523435.1  Ricinus communis






>CYP79D JcCA0180311.10 - C-term exons

91% to JcCB0697441.10, 83% to CYP79 JcCA0009561.10
74% to CYP79D31   = old CYP79A13 gi|255564884|ref|XP_002523435.1  Ricinus communis






>CYP79D JcCA0276031.10 - C-term exons

90% to JcCA0180311.10, 86% to CYP79   JcCA0009561.10
77% to CYP79D27P   gi|255564902|ref|XP_002523444.1  Ricinus communis






>CYP79D JcCA0267971.20 +  C-term


53% to CYP79B2   Arabidopsis thaliana 
79% to CYP79   JcCA0276031.10
67% to CYP79D30 XP_002523436.1  Ricinus communis
2 AA DIFFS TO JcCB0172531.10   +  C-term





>CYP79D JcCB0172531.10 +  C-term


51% to CYP79B2   Arabidopsis thaliana
96% to JcCA0267971.20
78% TO CYP79 JcCB0931751.10
69% TO CYP79D27P XP_002523444.1  Ricinus communis





>CYP79D JcSR112794r.10 + C-term exons

/pseudo runs off the end AT VEW


94% TO CYP79 JcCA0009561.10
77% to CYP79D27P   gi|255564902|ref|XP_002523444.1  Ricinus communis





>CYP79D JcCA0077011.10 + exon 1

85% to JcCA0009561.10

64% to CYP79D28   gi|255564896|ref|XP_002523441.1  Ricinus communis
68% to CYP79D29   gi|255564890|ref|XP_002523438.1  Ricinus communis








>CYP79D JcCA0255421.10 -  exon 1

78% to JcCA0009561.10

67% to CYP79D28   gi|255564896|ref|XP_002523441.1  Ricinus communis








>CYP79D JcCA0101361.10 – pseudogene

BABX01000167 two frameshifts, probable pseudogene

89% to JcCA0009561.10
67% to CYP79D29   gi|255564890|ref|XP_002523438.1  Ricinus communis












>CYP79D JcCA0292601.10 +  exon 1

69% to CYP79D28 gi|255564896|ref|XP_002523441.1  Ricinus communis












>CYP79D JcCB0505001.10 +  exon 1

64% to CYP79D28 XP_002523441.1  Ricinus communis








>CYP79D JcCA0224261.10 – runs off at YGN

BABX01013942 one frameshift at &

64% to CYP79D28 XP_002523441.1  Ricinus communis









>CYP79D BABX01089614, runs of the end

64% to CYP79D28 XP_002523441.1  Ricinus communis








>CYP79D JcCB0612561.10 + /pseudo (two stop codons and a frameshift)

BABX01094105 runs off the end at HGFT

92% to CYP79 JcCA0009561.10
68% to CYP79D29 XP_002523438.1  Ricinus communis













CYP80 family (6 sequences, maybe 6 genes, 3 are complete with three more C-term pieces)


>CYP80C JcCA0128991.20 - 

63% to CYP80C1 Populus trichocarpa
65% TO CYP80C5 EEF51432.1 (S)-N-methylcoclaurine 3'-hydroxylase Ricinus communis
87% TO CYP80C   JcCA0261201.20, 84% TO JcSR157561r.10   – mid region, pseudogene
BABX01003289 first gene

two genes on this contig (-) strand

second gene JcCA0128991.10 runs off the end at HCFD












>CYP80C JcCA0128991.10 -  C-term PSEUDOGENE

BABX01003289 second gene runs off the end at HCFD

no ESTs to extend seq.

67% TO CYP80C5 EEF51432.1 (S)-N-methylcoclaurine 3'-hydroxylase Ricinus communis
80% TO CYP80C   JcCA0128991.20
91% TO JcSR422361f.10   + I-helix to PERF, possible pseudogene, NO EXON 1 UPSTREAM





>CYP80C JcSR157561r.10 – mid region, pseudogene

2 frameshifts, one stop

84% to CYP80C JcCA0128991.20, 82% to CYP80C JcCA0261201.20
63% to CYP80C6 XP_002513351.1 (S)-N-methylcoclaurine 3'-hydroxylase isozyme Ricinus communis

BABX01119759 runs off the contig at both ends









>CYP80C JcSR422361f.10 + I-helix to PERF, possible pseudogene

BABX01120392 runs of the end at FLD

67% to CYP80C1 Populus trichocarpa
62% TO CYP80C5 EEF51432.1 (S)-N-methylcoclaurine 3'-hydroxylase Ricinus communis
91% to JcCA0128991.10





>CYP80C JcCA0261201.10 + 

62% to CYP80C1 Populus trichocarpa
BABX01018063 first gene

JcCB0939001.10 +  C-term

JcCB0177411.10 -  N-term

64% TO CYP80C6   gi|255544580|ref|XP_002513351.1 (S)-N-methylcoclaurine            3'-hydroxylase isozyme Ricinus communis












>CYP80C JcCA0261201.20 +


FM894218 EST

62% to CYP80C1   Populus trichocarpa
JcCB0936721.10 +  C-term

BABX01018063 second gene

two genes on this contig

87% to CYP80C JcCA0128991.20
same as JcCB0936721.10
64% TO CYP80C5 EEF51432.1 (S)-N-methylcoclaurine 3'-hydroxylase Ricinus communis












CYP80E partial sequences


>CYP80E10 JcCA0258831.10 +  C-term


61% to CYP80C1 Populus trichocarpa
68% to JcCB0478711.10
51% to CYP80C   JcCA0261201.20

runs off the contig end at FSLK, missing 67 aa at N-term

no ESTs to extend seq.

76% TO CYP80E10 XP_002509713.1 (S)-N-methylcoclaurine 3'-hydroxylase Ricinus communis. Note: there is only one CYP80E in Ricinus, so this is the ortholog











>CYP80E JcCB0478711.10 -  C-term


runs off the end at RKS

no ESTs to extend seq.

54% to CYP80C JcCA0261201.10
57% to CYP80E1 Populus trichocarpa
66% to CYP80E10 XP_002509713.1 (S)-N-methylcoclaurine 3'-hydroxylase Ricinus communis
65% TO JcCA0258831.10
yellow region not well conserved








CYP81 family (29 sequences, 9 are complete)


>CYP81B54 JcCA0147611.20 - 

58% to CYP81B1v1   Helianthus tuberosus
75% to CYP81B54 XP_002510131.1  Ricinus communis (ortholog)
second best match is 

61% to CYP81B55 XP_002510130.1  Ricinus communis











>CYP81B55 JcCA0147611.10 – N-term

60% to CYP81B1v1   Helianthus tuberosus 
BABX01005370.1a (two genes on this contig)
Runs off the end of contig at RADE
Other gene is CYP81B54 JcCA0147611.20
67% to CYP81B54   JcCA0147611.20
76% to CYP81B55 XP_002510130.1  Ricinus communis (ortholog)
no ESTs to fill the gap

CYP81B55 exon 1

 BABX01113096a two genes on this contig

85% to JcCB0091661.10 
81% to CYP81B55 XP_002510130.1  Ricinus communis







>CYP81B JcCB0091661.10 +  pseudogene

BABX01113096b two genes on this contig

56% to CYP81B54   JcCA0147611.20
64% to CYP81B55 XP_002510130.1  Ricinus communis











>CYP81C14 JcCA0309481.10 - 

64% to CYP81C3 Populus trichocarpa
73% to CYP81C14 XP_002510136.1  Ricinus communis (ortholog)
next best is 52% to CYP81B55 XP_002510130.1  Ricinus communis












>CYP81S JcCA0044911.10 + 

65% to CYP81Q7   Vitis vinifera
73% to CYP81S17 XP_002524942.1  Ricinus communis
next best 68% to CYP81S18 XP_002524941.1  Ricinus communis











>CYP81S JcCD0072850.10 -   


96% to CYP81S JcCA0044911.10
78% to CYP81S17   gi|255567929|ref|XP_002524942.1  Ricinus communis
no ESTs







>CYP81S JcCA0152811.10 +


64% to CYP81Q7   Vitis vinifera
73% TO CYP81S17 XP_002524942.1  Ricinus communis
88% TO CYP81S   JcCA0044911.10












>CYP81S JcCB0769781.10 +  

BABX01104552.1 runs off the contig at both ends

76% to CYP81S JcCA0152811.10
73% to CYP81S17 XP_002524942.1  Ricinus communis

no ESTs to extend seq.









