Linepithema humile (Argentine ant)

 genome

 

From Reed Johnson June 3 2010

 

179 entries

 

CYP2 clan (9 sequences)

 

>CYP15A1 Linepithema humile (Argentine ant) Lh15seqA1 505aa 8 exons .

70% to CYP15A1 honeybee

MLYIAISLLSIFGCLYCIYDCLKPKNYPPG(1)

PLWLPLLGCFLTFRWLRSKYGYIYLAFQELSRTYGPILGLKLGNQKVVVISTYDL

VKKALLQDEFNSRPDGFFFRIRSFGKRKG(1)

VLFTEGTTWSQCRKFTMRHLRMYGIGQSIMEKQLTIEARNLVNYLQRMSERGAVL

MHTAFDVAVLNSLWFMIAGHRFDYENEKLNQALKVVHDAFR(2)

LMDILGGIMSQIPLIRFVIPELSGYNELMRILEKLWSFLDEEIKVHEKKPLDGQP

HDLIDAFLLEISNKKGDKDTIFDR(1)

ENLLVLCLDLFLAGSKTTSDTLATTFLFLSLNLEWLKILQEELDSVVGRSRAPTE

NDLPFLPMTEAFLAE(0)

VQRYLILAPLGVPHRTAKDVSLNSYRIPK(0)

SYFFLQDTIVLFNFHSVHNDETYWDHPNEFRPERFLNEHGQFRRNNFALPFGLG(1)

KRRCLGEQLARSTLFYFFTYIVHYFDIEISPDHDKPDLNGYDGFTLSPKPYYLKFTKRADLRD*

 

>CYP18A1 Linepithema humile (Argentine ant) Lh18seqA1 541aa 5 exons

Tail-to-tail with Lh306seqA1

66% to CYP18A1 honeybee

MSVLCYAALVIWQWMKNILVYSKENTKVTECCALFTVFVAAIIVARYWIKNYNLP

PGPWGIPYFGYLFFMKGTPPHLMFESFAKKYGRIFSLRLGPQLVVVINDYNVIKE

TFRREEFTGRPQNEFMKILGGYG(1)

IINAEGAMWKEQRRFLHHKLRKFGMTFSSGSNQKSLQSKIS(0)

LEVNILNKRLVERRGAPTNISPFLATSISNVICSLMMNVRFDQGETRFKRFMGLI

EEGFKLFGSVDIINYIPITRFLPWMQKNQIKISENHAEMAKFFQETVNQHRETFE

ADSVRDIVDTYLLEIQQAKNEGREDELFQGKNHD(1)

RHIRQILGDLFSAGMETVKTTLEWAVLLMLHHPDKAKAVQEELDQVVGRSRMPSF

EDLPSLPITDATIREVLRICSIVPLGTPHATTR(2)

DVTLKGYKIPAGTTIVPLLYAVHMDPKLWNDPEAFRPSRFLTSEGKIHTPEYFM

PFGVGRRMCLGDVLARMELFTFFSSLMHTFDLKLSENSSLPSLKGNAGVTLSPD

PFEICLLQRNLECSEVPSNPLRNIGSH*

 

>CYP303A1 Linepithema humile (Argentine ant) Lh303seqA2 484aa 10 exons .

62% to CYP303A1 honeybee

MVLLVLTLLLLLYTSCRKPKGYPPG(1)

PKWWPILGCALEVARLRQETKYLCKTCSALGKKYGPVVGLKIGTDRIVVLNDLEN

IRAMLNNEDCDGRPTGPLYEARTWGARRG(1)

LIVVDGQLWVEQRRFVLRHLKEFGFGRNSMATIIENEALML(0)

KLSQSTGVIVSMNDTFGVTVLNTLWQMMAGKR(2)

FDTDDKQLKYLQRILTKLLEEIDMIGAPFSHFPLLRFIAPEMSGYKLFVETHQELWTFLK(0)

EELYNHKNTFIPSAPRDLMDVYLTVLDSKDYSKTFSE(1)

SQLLGICVDLFIAGSETTSKALGFGFLYLLLFPHVQRKAQEELDRVLGDRFPTLADRSK(2)

MPYVQAVVLETIRIFMSRTLNVPHRALRDTYINGHKIPK(0)

DTMLIVNFDGVLMDESWGDPENFRPERFLDSNDNIVTPEKYFPFSIG(1)

KHRCLGEVLAKSNIFVITAALLQAFTFSVVPGEPQPSTQEFVDSVTGGPKPYRALVTLRK*

 

>CYP303A2 Linepithema humile (Argentine ant) Lh303seqA1i 484aa 10 exons .

52% to CYP303A1 honeybee, 57% to CYP303A1 Lh303seqA2

MVVTAILLLVFILLLPYLDCRKPKGFPPG(1)

PRWWPILGCALEMTRIRREVKYMYKICLNLRDRYGPIVGLKIGKTRVIVANDLQSM

QAILVNEDCDGRPAGILQKLRTSGVRRG(1)

IIMTDKQPWAEQRRFVTRHLREFGFSRTGMAALVEDEAREL(2)

XXXXXXXXXXXXXXX

EMIIEMVHIFDLNVLNSIWRMIVGKR(2)

FEIGDKKLERVQRILTKTLTEMDMLGSLFSYFPLLRFIIPETSGYKSFAEGHKELWDFVE(0)

EQMQYYKKTLDPNAPRGLMDVYLTALSSENRSDSFNE(1)

SQLVAVCVDLFMAGTETTANSLTYAFLYLILFPRVQKKVQEELDRVIGRDRLPTMADKPK(2)

LMYLQVVVLECLRLFIAYSFSLPHRTLKDTTILGYKVPK(0)

NTMLMVNFNGVYDDKAYCDDFKNFRPERFFDKDGNIVTPDNYFPFGLG(1)

KRHCIGEMLARSNIFIIIATLLQNFSFSVVPGEPQPSTQDFIFGATPCPKPYKALISLRV*

 

>CYP305D1 Linepithema humile (Argentine ant) Lh305seqD1i 458aa 7

exons Can't find first exon

51% to CYP305D1 honeybee, 51% to CYP305D1 ortholog Nasonia vitripennis
probable ortholog to bee CYP305D1

 (1)

PFPWPFVGNHFYLRKLTRVLGGQHLAFLELSKLYNSGVVSLQLGASKVIVISNAKLIQEV

LNKEEYDGRPWTEFIKIRNFGMKKG(1)

ITMNDGPDWKELRAWSIRTLRSIGFAKREMTELITNELKLILERLKDNSVQHIRPAIEPA

VINVLWTLVTGKPLHYDLR(2)

LKFMNLLNRRMQAFDMAGGLLSAFPWIRYVIPKVSGYKLLVEFNQELKSFLM(0)

DIINDHKERYVEGSKADFIDMFLSEIFKHEDKKSIFTD(1)

DNLLVTLADFFIAGINTTTATLDFLFLQMANHQNVQQKLHKEIDAVIGSNKFLNLEDRIN(2)

MPFTEAILTECQRIWLVTPVIGPRRVLCDTTLDGYTIPKNSTILLNIFCNNMNPEFFPNP

ILFQPERFVKDGVYQPDKNIIIFGKG(1)

KRRCPGESLAKTAIFLLFAGVMQRYRLLPIPGKETIEAEIGTGLTIAPKPYEMLIIPR*

 

>CYP306A1 Linepithema humile (Argentine ant) Lh306seqA1 489aa 7 exons

Tail-to-tail with Lh18seqA1

62% to CYP306A1 honeybee

MISLTYIILGVSFILFAYVFRKNCKTLRLPPGPTGIPLLGYLPWLDPQRPHESLTNLARKYG

PICGLRLGSVYTILLSDPQLVRQAFAKDAFAGRAPLYLTHGIMQGYG(1)

LICAEGDRWKTQRRFVAEFLKHLGMKSSGFMRDKLEERILVAVNECIL(0)

KLRNRSTENGIDPLETLHHCFGNVINDLVFGKVYEEDDKVWKWLRHLQEEGVKHIGVAGPLNFLPFLR(2)

FLPRFGKLIESLIDGKQKTHQIYQTIIDEYRVRREKTDNFLAVFDDVMTANTDNPGHFTQPQ

FYHMLADLFGAGVDTTLTSFRWFLLFMAVYPDEQ(0)

KKVQDEMNELLGQKLPSLEDRLILIRLEAAIMETQRLRSVVPIGIPHGTIE(0)

NTQVGGYDVPKGTMVIPLQYAIHTDSSYWQDPLSFRPERFITDEGALAKPKAFLPFQTG(1)

KRMCVGDELARMMLFLFAARILHSFAISTPSGAHIDLEGECGITLVPKPHRLVFTPRE*

 

>CYP307B1 Linepithema humile (Argentine ant) Lh307seqB1 505aa 3 exons .

71% to CYP307B1 honeybee

MISISATTSILLGVTLVALILILVDYMRSKTPKKLYDGEEASALLDPPGPKPWPILGSLHIFGR

YDLPYKAFGDLVKLYDSQIIKLRLGSLPCVVINGLENIKEVLVAKGHHFDSRPNFIRYHLLFSGNKENS(1)

LAFCNWSDIQKTRREMLRPHTFPRAFTARYNQLNVIIGGEMELLIDQLVSVSGVSLHAKPLIMH

TCANVFLKYFCSQRFGLGHGPFRTMIENFDKVFYEVNQGYAADFMPFLMPLHQRNMTKMANWSH

EIRKFVEENIIGDRLTSWKSVIPEEDLIDCLINHIQTGAEPKITWDTALFALEDIIGGHSAVGN

LLIKILGYLVTRPHVQKTAQKEIDGVETSSRFVGLENRGNMPYTEAIILEAIRLIASPIVPHVANQDSSIAG(1)

YKIEKDTFIFLNNYDLNMSNKLWTSPEEFMPQRFVQNGRLLKPEHFLPFGGGRRSCMGYKMVQY

ISFSTIATLLKNFNIVPVEKEIYKIPIGNLALPEKTFNFRFERR*

 

>CYP343A1 Linepithema humile (Argentine ant) Lh305seqA1 496aa 8 exons .

58% to CYP343A1 Apis mellifera

MWFIIICLTIFIIKIVHDWQRPRKFPPG(1)

PRGLPIVGNILDLKRLVDKMKFYSHAWCHLADIYGSIVGLKLGISEPLIIVSGRDAVIEMMSR

PEFDGRPNGFIHRHRTGGKRRGVIFTDGDIWRDQKR(2)

FILKTLKEFGYGKIAMEDIILNDAVSLTSIIESSAKSGPLTNLYDITSIAVLNSLWTLVAGTR(2)

FDLEKKNSKLMEILSIINDIVRNINVTGGILTHLPFLRHISPGLTGFTALNQRQIRVFQFFK(0)

NEVTKHKAETHGELRNFIDVYLAEIKKQSNSTVSYFDE(1)

EQLISVVKDLFTAGVETTNNTIGFIITYLVVKQDVQRKVHEEIDRVLGKEVLPRIADKNR(2)

LPYLNATIAEVSRLANVGPTSVAHRATTDTVLLGYEIKKNYTLLANLRSVHLDEKHWGDPKKFR

PERFINDKGEYVEDPWLMQFGFG(1)

RRKCLGETLAKNNIFLFTACLLQKFQFVLPPKHSNPELDGIDGFTIAPPDISIIAVKRA*

 

>CYP369A1 Linepithema humile (Argentine ant) Lh342seqA1 503aa 7 exons .

54% to CYP369A1 honeybee (old CYP342A1)

MSPFLVIILVLLAVYKLYRFTIDKPPNSPPG(1)

IIRLPIGGSYWMLLWKNYKFPHLAVDYYTKKLKSKIISGYFGDFFLVIVNDYASIKEVFTREEF

DGRVTCLETINDRAFGKKLG(1)

IFFIDGPQWHEQRRFALRYMRDFGFGRRQDKLESEIMDEMSLFIDILKNGPIYDGEK(0)

EIMKGNLMLFPDILYATSANNIWNVMFGQRFDRSKHDISRHLCRSAMMFQRANETTGGMILFLP

ILKYFGNMFGYTNHMKGNYAIVDVVK(0)

KTLEEQKITLSEHIDRGFVDKYLKKLNENDKSEYFTEEQLIILLVDVMFPALSASPTVITHIIK

YLMHHPKAMEKAQSEIDTIVGTGRLVTWEDRKD(2)

LPYIEAVIRETMRIETLTPFGVIHKALKDTTLGGYDIPANTPIFTNLSAMHHDREMWGDPENFR

PERFLKEDGQICKDMSLPFGLG(1)

HRVCMGETYARYTIFETLALLLQNFNFSFVEGEPSSLEDRVPGLIVNVKELWIRLELR*

 

CYP3 clan (107 sequences)

 

>CYP6AQ10 Linepithema humile (Argentine ant) Lh6AQseq1 514aa 5 exons

SEQUENCING ERROR T deletion at 384065, upstream from Lh6AQseq2

58% to CYP6AQ1 Apis mellifera 

MAFITAHWGLDGIIVLTTLMIAVYLYMTRKLNYWKKRGVTEVVSPTLFLGNFTDCVLFKKSPGY

LIKDFYDRAKGLPYAGFFILNKPALLIRDRELVKNILVKDFSNFENRYGSPDTKDRLGYANLFF

INNPAWKILRSKLSPIFTSGKLKKMFELMLVCAQNLDTYLESLKLEG(1)

KGKELETKDLAAKFATDMIGVTAYGLNVNSLNNPDAEFRRHGKKIFEYSYIRGFEMLSIFFFPS

LVRWTRMRVFGKDSSVFLRKAFWDTLLQRIESGTKRHDLIDILIELKKNHVDQDLNGIK(1)

FDGDDLVAQAAIFFTGGYETSSSTVSFTLYELAMYPEVQNRLRKEIHNALKENNNKVTYDM(0)

IMSLPYLDMVVSEVLRKYPPLPFLDRVAGDTYKVPDSDLVLEKDTPIYVSMLGMHYDPEYFPDP

DKFDPERFNEENKHNIPSCAYFPFGEGPRICIG(1)

ARLGLLQSKLGLVTILNKYEVTPSKKTLIPMVLDPRGTTTTALGGGVYLNLRRLNIST*

 

>CYP6AQ11 Linepithema humile (Argentine ant) Lh6AQseq2 515aa 5 exons

Downstream from Lh6AQseq1, upstream from Lh6AQseq3

57% to CYP6AQ1 Apis mellifera 

MALITAHWGLDGIIVLTTLVTAAYLFMTRKFNYWKNRGVTELQPTPFFGNFTDCMLFKKSPGYLM

KDFYDQGKGLPYLGFFILDKPVLLIRDRELVKDVLIKDFNYFADRYSTADTKDRMGYVNLFFLKN

PAWKILRGKLTPFFSSGKLKKMFELMVEVAKNVDTCLESLELVG(1)

EGKEMEVKDITAKYSIDMIACTAFGFNVNSLNNPDAEFLKYAKIIFEIDIVRGLEFFAMFFLPSI

IKWTGTKSFGKATEFLREVFWQAINERIKSDVKRHDLIDILIELKKSHGDQDVGGFK(1)

FDGDDLVAQAAIFFTGGFESSTTTITFTLYELAVYPEIQDRVRKEIFDALERSDGKITYDM(0)

IMSLSYLDMVVSEILRKYPPLPFLDRVTTNTYKVPDSDLVLEKDTPIYVSMLGMHYDPEYFPDPE

KFDPERFNEENKRNIPSCAYFPFGEGPHSCIG(1)

LRLGLLQSKLGIIKILINYEVTPSRKTLIPMVFDPKALATSPLGGGMYLNIRKVKNGTNLK*

 

>CYP6AQ12 Linepithema humile (Argentine ant) Lh6AQseq3 514aa

5 exons Downstream from Lh6AQseq2, upstream from Lh6AQseq4

75% to Lh6AQseq5, 60% to Lh6AQseq1, 52% to CYP6AQ1

MAYITAYWSLDGIIVLTAIITVFYLYMIRNFNYWKKRGILEVAPPTPFLGNFSDCLRFKKAPADF

LKEFYDQAKGLLCVGFYILDKPILLIRDRELVKQILVKDFNHFNNRYALADPKDRLNYANLFFIK

DTDWKNLRTKLTPFFTSGKMKKMFDLMCQCGNHLDDYLDSLEFEG(1)

DGKTIEMKELAIKFTTDLIGSTAFGLEVNSFKDPNAEFCKYSKMLFRFSIIRAYEMLAVFFIPNI

VSLVGIKFFGEEPTKFLRKVFWETITARLKSGEKRNDLIEMLIELKQNPDNKLEDFS(1)

YDGDDLMAQAASFFSAGSDTSATTLSFALYSLAIRPEMQDKLRKEILEGLDASDGKITYDM(0)

TMSLPYLDMVISESLRMHPPLGHINRITTKTYKVPNSNIVIEKGTPIFISMLGMHYDPEYFPNPE

KFDPERFNEENKRNRPSCVYFPFGEGPHACIG(1)

NRFASLQTKLGLIQILSKFEVTPCEKTAIPIKVDPRGTLLSPVNGVIYLNIRRINNVKI*

 

>CYP6AQ13 Linepithema humile (Argentine ant) Lh6AQseq4 516aa

5 exons

Downstream from Lh6AQseq3, upstream from Lh6AQseq5

73% to Lh6AQseq5, 53% to CYP6AQ1

MAFITAYWGLDGIIVLAAIITVFYLYMIRNFNYWKKRGIVEMTPPTPFLGNFSDCLRFKKAPADFL

KELYDQAKGLPYIGFYVLDKPFLLICDRELVKQILVKDFNHFSDRYIEADENDRLGCANLFLIKNP

AWKLLRTKLTPFFTSGKMRKMFDLILQCGENLDAYLDKSEFED(1)

NGSIVDVKELTAKFTTDVVGSTAFGLEVNSFKYPDAEFSKCRRMIFDYSTVRAFELLMVFFIPSIV

SLFSIRIFGKEPTIFLRKVFWETFTQRINSGVKRNDLIDILVKLKENNENQNTENFT(1)

YDGDDLMAQAASFFSAGSDTSATTIAFALYELAVKPEIQNRLREEILHALDQSNGKITYDM(0)

IQSLPYLDMVLSETLRMYPPLGYLNRVANKTYKMSDSDLVLEKNIPVYISALGLHYDAEYFPNPEQ

FDPERFDEKNRHNRPSCVYLPFGDGPHSCIG(1)

NRFALLQSKLGLIQILKKCEITPCEKTTIPIRADPRAAMLAPLNGVIYLNIRKINTNTKI*

 

>CYP6AQ14 Linepithema humile (Argentine ant) Lh6AQseq5 516aa

5 exons Downstream from Lh6AQseq4

73% to Lh6AQseq4, 56% to CYP6AQ1

MALLTSYWGLDGILVLTTLMVVFYLYMTRKFKYWKKRGISETAPPTPFFGNFADCLLFKKAPADFL

KELYDQAKGLPYIGFYVLDKPILLIRDRELVKNILVKDFNYFSNRYVLADPKDRLGYATLFFLRNQ

AWKIIRTKMTPFFTSGKMKKMFELMIQCGKHLDEHLNSPEFEG(1)

KGKTIEIKELTAKFTTDVIGSTAFGLEVNSFKDPDAEFRKYGKMIFHYNAIRGFEMLAIFFLPEIV

RLAKVKMFGKEPTEFLRKVFWETINQRMKSGAKRNDLIDILVELKQNANDQNTLEDFT(1)

YDGDDLMAQAASFFSAGFETSATTISFALYELALCPEMQNRLRKEILEALEQSNGKITYDL(0)

VMSLPYLDMVVSESLRMYPPLGYLNRITTEPYKLPNSNLVLEKDTPVYISMLGMHYDPEYFPNPEK

FDPERFNEENKRNRPSTVYFPFGEGPHACIG(1)

NRFGLLQSKLGIMEILKKCEVTPSEKTTIPVQIDPRGAMLAPLNGVLYLNIRKLNTNAN*

 

>CYP6AS39 Linepithema humile (Argentine ant) Lh6ASseq1 504aa 5 exons .