>CYP81S JcCA0152811.20 +  pseudogene missing part of exon 2

BABX01005963.1b (three genes on this contig)

71% to CYP81S18 XP_002524941.1  Ricinus communis










>CYP81S JcCA0152811.30 +


61% to CYP81Q7   Vitis vinifera
72% TO CYP81S18   gi|255567927|ref|XP_002524941.1  Ricinus communis
70% TO CYP81S   JcCA0044911.10












>CYP81S JcCA0058601.20 - 

58% to CYP81Q7   Vitis vinifera
67% to CYP81S16   gi|255564958|ref|XP_002523472.1  Ricinus communis
62% to CYP81S19   gi|255567921|ref|XP_002524938.1  Ricinus communis











>CYP81S JcCA0286101.10 + 

BABX01020837 exon 2

96% to CYP81S   JcCA0058601.20, 98% to JcCD0049914.10
72% to CYP81S16   gi|255564958|ref|XP_002523472.1  Ricinus communis






>CYP81S JcCD0049914.10 -  


96% to JcCA0286101.10
72% to CYP81S16 XP_002523472.1  Ricinus communis
runs of the end at SDL







>CYP81S JcCB0168221.10 +  pseudogene


Runs off the contig end

95% to CYP81S   JcCA0058601.20
96% to CYP81S   JcCB0810301.10
65% to CYP81S16 XP_002523472.1  Ricinus communis










>CYP81S JcCB0548761.10 - pseudogene


49% to CYP81Q7   Vitis vinifera
56% to CYP81S   JcCA0058601.20
58% to CYP81S19 gi|255567921|ref|XP_002524938.1  Ricinus communis













>CYP81S JcCB0810301.10 – exon 1


98% to JcCA0058601.20 (3 aa diffs)
no ESTs to extend seq.
64% TO CYP81S16 XP_002523472.1  Ricinus communis








>CYP81S JcCB0003611.10 –

60% to CYP81Q7   Vitis vinifera
64% to CYP81S18   gi|255567927|ref|XP_002524941.1  Ricinus communis
66% to CYP81S JcCA0044911.10












>CYP81S JcCB0122661.20 - 

55% to CYP81Q7   Vitis vinifera
59% TO CYP81S20   gi|255538150|ref|XP_002510140.1  Ricinus communis
81% TO JcCB0480461.10












>CYP81S JcCB0043451.20 + exon 1

BABX01081785 exon 1

BABX01079139  exon 2 = JcCB0393371.10   -
56% to CYP81Q7   Vitis vinifera
80% to JcCB0023541.20, 78% to CYP81Q JcCB0122661.20
60% to CYP81S20 XP_002510140.1  Ricinus communis
EST GT978449.1










>CYP81S JcCB0480461.10 +

BABX01085177.1 runs off the end at both ends

60% TO CYP81S20 XP_002510140.1  Ricinus communis
81% TO CYP81S   JcCB0122661.20
no ESTs t oextend seq









>CYP81S JcCB0023541.20 +  exon 1


95% to CYP81S   JcCB0480461.10
80% to CYP81S   JcCB0043451.20 + exon 1
54% to CYP81Q7   Vitis vinifera
55% to CYP81S20 XP_002510140.1  Ricinus communis
no ESTs to extend seq







>CYP81S JcCB0130261.10 +  pseudogene


48% to CYP81B1v1  Helianthus tuberosus
57% to JcCB0480461.10
53% to CYP81S20 XP_002510140.1  Ricinus communis





>CYP81S JcCA0205711.10 + 

BABX01011864.1 exon 1

58% to CYP81S JcCA0058601.20
71% to CYP81S19 XP_002524938.1  Ricinus communis

No ESTs to extend seq







>CYP81S JcCA0298971.10 + pseudogene


65% to CYP81S JcCB0003611.10
55% TO CYP81S18 XP_002524941.1  Ricinus communis






>CYP81S JcCB0584681.10 +  


66% to CYP81S JcCA0044911.10
68% to CYP81S16 XP_002523472.1  Ricinus communis
no ESTs








>CYP81T2 BABX01061655.1b N-term

Runs off the end

61% to CYP81T3 XP_002510139.1  Ricinus communis
66% to CYP81T2P XP_002510137.1  Ricinus communis
59% to CYP81T JcCA0299491.10
EST GW877928.1

CYP81T JcCB0300631.10 – C-term

BABX01072891.1 exon 2

61% to CYP81S JcCA0152811.10
61% to CYP81S JcCB0043451.20 
65% to CYP81T3 JcCA0299491.10
66% to CYP81T2P Ricinus communis (probable ortholog)
67% to CYP81T1 Populus trichocarpa
63% to CYP81T3 XP_002510139.1  Ricinus communis
no ESTs to extend seq











>CYP81T3 JcCA0299491.10 –

71% to CYP81T1   Populus trichocarpa


77% TO CYP81T3 XP_002510139.1  Ricinus communis (ORTHOLOG)
52% TO CYP81B54  JcCA0147611.20











CYP82 family (50 sequences, 7 are complete)




>CYP82C24 JcCB0543141.10 +

BABX01088990.1 runs off the end at LAPY

53% to CYP82H1  Ammi majus
47% to CYP82C   JcCA0270761.10 
73% to CYP82C24 EEF43343.1  Ricinus communis (ortholog)
next best 47% to CYP82C26 XP_002510298.1  Ricinus communis 
no ESTs to extend seq, or join pieces

JcCA0116081.10 -  join with JcCB0543141.10

BABX01001818.1 runs off the end at YGMS

75% to CYP82C24 gi|223541795|gb|EEF43343.1  Ricinus communis (ortholog)

next best 62% to CYP82C28   gi|255538472|ref|XP_002510301.1  Ricinus communis











>CYP82C JcCA0270761.10 +


60% to CYP82C2 Arabidopsis thaliana
83% to CYP82C26   gi|255538466|ref|XP_002510298.1  Ricinus communis
next best 79% to CYP82C25 XP_002510297.1  Ricinus communis













>CYP82C JcCD0128885.10 + 

BABX01128855.1  runs off both ends, mid region

45% to CYP82M1v1 Nicotiana tabacum
66% to CYP82C   JcCA0270761.10
63% to CYP82C25   gi|255538464|ref|XP_002510297.1  Ricinus communis



>CYP82C JcCB0327041.10 +  N-term


79% to JcCA0270761.10
77% to x CYP82C26   gi|255538466|ref|XP_002510298.1  Ricinus communis
no ESTs to extend seq




>CYP82C JcCA0015251.20 – missing the N-term (off the contig)


72% to JcCA0270761.10
71% to CYP82C26   gi|255538466|ref|XP_002510298.1  Ricinus communis
next best 69% to CYP82C25 XP_002510297.1  Ricinus communis
no ESTs to extend seq










>CYP82C JcCA0015251.10 -  possible pseudogene

BABX01005926 IQRDPK exists in two different frames at the frameshift &

71% to CYP82C JcCA0270761.10

71% to CYP82C25   gi|255538464|ref|XP_002510297.1  Ricinus communis
71% to CYP82C26   gi|255538466|ref|XP_002510298.1  Ricinus communis 









K &




>CYP82C32 JcCA0283661.10 - 

51% to CYP82Q1   Stevia rebaudiana
75% to CYP82C32 XP_002510312.1  Ricinus communis (ortholog)
59% to CYP82C33   gi|255538496|ref|XP_002510313.1  Ricinus communis











>CYP82C33a JcCB0142741.10 -   

BABX01062408.1a  runs off the conti at GDI

Contig has two sequence including JcCB0142741.20
59% to CYP82C   JcCA0055221.10
67% to CYP82C33   gi|255538496|ref|XP_002510313.1  Ricinus communis (ortholog)
next best is 63% to CYP82C34P   gi|255538498|ref|XP_002510314.1  Ricinus communis
one aa diff in overlap







>CYP82C33b BABX01029322.1a two seqs on this contig

runs off the end at VEMK

66% to CYP82C33   gi|255538496|ref|XP_002510313.1  Ricinus communis (ortholog)
next best 55% to CYP82C32   gi|255538494|ref|XP_002510312.1  Ricinus communis










>CYP82C JcCA0074591.10 + pseudogene

BABX01029322.1b two seqs on this contig  

bottom part is 65% to CYP82C33   gi|255538496|ref|XP_002510313.1  Ricinus communis
55% to CYP82C32   JcCA0283661.10
57% to CYP82C   JcCB0142741.20













>CYP82C JcCB0477511.10 + pseudogene

80% to JcCA0074591.10
53% to CYP82C33   gi|255538496|ref|XP_002510313.1  Ricinus communis




>CYP82C JcCB0142741.20 –

51% to CYP82D1   Medicago sativa
62% to CYP82C29   gi|255538486|ref|XP_002510308.1  Ricinus communis
62% to CYP82C31   gi|255538492|ref|XP_002510311.1  Ricinus communis

BABX01062408  bad exon boundary at GLIL














>CYP82C JcCB0388011.10 -  

BABX01078805.1 runs off the contig at VMSY

63% to CYP82C29   gi|255538486|ref|XP_002510308.1  Ricinus communis
98% to CYP82   JcCB0142741.20 allele?











>CYP82SC JcCB0735191.10 +

BABX01101652.1 runs off at EFE

74% to JcCB0388011.10
64% to CYP82C31   gi|255538492|ref|XP_002510311.1  Ricinus communis




>CYP82C JcCB0802841.10 –

BABX01106367.1 runs off the contig end at RHT

97% to CYP82   JcCB0142741.20 
61% to CYP82C29   gi|255538486|ref|XP_002510308.1  Ricinus communis
61% to CYP82C31   gi|255538492|ref|XP_002510311.1  Ricinus communis
no ESTs to extend seq.









>CYP82C JcPR03BYXIH.10 -   

BABX01043576.1 runs off both ends

78% to CYP82C  JcCB0802841.10
60% to CYP82C29   gi|255538486|ref|XP_002510308.1  Ricinus communis






>CYP82C JcCB0894651.10 +

BABX01111516.1 runs off the contig end at HRN

61% to CYP82C   JcCA0055221.10
58% to CYP82C   JcCB0802841.10
72% to CYP82C33 XP_002510313.1  Ricinus communis
missing first 86 aa








>CYP82C JcPR03AW9Y2.10 +

BABX01041819 runs off both ends

59% to CYP82B1   Eschscholzia californica
70% to CYP82 JcCB0802841.10
64% to CYP82C33   gi|255538496|ref|XP_002510313.1  Ricinus communis






>CYP82C JcCA0314411.20 + exon 1 plus part of exon 2


46% to CYP82Q1 Stevia rebaudiana 
74% to JcCA0055221.10
71% to CYP82C29   gi|255538486|ref|XP_002510308.1  Ricinus communis
71% to CYP82C31   gi|255538492|ref|XP_002510311.1  Ricinus communis
no EST to extend the seq.










>CYP82C JcCB0443251.20 -  pseudogene

BABX01082246 runs off the contig at AAS, 2 frameshifts

44% to CYP82A6   Pisum sativum
72% to CYP82C29   gi|255538486|ref|XP_002510308.1  Ricinus communis
72% to CYP82C31   gi|255538492|ref|XP_002510311.1  Ricinus communis
90% to JcCA0055221.10
86% to CYP82   JcCA0314411.20, first 110 aa are identical










>CYP82C JcCA0055221.10 + exon 1, intron seq runs off the contig


75% to JcCA0314411.20, nearly identical to JcCA0171811.10
73% to CYP82C29   gi|255538486|ref|XP_002510308.1  Ricinus communis
73% to CYP82C31   gi|255538492|ref|XP_002510311.1  Ricinus communis
96% to JcCB0443251.20
47% to CYP82D1 Medicago sativa
no EST to extend the seq.








>CYP82C JcCB0280211.10 +  

BABX01071330.1 runs off end at EDFM

79% to CYP82   JcCB0142741.20
63% to CYP82C29   gi|255538486|ref|XP_002510308.1  Ricinus communis







>CYP82C JcCA0171811.10 +

BABX01008089 runs off the end at REFM

52% to CYP82Q1   Stevia rebaudiana
76% to CYP82C29   gi|255538486|ref|XP_002510308.1  Ricinus communis
77% to CYP82C31   gi|255538492|ref|XP_002510311.1  Ricinus communis
92% to CYP82   JcCA0055221.10






>CYP82C JcCA0283661.20 -  C-term

BABX01020566 contig has two P450s including JcCA0283661.10

Runs off the end at LKK

97% to JcCA0105361.10
74% to CYP82C29   gi|255538486|ref|XP_002510308.1  Ricinus communis





>CYP82C JcCA0105361.10 –


97% to CYP82C   JcCA0283661.20
65% to CYP82C   JcCB0388011.10
74% to CYP82C29   gi|255538486|ref|XP_002510308.1  Ricinus communis







>CYP82C JcCB0268961.10 -  


77% to CYP82C25 gi|255538464|ref|XP_002510297.1  Ricinus communis
78% to CYP82C26   gi|255538466|ref|XP_002510298.1  Ricinus communis
no ESTs to extend seq








>CYP82C JcCB0590781.10 – N-term

BABX01092363.1 runs off the contig at VMG

56% to CYP82C   JcCA0055221.10
58% to CYP82C   JcCB0802841.10
58% to CYP82C31   gi|255538492|ref|XP_002510311.1  Ricinus communis
no ESTs







>CYP82D58b JcCB0182421.10 +


61% to CYP82   JcCB0091131.10
65% to CYP82D1   Medicago sativa
77% to CYP82D58   gi|255538480|ref|XP_002510305.1  Ricinus communis (ortholog)
next best 53% to CYP82L7   gi|255580537|ref|XP_002531093.1  Ricinus communis 






>CYP82D JcCB0091131.10 - 

51% to CYP82D1   Medicago sativa
61% to CYP82D59   gi|255538482|ref|XP_002510306.1  Ricinus communis
55% to CYP82D58   gi|255538480|ref|XP_002510305.1  Ricinus communis












>CYP82D JcCA0263281.20 – pseudogene

missing the C-term


59% to CYP82   JcCB0091131.10
69% to CYP82D57P    gi|255538474|ref|XP_002510302.1  Ricinus communis
58% to CYP82D58   gi|255538480|ref|XP_002510305.1  Ricinus communis
runs of the end at LLFC
no ESTs to extend from either end
break at GPLS is not a typical place for an intron, but the gene stops there.









>CYP82D JcCB0582361.10 – exon 1 only


45% to CYP82A6   Pisum sativum
95% to JcCB0528981.10
55% to CYP82   JcCA0263281.20
64% to CYP82D58   gi|255538480|ref|XP_002510305.1  Ricinus communis








>CYP82D JcCB0528981.10 - 

BABX01087902.1 runs off the contig at both ends

66% to CYP82D58   gi|255538480|ref|XP_002510305.1  Ricinus communis
94% to JcCB0582361.10
EST GW614892.1 (one aa diff) = JcCB0471441.10








>CYP82D JcCB0501471.10 - 

BABX01086426.1b two seqs on contig

68% to CYP82D57P    gi|255538474|ref|XP_002510302.1  Ricinus communis

Runs of the end at IAGG

no ESTs to extend seq.






>CYP82D BABX01086426.1a two seqs on contig, pseudogene

55% to CYP82D58   gi|255538480|ref|XP_002510305.1  Ricinus communis
81% to CYP82 JcCB0091131.10






>CYP82J JcCB0219051.10 –

59% to CYP82J1   Populus trichocarpa
62% to CYP82J5   gi|255580539|ref|XP_002531094.1  Ricinus communis
next best 49% to CYP82L7 XP_002531093.1  Ricinus communis












>CYP82J JcCB0246241.10 - 

68% to CYP82J1   Populus trichocarpa
75% to CYP82J5   gi|255580539|ref|XP_002531094.1  Ricinus communis
48% to CYP82L7   gi|255580537|ref|XP_002531093.1  Ricinus communis


JcCB0392201.10 + join

BABX01079072.1b contig is the same as JcCB0246241.10












>JcCB0400141.10 +


96% to CYP82J   JcCB0246241.10
78% to CYP82J5   gi|255580539|ref|XP_002531094.1  Ricinus communis
no ESTs







>CYP82J JcCA0202251.10 +  pseudogene


98% to CYP82J JcCB0246241.10 (8 aa diffs and one frameshift)
74% to CYP82J5   gi|255580539|ref|XP_002531094.1  Ricinus communis










>CYP82J JcCD0129987.10 + pseudogene  N-term


88% to CYP82J JcCB0246241.10
72% to CYP82J5   gi|255580539|ref|XP_002531094.1  Ricinus communis