43% to CYP6AS5, 94% TO Lh6ASseq23, best matches are all CYP6AS

MLGLLELLYGFIAFFLALYYYYKIKFNFWKKRGVPGPEPILFFGTMKDVILQRMSRKDYHKKIYNTYK

SEPLIGFFDQTVPILMVNNPELIKDVLITDSAIFSRRGFNYSKK(0)

AEPLDHQIFYMNTDEVQPIRAKVSPIFTPSKLKSMVPLLLQRSEIFKDWLDTLLLQNEQINYSQVTAK

YTADLSATCLFGYDMQTLRNGESKVLQYIKKRMNANKLKTMLTDLLPNIVIYNKLYDLFGYYMFNNAE

DLQFFTELVKDIDGYRKKYGIVRHDITDAVMGLQENGKLIKPE(1)

STNNFIAANMFTFFFGAYETSSVTMTHTMYELAVNQSIQDRLRKEIKRVRAANNRNKAEEITYDDINT

MSYLDAVFKE(1)

TLRKYPLIELLKRQASSAYTFRNSEVTIPKNQLIGIPVHGIHHNPEIYPNPEVYDPERFMDEAAKSRP

LMYFLPFGHGPRNCIG(1)

ERFGILQTKISLITIVENYKIDTCENTRIVHSKDIIVQQTACMYLKLTKIN*

 

>CYP6AS40 Linepithema humile (Argentine ant) Lh6ASseq2i 378aa 4 exons

INCOMPLETE short scaffold missing 100aa on N-term, upstream from Lh6ASseq3i

83% to Lh6ASseq9P, 41% to CYP6AS5 Apis mellifera 

(1)

PLDHHIFYMKTDKAQPIRAKVSPMFTPSKLRSMVPICLERSKNFKDWLDTLLSRNEEINYSDMIEKYI

SDLSTTCLFGYDLEALKDGENKVLQQIRKAVSANTWKNICKSLLPNIVMQNKLYDLIGYYMFGNAQEW

QFFTALVKNIDSYRKKHGIDRHDLTNVIMGLKQNE(1)

ITDQLVVANIFAFMAASETSSATATNTMYELALNQSIQDKLREEIKSVRASNKEKQITYDDINTMSYL

DAVFKE(1)

TLRKYPIADVIGRQAISCYTFRNSKVTIPKNQLVGIPVCGIHYNPDIYPKPEVYDPERFIDPKTKNSM

HYFPFGHGPRNCIG(1)

ERFGILETKIVLITIIENYKVEPCENTKMIYNWEKIVQQTRSMYLKLTKIN*

 

>CYP6AS41P Linepithema humile (Argentine ant) Lh6ASseq3i 112aa 1 exon

INCOMPLETE first exon only, downstream from 6ASseq2i ヨ possibly the

first exon for this gene?

99% to Lh6ASseq9P, 1 aa diff

MLGFLEILYVFIAFFIVLYYYYKIKFNFWKKRGIPGPKPILFFGNTKDVILRRMNIMDFHKELYNKYRN

EPLIGFFYQTEPFLFVNDPELIKDVLITDSAVFAGRGSNYSEK(0)

 

>CYP6AS42 Linepithema humile (Argentine ant) Lh6ASseq6 501aa 5 exons

Upstream from Lh6ASseq7

54% to Lh6ASseq17, 50% to CYP6AS19 Apis

MAAGAFEILCGCVAILFLLYYYLTADFDYWRSRGVNGPKPIPFFGNIAKFILGKRSLGDVLKDVYEEFPK

EPIVGMFWHGEPILVLRDTEFIKKVLIKDFSVFPERRLIVFEK(0)

AEPLSMHLFRLDAVRWRPLRTRLSPIFTSGKLKDMFHLLLNCSEHFESYMSKIIPKDGIVECRNLTAKFT

IDVIGSCAFGIEINALKEENNRFHEMGRMMFRNDLKTAIRNLLRQFSWLFKHFGHIIDDHDLNQFMTDLT

RDTIDYRKQNNVCRHDFVDTLIDLKDNPDKLGENN(1)

VTDMFIAAQAMVFFAAGFETSSTTMSNAMYELALNQVIQDKVREEIREVLSSADGVILYDDLKKLKYLNKIFQE(1)

TLRKYPPVMYLSRKTIRNYTFENTKISLRKGQKVFIPIYAIQNDPNIYPNPDIFDPERFSDDNVAQRDSM

HYLPFGDGPRNCIG(1)

ARFAINQMKIGLIKVLMNYKIDVCEKTQMPIVNHPLSIMMLQPNHGIYVKLTRLA*

 

>CYP6AS43 Linepithema humile (Argentine ant) Lh6ASseq7 502aa

5 exons Frameshift insertions at 1895834 and 1895779 Downstream from

Lh6ASseq6, upstream from Lh6ASseq8P

48% to Lh6ASseq17

MVYGDYSILLGCVAFVLIVYYYITVKYNYWKVRDVKGPAPLPIVGNFGRIILGKISLSTLFERVYEKYKR

ESLIGIHWGSEPILIVKDPVLIKDILIKDFSVFIDRGVDSNER(0)

VDLFGVNIFSVEGKRWRPLRTKVSPIFSSGKLKQMFHIMVQCSNKFGQYLDQLISKESIVDCHMITAKYT

GDVIGTCFFGIDLHILNDGECEFLRIMKKLMKPNLKGFLREFIRGWLPSLYNFIGYYLQPHDVNAYFMQT

VTNVIEYRLKNNAIKHDFADILVDLKKHPEKLPELE(1)

LTNEILVAQAFILFVAGYFTSYTTMSHILHELALNPHIQKQLKEEITNELEKTGGAIEYESIKRMSYLDAIFKE(1)

TLRKHPAVTHIMRHAVTDYTFSGIKQLRIRKGQRIWIPIRQFQHDPDIFCNPEVFDPERFMGNTELIDSM

YYLPFGTGSRNCIG(1)

ARFGTYEIKVGIVRIIRNFKLDVCEESGSQATNQPRSFLLSPSSMYLKFTKINHD*

 

>CYP6AS44 Linepithema humile (Argentine ant) Lh6ASseq8P 265aa 4 exons

Frameshift deletion at 1892527, all introns lack splice sites, 6 stop codons,

downstream Lh6ASseq7

41% to Lh6ASseq7 32% to CYP6AS5 Apis mellifera, top hits all CYP6AS

INLNTMSNDEFL*IAKRYRTLSSKLCFRESLRSWLQWLYDYIGYYLIDHVTTVEHFNKKVISITEYR*KNNL

VKHEFTSILIDLKKNSQKLLNT(9)

MTDKVCHIFSAGFFAFYMRISHILRKLVTNSRT*KPLRKKIMN(9)

YIQKYDVLSFQTVKN*R*IKLEIRLN*RYLPVKREKIYSCFFFILEVLGKHSPVRYLMRRAVADSTFSGIKV

HICKRQQIWIPVYAIHLTSDIYPDPEVFDPERF(9)

YYLPFGVDSRNCIKQYFAKISKTKIFNII*

 

>CYP6AS45P Linepithema humile (Argentine ant) Lh6ASseq9P 441aa 4 exons

PSEUDOGENE? ASSEMBLY ERROR?? Truncated on C-term, missing heme-binding region.

Frameshift insertion at 826109

68% to Lh6ASseq1

MLGFLEILYVFIAFFIVLYYYYKIKFNFWKKRGIPGPKPILFFGNTKDVILRRMNIMDFHKELYNKYRNEPLI

GFFYQTEPFLFVNDPEMIKDVLITDSAVFAGRGSNYSEK(0)

ADPLDHHIFNMKSDKAKLIRAKVSPMFTASKLKTMVPLCLERSEIFKDWLDTLLSRNEKINYSDVIEKYTNDL

STTCLFGYDLEALKNGENKVLQQIRKKVNANTWKNICKSLLPNIVMQKKLYDLIGYYMFGNAQKWQFFTALVK

DIDSYRKKYGIDRHDLTDVIMGLKQND(1)

QLVVANVFTFLLGACDTTSGTITNIMYELALNQSIQDKLREEIKSVRERINGKEITYDDMNTMAYLDAVFKE(1)

TLRKYPLGEIIMRQAMSLYTFRNSEVTIPKNQLVGIPVCGIHYNPDIYPKPEVYDPERFITIDPKTSKNSMYY

FPFGHGPRNWY(0)

 

>CYP6AS46 Linepithema humile (Argentine ant) Lh6ASseq10 502aa 5 exons .

61% to Lh6ASseq21, 53% to CYP6AS5,  

METFEILCGIAAIIVVFYYYFTSTFNFWSSRGVRGPRPIPVFGTYKDVILGKKCANHYSMEVYNEFKDEIFIG

IFDKRTPILIVKDLDLIQDILIKDFLKFPDRGIIRTIHEK(0)

AEPWSASLLHLEFRRWRPIRTKLSPAFSPSKLKKMFSLILECSNRLKQYTEELVNRNEPIECCDLMAKYTTEV

IGTCGFGIDMNSLSDVDSEFRRMGRMMFYSPWRVIRDSLRNNVPLFYDILSSIVPLAEFVEFIRNLILKSIDY

RDKNNVSRQDFVDALRELKKQSKEMGDIE(1)

ITETLLISQAYIFFAAGFETSSMALSHALYELALNQKIQDKLREEIDQKYATHGSNLKDKNIKKMEYLDKVVKE(1)

TLRKYPVIAFLPRKSVSNYTFKGTNVSIPKNLNIWIPMYSIHRDSRFYPDPEVFDPERFSKEIKQTRHPMTFL

PFGDGPRNCIG(1)

LNFAFYQVKVGLITILRNFKVEPCEKTPIPYVINPITFLSAPKSGIHLRFTKVNRA*

 

>CYP6AS47 Linepithema humile (Argentine ant) Lh6ASseq11i 275aa 2 exons

INCOMPLETE, SEQUENCING ERROR T deleted at 16914, 1 frameshift, missing

200aa internal (N's)

96% to Lh6ASseq10

METFEILCGIAAIIVVFYYYFTSTFNFWSSRGVRGPRPIPVFGTYKDVILGKKCANHYSMEVYNEFKDEIFIGIF

DKRTPILIVKDLDLIQDILITDFLKFSERGIKNLHEK(0)

AEPWSASLLHLEFRRWRPIRTKLSPAFSPSKLKKMFSLILECSNRLKQYTELVNRNEPIECCDLMAKYTTEVIGT

CGFGIDMNSLSDVDSEFRRMGRMMFYSPWRVIRDSLRNNVPLFYDILLRNFKVEPCEKTPIPYVINPITFLSAPK

SGIHLRFTKVNRA*

 

>CYP6AS48 Linepithema humile (Argentine ant) Lh6ASseq12 502aa

5 exons Upstream from Lh6ASseq13

70% to Lh6ASseq17, 59% to CYP6AS7 Apis mellifera 

MALFEILCGVVAVVLAFYYYLTSNFDFWKSRGIRGPQPIPIFGNVKDVMLAKKFIGDYTLELYNNYKDES

MIGIFTRGKPILVLKDLDLIKDVLIKDFSNFTERDFANIHEK(0)

AEPLSQHLVALETKRWRLLRAKLSPVFTSGKLKEMVSLISECADKLDGYIEKLASKSDSIECRELTAKYT

TDVIGTCAFGIEMNALSDEDSEFRKMGREIFTPRWYKSVKNILREATPWLYNTLGYILPQTKATKFFIRL

TMDNINYREKNNIFRHDFIDTLRELKKHPETVGNIE(1)

LTDGLLASQAFVFFLAGFETSSTTMSNALYELALNFQIQDKLREEINQQYAKHGNNLIYENIKDMTYLDKIFKE(1)

TLRKYPPATLLRRKSTSNYTFKDTKLSISKDQVLFIPIYAIQRDPSIYPEPEVFDPERFSEEVVKTRHPM

SYFPFGDGPRNCIG(1)

ARFAIYQTKIGLIKILRKYKVETCEKTPIPYINNPKAFLLAPTGGMHLRLTKIDQD*

 

>CYP6AS49 Linepithema humile (Argentine ant) Lh6ASseq13 500aa

5 exons Downstream from Lh6ASseq12, upstream from Lh6ASseq14P

65% to Lh6ASseq17, 58% to CYP6AS7 Apis mellifera

MYFEILCGIVTVIVLLYYYFTSNYNFWKLHGVRGPQPIPIFGTFKDVMLAKKFLGDYLKEVYNDYKEEAM

IGIYHKKTPILILKDPDLIKDVLIKDFSAFSDRGAKNISEK(0)

TDPLSQHIFNLDTKRWRIIRTRLSPVFTTSKIREMFFLISKCANQLDKYVEKLTSKDKLIECRELATMYT

TDVIGTCAFGIEMDALSDEGNEFRRIGKQVFNHTWNVIIRNEIRQSIPWLYDILGNFLPHLEHHTFYTRL

TVENMNYREANNIVKHDFIDTLRELRNHPDKVRDID(1)

LTDSFLASQAYSFFIAGFETSASTISYALYELALNQQIQNKLHEEINQAYLKHGDITYENIKELIYLDKVVKE(1)

TLRKHTPSPLLMRQSTTNYNFNGTKVSIPKGQKVWIPIYAIQRDPSIYPEPDVFDPERFSEEAVQTRHAM

YYLPFGDGPRNCIG(1)

LRFANYQTKLGLIKILQKYKFETCEKTDIPYTNKPNTNLLTPINGITLKISKIDCV*

 

>CYP6AS50P Linepithema humile (Argentine ant) Lh6ASseq14P 363aa

4 exons PSEUDOGENE, SEQUENCING ERROR A inserted 175434,

missing 1st exon, 1 stop codon, unmatched intron, problems with

heme-binding sequence, downstream from Lh6ASseq13, upstream from Lh6ASseq15

66% to Lh6ASseq20 

(0)

AEPLSQHLFALEPKRWRLFRISLTPIFTSNKLKEMFLLIS*CADNLEQYVENMVNRKEPINCHDLMAKY

ATDVIGTCAFGIDMNAISNEDSEFRVMGKKFALNWKDFIRSRFRAFLPKFYNMLGHVLPQREITKFFIR

IVVETINYREKNNIVKHDFIDALRELRKHPEKLGDIA(1)

YVFFIAGFETSSTAMSHTLYELASNQQVQDKLCEEINEEYVKHGNNVIYDNIKRMNYLDKVFKE(1)

TLRKYPPVTFLMRQSISSYTFDGTKISILKDQSVWIPAIAIHNDPDIYPEPDVFGPERFSEDETRNPMF

YLPFGDGPRNCIG(9)

LLRNYKFETCEKTQISYKNSSKHPFLLAPKNGIHLKVTKIERV*

 

>CYP6AS51 Linepithema humile (Argentine ant) Lh6ASseq15 505aa 5 exons

GC donor on first intron, downstream from Lh6ASseq14P, upstream from Lh6ASseq16i

73% to Lh6ASseq20, 73% to Lh6ASseq17,  

MGLFEILCGIGVVLIALYYYFTSTFDFWNAHGVRGPRPLPVFGNIKDVMLGNKALGFYLKDLYDEYKNES

IVGIFLRRTPVLVVKDPDLIKDILIKDFSKFADRGGLA(0)

FILCLQTDPLSQHLFALESKRWRPLRTSMSPVFTSGKLKEMFFLITECASHLEQYLEKLVSKNEPIECRE

LMAKYTTDVIGTCAFGIEMNAISNEDSEFRKMGRKIFAASWSNYIRFRLANYTPKLYDLLGYVLPQREVT

TFFIRVVTETLDYREKNNVVRHDFVDVLRELKKHPEKLGDIK(1)

LTDNLIAAQAFVFFLAGFETSSTATSQALYELALNQEIQDKLREEIDEEYTKHGSNLIYDNVKNMNYLDKVFKE(1)

TLRKYPPVLYLMRKSTSSYTFEDTKVSVPKGQNVFIPVLAIHRDPDIYPEPEVFDPERFSEEVAKSRNPI

FYLPFGDGPRNCIG(1)

ARFAVHQSKVGLIKILRNYKVEPCEKTQIPYISSAVHQFLLAPKDGIYLKITKIKRG*

 

>CYP6AS52-de5b Linepithema humile (Argentine ant) Lh6ASseq16i 39aa

1 exon Last exon only, downstream from Lh6ASseq15, upstream from Lh6ASseq17

69% to Lh6ASseq17 

(0)

LPYEYYPKTFILASKDGIHLKITKIERLKNLNSFTMYVP*

 

>CYP6AS52 Linepithema humile (Argentine ant) Lh6ASseq17 499aa

5 exons Downstream from Lh6ASseq16i, upstream from Lh6ASseq18

84% to Lh6ASseq20

MESFEILCGIALVLIALYYYFTSTYDFWNSRGVRGPQPIPLFGNAKDVLLGKKGMGHYLMEVYNEYKNE

SMIGIFLRKTPILIVKDPELIKDVLIKDFSKFADRGFTVHEK(0)

ADPLSQHLFSLEPKRWRPLRTNLSPVFTSGKLKEMFSLISECADHLEKYIEKLANKKEPVECRELTAKY

TTDVIGTCAFGIEMNAMSNEDSEFRKMGREAFAPTWKNILRMRIRTSMPWLYDIFGYILPQNKVTKFFI

HVIVETLNYREKNNIVRHDFVDMLRELKKSPEKLGDID(1)

LTDSLIASQAFVFFLAGFETSSTTMSHALYELALNQHIQDKLREEINQEYAKHGSKLLYDDIKKMNYLDKVFKE(1)

TLRKYPPGTFLMRNSTTSYTFDGTKVSLPKNQRVWIPTYAIQHDPSIYPEPDVFDPERFTEEAVQSRNA

MFYLPFGDGPRNCIG(1)

ARFAIYQSKVGLIRILHNYRVETCEKTQIPYQYDPKAFVLAPIGGIHLKITKIE*

 

>CYP6AS53 Linepithema humile (Argentine ant) Lh6ASseq18i 473aa

5 exons INCOMPLETE Downstream from Lh6ASseq17, upstream from Lh6ASseq19,

missing 5aa on C-term Ns

89% to Lh6ASseq20 

MDPFEILCGIAVALIALYYYFTSSYDFWNSRGVRGPQPSIPFGNVKDVMLTKKAMGHYLKEVYNEYKNES

VIGIFLRKTPVLVVKDPELIKDVLIKDFSTFADRGFTIHER(0)

AEPLSQHLFGLEPKRWRPLRTNLSPVFTSGKLKEMFSLISECADHLEKYIKKLANKKEPVECRELTAKYT

TDVIGTCAFGIEMNAMSNEDSEFRKMGREAFAPTWKNILRMRIRTSMPWLYDILGYILPHTEVTKFFIRV

IVETLDYRERNNIVRHDFVDMLRELKKHPEKLGDID(1)

LTDSLIASQAFVFFLAGFETSSTTMSHALYELAINQQIQDKLREEIEQEYASHGSNLTYDNVKKMSYLDKVFKE(1)

TLRKYPPVTFLLRKSLSDYTFDGTKVSIPKNQSVWIPVYAIHHDPSIYPEPDVFDPERFTEEAVQSRHAM

FYLPFGDGPRNCIG(1)

ARFGVHQTKIGLIKMLRNYKVETCEKTR

 

>CYP6AS54 Linepithema humile (Argentine ant) Lh6ASseq19i 235aa 2 exons

INCOMPLETE Missing 60-350 Ns, downstream from Lh6ASseq18, upstream from Lh6ASseq20

3 aa diffs with Lh6ASseq20

MDPFEILCGIAVALIVLYYYFTSTYDFWSSRGVRGPQPSLLFGTVKDVMLTKKAMGHYLPAYI

LMRKSVSDYTFDGTKVSIPKNQSVWIPSYAIHYDPSIYPEPDVFDPERFTEEAERSRHAMFYLPFGDGPRNCIG(1)

ARFAVHQTKIGLIKMLRNYKVETCEKTRIPYETDPKAFLLAPIDGIHLRITKIERI*

 

>CYP6AS55 Linepithema humile (Argentine ant) Lh6ASseq20 501aa 5 exons

SEQUENCING ERROR T deleted at 196127, downstream from Lh6ASseq19i,

upstream from Lh6ASseq21

92% to Lh6ASseq21

MDPFEILCGIAVALIVLYYYFTSTYDFWNSRGVRGPQPSLLFGTVKDVMLTKKAMGHYLKEVYDEYKDES

MIGIFLRKTPILIVKIPELIKDVLIKDFSKFADRGFTVLEK(0)

AEPLSQHLFLLEPKRWRPLRTNLSPVFTSGKLKEMFSLISECADHLEKYIEKLANIKEPVECRELTAKYT

TDVIGTCAFGIEMNAMSNDDSEFRRMGRQVFAPTWKNIIRTRIRSIIPSLYNMLGYILPQNEVTKFFTRV

IVETLDYREKNNVIRHDFVDMLRELKKHPEKLGDID(1)

LTDSLIAAQAFVFFIAGFETSSTTMSHALYELAINQHIQDKLRKEIDQEYAIHGSNLTYDNVKKMIYLDKVFKE(1)

TLRKYPPLTF LMRKSVSDYTFDGTKVSIPKNQSVWIPSYAIHYDPSIYPEPDVFDPERFTEEAERSRHA

MFYLPFGDGPRNCIG(1)

ARFAVHQTKIGLIKMLRNYKVETCEKTRIPYKNDPKAFLLAPIDGIHLRITKIERI*

 

>CYP6AS56 Linepithema humile (Argentine ant) Lh6ASseq21 501aa 5 exons

Downstream from Lh6ASseq20

92% to Lh6ASseq20

MDPFEILCGIAVTLIVLYYYFTSTYDFWSSRGVRGPQPSLLFGNVKDVMLTKKAMGHYLKEVYDEYKDESM

IGIFLRKTPILIVKNPELIKDVLIKDFSKFADRGFTVLEK(0)

AEPLSQHLFHLEPKRWRPLRINLSPVFTSGKLKEMFSLISECADHLEKYIEKLANKKEPVECRELTAKYTT

DVIGTCAFGIEMNAMSNDDSEFRRMGRKVFAPSWKKIIQSRLRSIIPSLCNMLGYLLPQNEVTKFFTRVIV

ETLDYREKNNVIRHDFVDILRELKKHPQKLGDID(1)

LTDSLIAAQAFGFFVAGFETSSTTMSHALYELAINQQIQDKLREEIEQKYAIHGSNLTYDNVKKMSYLDKVFKE(1)

TLRKYPPLTFLTRKSVSDYTFNGTKVSIPKNQSVWIPAYAIHHDPSIYPEPDVFDLERFTEEAVQSRHAMF

YLPFGDGPRNCIG(1)

ARFAVYQTKIGLIKMLRNYKVETCERTRIPYENNPNTFFLTPIDGIHLRITKIERI*

 

>CYP6AS57 Linepithema humile (Argentine ant) Lh6ASseq22 501aa 5 exons.