>CYP82J JcCB0776161.10 - pseudogene N-term

BABX01104944.1 runs off the contig at YVND

69% to CYP82J5 XP_002531094.1  Ricinus communis
96% to CYP82J   JcCA0202251.10






>CYP82J JcCC0425801.10 –

BABX01123550.1 runs off contig at WID

71% to CYP82J5 XP_002531094.1  Ricinus communis
94% to JcCA0202251.10
missing the N-term   







>CYP82J JcCA0254321.10 +

BABX01017296.1 runs off the ehnd at MRK

77% to CYP82J5   gi|255580539|ref|XP_002531094.1  Ricinus communis
no ESTs to extend seq










>CYP82J JcCA0250771.10 +  

BABX01016900.1 runs off the contig at DFI

67% to CYP82J   JcCB0219051.10
64% to CYP82J5   gi|255580539|ref|XP_002531094.1  Ricinus communis








>CYP82J JcCB0121261.10 +  pseudogene


83% to CYP82J JcCA0254321.10
75% to CYP82J5 XP_002531094.1  Ricinus communis







CYP82L 1 gene, 1 possible allele and 2 pseudogenes


>CYP82L7v1 JcCA0094171.10 – same as JcCB0076561.10 -

BABX01031541.1 exon 2

BABX01104188.1 whole gene

65% to CYP82L1   Populus trichocarpa
71% to CYP82L7 XP_002531093.1  Ricinus communis ortholog








>CYP87L7v2 JcCC0029504.10 +

BABX01123015.1 runs off at SEID

99% to CYP82L7   JcCB0076561.10 





>CYP82L JcCB0786181.10 + pseudogene


97% to CYP82L7   JcCB0076561.10


(large deletion)






>CYP82L BABX01079072.1b contig also contains JcCB0246241.10


this seq same as JcCB0392201.20
93% top CYP82L7   JcCB0076561.10




CYP83 family (5 sequences, only one is complete) probably 3 genes and one pseudogene


>CYP83F8 JcCA0154731.20 + 


68% to CYP83F1v1 Populus trichocarpa
78% to CYP83F8 XP_002510500.1  Ricinus communis (ortholog)
EST GT981866 












>CYP83F9a BABX01028424 N-term

78% to CYP83F9 XP_002510498.1  Ricinus communis (ortholog)
66% to CYP83F10 EEF50805.1  Ricinus communis




>CYP83F9b CYP83F JcCB0600081.10 -   C-term

BABX01093139.1 runs off the end at CPGI

77% to CYP83F9 gi|255538866|ref|XP_002510498.1  Ricinus communis






>CYP83F JcCA0142841.10 +  poor seq. quality at N-term


67% to CYP83F   JcCA0154731.20
69% to CYP83F8 XP_002510500.1  Ricinus communis
66% to CYP83F11P XP_002535120.1  Ricinus communis

No EST to extend to N-term












>CYP83F JcCA0040311.10 + pseudogene


59% to CYP83F   JcCA0154731.20
65% to CYP83F9 XP_002510498.1  Ricinus communis







CYP84 family (2 sequences, only one is complete)


>CYP84A50 JcCB0578261.10 +  exon 1

JcCB0838541.10 -   exon 2


67% to CYP84A30 Vitis

76% to CYP84A1   Arabidopsis thaliana
84% to CYP84A50 XP_002533804.1 ferulate-5-hydroxylase Ricinus communis (ortholog)
next best CYP84A51   gi|255543847|ref|XP_002512986.1 ferulate-5-hydroxylase Ricinus













>CYP84A51 JcCA0156071.10 – N-term

66% to JcCB0578261.10, 74% to CYP84A1 Arabidopsis thaliana

BABX01006343 runs off the contig at YRAA

BABX01103843 finishes exon 1,

81% to CYP84A51 XP_002512986.1 ferulate-5-hydroxylase Ricinus (ortholog)
next best 66% to CYP84A50 XP_002533804.1 ferulate-5-hydroxylase Ricinus

JcCB0273011.10 – C-term probable match to JcCA0156071.10 (joined)

74% to CYP84A30 Vitis
74% to CYP84A   JcCB0578261.10








(52 aa gap)




>CYP84A51 Ricinus communis XM_002512940 partial (exon 1)

89% to JcCA0156071.10











CYP89 family (13 sequences, 4 are complete or nearly complete)


>CYP89A JcCB0017561.30 +

54% to CYP89A2   Arabidopsis thaliana
64% to CYP89A98 XP_002524040.1  Ricinus communis












>CYP89A95 JcCB0156811.10 + 

59% to CYP89A2   Arabidopsis thaliana
76% to CYP89A95 XP_002520014.1  Ricinus communis (ortholog)












>CYP89A JcCB0883391.10 +


NO ESTs for the C-term

56% to CYP89A2   Arabidopsis thaliana
72% to CYP89A98   gi|255566104|ref|XP_002524040.1  Ricinus communis
72% to CYP89A100   gi|255566096|ref|XP_002524036.1  Ricinus communis

finished cannot extend










>CYP89A JcCB0036011.40 - 

BABX01076741.1 runs off contig end at FCLL

65% to CYP89A2   Arabidopsis thaliana
75% to CYP89A98 XP_002524040.1  Ricinus communis
75% to CYP89A100 XP_002524036.1  Ricinus communis
EST GW881640.1

JcCA0255121.10 +  N-term of JcCB0036011.40 join










>CYP89A JcCD0098169.10 + pseudogene mid to I-helix

BABX01145495.1 runs off at both ends

87% to CYP89A JcCB0883391.10
96% to JcCB0036011.40
75% to CYP89A100 gi|255566096|ref|XP_002524036.1  Ricinus communis







>CYP89A JcCB0281941.10 - 

65% to CYP89A98   gi|255566104|ref|XP_002524040.1  Ricinus communis
66% to CYP89A95   gi|255557971|ref|XP_002520014.1  Ricinus communis












>CYP89A JcCB0036011.30 + pseudogene

BABX01076741.1a two genes on this contig see CYP89A JcCB0036011.40

84% to CYP89A JcCB0281941.10
66% to CYP89A98   gi|255566104|ref|XP_002524040.1  Ricinus communis













The next two probably are from one CYP89K gene


>CYP89K BABX01019125.1 N-term

72% to CYP89K1 XP_002539766.1  Ricinus communis
64% to CYP89K2   gi|255588234|ref|XP_002534544.1  Ricinus communis
no ESTs







>CYP89K JcCB1001391.10 – C-term

BABX01059149.1 runs off at both ends

67% to CYP89A   JcCB0156811.10
68% to CYP89A2   Arabidopsis thaliana
78% to CYP89K1   gi|255616623|ref|XP_002539766.1  Ricinus communis
76% to CYP89K2   gi|255588234|ref|XP_002534544.1  Ricinus communis





CYP92 family (2 sequences, none are complete)


>CYP92 JcCB0395531.10 +


76% to CYP92A32 Vitis

74% to CYP92A62   gi|255549934|ref|XP_002516018.1 flavonoid 3-hydroxylase Ricinus
73% to CYP92A61P   gi|255604505|ref|XP_002538235.1 flavonoid 3-hydroxylase Ricinus

no ESTs to extend the seq on either end

JcPR04F0BCC.10 + C-term of a CYP92 seq (possible end for JcCB0395531.10)












>CYP92A59 JcCA0307901.10 +


89% to CYP92A59 XP_002521317.1 flavonoid 3-hydroxylase Ricinus (ortholog)
69% to CYP92A62 XP_002516018.1 flavonoid 3-hydroxylase Ricinus






(40 aa gap)








CYP93 family (15 sequences, only 2 are complete)


>CYP93A52 JcCB0311271.10 +  

BABX01073598.1 runs off contig on both ends, no ESTs

67% to CYP93A53   JcCA0297371.10
84% to CYP93A52   gi|255583272|ref|XP_002532400.1  Ricinus communis (ortholog)
next best 61% to CYP93A53   gi|255583270|ref|XP_002532399.1  Ricinus communis








>CYP93A53 JcCA0297371.10 + 

78% to CYP93A4 Populus trichocarpa
79% to CYP93A53 XP_002532399.1  Ricinus communis (ortholog)
65% to CYP93A52   gi|255583272|ref|XP_002532400.1  Ricinus communis











>CYP93A54a JcCB0009781.10 –

BABX01117516.1 runs off the end at EEER, no ESTs

80% to CYP93A54   gi|255544284|ref|XP_002513204.1  Ricinus communis (ortholog)
60% to CYP93A53short XP_002532399.1  Ricinus communis








>CYP93A54b JcCA0029811.10 - 


79% to CYP93A54 gi|255544284|ref|XP_002513204.1  Ricinus communis (ortholog)
66% to CYP93A4  Populus trichocarpa
63% to CYP93A   JcCA0297371.10
62% to CYP93A   JcCB0060201.10
no ESTs






>CYP93A JcCB0060201.10 +

82% to CYP93A53 JcCA0297371.10

74% TO CYP93A4 Populus trichocarpa
73% to CYP93A53 XP_002532399.1  Ricinus communis (ortholog)
60% to CYP93A54   gi|255544284|ref|XP_002513204.1  Ricinus communis












>CYP93A JcCB0742401.10 + 

1 aa dif to CYP93A JcCB0060201.10 allele






>CYP93A JcCB0172961.10 +  pseudogene

86% to CYP93A   JcCB0060201.10
63% to CYP93A53 XP_002532399.1  Ricinus communis











>CYP93A JcCA0302521.10 -  pseudogene


78% to CYP93A53   JcCA0297371.10
70% to CYP93A53   gi|255583270|ref|XP_002532399.1  Ricinus communis














>CYP93A JcCA0285841.10 - pseudogene


67% to CYP93A53   gi|255583270|ref|XP_002532399.1  Ricinus communis
95% to JcCA0302521.10







>CYP93A JcCA0285841.20 -  pseudogene


92% to CYP93A   JcCB0060201.10
68% to CYP93A53 XP_002532399.1  Ricinus communis








>CYP93A JcCA0009062.10 +  pseudogene

BABX01031134.1b same contig as a CYP712A BABX01031134.1a

68% to CYP93A4 Populus trichocarpa
66% to CYP93A53   gi|255583270|ref|XP_002532399.1  Ricinus communis
74% to CYP93A JcCA0297371.10
87% to JcCA0302521.10










>CYP93A JcCC0159991.10 - pseudogene


67% to CYP93A53  gi|255583270|ref|XP_002532399.1  Ricinus communis





>CYP93A JcCB0557381.10 - pseudogene

BABX01089972.1 runs off the end at VGR

62% to CYP93A53 gi|255583270|ref|XP_002532399.1  Ricinus communis






>CYP93B JcCA0226911.20 + 

BABX01014236.1 runs off the end at HAT, nothing upstream for 2 kb


56% to CYP93B1v2   Glycyrrhiza echinata
67% to JcCA0071191.10
63% to CYP93B22 XP_002531103.1  Ricinus communis








>CYP93B22 JcCA0071191.10 -  C-term


77% to CYP93B22

67% to CYP93B   JcCA0226911.20
58% to CYP93A   JcCA0297371.10
53% to CYP93B1v2  Glycyrrhiza echinata
77% to CYP93B22   gi|255580558|ref|XP_002531103.1  Ricinus communis (ortholog)
next best 60% to CYP93A52   gi|255583272|ref|XP_002532400.1  Ricinus communis
no ESTs






CYP98 family (only one sequence)



JcCA0023581.10 +


89% to CYP98A43 Vitis, 79% to CYP98A3 Arabidopsis


Cannot extend to end, no EST for the C-term

JcCB0748211.10 –

88% to CYP98A43   AM435080.1 Vitis vinifera
93% to CYP98A63   gi|255570490|ref|XP_002526203.1  Ricinus communis (ortholog)
next best 79% to CYP98A64   gi|255570488|ref|XP_002526202.1  Ricinus communis
100% to CYP98A 













CYP701 family (only one sequence)


>CYP701A36 JcCA0155031.10 + 

66% to CYP701A3 Arabidopsis thaliana
79% to CYP701A36 XP_002510288.1 ent-kaurene oxidase Ricinus (ortholog)










CYP703 family (only one sequence)


>CYP703A16 JcCB0185791.10 - 

73% to CYP703A2   Arabidopsis thaliana
86% to CYP703A16 XP_002523334.1 flavonoid 3-hydroxylase Ricinus (ortholog)

JcCB0582051.20 - 











CYP706 family (7 sequences, only 2 are complete)

No sequence matches CYP706J9 in Ricinus


>CYP706C31 JcCA0302851.10 + 

56% to CYP706C9   Zea mays
81% to CYP706C31 XP_002509592.1  Ricinus communis (ortholog)











>CYP706B JcCA0302851.20 +  pseudogene

BABX01022714 two genes also includes CYP706C31 JcCA0302851.10

56% to CYP706G1   Vitis vinifera
74% to CYP706   JcCB0049601.10
83% to CYP706B5   gi|255537053|ref|XP_002509593.1  Ricinus communis
77% to CYP706B6   gi|255537069|ref|XP_002509601.1  Ricinus communis
runs off the end at AKVI




>CYP706B JcCB0049601.10 - 


55% TO CYP706G1   Vitis vinifera
67% to CYP706B5 gi|255537053|ref|XP_002509593.1  Ricinus communis
57% to CYP706B6 gi|255537069|ref|XP_002509601.1  Ricinus communis













>CYP706B N-term

BABX01086088 second gene runs off end at TESE

65% to CYP706 JcCB0049601.10
65% to CYP706B5   gi|255537053|ref|XP_002509593.1  Ricinus communis
48% to CYP706B6   gi|255537069|ref|XP_002509601.1  Ricinus communis             
no ESTs to extend seq.







>CYP706B JcCB0634951.10 – possible end for BABX01086088 second gene

79% to CYP706B5   gi|255537053|ref|XP_002509593.1  Ricinus communis






>CYP706D JcCB0731221.10 + 

BABX01101324 runs off the end at RQQ

63% to CYP706D1   Populus trichocarpa
45% to CYP706B5   gi|255537053|ref|XP_002509593.1  Ricinus communis
45% to CYP706C31   gi|255537051|ref|XP_002509592.1  Ricinus communis
no ESTs to extend seq.








>CYP706D JcCB0949521.10 + C-term


64% to CYP706 JcCB0049601.10
61% to CYP706B6   gi|255537069|ref|XP_002509601.1  Ricinus communis
runs off the contig at TVVV
73% to CYP706D1 Populus trichocarpa






CYP712 family (8 sequences, only 3 are complete)


>CYP712A14 BABX01023081.1

This contig includes the gene CYP712J1 JcCA0306151.20
85% to CYP712A14   gi|255583276|ref|XP_002532402.1  Ricinus communis (ortholog)




>CYP712A pseudogene? JcCC0397331.10 – N-term

BABX01123443.1 runs off the contig at KLS

70% to CYP712A1   Arabidopsis thaliana
79% to CYP712A14   gi|255583276|ref|XP_002532402.1  Ricinus communis 
40% to CYP712C   JcCA0150131.30
no ESTs
95% to BABX01023081.1








>CYP712A JcCB0736121.10 + C-term

BABX01101718.1 runs off the end

63% to CYP712A1   Arabidopsis thaliana
41% to CYP712   JcCA0306151.20  
78% to CYP712A14   gi|255583276|ref|XP_002532402.1  Ricinus communis
87% to CYP712A14 BABX01023081.1



>CYP712 BABX01031134.1a

same contig as CYP93A JcCA0009062.10

93% to CYP712A14 BABX01023081.1







>CYP712C3 JcCA0150131.30 +

60% to CYP712C1 Populus trichocarpa
74% to CYP712C3   gi|255584959|ref|XP_002533191.1  Ricinus communis (ortholog)











>CYP712D JcCB0103381.10 + N-term


50% to CYP712D1 Vitis vinifera
53% to CYP705B4P cottonwood 
43% to CYP712A14   gi|255583276|ref|XP_002532402.1  Ricinus communis
note: Ricinus genome does not have a CYP712D gene in current assembly

no EST to extend seq








>CYP712D JcCD0051854.10 + C-term


56% to CYP712D1 Vitis vinifera

no EST to extend seq

48% to CYP712A14   gi|255583276|ref|XP_002532402.1  Ricinus communis
56% to CYP712D1 Vitis vinifera
55% to CYP705B5 cottonwood







>CYP712D BABX01071351 pseudogene

66% to JcCD0051854.10, 
58% to CYP712D1 Vitis vinifera
48% to CYP712A14   gi|255583276|ref|XP_002532402.1  Ricinus communis
57% to CYP705B4P cottonwood




2980 VVKETLRLYAQ & 2948





>CYP712J1 JcCA0306151.20 - 

49% to CYP712B1   Arabidopsis thaliana
69% to CYP712J1   gi|255583274|ref|XP_002532401.1  Ricinus communis (ortholog)