63% to Lh6ASseq17

MESWTTLCGIAIAILLFYYYFTSTFNFWKSRGVRGPRPIPIFGNIKNVMLGKKFIGDYLTDVYNDYKDEPLI

GIFAKRTPILIVNNPEFIKDILIKDFSTFCERGVLNISKK(0)

NDPLTHNLLNLEYKNWKPLRKMLTPIFTSGKLKKMFPLILECADHLEQNVKEMVNQEKLVECRELTAKYTTD

VIGICAFGIDINALSDENSEFRKMGKAIVTPSWSNLLWYLTKQSAPWLYDILANVIPESEATKFFSHTALET

INHRQMHNIIRHDFIDILIELKNRPDKFKDIE(1)

LTDSLLAAQAFLFFVTGFEGSSTTMSFALYELALNQKIQDKLHEEIDEEYTKHGSDLIYDNINKMTYLDKVYKE(1)

TLRKYPPVTAHFRKSTSNYTFRGTNVNIPKGQEVWIPIYAIQQDPNIYPEPDVFNPERFNEENTQTRQATSY

LPFGDGPKSCIG(1)

VRFADYQIKVGIIKILRNYKVKTCEKTEIPINNPKAFFLAPKNEIYLKLTKIDRD*

 

>CYP6AS58 Linepithema humile (Argentine ant) Lh6ASseq23 504aa 5 exons .

94% to Lh6ASseq1

MLGLLELLYGFIAFFLALYYYYKIKFNFWKKRGVPGPEPILFFGTMKDVILQRMSKKDYHKKIYNTYKSEPLI

GFFDQTVPILMVNNPELIKDVLITDSAIFSRRGFNYSKK(0)

AEPLSHQIFYMNTDEVQPIRAKVSPIFTPSKLKSIVPLLLQRSEIFKDWLDTLLLQNEQINYSQVTAKYTADL

SATCLFGYDMQTLGDGESKVLQYIKKKMNANKLKIMLIDLLPDIVIYNKLYDLLGYYMFNNAEELHFFTELVK

DIDGYRKKYGIVRHDITDAVMKLQENGKLIKPE(1)

STNNFIAANMFAFFFAAYETSSVTMTHTMYELAVNQSIQDRLRKEIKSVRAANNRKKAEEITYDDINTMSYLDAVFKE

(1)

TLRKYPVIELLKRQASSAYTFRNSKVTIPKNQLIGIPVHGIHYNSEIYPKPEVYDPERFMGEAAKSRPSMYFL

PFGHGPRNCIG(1)

ERFGILQTKISLITIVENYKIDTCENTQIVHNKEIIVQQTARMYLKLTKIN*

 

>CYP6AS58v2 Linepithema humile (Argentine ant) Lh6ASseq1I 85aa 1 exon

INCOMPLETE very short scaffold, single exon

100% to Lh6ASseq23

(0)

KRCESI

PVIELLKRQASSAYTFRNSKVTIPKNQLIGIPVHGIHYNSEIYPKPEVYDPERFMGEAAKSRPSMYFLPFGHGPRNCIG(1)

 

>CYP6BC3 Linepithema humile (Argentine ant) Lh6BCseq1 520aa

5 exons downstream from Lh6BEseq2P

72% to CYP6BC1 Apis mellifera (only one hit, ortholog)

MLAIVALLLHPFLLIGLVLGSLYFYLTATFDFWKCRGVPYKKPTVLVGNFGPLLLFRQSLPEGVKEMYQWFKDE

RFFGVFRVRSPALILRDPDLVKSICIKDFSCFPYRGIPINNE(0)

DPLNEHLFHLEGRKWKSLRSKLTPAFSSGKLKRMFYLLVECCEELQKLISASCAADRTVEVRELATKFTIDVIG

SCAFGIQINALTNEESEFHKAAKKLSRPSYKATLWRMLRTAMPRLYKLLGVQVIDPSVTHFFKDVVSQVISQRE

SNGVRRHDFMDLLLDLKNKGAVENETGSAQICSDEDAQAAKEIE(1)

LDENAIAAQAFVFFAAGYETSSNTIAFCLYELALNQEIQEKTRREIRNAIKPLGGKLTYDTVQEMKYLDMVILE(1)

TLRKYPSAPLLSRKCAFKYQIPNSKVELPAGMRVIIPIYGFHHDPNYYPNPAKFDPERFTEENKRTRHPNTYL

PFGEGPRNCIG(1)

MRFALLQIKIGIISFLKDHQVEICDKSIVPIKFSRRSLVTTSEKGFWLAITPVS*

 

>CYP6BD7 Linepithema humile (Argentine ant) Lh4BDseq3 497aa

6 exons downstream from Lh4BDseq2P

51% to CYP6BD1 Apis mellifera, (only one strong match, ortholog to Apis)
41% to Lh6AQseq2 

MAILTNCIYLDILLIFSSLLATLYLWMKWKHSYWQRRGIRSLPTHWFFGHFKDAILMRKPPGVILGELYQQ

GNDEDDVLGIYILFKPFLLVRNSELIKQIMIKDFNVFPNHHFVARSNADKMSGYNLFGIGNPEWKYLR(2)

TKMSPVFTSGKLKSLFLLMVESGELMGAHLRSQISNDSKFKSISIKDVFYKYTTNIVASLAFGIQTNCFDTPNPEFYVKS(1)

REAFNLTFVRAIKFFFLFFLPNIGKHLRNKMLGDSTEYFRKVFWESMDNRTITKMKRGDLIDSLLQLKNEQPDR(1)

FEGDVLLAQAAIFFVAGRETSITTLTYVLCELAKHPEMQKRVRQEILEKIEAANGVTNEAVHDMKYLHQVI

NETLRLYPPAPILDRVPIRDYT(0)

FPGTNISIEKGTPVYVALRGLHSDPKYHPDPKRFDPERFSDEKKDEIAPCTFMPFGDGPRNCIG(1)

VLQTAVGLITILRDYEVALNPKWLTTVETRNPFTTPPAGFLLDLKKI*

 

>CYP6BD_fragment1 Linepithema humile (Argentine ant) Lh6BDseq8i 177aa

2 exons INCOMPLETE Missing 320aa on C-term (Ns?)

96% to Lh4BDseq3

MAILTNCIYLDILLIFSSLLATLYLWMKWKHSYWQRCGIRSLPTH*FFGHFKDAILMRKPPGVVLGELYQQ

GNDKDDVLGIYILFKPFLLVRNSELIKQIMIKDFNVFSNHHFVARSNADKMSGYNLFGIDNPEWKYLR(2)

TKMSPVFTSGKLKSLFLLMVESGELMGAHLRSQFSNDSK(2)

 

>CYP6BD_fragment2 Linepithema humile (Argentine ant) Lh4BDseq1P 137aa

1 exon PSEUDOGENE FRAGMENT single exon, downstream from Lh4BDseq2P

on opposite strand, upstream from Lh4BDseq3

94% to Lh4BDseq3

MAILTN*IYLDIFLIFSSLLATLYLWIKWEHSYWQRRGIRSLPTHWFFGHFKDAILMRKPPGVVLGELYQQ

GNDEDVLGIYILFKPFLLVRNLELIKQIMIKDFNVFPNHHFVARSNADKMSGYNLFGIDNPEWKYLR(2)

 

>CYP6BD_fragment3 Linepithema humile (Argentine ant) Lh4BDseq2P 39aa

1 exon PSEUDOGENE FRAGMENT single exon, upstream from Lh4BDseq1P

100% to Lh4BDseq3 

(2)

TKMSPVFTSGKLKSLFLLMVESGELMGAHLRSQISNDSK(2)

 

>CYP6BD_fragment4 Linepithema humile (Argentine ant) Lh6BDseq2P 91aa

1 exon INCOMPLETE PSEUDOGENE single exon, frameshift insertion at 4631

62% to Lh4BDseq3

(2)

SKMSPVFTSGKLKSFFQLMQESGESMGNRDRFTDDSKVVSIALMDTFYKYTTNMVSSLAFGIWTNCFDTP

VPEFYKKCKFYIINTCRSIKF*

 

>CYP6EL2 Linepithema humile (Argentine ant) Lh6BDseq1i 439aa 4 exons

INCOMPLETE on C-term from aa 410, SEQUENCING ERROR モTヤ deleted at 195448

68% to CYP6EL1 = old CYP6BD5 Nasonia vitripennis, 45% to CYP6BD1 Apis mellifera 
96% to Lh6BDseq5P, 98% to Lh6BDseq3i

MQLNTPVFGVSNIRFTLYSCRGKLNYWKKRGVESLESDLIFGNFKDAILFRSAPGWHIGQLYKAARADAA

YVGFYIFHKPCLLLRDPNVIRQFMIRDFKNFSDRHFAGPSQKDSIGMRNLFGVKNPVWKYLRTKIAPTLT

RNKLRQMFPLMMEIGTPMMEYLEKQPAVRGNAKLVDVQELSYKYTTDLIASVAFGTKMDTFHHPNTEFSSGV(1)

YKYFHSFKRMVALVTVFFMPELVELIGTKILFDFSFARKVFWSAMENREKTGEKRGDFIDSLLQLKYGEQNPVYK(1)

FEGENLLHQSGTLFSGFESSSTCMSFTLMELANYPECQDLARQDINQAIAKHGWSYEAFNDMKYLDQVIA

EALRLHPPVSTIDRYTRQDYR(0)

ISGTDIIIEKGTPVFISLYGLGEDPKFWHAPEVFNPNRFAENNRDMSVYLPFGLGPRMCVG(1)

 

>CYP6EL3 Linepithema humile (Argentine ant) Lh6BDseq3i 389aa 5 exons

INCOMPLETE, missing 1st exon (N's)

, Using first alternate 4th exon, supported by isotig03125

98% to Lh6BDseq1i

SPLRWPSQKDSIGMRNLFGVKNPVWKYLRTKIAPTLTRNKLRQMFPLMMEIGTPMMEYLEKQPAVRGNAKL

VDVQELSYKYTTDLIASVAFGTKMDTFHNPNTEFSSGV(1)

YKYFHSFKRMVALVTVFFMPELVELIGTKILFDFSFARKVFWSAMENREKTGDKRGDFIDSLLQLKYGEQNPVYK(1)

FEGENLLHQSGTLFSGFESSSTCMSFTLMELANYPECQDLARQDINQAIAKHGWSYEAFNDMKYLDQVIA

EALRLHPPVSTIDRYTRQDYR(0)

ISGTDIIIEKGTPVFISLYGLGEDPKFWHAPEVFNPDRFAENNCDTSVYLPFGLGPRMCVG(1)

MKVGQLHAKVVLALLIHNYEIWQTQEHKSVLDSRSTLTAAGNGINLYFKKIVQ*

 

>CYP6EL4P Linepithema humile (Argentine ant) Lh6BDseq5P 433aa 4 exons

PSEUDOGENE? No start codon on N-term, missing last exon on C-term (N's)

, upstream from Lh6BDseq6

96% to Lh6BDseq1i

LCSVFQIYASLYSCRGKLNYWKKRGVESLEGDLIFGNFKDAILFRSAPGWHIGQLYKAARADAAYVGFYI

FHKPCLLLRDPDVIRQFMIHDFENFSDRHFAGPNQKDSIGMRNLFGVKNPVWKYLRTKIAPTLTRNKLRQ

MFPLMMEIGTPMMEYLEKQPAVRDNAKLVDAQELSYKYTTDLIASVALGTKMDTFHHPNTEFSSGV(1)

YKFFHSFKRMVALVTVFFMPELVELIGAKILFDSSFVRKVFWSAMENREKTGEKRGDFIDSLLQLKYGEQNPVYK(1)

FEGENLLHQSGTLFSGFESSSTCMSFTLMELANYPECQDLARQDINQAIAKHGWSYEAFNDMKYLDQVIA

EALRLHPPVSTIDRYTRQDYR(0)

ISGTDIIIEKGTPVFISLYGLGEDPKFWHAPEVFNPNRFAENNRDMSVYLPFGLGPRMCVG(1)

 

>CYP6EL5P Linepithema humile (Argentine ant) Lh6BDseq6P 207aa 2 exons

PSEUDOGENE?? Missing 200aa on C-term, GC donor on first intron, Downstream

from Lh6BDseq5i, upstream from Lh6BDseq7

88% to Lh6BDseq7

MQLNTPMFSVSNIRFTLYSCRGKLNYWKKRGVESLEGDLIFGNFKDAILFRSAPGWHIGQLYKAAWADAAYVG

FYIFHKPCLLLRDPDVIRQFMIHDFKNFSDRHFASSNQKDSIGMRNLFGVKNPVWKYLL(1)

YKFFHSFKRMVALVTVFFMPELVELIGAKILFDSSFVRKVFWSAMENREKTGEKRGDFIDSLLQLKYGEQNPVYS(1)

 

>CYP6EL6 Linepithema humile (Argentine ant) Lh6BDseq7 486aa 5 exons

Downstream from Lh6BDseq6P

92% to Lh6BDseq1i 

MQLNTPVFSVSNIRFTLYSCRGKLNYWKKRGVESLEGDLIFGNFKDAILFRSAPGWHIGQLYKAARADAAYV

GFYIFHKPCLLLRDPDVIKQFMIRDFKNFSDRHFAGPNQKDSIGMKNLFGVKNLVWKYLRTKIAPTLMRNKL

RQMFPLMMEIGTPMMEYLEKQPAVRGNAKLVDVQELSYKYTTDLIASVALGTKMDTFHHPNTEFSSGGIS(0)

RMIALVTVFFMPELVELIRAKILFDFSFVRKVFWSAMENREKTGEKRDDFIDSLLQLKYGEQNPVYK(1)

FEGENLLHQSGTFISGFETSGTCMSFTLMELANYPECQDLARQDINQAIAKHGWSYEAFNNMKYLNQVIA

EALRLHPPVSTIDRYTRQDYR(0)

ISGTDIIIEKGTPVFISLYGLGEDPKFWHAPEVFNPDRFAENNRNTSVYLPFGLGPRMCIG(1)

MKVGQLHAKIVLALLLHNYEIWQTQEHKSVLDPRSTFTAAANGINLYFKKIVR*

 

>CYP6EL_fragment1 Linepithema humile (Argentine ant) Lh6BDseq4i 61aa

1 exon INCOMPLETE single (alternate?)

 exon 4

93% to Lh6BDseq7

(0)

ISGTEIIIEKGTPVFISLYGLGEDPKFWHAPEVFNPDRFAENNRDTSAYLPFGLGPRMCVG(1)

 

>CYP6ES1 = old CYP6EM2 Linepithema humile (Argentine ant) Lh6BDseq9P 552aa

5 exons PSUEDOGENE 1 stop codon, downstream from Lh6BDseq10i, alternate first exon?

37% to Lh6AQseq5, 53% to CYP6BD4 Nasonia vitripennis

MNLSIVDIFIYCSTALVICISLFYAYAKYKLSYWSRRGVKTPPTHLIFGNFGDSLTLKKPPSEVLREIYNYADP

DDPYIGFYIFHKPMLLLRNHDVMKQIFIKDFDVFPNRRFGSANQRDALGLDSILSIQQPRWKYLRNKLTVALSG

QRLKNMFPLIIECGQPMLNFMKNLSMSSSNKTEVKELSGRYVTDIIASVIFGINATSFDEKKDAFWKNSN(2)

ILSIFAFAIVTFSFLEKD*TFVILKFAGLNIFYGFMRSMIMIMIFFIPEWIPLFGPTIKIYTNYFRKIFWDSMN

SREKSGYKRGDFIDFLLTLKNEEQDPIYSKDY(0)

RERLIKMLILLFCCINNLVLEFEGDHLLAQSASLLIAGIEATADAIAFALYNLARHPELQATLYDEIQTHISGK

ELTMDLITEMSFLDSVLIETLRLHPPLPIVDRIATRNYK(0)

LLSTGLIIEKDIPVYISINATNQDPKYFSNPHDFIPLRAETGNKKFYESLAFGLGQRSCIG(1)

QRLGLLIAKVALITILSNYILDYEPSKKDDKGIIHVFTYAADGLYVQLKKREKGA*

 

>CYP6ES_fragment1 old CYP6EM_fragment 1 Linepithema humile (Argentine ant)

Lh6BDseq10i 35aa 1 exon INCOMPLETE first exon only, upstream from Lh6BDseq9P

33% to Lh6BEseq3 N-term

MVLLKWFWLRISLCVIYVYMYIHIYNYSNKNKITH(0)

 

>CYP6BE2 Linepithema humile (Argentine ant) Lh6BEseq1 510aa 6 exons .