CYP736 family (2 sequences, only one is complete)


>CYP736A JcCA0018341.10 +

BABX01009362 onr frameshift at &

55% to CYP736A17 Vitis, 55% to CYP736 XM_002531999 Ricinus communis

61% to CYP736A1 Pyrus communis
64% to XM_002511922 Ricinus communis












>CYP736A XM_002511922 Ricinus communis, EEF50637.1
59% to CYP736A1 Pyrus communis (pear)



The next four sequences may be from the same gene


>CYP736 N-term

BABX01079837 runs off the end

73% to CYP736 XM_002531999 Ricinus communis



(35 aa gap)

>CYP736 JcCD0110799.10 – exon 1 fragment


46% to CYP736A17 Vitis
43% to CYP71AS JcCB0793041.10
86% to XM_002531999 Ricinus communis



(27 aa gap)

>CYP736 JcCB0902881.10 – exon fragment

BABX01112214 runs off the end

44% to CYP736A1 Pyrus communis
47% to JcCD0092500.10 
41% to CYP71   JcCA0204311.10
89% to CYP736   XM_002531999 Ricinus communis


>JcCB0335831.10 +  C-term


83% to CYP736  XM_002531999 Ricinus communis






>CYP736A XM_002531999 Ricinus communis, XP_002532045.1

54% to CYP736A1 Pyrus communis (pear)
53% to CYP736A XM_002511922 Ricinus communis



CYP72 clan


CYP72 family (4 sequences, 2 are complete)


>CYP72A JcCA0144411.10 + 

50% to CYP72A5 Zea mays


72% to CYP72A261 XP_002517860.1  Ricinus communis (possible ortholog)
69% to CYP72A260 XP_002517862.1  Ricinus communis











>CYP72A JcCB0881951.10 +

BABX01110460.1 runs off the end at VLSM

57% to CYP72A7   Arabidopsis thaliana
96% to CYP72   JcCA0144411.10 (3 aa diffs) possible allele or closely related gene
82% to CYP72A261 XP_002517860.1  Ricinus communis (possible ortholog)
75% to CYP72A260 XP_002517862.1  Ricinus communis
no ESTs





>CYP72A JcCB0532981.10 + pseudogene N-term


84% to CYP72   JcCA0144411.10
69% to CYP72A261   gi|255553639|ref|XP_002517860.1  Ricinus communis








>CYP72D9 JcCA0303821.10 +


67% to CYP72D1   Populus trichocarpa
75% to CYP72D9   gi|255550159|ref|XP_002516130.1  Ricinus communis (ortholog)
next best is 54% to CYP72D10   gi|255550487|ref|XP_002516294.1  Ricinus communis
N-term frameshifted, complete











CYP709 family (7 sequences, only one is complete) probably 4 genes


>CYP709F JcCA0131871.10 + 

57% to CYP709F1 Populus trichocarpa
63% to CYP709F3   gi|255548211|ref|XP_002515162.1  Ricinus communis (ORTHOLOG)
58% to CYP709B2 Arab.















3 different C-terminal seqs


>CYP709F JcCB0250351.20 - 


60% to CYP709F1 Populus trichocarpa
74% to CYP709F3   gi|255548211|ref|XP_002515162.1  Ricinus communis
runs off the end at AAED








>CYP709F JcCB0235711.10 - 


59% to CYP709F1   Populus trichocarpa
64% TO CYP709F3   gi|255548211|ref|XP_002515162.1  Ricinus communis
81% to JcCB0551901.10
70% to CYP709F   JcCA0131871.10







>CYP709F JcCB0551901.10 + 


59% to CYP709F1   Populus trichocarpa
65% to CYP709F3   gi|255548211|ref|XP_002515162.1  Ricinus communis
runs off at TYD, NO ESTs








3 different N-terminal seqs


>JcCB0445171.10 – N-term


50% to CYP709B1 Arabidopsis thaliana
80% to JcCB0827551.10
55% to CYP709   JcCA0131871.10 
49% to CYP709F3   gi|255548211|ref|XP_002515162.1  Ricinus communis
runs off end at EFIK, NO ESTs







>JcCB0397941.10 - N-term


41% to CYP709B1   Arabidopsis thaliana
60% to CYP709   JcCA0131871.10
66% to CYP709F3 XP_002515162.1  Ricinus communis
no ESTs




>JcCB0827551.10 - N-term

BABX01107597.1 runs off the end at FEK

56% to CYP709F3   gi|255548211|ref|XP_002515162.1  Ricinus communis

ESTs GW617334.1, GW878208.1








CYP714 family (9 sequences, only 2 are complete)


>CYP714A20 GW616570, GW619672
54% TO CYP714A1 Arabidopsis thaliana
83% to CYP714A20   gi|255550874|ref|XP_002516485.1  Ricinus communis (ortholog)
67% to CYP714A21   gi|255548610|ref|XP_002515361.1  Ricinus communis

JcCB0557511.10 – exon 2











>CYP714A20 JcCB0609731.10 -   

54% to CYP714A1   Arabidopsis thaliana
97% to CYP714 GW616570, GW619672 only differs at end 5 diffs in 17 aa 
(seq error?)
83% to CYP714A20   gi|255550874|ref|XP_002516485.1  Ricinus communis







>CYP714A21 JcCA0079341.30 –


59% to CYP714A1 Arabidopsis thaliana

77% to CYP714A21   gi|255548610|ref|XP_002515361.1  Ricinus communis (ortholog)
64% to CYP714A20   gi|255550874|ref|XP_002516485.1  Ricinus communis















>JcCA0108741.10 – exon 1


58% to CYP714 JcCA0079341.30
63% to CYP714A20   gi|255550874|ref|XP_002516485.1  Ricinus communis




>BABX01140793.1 JcCD0059111

83% to Ricinus communis XM_002516439

74% to CYP714A   JcCA0079341.30





>CYP714A20 Ricinus communis XM_002516439, XP_002516485.1

83% to GW616570, GW619672












>CYP714E16 JcCB0338361.10 +  exon 1

58% to CYP714E4 Populus, probable N-term to JcCA0300951.10 (ortholog)

76% to CYP714E16 XP_002526382.1  Ricinus communis

JcCA0300951.10 –

BABX01022503 C-term part

73% to CYP714E4 Populus trichocarpa 
finished, cannot find exon 2



(missing exon 2)









 JcCB0058861.10 pseudogene upstream of JcCB0058861.10 – N-term seq

65% to CYP714M3P   gi|255582040|ref|XP_002531817.1  Ricinus communis






>CYP714M JcCA0282821.10 +


66% to CYP714M1   gi|255582038|ref|XP_002531816.1b  Ricinus communis
48% to JcCA0300951.10
46% to CYP714A JcCA0079341.30
54% to CYP714H1 soybean
73% to Ricinus communis XM_002531771


CYP714 JcCB0058861.10 – probable N-term for this seq.















>CYP714M3P Ricinus communis XM_002531771 partial seq













>CYP714M JcCA0144051.10 -  pseudogene EXXR motif missing R


74% to JcCA0282821.10, 70% to Ricinus communis XM_002531771
69% to CYP714M3P   gi|255582040|ref|XP_002531817.1  Ricinus communis












CYP715 family (3 sequences, none are complete)

There are probably 2 genes. The top two could join

The last two look different from both of the top two


>CYP715 BABX01020427.1 N-term

JcCA0282411.10 + /pseudo

77% to CYP715A19   gi|255545268|ref|XP_002513695.1  Ricinus communis

no ESTs to extend the seq.







>CYP715 JcCA0073861.10 +

BABX01029242.1 runs off the end

76% to CYP715A6 Vitis

85% to CYP715A19   gi|255545268|ref|XP_002513695.1  Ricinus communis

no ESTs to extend the seq.

Probable end for the BABX01020427 sequence








>CYP715 JcCA0213041.10 +


85% to JcCA0073861.10

90% to BABX01020427.1 N-term (4 aa diffs)
82% to CYP715A19 XP_002513695.1 Ricinus communis







BABX01043978.1 runs off the end

Probable end for the BABX01012691.1 sequence





CYP721 family (4 sequences, only 1 is complete) probably 3 genes


>CYP721A30 JcCB0108161.20 –


53% to CYP721A1   Arabidopsis thaliana
77% to CYP721A30   gi|255538580|ref|XP_002510355.1  Ricinus communis (ortholog)












>CYP721A BABX01060279.1b

57% to CYP721A30   gi|255538580|ref|XP_002510355.1  Ricinus communis
63% to CYP721A2v1 cottonwood
58% to CYP721A30   JcCB0108161.20
66% to CYP721A JcCD0092113.10














>JcCB0108161.10 -  exon 1

BABX01060279.1a three genes on this contig including CYP721A30

44% to CYP721A1   Arabidopsis thaliana
53% to CYP721   JcCB0108161.20
48% to CYP721A30   gi|255538580|ref|XP_002510355.1  Ricinus communis
might join with CYP721A JcCD0092113.10
no ESTs




>CYP721A JcCD0092113.10 + 


55% to CYP721A1   Arabidopsis thaliana

JHS13D13f.10 - 


63% to CYP721   JcCB0108161.20
63% to CYP721A30 XP_002510355.1  Ricinus communis
70% to CYP721A2v1 cottonwood
overlap is identical to CYP721A JcCD0092113.10 join












CYP734 family (probably only one gene)

>CYP734A26 BABX01068676 N-term

JcCB0238321.10 +

83% to CYP734A13 Vitis
89% to CYP734A26 XP_002524439.1  Ricinus communis (ortholog)






(82 aa gap)

CYP734 JcCB0513991.10 –

84% to 734A13 Vitis 





CYP735 family (probably only one gene)










(9 aa gap)

JcCB0951161.10 +  




(20 aa gap)


(35 aa gap)




(30 aa gap)





>CYP735A22 JcPR09FLNIW.10 + 


96% TO CYP735A22 XP_002516723.1  Ricinus communis (ORTHOLOG)




CYP749 family (14 sequences, only 4 are complete) probably 9 genes and 2 pseudogenes


>CYP749A JcCB0359191.10 - 

58% to CYP749A1v1   Populus trichocarpa
69% to CYP749A27   gi|223549219|gb|EEF50708.1  Ricinus communis
66% to CYP749A26   gi|223549220|gb|EEF50709.1  Ricinus communis












>CYP749A JcCA0020391.20 + missing N-term


56% to CYP749A1v1   Populus trichocarpus
69% to CYP749A25 EEF50711.1  Ricinus communis (ortholog)
next best 59% to CYP749A26 EEF50709.1  Ricinus communis
missing the N-term, not present in 9700 bp upstream
no ESTs to extend seq.









>CYP749A JcCB0047971.20 +

BABX01085129.1 runs off the end at HLI
59% to CYP749A1v1   Populus trichocarpa
75% to JcCB0285341.10
70% to CYP749A25   gi|223549222|gb|EEF50711.1  Ricinus communis (ortholog)
next best 59% to CYP749A29   gi|223549217|gb|EEF50706.1  Ricinus communis
no ESTs









>CYP749A JcCB0153911.10 -  C-term, last exon for JcCB0047971.20

BABX01063123.1 runs off the end at NETLR
63% to CYP749A1v1   Populus trichocarpa
84% to CYP749A25   JcCA0020391.20
78% to CYP749A25 EEF50711.1  Ricinus communis (ortholog)
next best 64% to CYP749A29 EEF50706.1  Ricinus communis
no ESTs






>CYP749A JcCA0306671.10 +


57% to CYP749A1v1   Populus trichocarpa 
65% to CYP749A26   gi|223549220|gb|EEF50709.1  Ricinus communis
64% to CYP749A27   gi|223549219|gb|EEF50708.1  Ricinus communis













>JcCA0080541.20 +  pseudogene

55% to CYP749A1v1 Populus trichocarpa
64% to CYP749A26   gi|223549220|gb|EEF50709.1  Ricinus communis
89% to CYP749 JcCA0306671.10














>CYP749A28a JcCB0184751.10 -


73% to CYP749A28 EEF50707.1  Ricinus communis (ortholog)
next best is 66% to CYP749A29 EEF50706.1  Ricinus communis

no ESTs

CYP749A28b JcCB0098201.20 -  join with JcCB0184751.10

BABX01117872.1 last exon

65% to CYP749A1v1   Populus trichocarpa
66% to CYP749A29   JcCB0158131.10
80% to CYP749A28   gi|223549218|gb|EEF50707.1  Ricinus communis ortholog
next best 66% to CYP749A27   gi|223549219|gb|EEF50708.1  Ricinus communis












>CYP749A29 JcCB0158131.10 + 

BABX01063409.1 runs off the end at LKM

76% to CYP749A29   gi|223549217|gb|EEF50706.1  Ricinus communis (ortholog)
next best 64% to CYP749A25 gi|223549222|gb|EEF50711.1  Ricinus communis

no ESTs









>CYP749A JcCB0285341.10 +


64% to CYP749A25 gi|223549222|gb|EEF50711.1  Ricinus communis
75% to JcCB0047971.20
no ESTs









>CYP749A JcCB0547401.10 -  pseudogene

JcCA0103271.20 +  from same pseudogene



64% to CYP749A26 gi|223549220|gb|EEF50709.1  Ricinus communis

NO FIRST EXON, 2 frameshifts





PGIR (2)








>CYP749A JcCB0587401.10 –

BABX01092091.1 runs off the end at PCS

59% to CYP749A26   gi|223549220|gb|EEF50709.1  Ricinus communis
59% to CYP749A27   gi|223549219|gb|EEF50708.1  Ricinus communis









>CYP749A JcCA0298201.10 –

BABX01022198.1 runs off the end at KIVS

54% to CYP749A1v1  Populus trichocarpa
73% to JcCB0587401.10
59% to CYP749A26   gi|223549220|gb|EEF50709.1  Ricinus communis
no ESTs 










>CYP749A JcCB0781971.10 +  last exon


62% to CYP749A1v1  Populus trichocarpa
83% to CYP749 JcCA0306671.10
86% to JcCA0080541.20
74% to CYP749A26   gi|223549220|gb|EEF50709.1  Ricinus communis
73% to CYP749A27   gi|223549219|gb|EEF50708.1  Ricinus communis





>CYP749A JcCB0217801.20 – C-term


55% to CYP72D1   Populus trichocarpa
66% to CYP749A26   gi|223549220|gb|EEF50709.1  Ricinus communis
63% to CYP749A27   gi|223549219|gb|EEF50708.1  Ricinus communis
70% to CYP749   JcCA0306671.10



CYP74 clan


CYP74 family (3 sequences)


>CYP74A27 GT979878, GT978442.1, GT977155, GW617132.1, GT229029.1

Contig1362Allene oxide synthase

= fifth most highly expressed transcript in germinating endosperm

90ESTs found for Jatropha[orgn] AND "allene oxide synthase"

JcCB0380331.10 - allene oxide synthase CYP74

65% to CYP74A1 Arab.

89% to DQ340980.1 Hevea brasiliensis latex allene oxide synthase (AOS)

85% to CYP74A27   gi|255538510|ref|XP_002510320.1  Ricinus communis (ortholog)

71% to X78166.2 Parthenium argentatum mRNA for rubber particle protein

3 aa diffs to JcCB0380331.10 in overlapping region














JcCB0253921.10 - short

63% to CYP74B2 Arabidopsis, N-term

GT981413.1 = JGCCJG2055C12.b

GW878141.1, FM896436.1

CYP74B BABX01099317.1

JcCB0697851.10 +  

82% to CYP74B ricinus communis (ortholog)

probably C-term for JcCB0253921.10 gene


JcCB0262151.10 - 

52% to CYP74B2   Arabidopsis thaliana
100% to CYP74B











JcCA0087981.10 + allene oxide synthase CYP74

75% to CYP74C8 Populus trichocarpa

44% to CYP74A1 Arabidopsis aa 92-377

BABX01030838.1 (WGS)

no ESTs

JcCB0164291.10 + allene oxide synthase CYP74

54% to CYP74A1 Arabidopsis aa 414-516, no ESTs

BABX01063767.1 (WGS)

Short finished

Note: current Ricinus genome assembly does not have a CYP74C










CYP85 clan


CYP85 family (2 sequences plus one pseudogene)


>CYP85A1 JcCA0146101.10 –


85% to CYP85A1    Vitis vinifera
91% to CYP85A1   gi|223534738|gb|EEF36429.1  Ricinus communis
78% to CYP85A1    Solanum lycopersicum










>BABX01104851.1 possible N-term for JcCB0061491.10

GW881810.1 Seed specific Normalized cDNA library
69% to CYP85A1 gi|223534738|gb|EEF36429.1  Ricinus communis



(106 aa gap)