55% to CYP6BE1 Apis mellifera 

MFIELLEFLVIVISAVYIYYKYVLFNYWRKKGVFYVKPIVPAGNLTAFVTGKKSLG(1)

ELYLDVYVRYKGHRAFGMYSFFKPNLVIADLDLIRTVLIKEFESFHDRGTFCNEKIDPLSGNLFNLP

GKKWRNLRNKLIPTFTSAKIKQMFMTLKEHGRQLTQSVENEGRATDCIEMKDMFAR(2)

YSTDVIMSTAFGIEANCIKDPNSEFRRWGKQIFKENSFWIALFLFFPQFMNFFSVPTTNKNITQFFI

KMFRDNVNYRQTFNVVRHDFMNLLIQLMEKGYVEPDDKKDTTKDTINVSP(1)

TTNRITMLEATAQSYVFFLAGFETSSTTATFSLYELAQQQHIQDKVYNEIDKVLKKHGELTYDSVNE

MTYLHKVINE(1)

TLRKYPAVPILNRVCTKDINVPTTNIHVPKGTLISIPVFGVHRDPSIYPDPDKFDPERFNADEIAAR

HPYAYLPFGEGPRICIG(1)

ARFGYLQVKIVLVSLLSKFKFKLHPRTPVPLSFDERSPVLVAKGGVYFIIEQR*

 

>CYP6BE2-de2b Linepithema humile (Argentine ant) Lh6BEseq2P 38aa

1 exon PSEUDOGENE FRAGMENT single exon, upstream from Lh6BCseq1

66% to Lh6BEseq1 

(1)

RGTAMNEHVDPLSANLINLSGQRWRNLRTKLAPQLREQ(2)

 

>CYP6BE3 Linepithema humile (Argentine ant) Lh6BEseq3 510aa 6 exons

GC donor on fourth intron

81% to Lh6BEseq1, 54% to CYP6BE1 Apis mellifera 

MYMELLGFFIIAVSAVYIYYKYVLFNFWRKKGVFYVEPVVPAGNLTAYVTGRKSLG(1)

ELYLDAYIKYKNHRAFGMYSFFKPNLVITDLDLIRTVLTKEFPSFHDRGFFCNEKTDPLSGHLFSLP

GKKWRNLRFKLGPTFTPAKIKQMFTILKEFGRELTRCIDNKSQETDCIEMKDIFSR(2)

YSADVIMSTAFGIEANCIKDPNSEFRRWGKRVFEENSFWVALFVFMPQFMNFFSIPITDRGVTRFFT

KIFRENVNYRQTSNVVRHDFMNLLIQLMEKGYVEPDDEKDTNKDTVNVTP(1)

TMNRITMSEATAQSYIFYLAGFETSSTTATYCVYELAQHQHLQDKVRSEIDKVLEKHGELTYDAVNE

MTYLHKVVNE(1)

TLEKYPSVPVLNRICTKDINIPTTNIHVPKGTLISIPVFGVHRDPSIYPDPDKFDPERFNADEIATR

HPCAHLPFGEGPRNCIG(1)

ARFGYLQVKVGLVSLLSKFKFKLHPRTAIPLSYDERPFLLIPKGGVYFNIEPR*

 

>CYP6BE4P Linepithema humile (Argentine ant) Lh6ASseq4P 263aa 4 exons

PSEUDOGENE frameshift deletion at 5230, missing first and last exons,

4 in-frame stop codons, three unmatched introns, upstream from Lh6ASseq5P

92% to Lh6BEseq3 in parts

MGLFDVKKCGTEWKLYCIAELYLDAYVKYKNHRAGMYSFFKPNLVITDLDLIRTVLTKEFPSFHDRKFF

CNEKTDPLSGHLFSLPGKKWRKLRFKLGPTFTPIKIKQMFTILKEYGRELTR(2)

YSTDVIISTAFGIEANCIKDPNSEFRR*GKRVFEENSFWVALFV*CSNL*ISFPFLSLIEASHISLQKYF

GRM*IRQTSNVVRHDFINLLI*LMEKGY(9)

TLSKYPTVLVLNRVCTKD(9)

TDAISWSFSKRQISIRMSSRYLIRVESLGIK(9)

 

>CYP6BE5P Linepithema humile (Argentine ant) Lh6ASseq5P 59aa 1 exon

PSEUDOGENE single exon, frameshift insertion at 14883, downstream from Lh6ASseq4P

56% to Lh6ASseq15

(1)

SYIVPSGTIIFIPIKMIHRNPDWPNPEVFDPDRFFPENIQNLHPFSYLPFSAGSRNCIG(1)

 

>CYP6BE6 Linepithema humile (Argentine ant) Lh6BEseq4 511aa 6 exons

GC donor on first intron

72% to Lh6BEseq3, 59% to CYP6BE1 Apis

MLVAELIGILIVALSVVYIYYKYVLFNFWRKKGVFYVEPLVPAGNLTAFVTGKLSVD(1)

LSTGELFRDAYLKYKHHRAFGMYTFFKPNLVIADLDLIRTVLTKDFGSFHDRGMYCNEKIDPLSGHLFLLP

GKKWRNLRVKLTPTFTSGKIKQMFMILKECSEEFAKSLESKAQTKDCIEIKDIFAR(2)

YSTDIIMSAAFGIKSDCISQPDNEFRYWGKKVFEEKPFWNAILMFAPQVMDFFSIPFNDRGVSNFFTKMFR

DNVEYRQTHNVIRHDFMNLLIQLMEKGYVEPDDEKDINNESS(1)

TATKLTILEAAAQAYVFFLAGFETSSTTATYCLYELAQNQDLQNKVCKEIDEMLKKHGELNYNAVNDMTYLHKVINE(1)

TMRKYPPVPVLNRVCTKNIKLPTTNIHVPEGTLITIPVFGLHRDPSIYPDPDKFDPERFNADKVAARHPYA

YLPFGEGPRVCIG(1)

TRFGYIQTKVGLISLLSKFKFTLHPQTPVPLSFEEAPIVLTAKGGINLTIELR*

 

>CYP6BE7 Linepithema humile (Argentine ant) Lh6BEseq5P 510aa 6 exons

PSEUDOGENE, SEQUENCING ERRORS A deletion at 9608, 1 frameshift at  8729,

upstream from Lh6BEseq6i (alternate last exon?)

87% to Lh6BEseq1, 98% to partial seq Lh6BEseq6i, 52% to CYP6BE1 Apis

MFIELLEFLVIVISAVYIYYKYVLFNYWRKKGVFYVKPVVPAGNLTAFVTGKKSLG(1)

ELYLDVYVRYKDHRAFGMYSFFKPNLVIADLDLIRTVLIREFESFHDRGTFCNEKYDPLSGNLFNLS

GKKWKNMRSKLIPAFTSAKIKQMFMIMEKYGEQVTQSVENQGQATDCIEMKEIFAR(2)

YSTDVIMSTAFGIEANCMKDPNSEFRRRGKKVFEENSFWLALFYSCPQFMNFLSIPTTDKKITQFFT

KIFRENVNYRQTSNVVRHDFMNLLIQLIEKGYVEPDDEKDTSKNTVNVSP(1)

ATNRITMMEAAAQSYVFYLAGFETSSTTATYSLYELAQQQHIQDKVYNEIDKVLKKHGELTYDAVNE

MTYLHKVVNE(1)

TLRKYPTVPVLNRVCTKDINIPTTNIHVSKGTLISIPVLGVHRDPLIYPDPDKFDPERFNADEIAAR

HPYAYLPFGEGPRNCIG(1)

ARVGYLQVKIALVSLLSKFKFKLHPRTPVPLSFDERPLAFVPKGGVYFIIEQR*

 

>CYP6BE7-de6b Linepithema humile (Argentine ant) Lh4BEseq6i 53aa

1 exon INCOMPLETE Last exon only, possible alternate final exon for

Lh4BEseq5P. Downstream from Lh6BEseq5P

98% to partial seq Lh6BEseq5P

(1)

ARVGYLQVKIALVSLLSKFKFKLHPRTPVSLSFDERPLAFVPKGGVYFIIEQR*

 

>CYP6BE8 Linepithema humile (Argentine ant) Lh6BEseq7 515aa 6 exons

Odd heme-binding sequence

57% to Lh6BEseq4, 50% to CYP6BE1 Apis mellifera 

MLIEILVTIIITFLIFTYFYHKYVISNFWRKKNVFYVDPSAAKNYMAASFGQVALGN(2)

VISTGEFFRDVYLKYKDHHAFGMCMYFNPMLMVADLDFIRTVLTKDFSNFHDRGMFCDEKHDPLSCNLF

NLTGTKWKNLRIKMTPIFTPGKIKQQFPYINEISQRLVKYLEKEAQMKSTIEMKDLFER(2)

YTTDVIMSTVFGVNSDCIENPNNEFGHWKRRVIEPSQLRIVLSAYAAKIIKIWQFLSIPITPNDVTNYF

INLFQVNMENRKAHNIVKQDFLNLLIQLVDTGYIKSDDVKNTVDMSC(1)

IATEKLTMIEGAAQAFIFFIAGYETSATTASNCMYELAQNQDIQDKLRNEIDEIIKKHNGLSYDALNEM

TYLHKVINE(1)

TMRKYPPVPSIHRICTEDTIFPPNIQVSKGTAIIIPVFGLHRDPLIYPDPDKFDPDRFNAEEIAARHPY

AYLPFGEGPRICIA(1)

AKLGYLQTKIGIINVLSKYKFKLAPQTPVPLTFKSAPIVLRVKDDIHVIIEPR*

 

CYP9 family

 

>CYP9AS1 = old CYP9AQ1 Linepithema humile (Argentine ant) Lh9seq2 516aa

1 exon Upstream from Lh9seq3

89% to Lh9seq3 

MEFSTLLLTVLTAGACLYYFVLSKLSYFEQLKIPHVRPIPLLGNMAPCILRRVTMADNLLNIYNLFNDAKYF

GFFEFMQPKYVIRDPDLINSLAIKNFDYFCDHINFVNEELEPMASKNLFGLRGDHWREMRKLLSPSFTSSKM

KMMFELMCQCAKNFTDFLIAESGNIGKTYNMQDILPRYSNDVVATCAFGISVDSFKHPNNEFYLLGKKAMNF

ASPRVMFAFLMHRNFPKIANFFRIRMFSAEVDNFFKNVVTSTVKARDEQGIVRPDMIQLMMETRNKNHGPTF

DINEMTAQAFVFFLGGFDTVSRAMCFAVHEVAVNADIQNKLREEIEDVLRETDNKPTYEAINNMKYMDAIVN

EIMRIYPPAIFIDRVCVKEFELPPATPDGKPITLKPGDSILFPTYALHHDSKYYSQPEKFDPDRFLNGEVDN

SVYLPFGVGPRICIGNRFALMEAKIMLFYLLWHCDLEPDAKTRNPIVLDKKALAMTSENGFWLKVRARKSSV

STKKFLSNGQKI*

 

>CYP9AS2 = old CYP9AQ2 Linepithema humile (Argentine ant) Lh9seq3 507aa

1 exon Downstream from Lh9seq2, upstream from Lh9seq4

89% to Lh9seq2  

MEFSTLLLTVFTAVACLYYFVLSKLSYFERLKIPHLRPIPLLGNMLPLILQRVTMADNLLNTYNSFADAKYF

GFFEFMSPRYVIRDPDLINSIAIKNFDYFCDHNNFVNEKLEPMASRNLFGLRGDHWREMRKLLSPSFTSSKM

KTMFELICQCAKNFTNFLIAESGNTGKTYDMQDILPRYSNDVVATCAFGISVDSFKHPNNEFYLLGKKAMNF

ASPRVMFAFLMHRNFPKIANFFRIRMFSAEVDNFFKNVVTSTVKARDEQGIVRSDMIQLMMETRNKNHGPAF

DINEMTAQAFVFFLAGFDTVSKAMCFAVHEVAVNLDIQSKLREEIEDVLRETNNKPTYEAINGMKYLDAVVN

ETLRLYPPVIFLDRLCVKEFELPPATSDGKPTTLKPGDNIWLPTYALHHDSQYYSQPKKFDPDRFLNGEVDN

SVYLTFGIGPRICIGNRFALMEAKIMLFYLLWHCDLEPDAKTRNPIVLEKKSFAMTSENGLWLKVRARKSSISTK*

 

>CYP9AS3 = old CYP9AQ3 Linepithema humile (Argentine ant) Lh9seq4 507aa

1 exon Downstream from Lh9seq3, upstream from Lh9seq5

51% to CYP9AG3 Nasonia vitripennis, 48% to CYP9R1 Apis

MEFSTLLLTVLTAVVCLYYFVLSKLSYFERLKIPHFRPIPLLGNMAPFILRRVTMADNLLNIYNLFPDTKYF

GFFEFMQPIYVIRDPNLINSIAIKNFDYFCDHKGFINEELEPMASRNLFALRGDHWREMRKLLSPSFTSSKM

KAMFELMCQCAKNFTDFLIAESGNTGKTYDMEDMMPRYSNDVVATCAFGISVDSFKHPNNEFYLLGKKAMNF

ASPRVMFAFLMHRNFPKIANFFRIRIFSTEVDKFFKDVVTSTVKARDEQGIVRPDMIQLMMEARNNDHGPIF

DIDEMTAQAFVFFLAGFDTVSKAMCFAVHEVAVNPDIQSKLREEIEDVLRETNNKPTYEAINGMKYLDAVVN

ETLRLYPPAVFADRVCVKEFELPPVTPDEKPITLKPGDNIWFPVYALHHDSQYYSQPKKFDPDRFLNGEVDN

SVYLTFGIGPRNCIGNRFALMEAKIMLFYMLWHCNLEPDAKTRNPIVLDKKALAMTSENGFWLKVRARKSSVSTE*

 

>CYP9AS4 = old CYP9AQ4 Linepithema humile (Argentine ant) Lh9seq5 507aa

1 exon Downstream from Lh9seq4, upstream from Lh9seq6

74% to Lh9seq2

METSTLLLTILTAGICLYYFVLSKLFHYKRLKIPHTRPIPLLGNMASLIFQRESAPHSLRNMYNQFCDAKYY

CFYEFTTPTYIIRDPDLINMIAIKNFDSFCDRRNVVNEDIEPMAGRNLLGMRGDHWREMRKLLSPSFTSSKM

KMMFELMCHCAKNFIDFLTIESGKTGKTYDMLDILSRYANDVVATCAFGINVDSFKYPNNDFFLLGKEVINF

NSPRMLFAFLMHRNFPKIAKLFKLRMFSAKVDKFFKGVVTSTVKARDEQGIVRPDMIQLMMETRNKNHGATF

DINEMTAQAFIFFSAGFETVTKTMCFMAHEITVNPDVQRKLREEIDDVLKVTNGKPTYEAINGMKYLDAVVN

ETLRFYPPSFSTDRICVKEFVLPPATPDSEPLTLKPGDNVWFPIYALHHDSKYYPEPEKFDPDRFLNGKVDN

SVYIPFGIGPRLCIGNRFALMEAKIMLFHLLWHCDLELDIKTRNPLVFDKKTMVMMVEGGFWLKLRMRKSLIPVV*

 

>CYP9AS5 = old CYP9AQ5 Linepithema humile (Argentine ant) Lh9seq6 505aa

1 exon Downstream from Lh9seq5, upstream from Lh9seq7P

89% to Lh9seq46

MEISTLLLTILTASVCFYYFIVSKLSHFEQLKIPHVRPIPLLGNMVSYIFGHKSLMDNLGSISNLFPDAKYF

GFYEFMRPTYVIRDPDLINTIAIKHFDNFCDHLNFTNEEIEPMASKNLFGLRGDHWREMRKLLSPSFTSSKM

KMMFGLMCQCADNFANFLATESGSTGKTYDMKNVLSRYANDVVATCAFGISVDSFKHPKNEFFLLGKTLIFN

TWMSFVFLMHRNFPKISKFINLRMFGSKVDKFFKDVVTSTVKARDEQGIIRPDMIQLMMETRDKNHGPAFDI

DEMTAQAFVFFLGGFDTVSTIMSFAAHEVAVNPNIQSKLREEIDDVLKMTNGKPTYEAINNMKLLDAIIN

ETLRLYPPGFFIDRLCVKEFELPSATPNSKSVILKPGDNIWFPVFALHRDSKYYSQPEKFDPDRFLNDEVDN

SVYMPFGIGPRICIGNRFAIMETKIMLFYLLWHCDVEPDTKTTNPMVLNKRSFVVMPENGFWLKLRTRKSTVPVA*

 

>CYP9AS6 = old CYP9AQ6 Linepithema humile (Argentine ant) Lh9seq44 506aa

1 exon Head-to-head with Lh9seq45P

97% to Lh9seq47P 

MEFSTLLLIILTAGIFLYYFVLSKLSHFERLKIPHVRPVPYLGNLAPFIFRRVSLMDNLRDIYNLFPDAKYF

GFYEFMRPVYVIRDPDMINTIAIKNFDNFCDHNNFVNEEIEPMASRNLFGLRGDHWREMRKLLSPSFTASKM

KMMFELICQCAENFTNFLVIESGNTGKTYEMKDIVSRYANDVIATCAFGISVDSFKHPKNEFFLLGKTLNVG

GWQSFIFFMHRNFPKVAKFFGLRMFSTRIDNFFKEVVTSTVKARDEQGIIRPDMIQLMMETRDKNHGPVFDI

NEMTAQAFTFFLGGFDSVATVMCFAAHEIAVNRDVQNKLRKEVDDVLKETNGKPTYEAINGMKYMDAVVN

EVLRLYPLSAFLDRLCVKEFELPPATSDGEPVTVKPGDSIWFPSYAIQRDSKYYSQSEKFDPDRFLNSEMDN

SVYIPFGIGPRICIGNRFALMEIKIMLLYLLRRCDVEADVKTKNPMVLNKKTFIMNAEDGFWLKVRTRKSAASFAK*

 

>CYP9AS7P = old CYP9AQ7P Linepithema humile (Argentine ant) Lh9seq45P 61aa

1 exon PSEUDOGENE 60aa fragment on C-term, 3 stop codons, head-to-head with

Lh9seq44P, upstream from Lh9seq46

62% to Lh9seq6  

PSTDIGNRFALMEENIMLLYLLHYDLELKTRNPIVLNNKMFVVAKGGFLKLRGRKSTVTVA*

 

>CYP9AS8 = old CYP9AQ8 Linepithema humile (Argentine ant) Lh9seq46 503aa 1 exon

Downstream from Lh9seq45P

89% to Lh9seq6

METSTLLLTILTAGVCFYYFILSKLSHFERLKIPHIRPIPLLGNMVSYVFGHASLMDNLRNIYNLFPDAKYF

GFYEFMRPIYVIRDPDLINTITIKNFDNFCDHLNLTNEKIEPIASKNLFGLRGDHWREMRKLLSPSFTSSKM

KMMFGLMCQCAENFANFLITESGSTGKTYNMKDVLSKYANDVIATCAFGISVDSFKHPRNEFFLLGKTLNFG

TWMSFVFLMNRSFPKISQFINLRMFGLKVEKFFKDIVSSTVKTRDEQRIFRPDMIQLMMDTRDKNHGPTFDI

DEMTAQAFVFFLGGFDTVSTIMSFAAHEVAVNPDIQSKLREEIDDVLKMTNGKPTYEAINNMKYLDAVIN

ETLRVYPPGFFLDRLCVKEFELPSATPDSEPVILKPGDSIWVPVFALHRDSKYFSQPEKFDPDRFLNDEVDN

SVYMPFGIGPRICIGNRFALMEAKIMLFYLLWHCDVEPDIKTTNPMVLNKKSFVVMPENGFWLKLQTRKSAVT*

 

>CYP9AS9 = old CYP9AQ9 Linepithema humile (Argentine ant) Lh9seq47P 489aa

1 exon PSEUDOGENE Missing start codon, 3 stop codons

97% to Lh9seq44

LYYFVLSKLSHFERLKIPHVRPVPYLGNLAPFIFRRVSLMDNLRDIYNLFPDAKYFGFYEFMRPVYVIRDPD

MINTIAIKNFDNFCDHNNFVNEEIEPMASRNLFGLRGDHWREMRKLLSPSFTASKMKMMFELICQCAENFTN

FLVIESGNTGKTYEMKDIVSRYANDVIATCAFGISVDSFKHPKNEFFLLGKTLNVGGWQSFIFFMHRNFPKV

AKFFRTQNVYEDRHFFKEVVTSTVKARDEQGIIRPDMIQLMMETRDKNHGPVFDINEMTAQAFTFFLGGFDS

VATVMCFAAHEIAVNRDVQNKLRKEVDDVLKETNGKPTYEAINGMKYMDAVVNEVLRLYPLSAFLDRLCVKE

FELPPATSDGEPVTVKPGDSIWFPSYAIQRDSKYYSQSEKFDPDRFLNSEMDNSVYIPFGIGPRICIGNRFA

LMEIKIMLLYLLRRCDVEADVKTKNPMVLNKKTFIMNAEDGFWLKVRTRKSAASFAK*

 

>CYP9AS10P = old CYP9AQ10P Linepithema humile (Argentine ant) Lh9seq7P 322aa

1 exon PSEUDOGENE 1 frameshift, 3 stop codons, missing 180aa on N-term

88% to Lh9seq44

(2)

YANDVVAICAFGISVDSFKYPKNEFFLLDKTLNVGGWQSFTFFMNRNFPKVAKFFGLRMFSTRIDNFFKEVVTRT

VKARDEQGFIRPDMIQLMMETRDKNHGPVFDINEMTAVFIFFLGGFDSVATVIYFATHKIAVNRDIQNKLRKEVD

DVLKETNGKPTYETINGMKYMDAVVNKVLRFYPLAAFLDRLCVKEFELPPATSDGEPVTVKPGDSIFPSYAIQRD

SKYYSQSEKFDSDRFLNSEMDNSVYIPFGIGPRICIGNRFALMEIKIMLLYLLRRCDVEPDVRPKSHDIEQKTFI

MNAEDGFWLKVQTRKSAVPFTK*

 