CYP85A JcCB0061491.10 +

BABX01094265.1 frameshift at &

66% to JcCA0146101.10

73% to Vitis vinifera XM_002273577.1

no ESTs









>BABX01064456.1 pseudogene N-term for CYP85A

65% to CYP85A1   gi|223534738|gb|EEF36429.1  Ricinus communis





CYP87 family (7 sequences, 4 are mostly complete)


>CYP87A29 JcCB0025421.10 + 


75% to CYP87A9 Medicago truncatula
82% to CYP87A7 Populus trichocarpa
cannot detect the N-term
84% to CYP87A29   gi|255537303|ref|XP_002509718.1  Ricinus communis (ortholog)











>CYP87B15 JcCB0082131.10 - 

49% to CYP87D1   Populus trichocarpa
84% to CYP87B15   gi|255570414|ref|XP_002526166.1  Ricinus communis (ortholog)











>CYP87D JcCB0397291.10 –

64% to CYP87D1   Populus trichocarpa
57% to CYP87D14   gi|255573862|ref|XP_002527850.1  Ricinus communis
65% to CYP87D10 cottonwood


JcCD0104599.10 - 

BABX01125511 SAME AS CYP87D JcCB0397291.10 C-TERM











>CYP87D JcCA0251181.10 - 


56% TO CYP87D   JcCB0397291.10
52% to CYP87D1 Populus trichocarpa
63% to CYP87D14   gi|255573862|ref|XP_002527850.1  Ricinus communis
ESTc GW613938.1, GW613366.1










>CYP87D JcCA0041331.10 + pseudogene

61% to CYP87D11 Populus trichocarpa
85% to JcCA0251181.10
55% TO CYP87D   JcCB0397291.10
58% TO CYP87D14 XP_002527850.1  Ricinus communis
no downstream exons in 4000 bp








>CYP87D JcCB0748311.10 +


49% to CYP87D1   Populus trichocarpa
58% to JcCA0251181.10
61% to CYP87D14 XP_002527850.1  Ricinus communis








>CYP87D JcCB0419061.10 -  pseudogene mid region


42% to CYP87D1   Populus trichocarpa
46% to CYP87D14   gi|255573862|ref|XP_002527850.1  Ricinus communis
69% to JcCA0251181.10







CYP88 family (3 sequences)


>CYP88A41 JcCA0285021.10 - 

71% to CYP88A11 Glycine max

78% to CYP88A41 XP_002526524.1 Ent-kaurenoic acid oxidase Ricinus (ortholog)

GW617093.1 C-term


JcCD0180051.10 -


100% to CYP88A JcCA0285021.10 C-term EXOT











>CYP88A JcCB0742491.10 +


70% to CYP88A11 Glycine max

91% to JcCA0285021.10

75% to CYP88A41 XP_002526524.1 Ent-kaurenoic acid oxidase Ricinus            communis 






(61 aa gap)

JK317501.1 may be the end of JcCB0742491.10










>CYP88A JcCB0538921.10 -  pseudogene N-term


72% to CYP88A41 XP_002526524.1 Ent-kaurenoic acid oxidase Ricinus communis
72% to CYP88A   JcCB0742491.10




>CYP88A JcCD0209899.10 - pseudogene


77% to CYP88A JcCA0285021.10
82% to CYP88A41 XP_002526524.1 Ent-kaurenoic acid oxidase Ricinus communis


K (0)




>JcCB0778131.10 +   

70% to CYP88A41 XP_002526524.1 Ent-kaurenoic acid oxidase Ricinus communis
86% to CYP88A   JcCA0285021.10




CYP90 family (4 sequences plus 2 pseudogenes)


>CYP90A35  (one sequence)

JcCB0094371.10 – exon 1

BABX01128559.1 exon 2

69% to CYP90A16 Vitis vinifera


CYP90A JcCB0171311.10 - 

76% to CYP90A16 Vitis vinifera

85% to CYP90A35 XP_002540303.1  Ricinus communis (ortholog)

BABX01083659.1 heme signature exon to end = JcCB0461461.10 -













>CYP90B21 (one sequence)

JcCB0297661.10 +




86% to CYP90B12 Vitis

83% to CYP90B21 EEF40874.1  Ricinus communis (ortholog)

BABX01084131.1 frameshifted exon GYDI..

JcCA0274071.10 -  C-term


Missing N-term




PT &













>CYP90C (one sequence)


>CYP90C14 JcCD0065514.10 – N-term

50% to CYP90C5 Vitis, 39% to CYP90D8 Vitis

63% to CYP90C14 EEF40775.1  Ricinus communis (otholog)

GW880012.1 (includes stop codon)

GW881060.1 (includes same stop codon)

JcCD0120124.10 -  

60% to CYP90C5 Vitis


Missing the C-term








>CYP90D (one sequence plus one pseudogene)


>CYP90D21 JcCA0302541.20 + N-term

JcCB0457811.10 +


BABX01011113.1 last exon

77% to CYP90D8  Vitis vinifera
BABX01022680.1 N-term
Lower case is from the pseudogene BABX01000683.1
89% to CYP90D21 Ricinus communis XM_002527368.1 (ortholog)





iafqvlvkalisldpgqemeslkkqfqefisglmslpinvpgsqlyrslqa (?)



ylsdcpaalqqlt (0)

denm &

klrslkaqfgeplnwtdylslpftqk (0)


WRWQ (0)





>CYP90D BABX01000683.1 nearly identical seq but appears to be a pseudogene

JcCA0105981.10 +  /pseudo

79% to CYP90D8 Vitis

91% to Ricinus communis XM_002527368.1

missing N-term 178 aa and last exon, no ESTs












>CYP90D Ricinus communis XM_002527368.1, XP_002527414.1











CYP707 family (5 sequences)


>CYP707A78 JcCA0143101.10 –


65% to CYP707A25   Nicotiana tabacum
82% to CYP707A78 XP_002518764.1  Ricinus communis (ortholog)
next best 69% to CYP707A82 XP_002510214.1  Ricinus communis








CYP707 JcCA0283241.10 +  possible end for JcCA0143101.10

BABX01020520.1 C-term exon






>CYP707A79 JcCB0029391.10 + 

58% to CYP707A25   Nicotiana tabacum
87% to CYP707A79 XP_002518804.1  Ricinus communis (ortholog)
next best 58% to CYP707A82 XP_002510214.1  Ricinus communis










>CYP707A80 JcCA0152931.10 +



58% to CYP707A25   Nicotiana tabacum
62% to CYP707A79   gi|255555535|ref|XP_002518804.1  Ricinus communis
57% to CYP707A81   gi|255565166|ref|XP_002523575.1  Ricinus communis
91% to CYP707A80 Ricinus (partial seq)

CYP707 BABX01031285.1 C-term exon

possible end of JcCA0152931.10

78% to CYP707A2 Arab.

missing C-term exon












JcCB0602461.10 + 

BABX01093346.1 possible N-term for JcCB0546421.10

85% to CYP707A81 XP_002523575.1  Ricinus communis (ortholog)
next best 68% to CYP707A82 XP_002510214.1  Ricinus communis






CYP707 JcCB0546421.10 +  

65% to CYP707A25 Nicotiana tabacum





JcCA0152161.10 +   possible end for JcCB0546421.10

CYP707 BABX01005889.1 last exon




>CYP707A82 JcCA0153431.20 - 

BABX01006033.1 C-term exon

72% to CYP707A25   Nicotiana tabacum
85% to CYP707A82 XP_002510214.1  Ricinus communis (ortholog)
next best 72% to CYP707A78 XP_002518764.1  Ricinus communis









>CYP707A82 Ricinus communis XM_002510168, XP_002510214.1












CYP716 family (10 sequences, only 2 are complete)


>CYP716A54v1 JcCA0316961.10 - 

BABX01024285.1 8 a diffs to JcCA0225861.10

71% to CYP716A15 Vitis vinifera

98% to JcCA0225861.10

85% to CYP716A54 XP_002528002.1  Ricinus communis (ortholog)











>CYP716A54v2 JcCA0225861.10 –

BABX01014119.1 100%

70% to Ricinus communis XM_002522891.1

85% to CYP716A54 XP_002528002.1  Ricinus communis 
98% to JcCA0316961.10 allele?

N-term may be too long

missing C-term











>CYP716A JcPR01CTLCA.10 + pseudogene N-term


68% to CYP716A54 XP_002528002.1  Ricinus communis
77% to CYP716A54v1 JcCA0316961.10