>CYP9P6 Linepithema humile (Argentine ant) Lh9seq31 515aa 1 exon

Upstream from Lh9seq32

87% to Lh9seq32, 57% to CYP9P2 Apis mellifera, 55% to CYP9P1

MELYQLFLSPFALLLITLILIGVVKIVPHVNRAYFYWKKKDAPYLPLSWSSFTTGWKLFMRRISIVDYNNF

LYNYFPDAKYVGISSFSTPVILLRDPELIKDIMVKHFEHFPDHRSFVNEDVEPLFAKNVASLRGDRWKEMR

NTLSPSFTASKMKFMFELISKCSSDFVDYLVEHPEICLAIETKQAFRRYTTDVIATAAFGINVNSMKEQNN

EFYTRGVEVTTFSSGALALLKFTLLRFFPRFAKSLGISFFPSATSKFFKKIVGETIEVRQKHGIIRPDMIH

LLMQARDKENSHKITLDDIVSQAVVFFFAGFETSATLMCFVAHELAVNRDVQDRLREEVEQHLSEENDTIS

YESLSKMVYMDMVVSETLRKYPPATFTDRLCVKNYELPPSQSGYKSVTVESNAMMLIPVYGLHHDPKYFPN

PQKFDPERFSDENKDNIFPYTYLPFGHGPRKCIGNRFALMETKLLIAHLLRKFILKTTEKTVEPVVFDKKE

FTLKPVGGFWIGLEKRKI*

 

>CYP9P7 Linepithema humile (Argentine ant) Lh9seq32 515aa 1 exon

Downstream from Lh9seq31, upstream from Lh9seq33

87% to Lh9seq31, 57% to CYP9P1, 57% to CYP9P2

MELSQIFSSPFALLLTTLILIGVVKIVPYVNCAYSYWNKKGVPYLPDSWSSFIAGWKLFMGRMSFV

DYTNYIYNYFPDAKYVGISDFATPGILLRDPELIKDVMVKDFEHFPDHRSFVTEEVDPLFGKNVFS

LRGDRWKEMRNTLSPSFTASKMKFMFELISKCSSDFVDYLVEHPEICLAIEAKQAFRRYTNDVIAT

AAFGINVNSMKEQNNEFYTRGVEATTFSSGALALLKFTLLRFFPRLAKSIGVAFFPLATSKFFKKV

VGETIEAREKHGIIRPDMIHLLMQARDKENSHKMTLDDIVSQAFIFFFAGFDTSATLMCFVAHELA

VKSDIQDRLREEVEQHLSEEDDTISYESLSKMVYLDMVVSETLRKYPPVLILDRLCFKDYELPPSQ

PGYKGVTVKSNEVIMIPVYGLHHDPKYFPNPQNFDPERFSDENKDNIFPYTYLPFGHGPRKCIGNR

FALMETKLLIAHLLRKFIIKTTEKTVEPVVFDKKEFSLKPVSGFWIGLEKRKT*

 

>CYP9P8 Linepithema humile (Argentine ant) Lh9seq33 516aa 1 exon

Downstream from Lh9seq32, upstream from Lh9seq34

90% to Lh9seq37, 55% to CYP9P1

MTALFQLFSSPFALILTTLILIGVVKIVPYVNLAYFYWKKKGIPYLPDSWLSFITGWKLFTGHLSI

VEYNNFLYNYFPDAKYVGISDFATPTILLRDPELIKDIMVKDFEHFPDHRSFVDEEVDPLFAKNIF

ALRGDRWKEMRNTLSPSFTASKMKFMFELVSKCSSDFVDYLVEHPEICLAIETKQAFRRYTNDVIA

TAAFGINVNSMKDQNNEFYTRGAEATTFSSGILVMLKFMFLRLFPRLGNLFGLSFSPLAMSKFFKK

VVGETIEAREKHGIIRPDMIHLLLQARDKENSHKITLDDIVSQAVVFFFAGFDTSATLMCFIAHEL

AVNRDIQDRLREEVEQHLSVENDTISYESLSKMVYMDMVVSETLRKYPPAPTTDRLCVKDYELPPS

QPGYKSVTVKSNDVMMIPVYGLHHDPKYFPNPQKFDPERFSDENKDNIFPCTYLPFGHGPRKCIGN

RFALMETKLLIAHLLQKFILKTTEKTIEPVLFDKKEFALKPVGGFWIGLEKRKI*

 

>CYP9P9 Linepithema humile (Argentine ant) Lh9seq34 515aa 1 exon

Downstream from Lh9seq33, upstream from Lh9seq35

90% to Lh9seq36, 57% to CYP9P1

MELSQIFSSPFALLLTTLILIGVVKIVSYMNHAYFYWKKKGVPNLSNSWSFSIVGWKLFMGRISFV

DYSRYIYNYFPDAKYVGMMEFSTPGIFLRDPELIKDIMVKDFEHFPDHRSFVNEEVDPLFGKNVFS

LRGDRWKEMRNTLSPSFTASKMKFMFGLISKCSSDFVDYLVEHPEICLAIETKQAFRRYTNDVIAT

AAFGINVNSMKEQNNEFYTRGVEATTFFSGTLAMLKFMFLRLSPRLAKSLGISLLPLATSKFFKKV

VGETIEAREKHGIIRPDMIHLLMQARDKENSHKMTLDDIVSQAFTFFFAGFDTSATLMCFVAHELA

VNRDIQDRLREEVEQHLSEENDTISYESLSKMVYMDMVVSETLRKYPPVLFIDRLCVKNYELPPSQ

PGYKSITVESNSLVMIPAYSLHHDPKYFPNPQKFDPERFSDENKDNIFPYTYLPFGHGPRKCIGNR

FVLMETKLLIAHLLRKFILKTTEKTVEPVVFDKKEFTLKPVGGFWIGLEKRKL*

 

>CYP9P10 Linepithema humile (Argentine ant) Lh9seq35 516aa 1 exon

Downstream from Lh9seq34, upstream from Lh9seq36

92% to Lh9seq37, 55% to CYP9P1, 57% to CYP9P2

MVELPQLFSSSFALLLTTLFLIGVVKVVPYVNLAYFYWKKKGIPYLPDSWSSFIAGWKLFMGRMSL

ADYTNYLYNYFPDAKYVGMSDFATPTILLRDPELIKDITVKDFEHFPDHRSFVDEELDPLFGKNVF

SLRGDRWKEMRNTLSPSFTASKMKFMFELVSKCSFDFVDYLVEHPEICLAIETKQAFRRYTNDVIA

TAAFGINVNSMKEQNNEFYTRGAEATTFSSGFLVMLKFVFLRFFPRLGSLIGLSFFPSATSKFFKK

VVGETIETREKHGIIRPDMIHLLMQARDKESFRKMTLDDIVSQAFIFFFAGFESSATLMCFVAHEL

AVNRDIQDRLREEVEQHLSEENDTISYESLSKMAYMDMVVSEALRKYPPSPTTDRLCVKDYELPPS

QPGYKSVIVKSNDVMMISIYGLHHDPKYFPNPQKFDPERFSDENKDNIFPYTYLPFGHGPRKCIGN

RFALMETKLLIANLLRKFILKTTEKTVEPVVFDKKEFALKPMGGFWIGLEKRKI*

 

>CYP9P11 Linepithema humile (Argentine ant) Lh9seq36 515aa 1 exon

Downstream from Lh9seq35, upstream from Lh9seq37

90% to Lh9seq34, 56% to CYP9P1, 58% to CYP9P2

MELAQIFSSPFGLLLTTLILIGVVKIVSSVNHAYSYWRKKGVPYLPDSWSSSIVGWKLFMGRISFV

DYSRYIYNYFPDAKYVGMMEFSTPGILLRDPELIKDIMVKDFEHFPDHRSFVTEEVDPLFGKNVFS

LRGDRWKEMRNTLSPSFTASKMKFIYELISKCSSDFVDYLVEHPEICLTIETKQVFRRYTNDVIAT

AAFGIDVNSMKEQNNEFYTRGVEATAFFGGILAMLKIMFLRFFPRVSNLIGLSFFPSATSKFFKKI

VGETIEAREKHGIIRPDMIHLLMQALDKENSHKMTLDDIVSQAFIFFLAGFDTSATLMCFIAHELA

VNRDIQDRLREEVDQHFSEENDTISYESLSKMFYMDMVVSETLRKYPPALLIDRLCVKNYELPPSQ

PGYKNATVESNSLVMIPVYSLHHDPKYFPNPQKFDPERFSDENKDNIFPYTYLPFGHGPRKCIGNR

FALMETKLLIAHLLRKFIIKTTEKTVEPVVFDKKEFTLKPVGGFWIGLEKRKT*

 

>CYP9P12 Linepithema humile (Argentine ant) Lh9seq37 515aa 1 exon

Downstream from Lh9seq36, upstream from Lh9seq38

92% to Lh9seq35, 55% to CYP9P1

MELSQIFSSPFALLLNTLLLIGIVKIVPYVNLAYFYWKKKGIPYLPDSWSSFIAGWKLFTGHMSIV

DYSNYMYNYFSDAKYVGISEFATPVLLLRDPELIKDITVKDFEHFPDHRSFVDEEVEPLFAKNIFS

LRGDRWKEMRNTLSPCFTASKMKFMFELISKCSSDFVSYLVEHPEICLAIETKQAFRRYTNDVIAT

AAFGINVNSMKEQNNEFYTRGAEATTFSSGFLVMLKFMFLRFFPRLGSLIGLSFFPSATSKFFKKV

VGETIETREKHGIIRPDMIHLLMQARDKESSRKMTLDDIVSQAFIFFFAGFESSATLMCFVAHELA

VNRDIQDRLREEVEQHLSEENDTISYESLSKMVYMDMVVSEALRKYPPAPTLDRLCVKDYELPPSQ

PGYKSVTVKSNEVIMIPVYGLHHDPKYFPNPQKFDPERFSDENKDNIFPYTYLPFGHGPRKCIGNR

FALMETKLLIAHLLRKFILKTTEKTVEPVVFDKKEFALKPVGGFWISLEKRKT*

 

>CYP9P13 Linepithema humile (Argentine ant) Lh9seq38 514aa 1 exon

Downstream from Lh9seq37, upstream from Lh9seq39

88% to Lh9seq39, 54% to CYP9P1

MELPQLFLSPFALLLTTLFLIGIVKIVPYVNLAYFTWKKKGIPYLPDSWSSFIAGWKLFTGHLSIV

DYSNYIYNYFPDAKYVGISEFGGPAILLRDPEIIKDITVKSFEHFPDHRIFVDEEVEPLFCKNVFA

LRGDRWKEMRNTLSPSFTASKMKFMFELISKCSSDFVDYLVEHPEICLSIEAKQAFRRYTNDVIAT

AAFGINVNSMKDQNNEFYTRGVEASLFGGILVMLKIMFLRFYPRVSKLIGLSLFPSATSKFFKTIV

GETIEAREKHGIIRPDMIHLLMQARDKESSHKMTLDDIVSQAFIFFFAGFDTSATLMCFVAHELAV
NRDIQDRLREEVEQHLSEENDTISYESLSKMVYMDMVISETLRKYPPAPSIDRLCVRDYELPPSQP

GYKSIIVKSNDAMIIPVYGLHHDPKYFPNPQKFDPERFSDENKDNILPCTYLPFGHGPRKCIGNRF

VLMETKLLIARLLQKFILKTTEKTVEPVVFDKREFALKPVGGFWISLEKRKT*

 

>CYP9P14 Linepithema humile (Argentine ant) Lh9seq39 515aa 1 exon

Downstream from Lh9seq38

88% to Lh9seq38, 55% to CYP9P2 Apis mellifera, 54% to CYP9P1

MELPQLFSSPFALLLTTLFLIGIVKIVPYMNLAYFSWKKKGIPYLPNSWSSFIVGWKLFRGHLSIV

\DYSHYIYNYLPDAKYVGISEFAMPVILLRDPELIKDIMVKDFEHFPDHRSFVNEEVEPLFAKNIF

SLRGDRWKEMRNTLSPSFTASKMKFMFELISKCSSDFVDYLVEHPEICLAIETKQAFRRYTNDVIA

TTAFGINVNSMKEQNNEFYTRGVEATTFSVGILAMLKFIFLRFFPRFAKLLGLSFIPLATSKFFKK

VVGETIEAREKHGIIRPDMIHLLMQARDKENSHRMTLDDIVSQAFIFFFAGFDTSATLMCFVAHEL

AVNRDIQDRLRKELEQHLSEENDTISYESLSKMVYMDMVVSEALRKYPPVPSIDRLCFKDYELPPS

QPGYKSVTIKSNDVMTIPVYGLHHDPKYFPNPQKFDPERFSDENKDNIFPCTYLPFGHGPRKCIGN

RFALMETKLLIAHLVRKFILKTTEKTVEPVVFDKKEFALKPVGGFWIGLEKRKT*

 

>CYP9R2P Linepithema humile (Argentine ant) Lh9seq1P 324aa 1 exon

PSEUDOGENE 1 frameshift, missing 160aa on N-term and 20aa on C-term

83% to Lh9seq8

(2)

TNIVNLPSDKSLINIKNCFTRYTNDVIATCAFGISVDSMRNPDNKFYISGKETMSFNTMRAIKLYL

IRSMPFITKRLGIKLINDCIGRFLKNIIKNTIQTRDKQNIVRLDMLQLMMESRGKRSGKELTTEDM

ISQAFSFFFGGFDSVSTSMCFAAHEIAVNPNIQAKLREEIDQVLQTTNGNLTYEAVNEMQYLNAVN

ETLRLWPVAAFFDRICTQDFELLPALPGDKPFVAKTIPVCGLYRYSKYFERLNEFDPDRFLDQNKK

NMNEMAAYIPFGIGPRRCIGYRFALLEIKVIIFHLLARCELKPCAKTNQPVHIICVRIKN*

 

>CYP9R3 Linepithema humile (Argentine ant) Lh9seq8 507aa 1 exon

Upstream from Lh9seq9i

93% to Lh9seq9i 

METWILLSILAGTIAVYYCFLKDLNFFKKHGILHISPWPVLGNMGPVFLRQLSMVELVKKIYNLNQD

AKYVGFFDSTNPVVMIRDLDIIKSISVRNFEMFSDHRNFITEDSEPLIAKSLFLLRGEKWLNMRTLL

SPAFTPNKMKVMFKLMSDSGANFADFLVNLPSDKSVVDMKNCFTRYTNDVIATCAFGISVDSMRNPD

NEFYVFGKKAMSFETFRAIKFYIIRSMPLVSKLLKIKLINDRIGRFFKNIIKNTIQTRIEQNIVRPD

MLQLMMESRGKRPGNELTIEDMISQAFSFFFGGFDTVSTSMCFAAHEIAVNPNIQAKLREEVDQVLQ

TMNGNLTYEAVNRMQYLDAVINETLRLWPVTALFDRICTQDFELPPALPGDKPFVIKKGMSVWFPVC

GLHRDPKYFERPNEFDPDRFLDQNKKNMNMAAYIPFGIGPRKCIGYRFALLEIKVMVFHLLARCELK

PCAKTNQPIRLCKTSFDMQPEGGFWLKIEKRSNAYIKY*

 

>CYP9R4 Linepithema humile (Argentine ant) Lh9seq9i 459aa 1 exon

INCOMPLETE missing 40aa on C-term Ns, downstream from Lh9seq8

93% to Lh9seq8 

METWILLSILAGTIAVYYCFLKDLNFFKKHGILHISPWPVLGNMGPVFLRQLSMVELVRKIYNLNQD

AKYVGFFDSMNPVVVIRDLDIIKSISVTNFEKFSDHRNFITEDSEPLIAKSLFLLRGEKWHNMRTLL

SPAFTPNKMKVMFKLMSDSGANFADFLVNLPSDKSVVDMKNCFMRYANDVIATCAFGISVDSMRNPD

NEFYVFGKKAMSFETSRALKLYIIRSMPLVSKLLKIKLINDRIGRFFKNIIKNTIQTRDEQNIVRPD

MLQLMMESRGKRPGKELTIEDMISQAFSFFFGGFDTVSTSMCFVAHEIAINKKIQAKLQEEVDEVLQ

TTNGNLSFEELNNMQYLDAIVKETLRLWPVTALFERICTQQFKLPPALPGDKPFVIKKGMSVWFPVC

GLHRDPKYFERPNEFDPDRFLDQNKKNMNMAAYIPFGIGPRKCIGYRFALLEIKVMV

 

>CYP9R5 Linepithema humile (Argentine ant) Lh9seq10 514aa 1 exon

Upstream from Lh9seq11

53% to CYP9R1 Apis mellifera, 93% to Lh9seq42

MVYVIALSVLAGALGLYYFLLKNLNFFKKHEIPHFKPLPLLGNMAPSLFRRQSAVDLIKSIYDLNPD

AKYVGLYELNRPLIVIRDPELIKSITLKHFDTFMDHIGFFDETQDALLGKNLFSLRGERWRQIRSLL

SPAFTSSKMKSMFKLMSDCGAKFGNYLAQLPPEQRMMETKDAFTRYTNDVIATCAFGITVDSMRNPK

NEFYVYGKEASGFDSIILLKIYIFRTFPWLGRIFGLKIIREKIANFFRDLVEVTIKTRDENGIVRPD

MLQLMMDNRGKESKTELSIEDMVSQAFIFFFGGFDSTSTLMCFAAHEIAVNRNIQERLQTEIDQVLE

ETNGQVPYEAVNNMEYLDAVISETLRMYPVAAILDRICMKDFELPPTLPGKKPFTMKKGQGLWIPVY

GLHQDPKYFEEPEKFDPERFLGERKNESLHSEAYLPFGSGPRMCIGNRFALLETKVLLFHLLARCDL

KPCEKTPIPLKIAKDAFNMKPEGGFWLSVTPRQKPHKTVVINETH*

 

>CYP9R6 Linepithema humile (Argentine ant) Lh9seq11 505aa 1 exon

Downstream from Lh9seq10, upstream from Lh9seq12

57% to CYP9R1 Apis mellifera,

MVYIIALSVIAGALGIYYFLLKDLNFFKKHGIPHIKPLPVVGNMGPSLFRRQSVADLVKSIYDLNPDA

KYVGLYDLTTPLTVIRDPELIKSITLKHFDTFMDHIAFVEETQDPLFGKNLFSLRGERWRQIRFLLSP

AFTSSKMKNMFKLMSDCSAKFGNYLAQLPPEQKTMETKDAFTRYTSDVIATCAFGITVDSMRNPNNEF

YVYGKEATTFDSIALLKFYIFRSLPWLARVLRLRFIREKIANFFGDLVKDTIKTRDEKGIVRPDMLQL

MMDNRAKENKTELSIEDMVSQAFIFFFGGFETTSTLMCFAAHEIAVNRDIQERLQTEIDQVLEETNGQ

APYEAVNNMEYLDAVIYEALRRYPVVVALDRICMKDFELPPTLPGIKPHTIKKGQGIWIPVYGLHHDP

KYFEEPEKFDPERFLGERKNDSLHCGAYLPFGLGPRMCIGNRFALLETKVLLFHLLARCDLKSCEKTP

IPLKIAKDGFNMKPEGGFWLSVVPRQKPQ*

 

>CYP9R7 Linepithema humile (Argentine ant) Lh9seq12 514aa 1 exon

Downstream from Lh9seq11, upstream from Lh9seq13

57% to CYP9R1 Apis mellifera, 85% to Lh9seq42, 

MVYLIVLSVIAGALGIYYFLLKDLNIFKKHGIPHIKPLPLLGNSAPMLLRRQSPADFIKLIYNLNPDA

KYVGIYDLTKPTTVIRDPELIKSVTLKHFDTFMDHVGFVEETQDPLFGKNLFSLRGERWRQMRSLLSP

AFTSSKMKTMFKLMSDYGAKFGNYLAQLPPEQRTMETKNVFTRYTNDVIATCAFGVTVDSMRNPKNEF

YVYGKEATNFDGIVILKFFIFRIFPWLARILRLRLFREKMASFFRDLVKDTIKTRDEKGIVRPDMLQL

MMDNRGTESKTQLNIEDMVSQAFIFFFGGFESTSTLMCFAAHEIAMNRDIQERLQNEIDQVLEKTNGQ

APYEAVNNMEYLDAVINEALRIYPVSVALDRICIKDFELPPTLPGIKPYTIKKGQGIWIPVYGLHHDP

KYFEEPEKFDPERFLGERKNESLHCGAYLPFGSGPRMCIGNRFALLETKVLLFHLLARCDLKPCEKTP

IPLIIGKNPFNIQPEGGFWLSVTPRQKPHKTVVINETH*

 

>CYP9R8 Linepithema humile (Argentine ant) Lh9seq13 508aa 1 exon

Tail-to-tail with Lh9seq12, head-to-head with Lh9seq14

74% to Lh9seq15, 

MEYWSILLSIVIGALGIYCLFKNFNFFKRHGVIHIPLDTMLCIVVSVLFRRISFVDFMKKIYNFNPDA

KYFGFYAITTPFILLRDPELIKTVLIKNFDAFPNRRGFSELNELFAKNLFSLRGEKWRDVRNLLSPSF

TSSKLKTMFTLMSECAVDFVKFLSTLPTDKSDMDIKDAFTKYTNDVIATCAFGIKVDSMKDPANKFYI

YGKDATDFSGMRSIKFLLLTNFPRLGRILNLKLINDYVTNFFRDIIKTTIATRDAENITRPDMIQLMM

DIRGKEGRRELSIDDMTAQAFNFFFGGFETSSVAMSFAAHAIATNLDVQVKLREEIDKALEESNGEVT

YEVINQLEYLDAVINETLRLYSPVPFLERLCEKDYELPPALTGEKAFTVKKGMMLWIPVSSIHYDENY

YDNPDKFYPERFLNNKTHQNSLFYMPFGLGPRMCIANRFAVLEIKVLLFYLLARCELKPCGKTVLPLK

FSKKDIIITPEGGFWLNIQRRSDMHSALEPKN*

 

>CYP9R9 Linepithema humile (Argentine ant) Lh9seq14 512aa 1 exon

Head-to-head with Lh9seq13, tail-to-tail with Lh9seq15

83% to Lh9seq11, 48% to CYP9Q1 Apis, 57% to CYP9R1

MIYAIALSVIVGALGIYYYLFKDLNFYKKHGIPHAKPLPFLGNMGPSLFRRQSVAELVKWIYDLNPDA

KYVGMYDLTRPLTVIRDPELIKSITLKHFDTFPDHRAFIDETQDPLFGKNLVALRGKRWHEVRSILSP

AFTSSKMKSMFKLMSDYGANFSDYLAQMPSEKRKMEMKDVFTRYTNDVIATCAFGVTVDSMKNPKNEF

YVYGREATVFSALMFLKFYIFRSLPWLARILRLRFVREKIGNFFRDLVKDTIKTRDEKGIVRPDMLQL

MMESRGKEGKAALTIEDMVSQAFIFFFGGFESTSTLMCFAAHEIAVNQDVQERLQNEIDEVLEKTNGQ

APYEAVNSMEYLDAVINEALRMYPVGVALDRACVEDFELPPTLPGIKPFTLKKGDGIWIPVYGLHHDP

KYFEEPEKFDPERFLGERKNNSLHCGAYLPFGLGPRMCIGNRFALLETKVLLFHLLARCDLKPYEKTS

IPLKIAKDGFNMKPEGGFWLNVVPRKNPHHTITKKI*

 

>CYP9R10 Linepithema humile (Argentine ant) Lh9seq15 510aa 1 exon

Tail-to-tail with Lh9seq14, downstream from Lh9seq16

74% to Lh9seq13

MEYWSILLSIIIGALSIHYLFRNFNVFKRHGLLHIPPFPILGNMTSIIFRRVSFADFSLTLYNTYPDA

KYFGFYATTNPIILLRDPELIKTVLVKNFDAFPDRRGLRDLNEPLFANNLFSLHGEKWRNIRNLLSPS

FTSSKMKTMFTLMSECAADFVKFLSTLPTDKSDLDMKDAFTKYTNDVIATCAFGIKIDSMKDPTNKFY

VNGKEATNFLSGLRTIKFLFLRTFPKLGALLNIKLIDNYVSTFFKDIIQTTIDTRDAEHITRPDMIQL

MMDIRGKEGRRQLDIDDMVAQAFIFFFGGFDTSSTAMCFAAHEIAANPDVQAKLRQEIDNVLEESNGE

VTYEIINRLEYLDAVINEALRMYPPVAFLERLCDRDYELPPTLPGEKPFIMKKNMNFWIPVFSIHQDE

KYYENPKQFNPERFYNNKTYHNTSHYIPFGLGPRMCIANRFALLEVKVVLFYLLAKCELKPCKKTSLP

LKFSKTGLVMMPEGGFWLNIQGRKDVKVNNVSNS*

 

>CYP9R11 Linepithema humile (Argentine ant) Lh9seq16 516aa 1 exon

Downsteam from Lh9seq17, upstream from Lh9seq15

86% to Lh9seq18

METWILLSILAGTIAIYHYFFKGLNFFKKHGILHIPPWPVVSNLGPVFLRQLPLAELVGKVYNLNQDA

KYVGFFDGMNPVVVIRDPDIIKSISVKNFDMFPEHRSFIDEDSEPLFGKNLFSLRGEKWRDVRTLLSP

AFTSSKMKAMFKLMSDCGANFADFLVSLPSDKSITEMKDCFTRYTNDVIATCAFGISVDSMRNHDNEF

YVFGKEATTFGVLRTIKFYLIRSLPFTIKMFRIKLIDDHIVEFFKNLVRSTIQTRDEQNIVRPDMLQL

MMESRGKRGPGKELTIDDMTAQAFIFFFGGFETVSTLMCFAAHEIAVNPSVQAKLHDEIDQVLKTTNG

DLTYESVNGMQYLDAVINEALRLWPVQVFVDRLCVQDFELPPALPGDKSFVVKKGRSIWFPVYGLHRD

PKYFERPNEFDPNRFLDENKKNMNLAAYIPFGIGPRMCIGNRFALLETKVLIFHLLARCELKPCAKTT

HPMRLNKASFPMMAEGGFWLKIEKRSNTYIDTFANIVKDG*

 

>CYP9R12 Linepithema humile (Argentine ant) Lh9seq17 516aa 1 exon

Downstream from Lh9seq18, upstream from Lh9seq16

87% to Lh9seq16

METWILLFILAGTIAIYRYFFKDLNFFKKHGILHIPPWPVLGNMGPTFLRQLSLAELVEKIYNINQDA

KYVGFFDIMNPVVMIRDPDIIKSIGVKNFEMFPDHRTFIDENSDPLIGKNLFSLRGEKWRDVRTLLSP

AFTSSKMKVMFKLMSDCGANFADFLVSLPSDKSITEMKDCFTRYTNDVIATCAFGISVDSMRNPDNEF

YVNGKEATYFNILRAIKIYCIRSMPFITKMLGIKFINDRIGGFFKNLIKSTIQTRDEQNIVRPDMLQL

MMESRGKRGPGKDLTIEDITSQAFIFFLGGFDTVATLMCFAAHEIAVNPNVQAKLHDEVDQVLKATNG

DLTYESVNGMQYLDAVINETLRLWPVQVFVDRLCVQDFELPPALPGDKPFVIKKGMNVWFPVYGLHRD

LKYFERPNEFDPDRFLDENKKNINMAAYIPFGIGPRMCIGNRFALLETKVLIFHLLARCELKPCAKTT

YPMRLSKTSFVMQAEGGFWLKIEKRSNAYIDTFANIVKDG*

 

>CYP9R13 Linepithema humile (Argentine ant) Lh9seq18 524aa 1 exon

Upstream from Lh9seq17

86% to Lh9seq16

METWILLSILAGTIAIYHFFFKGLNFFKKHGILHIPPWPVVGNMGPAFLRQLSLAELVGKIYNLNQDA

KYVGFFDGMNPVVVIRDPDIIKSIGVKNFEMFPDHRSFIDEVNDPLFGKNLFSLRGEKWRDVRTLLSP

AFTSSKMKTMFQLMSDCGANFADFLVNLPSDKSIIEMKNCFTRYTNDVIATCAFGISVDSMRNPDNEF

YVYGKEATSFDTVRTIKFYLVRSMPYITKMLGLKFVNDHIGRFFKNLVRSMIQTRDEQNIVRPDMLQL

MMESRGKRGPGKELTIEDMTSQAFIFFFGGFDTVSTLMCFAVHEIAVNPNIQAKLRDEIDQVLKTTNG

DLTYEAVNGTQYLDAIINETLRVWPVAVFLDRICAQDFELPPALPGDKPFVIKKGRSVWFPVYGLHRD

SKYFERPNEFDPDRFLDENRKNMNMAAYIPFGLGPRMCIGNRFALLETKVMIFHLLARCELKPCAKTT

HPMRLNKASLTMLAEGGFWLKIEKRSNSYIDTLVKNVKNGVANGSTNK*

 

>CYP9R14 Linepithema humile (Argentine ant) Lh9seq40 518aa 1 exon

Upstream from Lh9seq41

50% to CYP9R1 Apis

MECWTIVLSILAGALAIYYYSSRKKSNDFQQHGIPHVEKPSLLKRLWMIFIFPKSFAQIIQEVYNLHSE

AKYIGLFDFTRLVVVIRDLELIKSVAIKNFDSFEDHLFFSSENQDPLFGKNLIALRGDQWRDVRALLSP

SFTSSKMKAMFQLASECAINFSDYLMNVPSEKRIMEMKDIFSRYTNDVIATCAFGINIDSMRNPENDFY

TYGKKASNFNTLAIIKILIYQHAPRLARLLNLKMLDEHTNAFFMNLVADSIKFRDENGITRPDMLQLLM

DSRDKREPGKELTIVDMTSQAFIFFLGGFDSSSTLLSFAAYEIGVKPKVQERLQNEIDQVLEDTNGQPT

YEAINGMAYLNAVINETLRMYPVQPMTDRLCVKDFELPAALPDAKPYLVKEGTILWIPFYGLQRDAKYF

PEPDKFKPERFLDENKKDQCNLNAYYPFGLGPRVCIGNRFALLETRIVLFHLLARCDLKPCEKTPIPLK

LKKGGFSTRAEGGCWLNIVPRENRYSNITDAKQQH*

 

>CYP9R15 Linepithema humile (Argentine ant) Lh9seq41 518aa 1 exon

Downstream from Lh9seq40, upstream from Lh9seq42

100% to Lh9seq40

MECWTIVLSILAGALAIYYYSSRKKSNDFQQHGIPHVEKPSLLKRLWMIFIFPKSFAQIIQEVYNLHSEA

KYIGLFDFTRLVVVIRDLELIKSVAIKNFDSFEDHLFFSSENQDPLFGKNLIALRGDQWRDVRALLSPSF

TSSKMKAMFQLASECAINFSDYLMNVPSEKRIMEMKDIFSRYTNDVIATCAFGINIDSMRNPENDFYTYG

KKASNFNTLAIIKILIYQHAPRLARLLNLKMLDEHTNAFFMNLVADSIKFRDENGITRPDMLQLLMDSRD

KREPGKELTIVDMTSQAFIFFLGGFDSSSTLLSFAAYEIGVKPKVQERLQNEIDQVLEDTNGQPTYEAIN

GMAYLNAVINETLRMYPVQPMTDRLCVKDFELPAALPDAKPYLVKEGTILWIPFYGLQRDAKYFPEPDKF

KPERFLDENKKDQCNLNAYYPFGLGPRVCIGNRFALLETRIVLFHLLARCDLKPCEKTPIPLKLKKGGFS

TRAEGGCWLNIVPRENRYSNITDAKQQH*

 

>CYP9R16 Linepithema humile (Argentine ant) Lh9seq42 514aa 1 exon

SEQUENCING ERROR T inserted at 3268, Downstream from Lh9seq41, upstream from Lh9seq43

93% to Lh9seq10, 53% to CYP9R1 Apis

MVYVIALSVLAGALGLYYFLLKNLNFFKKHEIPHFKPLPLLGNMAPSLFRRQSAVDLIKSIYDLNPDA

KYVGLYELNRPLIVIRDPELIKSITLKHFDTFMDHIGFFDETQDALLGKNLFSLRGERWRQIRSLLSP

AFTSSKMKSMFKLMSDCGAKFGNYLAQLPPEQKTMEMKDAFTRYTSDVIATCAFGITVDSMRNPKNEF

YVYGKEASGFDSIILLKIYIFRTFPWLGRIFGLKIIREKIANFFRDLVEVTIKTRDENGIVRPDMLQL

MMDNRGKESKTELSIEDMVSQAFIFVFGGFESTSTLMCFAAHEIAMNRDIQEKLQTEIDQVLEKTNGQ

APYEAVNNMEYLDAVINEALRIYPVSVALDRICMKDFELPPTLPGIKPYTIKKGQGIWIPVYGLHHDP

KYFEEPEKFDPERFLGERKNDSLHSGAYLPFGLGPRMCIGNRFALLETKILLFHLLARCNLKPCEKTP

IPLKIANDGFNMKPEGGFWLSVVPRQKPHNTVVINETH*

 

>CYP9R17 Linepithema humile (Argentine ant) Lh9seq43i 468aa 1 exon

INCOMPLETE missing 40aa on C-term, scaffold ends, downstream from Lh9seq42

92% to Lh9seq11, 56% to CYP9R1 Apis

MVYVIALSVIAGALGLYYFLLKDLNFFKKHGIPHVKPLPIFGNMAPSIFRRQSVADLVKSIYDLNPN

AKYVGMYDLTRPLTVIRDPELIKSVTLKHFDMFMDHLAFVEETQDPLFGKNLFSLRGERWRQMRSLL

SPAFTSSKMKNMFKLMSDCGAKFGNYLTQLPSEQKIIQTKDVFTRYTNDVIATCAFGVTVDSMRNPK

NEFYVYGKEATNFGGIALLKFYIFRSLPWLARVLRLRFIREKIANFFGDLVKDTIKTRDEKGIVRPD

MLQLMMDNRGTESKTELNIEDMVSQAFIFFFGGFESTSTLMCFAAHEIAVNRDIQEKLQTEIDQVLE

ETNGQAPYEAVNNMEYLDAVIYEALRRYPVVVALDRICMKDFELPPTLPGIKPHTIKKGQGIWIPVY

GLHHDPKYFEEPEKFDPERFLGERKNDSLHCGAYLPFGLGPRMCIGNRFALLETKVLLFHLLARCD

 

A block of pseudogenes

 

>CYP9R_fragment1 Linepithema humile (Argentine ant) Lh9seq19P 117aa 1 exon

PSUEDOGENE 4 stop codons, missing 45aa on N-term and 340aa on C-term, upstream from Lh9seq20P

67% to Lh9seq2

PSRRKL*AIVQLQLLRIYAEFMQSKYVIRDPDLISSIAIKNFDYFCDHERV*TKSINEECKLIISRNLFCLR

DNQWSEMRKLLSPSFTSSKI*MMFELMCE*AKNFTDYISVDYILCLWNI

 

>CYP9R_fragment2 Linepithema humile (Argentine ant) Lh9seq20P 68aa 1 exon

PSEUDOGENE 70aa fragment 320-390aa, downstream from Lh9seq19P, upstream from Lh9seq21P

100% to Lh9seq21P

NIQAKLQKEINEVLKATNGELTYEATNTMKYLNAIINETLRIWPVLAFVDRICVQDFELPPALPGDKP

 

>CYP9R_fragment3 Linepithema humile (Argentine ant) Lh9seq21P 68aa 1 exon

PSEUDOGENE 70aa fragment 320-390aa, downstream from Lh9seq20P, upstream from Lh9seq22P

100% to Lh9seq20P

NIQAKLQKEINEVLKATNGELTYEATNTMKYLNAIINETLRIWPVLAFVDRICVQDFELPPALPGDKP

 

>CYP9R_fragment4 Linepithema humile (Argentine ant) Lh9seq22P 67aa 1 exon

PSEUDOGENE 2 stop codons, 70aa fragment 310-380aa, downstream form Lh9seq21P,

upstream from Lh9seq23P

100% to Lh9seq25P in green region

CFAGHEIAINPNI*VKSHDEIDQVLKATNGELTYEAVNTMQY

FRCCCLKKHCEYGL*LHSFDRICVQDF

 

>CYP9R_fragment5 Linepithema humile (Argentine ant) Lh9seq23P 44aa 1 exon

PSEUDOGENE 50aa fragment, 200-250aa, downstream from Lh9seq22P, upstream from Lh9seq24P

100% to Lh9seq26P

QRKFYIFGKKSMSFNTIRAFKFYIIRSMPFVSKLLSIKLINDNI

 

>CYP9R_fragment6 Linepithema humile (Argentine ant) Lh9seq24P 78aa 1 exon

PSEUDOGENE frameshift 70aa fragment 320-390aa, downstream from Lh9seq23P,

upstream from Lh9seq24P

95% to Lh9seq20P 

FAAHEIGINSNIQAKLQKEIDEVLKATNGELTYEAINTMKYLNAIINETLRIRPVLAFVDRICVQDFELPPALPGDKP

 

>CYP9R_fragment7 Linepithema humile (Argentine ant) Lh9seq25P 78aa 1 exon

PSEUDOGENE 70aa fragment 320-390aa, downstream from Lh9seq24P, upstream from Lh9seq26P

77% to Lh9seq17

CFAGHEIAINPNI*VKSHDEIDQVLKATNGELTYEAVNTMQYLDAVVKETLRIWPVIAFVDRICVQDFELSSALPGDKP

 

>CYP9R_fragment8 Linepithema humile (Argentine ant) Lh9seq26P 44aa 1 exon

PSEUDOGENE 50aa fragment, 200-250aa, downstream from Lh9seq25P, upstream from Lh9seq24P

100% to Lh9seq20P

QRKFYIFGKKSMSFNTIRAFKFYIIRSMPFVSKLLSIKLINDNI

 

>CYP9R_fragment9 Linepithema humile (Argentine ant) Lh9seq27P 155aa 1 exon

PSEUDOGENE 150aa fragment, 1-150aa, directly upstream from Lh9seq28P

86% to Lh9seq29P

METWILLSILAGTIAIYHCFFKGLNFFKKHGILHISSWPVLGNMGPVFLRQLSMVKLRNLELRKIYNINQDAKYV

GFFESSANPVVVICDLDIIKSISVKIFEMFPDHRNFITEDNEPLIAKTLFLLRSEKWQNVRTLLSPAFTSSKMKVMFTTR

 

>CYP9R_fragment10 Linepithema humile (Argentine ant) Lh9seq28P 66aa 1 exon

PSEUDOGENE 75 aa fragmetnt, 1-75 aa, 5 stop codons, downstream from Lh9seq27P

88% to Lh9seq30P

VEETNIFGVLIYIIDFSNKLDH*QLAEKNWSHVTQNRPRWYVKNSMFLEKV*TLKETAVYSDGAS*DR**Y

 

>CYP9R_fragment11 Linepithema humile (Argentine ant) Lh9seq29P 147aa 1 exon

PSEUDOGENE 150aa fragment, 1-150aa, directly upstream from Lh9seq30P

86% to Lh9seq27P

METWILLSILAGTIAIYHCFFKGLNFFKKHGILHIPPWPVLGNVGPVFLRQLSMVELVRKIYNINQDAKYVGFFDS

TNLVVICDLDIIKFISVKNFEMFPDHRNFIAEDSEPLIAKTLFLLHSEKWRNVRTLLSPAFTSSKMKVMFT

 

>CYP9R_fragment12 Linepithema humile (Argentine ant) Lh9seq30P 71aa 1 exon

PSEUDOGENE 75 aa fragmetnt, 1-75 aa, 4 stop codons, downstream from Lh9seq29P

88% to Lh9seq28P

VEETNIFGVLIYIINFSN*YDH*QLAEKNWSHVTQNKPRWYVKNFMFLEKVYTLKETVVYSDGAS*DRQ*YSSFH

 

CYP336 family (there is only one 336 member in Apis)

 

>CYP336A2P Linepithema humile (Argentine ant) Lh336seq1P 91aa 1 exon

PSEUDOGENE 1 frameshift, 2 stop codons, short scaffold missing 420aa on N-term,

tail-to-tail with Lh336seq2P

84% to Lh336seq4 

(1)

HFFENKQSINFAFLPFGEGSRICPGMRIAVLQIKSGLTAFLGKYSLELSSKTKVSLEIIPGSILPSPIG

GLFIIRKLNNFVFHYQIFGSGS*

 

>CYP336A3P Linepithema humile (Argentine ant) Lh336seq2P 69aa 1 exon

PSEUDOGENE 3 stop codons, missing 420aa on N-term, tail-to-tail with Lh336seq1P,

head-to-head with Lh336seq3

75% to Lh336seq11P

(1)

LKRFNDNKLSIEKLTFLPFDKGSRIPIMRMALQIKAMLLRKYSLKFSAKTQVPLKVMSRSFLNSPFSSL*

 

>CYP336A4 Linepithema humile (Argentine ant) Lh336seq3 502aa 1 exon

Head-to-head with Lh336seq2P, upstream from Lh336seq4

87% to Lh336seq12, 50% to CYP336A1 Apis

MTIMLVSLILGAFAALYYYLTQNYKYWQKRGIPCADGALPGVGHMLPAICFRTSFPELFNKIYNDNKNRSMV

GFYNFTSPSLLVIEPQLVKTVLQTNFASFNKPIFPIDPDLDPLTALNPFALTGDKWLAARKRLTYAFSSMRL

KILLESVKPVCVLFENYLNNKLSKTEKIEVELKDLFSKFTAQVVAGAGFGVDGYCFNEEKENLSFQKIGAVI

LEPNLRTKIATMLIFLVPSLNKIFKISFVPKHVDNFFRTLVAELMEQRRKDAIPRNDFLHLMTELEKQDGIK

FDVELLTAQALSFVLDGYETSSTVMSLVGYQLAVHQEIQKKLREEVMSVFKKYDGEITYEGLKEMTYMDQVL

NESQRIIPTIGFQGRICTEEFELRGSDGLICRVQPNTEIRISIDGLHHDSRYWNNPEIFDPERFNSENKQNI

DRFAFLPFGEGPRICPGMRMALLQIKAGLATLLRKYSLELSPKTKLPLQMTPGVILASPKGGLWVKIRQL*

 

>CYP336A5 Linepithema humile (Argentine ant) Lh336seq4 502aa 1 exon

Downstream from Lh336seq3, upstream from Lh336seq6

74% to Lh336seq3, 50% to CYP336A1 Apis

MSIILISLILGALVALYFYLTQNFKYWQKRGIPCPNGAWPVVGHMLPVVCMRTTASEHIAKIYKDYKNQSLV

GFYNFSSPSLIVIEPELVKTVLQTNFASFNKNSFQADPDLDPLVAHNPFSLTGDKWLAARKRLTYAFSSMRL

KILLENVKPVCVLFENYLDSKISKTGKVELELKDLFSRFTAQVVANAGFGVDGYCFDDEKENVSFRKIGAAI

LEPNLRTKIVFTIIFVAPVLKKLLKLRFIPKHIDHFFRTLVAELIEQRRTDKIPRNDFLHLMVELEKLEGDK

FDLEIIASHALSFVVDGYETSSTVMSFVVYQLATHSEVQEKLREEIVSVLNKYNDEITYEGLKEMTYMDQIL

SETQRLTPAAGFLTKICTEEFELKGSDGLVCRVQPGTQVQICLDGLHNDPQYWSNPEIFDPERFTPENKQSI

NRFAFLPFGEGPRICPGMRMAVLQIKAGLAAFLRKYSLELSPKTKVPLEMIPGSILPSPIGGLWATIRKL*

 

>CYP336A6 Linepithema humile (Argentine ant) Lh336seq5 501aa 1 exon

Downstream from Lh336seq4

55% to Lh336seq6, 50% to CYP336A1 Apis, 40% to CYP336B1 Nasonia,
39% to CYP336C1 Nasonia 

MEIVILFLILVGIVAYYFYLVRNYNYWRDRGIPCARDVLPGFGHMWPVVSLKMSMHDLIRCIYDSHPNCSMV

GLYDKTVPALVVREPELVKTVMQTNFASFAENQLKLDSQLDPLLSLNPFFTAGNVWITSRKRFTHAFSGMRL

KLLFDCVERVCEKFENYLDRKLKSGALEVELKDLFSRYTGEVVADAAFGVEGFCFEDDIRRESFLTIGRSIF

EPSFLSKIVQTLNFFLPQFNRIFQMPFLPKEADRFFRDIVKQVLQHRQRESVRRNDFFQLMMDLEKSANNHY

DEEVLASHALGFFFDGYETSSITMSFIGYQLARHPQIVQKLRDEVESVLARYDNQLTYESLKEMTYMDQVIN

ESQRLYSALAIFGKICTEEIELKGSDGLSCRVRPGTLILMSVDGLHRDPKYWREPHIFDPDRFAADKKAEIT

KYTFLPFGEGPRICVGMRMGLLQMKACLATLVRKYTLELSPKTKEPLKMLPGSFLTAPVGGLWVNIKRL*

 

>CYP336A7 Linepithema humile (Argentine ant) Lh336seq6 502aa 1 exon

SEQUENCING ERROR A inserted at 19954, downstream from Lh336seq7

92% to Lh336seq7, 50% to CYP336A1 Apis

MAVTLVFLIFASLIVLYFYLTRNYKYWQKRGVPSAEDVFPGIGNMWDFFTMKTTFSENCRNIYNKYKGYSMV

GFYNFTMPTLMVLEPQLVKTVLQTNFASFHENTLKVDPDLDPLVANNPFFTYGEKWATGRKRLTYAFSSMRL

KMLLESVKQVCVTFEEYLNREVNKVAKLEVELKDLFSKFTAQVVTGAAFGVDGLCFDEERQSESFYSLGKAF

INPSLLNNIIFNIVFFLPSLGKIFKARFLPKKADHFFKSLVTEIFEQRRTDGVHRNDFLQLMAELERIEGNK

FDLDLLTSHAVSFFIDGYETSSTVLSFVGFQLASHPEVQKKLREEVLSVFARHDGVITYEGLKEMTYMDQVI

SESQRIIPTLGFQSRNCTEEFELKGSDGLVCRVQRGTPILIPVHGLQEDDRYWENPEVYDPDRFSPDSKHSI

EKFAFLPFGEGPRICPGMRMAQLEMKACLATLLRKYSLELSPKTQVPLKLTSSAFLNAPVGGLWAFIQPI*

 

>CYP336A8 Linepithema humile (Argentine ant) Lh336seq7 502aa 1 exon

Upstream from Lh336seq6, head-to-head with Lh336seq8

92% to Lh336seq6, 52% to CYP336A1 Apis

MAVTLVFLIFASLIVLYFYLTRNYKYWQKRGVPSPEDVFPGIGNMWDFFTMKTTFSENCRNIYNKYK

GYSMVGFYNFTMPTLMVLEPQLVKTVLQTNFASFHENTLKIDPDLDPLLANNPFFTYGEKWAIGRKR

LTYAFSSMRLKMLLESVKQVCVTFEDYLNRNLNKVAKKEVELKDLFSKFTAQVVSGAGFGVDGLCFD

EERQSESFYSLGKTFLDPSLLNNIIFNIVFFLPSLGKILRARFLPKKADHFFRSLVTEVFEQRRSDG

VRRNDFLQLMAELERMEGDKFDLGVLTSHAVSFFIDGYETSSNVLSFVGFQLASHPEVQKRLREEVL

SVFARHDGVITYEGLKEMTYMDQVISESQRIIPTLGFLTKVCTEDIELKGSDGLVCRVQRGTPILIP

VHGLQEDDRYWKNPEIYDPDRFSPDSKHSIEKFAFLPFGEGPRICPGMRMAQLQMKACLATLLRKYS

LELSPKTQVPLKMTASSFLSAAVGGLWAIIQPI*

 

>CYP336A9 Linepithema humile (Argentine ant) Lh336seq8 502aa 1 exon

Upstream form Lh336seq9, head-to-head with Lh336seq7

85% to Lh336seq12, 50% to CYP336A1 Apis

MTIVLVSLILGAFAILYYYLTHNYKYWQKRGIPCADGILPGIGHMLPAITLRTTFPEFLSKMYNDNKN

CSMVGFYSFTKPSLVVIEPQLVKTVLQANFSSFNRNVFQVDPDLDPLFALNPFNLIGEKWQAARKRLT

YAFSSMRLKILLESVKTVCVVFENYLDNKLKETRKIEVELKDLCSKFTAQVVAGAGFGVDGYCFNEEK

KDLSFQKVGTAILQPNLRTKIVMMLTFIAPSLNKILRVKAIPKHIDNFFRTLVAELIEQRRKDGKPRN

DFLHLMTELEKQEGTKFDLEVLTAHAMSFFIDGYETSSTVMSLVLYQLAVHQEIQKKLREEVMSVFEK

YNGEITYEGLKEMTYMDQVLCESQRIIPTVGFQSKMCTEEFELKGSDGLVCRVQPTTEIQIPVDGLHR

DPKYWNNPEIFDPDRFSPENKQSIDRFAFLPFGEGPRICPGMRMALLQIKAGLAVLLRKYSLELSPKT

KLPLKMIPGAILASPEGGLWVKIQQL*

 

>CYP336A10P Linepithema humile (Argentine ant) Lh336seq9P 59aa 1 exon

PSEUDOGENE 40aa fragment on N-term, 1 frameshift, 1 stop codon,

downstream from Lh336seq8, upstream from Lh336seq10P

83% to Lh336seq4 (first 35 aa)

MSIILLSLILGAFVALYFYLMQNFKYWQKRVPCPD

PGKDIFRRRHSTFLPVFVVPR*IEI

 

>CYP336A11P Linepithema humile (Argentine ant) Lh336seq10P 501aa 1 exon

PSEUDOGENE 1frameshift, 1 stop codon, downstream from Lh336seq9P, tail-to-tail with Lh336seq11P

49% to CYP336A1 Apis mellifera 

MTIVLVSLIFGAFAVLYYYLTQNYKYWQKRGIPCADGILPGIGYMLPAITLRTTFCEFLSKIYNDNKNCSMV

GFYNFTKPSLIVTEPQLVKTVLQTNFASFNRNVFVDPDLDPLIAINPFNIGEKWQAARKRLTYAFFSMRLKI

LLESVKTVCVVFENYLDNKLRETGKVEVELKDLCSKFTAQVVAGAGLGVDGYCFNEKKKDLSFQKIGALILE

PNLRSKIVIMLSFVAPSLKKIFKVSVVPKHIDNFFRTLVAELMEQRRKDGKPRNDFLHLMTELEKQKGTKFD

LEVLTVQAMSFVIDGYETSSTVMSLVLYQLAVHQEIQKNLREEVMSVFKKYNGEITYESRLKEMTYMDQVLN

ESQRIIPTAGFQSKICTEEFELRGSDGLVCRVQPKTEIQIPVHGLHHDPRYWNNPEIFDPDRFSPENKQSID

RFAFLPFGEGPRMCPAMRMAVLQIKAGLAAFLRKYSLELSPKTKVPLEIISGSILTSLKGGLWAVIRKL*

 

>CYP336A12P Linepithema humile (Argentine ant) Lh336seq11P 117aa 1 exon

PSEUDOGENE 120aa fragment on C-term, 11 stop codons, tail-to-tail with Lh336seq10P, head-to-head with Lh336seq12

61% to Lh336seq6 

ELKGSDELAFCVQHIIKFYLILIHGLQEDNYKNFEVFDLERFSDNKHGIEKLTCLPFDKGSRIPIMRMALQ

MKACLATLLRKYSLKLSAKTILLKMTSFFLNSPFNSLWDFIDIKIH*

 

>CYP336A13 Linepithema humile (Argentine ant) Lh336seq12 502aa 1 exon

Head-to-head with Lh336seq11P, upstream from Lh336seq13

87% to Lh336seq3, 50% to CYP336A1 Apis 

MTIMLVSLILGAFAALYYYLTQNYKYWQKRGIPCPDGALPGIGHMLPAITLRTTFSEFLRKMYNNNKNCSMV

GFYSFTKPSLIVIEPQLVKTVLQTNFASFNRNVFQVDPDLDPLVALNPFNLFDEKWQTARKRLTYAFSSMRL

KILLESVKPVCVLFENYLNNKLSKTEKVEVELKDLFAKFTAQVVAGAGFGVDGYCFNEEKKNLSFQKIGEVV

LEPSLRTKIATMLLFLVPSLNKIFKISFVPKHIDNFFRTLVAELMEQRRKDGKPRNDFLHLMTELEKQEGIK

FDVELLTAQAFSFVVDGYETSSIVMSLVGYQLAVHQEIQEKLRKEVMSVFKKYNDEITYEGLKEMTYMDQVL

NESQRIIPTAGFQSKICTEEFELRGSDGLVCRVQPSTEIQIPVHGLQHDPRYWNNPEVFDPERFNPENKQNI

DRFVFLPFGEGPRICPGMRMALLQIKAGLATLLRKYSLELSPKTKLPLKMIPGVILASPEGGLWVKIRQL*

 

>CYP336A14P Linepithema humile (Argentine ant) Lh336seq13P 429aa 2 exons

PSEUDOGENE missing 80aa on C-term, 2 frameshift, 3 stop codons, 1 bad intron, downstream from Lh336seq12

85% to Lh336seq4 

MCIVLISLILGAVVALYLYLTQNFKYWQKREIPCPDGALPVVSHMLSAVCLRTTVS*HFAKIYRNNKNHSMV

GFYNFSSPSLIVIEPELVKTLQTNFASFNKNSFQADPNLDPLVTHNLFSLT(9)

DKLAARKRLTYAFFSMRLKILLENVKLVCMLLENYLDSKISKTGKVELELKDLFSRFTALAVVNAGFGVDRY

CFDDEKKNVSFRKIGAAVVEPNLRIKIVFTILFVAPVLKKLLKLRFIPKHIDHFYRTLVAELIEQRRTDKIP

RNDFLYLMVELEKLEGDKFCLEIASHTLSFVVDGYETSSTVISFVVYQLATHSEVQEKLREEVVSVLNKYIG

KITYKGLKEITYMDQILNETQRLTSAAGFLTKVCTEEFELKGSDGLLCRVQLGTQIQICLDGLHNDSQYWSN

FKIFDTERFTPETLKKIFR*

 

 

CYP4 clan (57 sequences)

 

>CYP4G63 Linepithema humile (Argentine ant) Lh4Gseq2 555aa 8 exons .

51% to CYP4G11 honeybee, 59% to CYP4G44 Nasonia vitripennis

METIPETAWSFQSVAVSLLAVFVVIILAAYYYVETNRAVRIIKKLPQ(1)

PRPVPIIGHALYTLGLSPNNLVTELLKYWQKLGMVGGVYVGSKVFAFLGDPEDIEIILKSSVHIDKAMEYK(2)

LFEPWLGDGLLITKGDKWRRHRKIIAPTFHINILKTFVPLFYENSLALVRQLRDEIGKEFDCHDYLSAVTVDI

LTETVMGVKKEKGEKTGFDYALAVMK(2)

LSDILHRRHYNMLLRFEFIFKHTKLAKLQKKLIDLVHATTNRVIAKKTENIEKKLVEQQEDKSTDNLNTAENP

KDAQSNGSSYTKLHYARDDLDDIDENDVGEKKRLAFLEMMIEMKKNGGQMTDEEIREEVNTIMFE(0)

GHDTVAAGSSFTLCILGCHPDVQ(0)

ARVHEELDEIFGDSDRQCTFQDTLEMKYLERVILESLRLFPPVPVIARYLNEDVQIV(1)

TGNYILPKSTTVLIFPFGAHRAEKYYPNPSVFNPDNFLPENMQKRHSHAFIPFSAGPR(2)

SCVGRKYALLKLKVLLSTILRHYRIISDSFEETQLRGDIILKRDDGFKIKIEPRESIPCELR*

 

>CYP4G64 Linepithema humile (Argentine ant) Lh4Gseq3 550aa 8 exons .

54% to CYP4G11 honeybee

MDVVPETTSYLSTIIFSLLTVLVVTLLAAYYYIDTSRTIRLAKKLPG(1)

PPAVPIIGHALLSLGLTPDVFLTKAFAFAEQYGPVVSARLGLRVAIFLTEAQDIEVILSSSEHLDKSVEYQ(2)

LFKPWLGDGLLITTGDKWRKHRKAIAPTFHMNILKTFVPLFYENSIDLVNRLRDKVGTEFDCHDYLSAVTVDI

LTETAMGVRKERRPQTGFDYALAVMK(2)

LSDIVHRRHYDITLRSDITFQFTKLAKMQEKLLNTIHTLTNRVIYEKSNDVEEKSVRDQQQKENGTSKESLTE

KVDNANMTNYKLHYVRDDLDDIDENDVGEKKRLAFLEMMIEMRRNGEQMTDEEIKEEVNTIMFE(0)

GHDTTAAGSSFALCVLGCHPDIQ(0)

ARVHEELDSIFGDSDRQCTFHDTLEMKYLERVILETLRLFPPVPVIARKLNKDTKIV(1)

TGDYILPRGATIVIAQLLAHRSEKYYPNPLVFNPDNFLPEKMQQRHYYAYIPFSAGPR(2)

SCVGRKYAMLKLKVLLSTILRNYRVISDKSYTDFQLRADIILKREDGFKIKIEPRK*

 

>CYP4G65 Linepithema humile (Argentine ant) Lh4Gseq4 562aa 7 exons

SEQUENCING ERROR A missing at 188560, GC donor on third intron

79% to CYP4G11 honeybee

MSAAGPEIINGSAATVTSTGLSASTVFFCLLIPALVLYYIYFKISRRHMIELAEKIPGPDGLPLIGNALMLLGSSDT(1)

VFRTVYRKSFEFDHIIKLWLGPKLLVFLMDPRDVEIILSSHVYIDKSSEYRFFKPWLGNGLLISTG(1)

PKWRAHRKLIAPTFHLNVLKSFIDLFNANSRAVVEKLRKEGNKEFDIHDYMSECTVEILLETAMGVSKSTQDRSGFEYAMAVMK(2)

MCDILHLRHTKVWLRPNWLFNLTKYGKDQIRLLEIIHGLTKKVIARKKTEFKSGKRNVIDNATQNDTSKAAK(0)

NTSVEGLSFGQSAGLKDDLDVDDNDVGEKKRQAFLDLLMEAGQNGSILTDEEVKEQVDTIMFE(0)

GHDTTAAASSFFLSIMGCHPDIQEKVIQELDEIFGDSDRPVTFQDTLEMKYLERCLMETLRLFPPVPLIARKINTDLKLV(1)

SGDYIIPAGCTVVVTTFKMHRQPHLYPNPEVFNPDNFLPEKTANRHYYAFVPFSAGPRSCVGRKYAMLKLKIILSTVLRNF

RVKSDIKESDFRLQADIILKRAEGFKIKLEPRQSATASA*

 

>CYP4G66 Linepithema humile (Argentine ant) Lh4Gseq5i 232aa 4 exons .

87% to CYP4G62

MLRRNINRSRVVILIVAYYYIETSRAARLIKKLPH(1)

PPSVPIFGHALMPLGMFPNTLVIELLKVWDEYGLIASAYFDPRVLAFLGNPQDIKIILNSSVHINNSSQVLNVPLV(1)

SGNYILPKNATVIIVPLVVHRMEKYYPNTTAFNPDNFLPGNMQQRHSYAYIPFSAGSR(2)

SCVGRKYVMLKLKVLLSTIPRNYRVISDLSLEDFQLRGDIILKRKDGFKIKIEPRKPVPCELK*

 

>CYP4G67 = old CYP4G62 Linepithema humile (Argentine ant) Lh4Gseq1i 500aa 7 exons

INCOMPLETE can't find 1st exon, unmatched intron SEQUENCING ERROR A deleted at 833526, A deleted at 834313

62% to CYP4G44 Nasonia vitripennis

54% to CYP4G11 honeybee

 (1)

PPSVPIFGHALMPLGMSPNTLITELLKLWDEYRPIVSAYLGPRAFAFLGDPQDIKIILNSSVHINKSIEYK(2)

LFKPWLGDGLLISSGDKWRRHRKIIVSTFHINILKTFVPLFYENSIELVRRFRNEIGKEFDCHDYLSTTTVDI

LTETAMGVKKEKGEKTEFNYALAVMK(2)

LSDILHRRHYDPLLRLDFIFKFTKLAKMQKKLLNIVHTTTNRVIEKKSKNIEEKLVEYQQQTDKSADSLDTTE

DLEDAQSNISSYTKFHYARDDLDDIDENDVGEKRRLAFLEMMLEMKKNGGQMADEEIREEVNTIMFE(0)

GHDTTAAGSSFALCILGCHPDIQ(0)

AHVHEELDTIFGDSNRQCTFQDTLEMKYLERVILESLRLFPPVPAI(9)

SGNYILPKNATVIILPFVVHRMEKYYPNPTAFNPDNFLPENMQQRHSYAYIPFSAGPR(2)

SCVGRKYAMLKLKVLLSTILRNYRVISDLSLEDFQLRGDIILKREDGFKIKIEPRKLVSCELK*

 

>CYP4AA1 Linepithema humile (Argentine ant) Lh4AAseq1 471aa 5 exons .

62% to CYP4AA1 honeybee

MWTYLAFLAVIYVIYALKNYIRIIRFIFTLDGPKTVPILGNVNTVFEGNL(1)

IQRMTNEAQSYGRIFRVWLTLLPYVTLMEPEDIQVVLSSMKHTQKIYLYKLLDNFLGKGLITREVDK

WRIHRKILQPAFHLHVLERFVDTFGEYADRLVGKLLEKDGDDINVTVFVNNSVYDILIG(1)

XXXXXXXXXXXXXXXXXXXXX

GQVMVPYRFARPWLLIDWIYRLTAAGKSEERQQKDLFDFCFKKMKEKREFLRKNGSFVADNETSRKM

SLLEYMVEINEKNPCFTERDIIEECCTFMLAGQDSVGTGTAMTLFLLANNPKWQERCVEELNEIFSD

DNRSPTMQDLKEMKCLDMCIKESLRLYPSVPLFARTLGQDVRIG(1)

KHVIPAGCGVFILPYCTHRLPHHFPDPHDFKPERFSPENSEGRHPYAFIPFSAGPRNCIG(1)

YKFAMLEMKSIISTVLRKCRLEPVLGKEKVLARFRMTVRAHGGLWVKIRARDKRYES*

 

>CYP4AB28 Linepithema humile (Argentine ant) Lh4ABseq10i 416aa 10 exons

INCOMPLETE short scaffold missing 100aa on N-term, upstream from Lh4ABseq11i

60% to CYP4AB1 Solenopsis invicta (fire ant)

SDSDAFMHPWLGTGLLTSEG(1)

TKWHERRKMLTPAFHFDMLKQFVDIFIEEGNYMTQCLKDIKGSTVNDLISFTSRHTLNVICE(1)

TAMGISLKDMGEFQQQYRETVHDTNKLILAR(2)

LTSPWFYADVIFALSPMGRRQAKNLKILHGFTEK(0)

IIAERKQYHRNTNGQYLKQFENDSVNDDEEIIGI(1)

KRKRLAMLDLLIAAFYNNKISDLDIREEVDTFMFE(0)

GHDTVAVAISFTILLLAEHKNIQ(0)

ERVRSEVSAVMLENNEKLTMTALNNMPYLERCLKESMRLYPSVPNIFRVAFEDLKIQ(1)

SYIVPSGAILYIPVKSIHRNPDFWPNPDVFDPDRFLPENSQNRHPFSYLPFSAGPRNCIG(1)

QRFAMFELKAIIATLVHNFYLEPVDYLKDLRFRLDLLTRVSDPIRVKFISIEQMQAFKVN*

 

>CYP4AB29 Linepithema humile (Argentine ant) Lh4ABseq11i 164aa 3 exons

INCOMPLETE missing 350aa internally (N's?)

, downstream from Lh4ABseq10i, upstream from Lh4ABseq12

75% to Lh4ABseq26

MIITLLILCFVLLLLHDYFQRYGKFGQYINRIPGNTSLPIIGNG(9)

SYIVPSGALLHIPVKSIHRNPDFWPNPDVFDPDRFLPENSQNRHPFSYLPFSAGPRNCIG(1)

QRFAMFELKAIIATLVHNFYLEPVDYLKDLRFRLDLLTRVSDPICVKFIPIEQMQAFKVN*

 

>CYP4AB30 Linepithema humile (Argentine ant) Lh4ABseq12 508aa

12 exons downstream from Lh4ABseq11i

62% to CYP4AB1 Solenopsis invicta (fire ant)

MIISLLLFCIFIILLCHYAIHYGRFGQLINRIPGEPVLPLIGH(0)

DLWTYHREIGKKFYPIYRIWHVNIAYVSISHPDDVQ(0)

TILTNPKQHLGKGYIYTFLHPWLNTGLLTSEG(1)

IKWHKRRKILTPAFHFNVLKQFVDILIEEGNYMTQCLKDSKESTVNDLTSFTSNHTLNAICK(1)

TAMGTSLKEMGEFQQEYRHAVHQIGKIVIKR(2)

LMKIWIHSDVVFSFVPMGRMQAKCLKILHGFTEK(0)

IITERKQHHKSTNGQYLKQFENGSIIDDEE(0)

KKRLAMLDLLIAASQNNELSDLDIREEVDTFMFE(0)

GHDTVAIGTCFAILLIAEHKDIQ(0)

DRIRSEVSAVMQENDGKLTMAALNNMPYLERCLKESLRLYPSVPFISRVLSEDVKLQ(1)

SYLVPSKTVLFMPIYDIHRDPNFWPQPDVFDPDRFLPENSQNRHPFSYLPFSAGPRNCIG(1)

QRFAMLELKAVIAPLVYNFFLEPVDYLKDLRFIMDIVLRVAHPIRVKFVPIVRTESSEVSDSTNRN*

 

>CYP4AB31 Linepithema humile (Argentine ant) Lh4ABseq27 525aa

12 exons Upstream from Lh4ABseq21

63% to CYP4AB1 Solenopsis invicta (fire ant)

MIISILLLFFSILLMFNYYVHHGRSGRLINLIPGPKATPIFGNAFLFRGSHE(1)

EIWKRVRSLSDDFYPILKVWMFFIPSVLIRHPDHLE(0)

KILSNMKYITKSGLYDILHPWFGTGLLTSQG(1)

AKWQTRRKILTPAFHFNILQQFVDILIEESGRMVQSLKDVEGVVVKDLVPFMSEHTLNAICE(1)

TAMGTCLQGLGESQHRYRKAIYEIGELLVHR(2)

TVTPWIYLSATFELSPTAYRQRKVLKILHGFTEK(0)

IIAERKLYHEHTNNRYLKNFENYNIGKIDDTEVYGT(1)

RKKRLAMLDLLIAASKENNITDLDIREEVDTFMFE(0)

GHDTTAMAACFTLLLLAEHKDVQ(0)

ERIRTEIDTAIQEHGKKYTMTLLQNLPYLDRCLKESLRLYPSVHLISRVAPEDIKLD(1)

SYIIPAGTFIHINIYDVHRDPNFWPNPDVFDPDRFLPEKIRNRHFYSYVPFSAGPRNCIG(1)

QRFAMLEMKAIIAPLVHNFYLESVDKLKDVRLKSDLVLRPAHPLRVKFIPIERIKPCEATTNSSNVID*

 

>CYP4AB32 Linepithema humile (Argentine ant) Lh4ABseq21 525aa

12 exons Downstream from Lh4ABseq27, upstream from Lh4AB22

64% to CYP4AB1 Solenopsis invicta (fire ant)

MIISILLLFFFILLMYNYYVHHGRSGRLINLIPGPKVTPICGNAFLFQGSLE(1)

DIWKNWRSLSDDFYPITKFWMFFTPAVLIRHPDHVE(0)

KILSNVKYINKSYWYEILHPWFGTGLLTSQG(1)

AKWQTRRKILTPAFHFNILQQFVDILIEESGRMIQSLKDVEGTVVKDLVPFMSEHTLNAICE(1)

TAMGTSLQGLGESQHRYRKAVHEIGELLVRR(2)

MMRPWFNYTLVFELSPTGFLQRKILKILHGFTEK(0)

IITERKLYHERTNNQYLKSFEKYNIGEINGTEVYGT(1)

RRKRLAMLDLLIAASKENNITDLDIREEVDTFMFE(0)

GHDTTAMAACFTLLLLAEHKDVQ(0)

ERIRTEINTAIQENGKKYTMTLLQNLPYLDRCLKESLRLYPSVHLISRVAPEDIKLD(1)

SYIIPAGTFMHINIYDVHRDPNFWPNPDVFDPDRFLPEKIRNRHSYSYVPFSAGPRNCIG(1)

QRFAMLELKAIIAPLVHNFYLESVDYLKDVRFKSDLVIRPAHPVRVKFIPIDHIKSCEATTNSSKVTD*

 

>CYP4AB33 Linepithema humile (Argentine ant) Lh4ABseq22 525aa

12 exons Downstream from Lh4AB21, upstream from Lh4AB23P

63% to CYP4AB1 Solenopsis invicta (fire ant)

MIISILLLFFFILLMYNYYVHHGRSGRLINLIPGPKVTPIFGNAFSFQGSHE(1)

ELWKNWRSLTNDFYPITKLWMFFTPAVLIRHPDHLE(0)

KILSNVKYINKSRMYEILHPWFGTGLLTSQG(1)

AKWQTRRKILTPAFHFNILQQFVDILIEESGRMIQSLKDVEGTVVKDLVPFMSEHTLNAICE(1)

TAMGTSLQGLGESQHRYRKAVYEIGELFVRR(2)

MMRPWFYYTPVFELSPTGFRQRKVLKILHEFTEK(0)

IIAERKLYHERTNNRYLKNFENYNTGEIDGTEVYET(1)

RKKRLAMLDLLIAVSKENNITDLDIREEVDTFMFE(0)

GHDTSAMAACFTLLLLAEHKDVQ(0)

ERIRTEIDTAIQGNGKKYTMTLLQNLPYLDRCLKESLRLYPSVHLISRVASEDIKLD(1)

SYIIPAGTFIHINIYDVHRDPNFWPNPDVFDPDRFLPEKIRNRHFYSYVPFSAGPRNCIG(1)

QRFAMLELKAIIAPLVHNFYLESVDYLKDVRFKSDLVIRPAHPVRVKFIPIDRIKSCDATTNSSKVTD*

 

>CYP4AB34Pv1 Linepithema humile (Argentine ant) Lh4ABseq23P 147aa 4 exons

PSEUDOGENE 1 stop codon, 2 frameshift, 1 unmatched intron,

missing 300aa on N-term, downstream from Lh4AB22, upstream from Lh4AB24i

100% to Lh4ABseq24i 

(1)

HDTSAIAISFTLLLLTEHKDVQVLFDIQESYKSY(1)

HFILQTATKDVKLDC(2)

DSNF*PNADVFNPDRFLPDKNHHPYSYLPFSAGPRNCIG(1)

LKAIIAPLVHNFYLESQLIIKRSLKNDLVLRPVHPVRVKFIPIDRNKSCEATTNSSNVTS*

 

>CYP4AB34Pv2 Linepithema humile (Argentine ant) Lh4ABseq24i 147aa

4 exons INCOMPLETE can't find 1st exon, downstream from Lh4ABseq23P,

upstream form Lh4ABseq25P

100% to Lh4ABseq24i 

 (1)

HDTSAIAISFTLLLLTEHKDVQVLFDIQESYKSY(1)

HFILQTATKDVKLDC(2)

DSNF*PNADVFNPDRFLPDKNHHPYSYLPFSAGPRNCIG(1)

LKAIIAPLVHNFYLESQLIIKRSLKNDLVLRPVHPVRVKFIPIDRNKSCEATTNSSNVTS*

 

>CYP4AB35P Linepithema humile (Argentine ant) Lh4ABseq25P 521aa

12 exons GC donor on first intron, 1 frameshift 9425,

downstream from Lh4AB24i, upstream from Lh4ABseq26

58% to CYP4AB1 Solenopsis invicta (fire ant)

MIIISLLLCIVLILLCHYLIHYGRFWQLIDKIPGAPSLLLLGNSFLWYTRSLE(1)

QQLKTLEKYMNIYYPVAKIWVFHSAAVFVGHPDDVE(0)

TILSNSKEHTGKGFIYTFIQPWLGTGLLTSDG(1)

CYLISITGTKWHERRKMLTPAFHFNILKQFVNILIEEGNHMSQCLKDNKELIVNDLLSFISHHTLNTICE(1)

TAMGISIKDMGEFQQQYRKAVHETNQIIIAR(2)

FARPWLYPDVIFALSSLGRRQAKNLKILHGFTEK(0)

IIAEKKQFHKSTDGQYLKQFQNDSVNDDEDIIGV(1)

RRKRLAMLDLLIAASYNNKMSDLDIREEVDTFMFE(0)

GHDTVAVSTCFTILLLAEHKTIQ(0)

DRVRREVNAVMLEENGKLTMTALNNMPYLERCLKESLRLYPSVPNIVRVASEDVKIQ(1)

SYIVPSGTSLYVPIKTIHRHPDLWPNPDVFDPDRFLPENSQNRHPFSYLPFSAGPRNCIG(1)

QRFAMFELKAIIAPLLHNFYLEPVDYLKNFRFRLDLITRVVHPIRVKFIPIENAAI*

 

>CYP4AB36 Linepithema humile (Argentine ant) Lh4ABseq26 512aa

12 exons downstream from Lh4ABseq25P

60% to CYP4AB1 Solenopsis invicta (fire ant)

MIITLLILCFVLLLLYDYFQRYGKFGQYINRIPGNTSLPIIGNGLEIFARPLGK(2)

KYYDKLSNTYYPIFKFWLFHLAFIGIRHPDDVE(0)

IILSNSKQHLQKGFLYTFLYPWLRTGLLTSEG(1)

AKWHKRRKILTPAFHFNMLKQFVDVFIEEGNYMTQCLKGNEELIVNDLISFVSQHTLNAICE(1)

TAMGTSLKNVGEFQQQYREAVHEMGKFISKR(2)

VLRPWYYPDMIFSFSSMGRMQAKCLKILHGFTEK(0)

IIAERKQYHESTNRRYLKQFENDSINNDEE(0)

YVLYVSDRKKRLAMLDLLIAAHYNNELNDLDIREEVDTFMFE(0)

GHDTVAMGMTFAILLLAEHKDIQ(0)

DRVRSEVNAVMKENDGKLTMSALNNMPYLERCLKESLRLYPSVPIITRVISEDVKLQ(1)

SYMVPSGAILHISIKNVQRDPNFWPNPDVFDPDRFLPENCQNRHPFSYIPFSAGSRNCIG(1)

QRFAMFELKALIAPLVHNFYFEPIDYLKDLQLPMDIILRVEHPIRLKFIPIKYI*

 

>CYP4AB37P Linepithema humile (Argentine ant) Lh4ABseq2P 126aa

2 exons PSEUDOGENE FRAGMENT missing 400aa on N-term,

multiple in-frame stop codons, missing 'G' in heme binding sequence

77% to Lh4ABseq22 

(1)

SYRIPAGTFIHINIYSVHRKPNF*PNPDVFNPDRFLLEKIQNRHLYSYLLFSARPRNCIC(1)

QQFAMLELKAIITSLVQNFYLESVDYLKDLMKDDIVLRPAHSIRVKFIPIGRIKSCKATTHSSNVTS*

 

>CYP4AB38 Linepithema humile (Argentine ant) Lh4ABseq3 484aa 11 exons

SEQUENCING ERROR A inserted at 374555, GC donor on first intron, downstream from Lh4ABseq2

49%-59% to CYP4AB1 Solenopsis invicta (fire ant)

MVITLLYSLLLCIFLILLCHYLIHHGRFWQLFDQIPGPPALPLIGNTLLYCTSSLE(1)

DILNIQEKLSKEYKNIFKMWSFTIGAVSITNPDDAQ(0)

TILTNPKEHIGKGFVYTLLNPWLGTGLLTSDG(1)

TKWHKRRKMLTPAFHFNMLKQYVNILIEEGNYMVQCLKDIEGSTINDLISFISHHTLNTICE(1)

TAMGISMKDMGEFQEQYRTAVHEGSKMILDR(2)

LTQPWLYSDTIFAFSPLGRRQAKNLKILHGFTEK(0)

IIAQRKQYHKNIDGQYLKQFENDALNDDEIIGG(1)

(0)

GHDTVAMSICFTILLLAEHKNIQ(0)

DRVRSEISAVMLRNNGKLNMAALNDMPYLERCLKESLRLYPSVPNIARVASEDVKLQ(1)

SYIVPAGTLIITAIKLIHRNPDFWPNPDVFDPDRFLPENIKNRHPFSYLPFSAGSRNCIG(1)

LRFAMMELKAIIAPLVYNFYLEPVDRLKDFRFRFDLINRVVHPIRVKFIPIEQMQPFEAN*

 

>CYP4AB39P Linepithema humile (Argentine ant) Lh4ABseq20P 454aa 11 exons

PSEUDOGENE 1 stop codon, missing 1st exon, unmatches splice, frame shift last exon

(1)

58% to CYP4AB1 Solenopsis invicta (fire ant)

DQLKTLEKYLKIYYPIAKVWSFHLAAVLVGHPDDVE(0)

RVLSNSKEHFGKGFAYTFAHPWLGTGLLTSEG(1)

TK*HERRQMLTPTFYFNILKQFVNILIEESNHMIQCLKDNNEFIVNDLQSFISHHTLNIICE(1)

TAMGTSMKDMGEFQQQYRKAVHESGKLIIAR(2)

LTRPWLYPDVTFALSSLGRKQAKNLKILHGFSEK(0)

IIAERKQYHKSTGGQYLKQFENDLVNNDEEKIGV(1)

RRRRLTMLDLLIAASHNNKMSDLDIREEVDTFMYA(0)

GHDTVSLSLCFTILLLAEHKNM(9)

DRVRSEVNAVMLENNGKLTITALNNMSYLERCLKESLRLYPSAPFILRVASEDVKIQ(1)

SYMVPSGTLLFIPIKFIQRYSDFWPNPDIFDPDRFLPENSQNRHSFSYLPFSAGPRSCIG(1)

QRFAMMELKTIIATLVHNFYLEPVDYLKDLRFQVDIVNRVMDPIRVKFIPIE*

 

>CYP4AB40 Linepithema humile (Argentine ant) Lh4ABseq8i 254aa 6 exons

INCOMPLETE short scaffold missing 200aa on C-term, head to head with Lh4ABseq7P

86% to Lh4ABseq5i

MEIIDCSPLIIMQISYYFLKFEFPEEQLKILEKYLKIYHPVAKVWTFNIAGVLASHPDDVQ(0)

TILSNSKQHIGKRYAYTFLYPWLGTGLLTSEG(1)

TKWHERRKMLTPAFHFNMLKQFVDIFIEEGNYMTQCLKDIEGSTVNDLIFFTSHYTLNVICE(1)

TAMGISLKDMGEFQQQYRKAVHEITKLIMAR(2)

GTNPLFYPNVIFAFSSLCRRQAKVLKILHGFTEK(0)

IIAERKQYHKSTNGQYLKQFENNSVNDDEEIIGS(1)

 

>CYP4AB41P Linepithema humile (Argentine ant) Lh4ABseq7P 151aa 2 exons

PSEUDOGENE FRAGMENT missing 400aa on N-term, 2 in frame stop codons,

2 frameshifts, head to head with Lh4ABseq8i

87% to Lh4ABseq13a

(2)

NQDFWSSPDVFDPDRFLPENIQNHHTFFY*PFSAGSRNCIIIFRNQDF*PNPEVFNPDRFLPENIQNRRTFSYLPFSAGSRNCIG(1)

QRFAMMELKIIIASLIHNFYLEIDGPIDYLKDLQFTLDIVNRVARPIRAKFIAIKFKYILSNTNVSGT*

 

>CYP4AB_fragment1 Linepithema humile (Argentine ant) Lh4ABseq13a 151aa 3 exons

INCOMPLETE PSEUDOGNE short scaffold missing 350aa on N-term, 1 in-frame stop codon,

completed on reverse strand Lh4ABseq13b

87% to Lh4ABseq7P

(2)

NQDFWPNPDVFDPDRFLPKNTQNRHTFSYLPFSAGSRNCIG(9)

VIFRNQNFWPNPEVFDPDRFLPKNIQNRHTFFYLPFSAGSRNCIG(1)

QRFAMMELKIIIASLIHNFYLEPIDYLKDLQFALDTVNRVARPIRAKFIAIKFKYILSNTNVSGT*

 

>CYP4AB_fragment2 Linepithema humile (Argentine ant) Lh4ABseq13b 75aa 2 exons 
INCOMPLETE PSEUDOGNE short scaffold missing 350aa on N-term, 1 in-frame stop codon, 
continuation of Lh4ABseq14a on opposite strand, repeated exon, 70% to Lh4ABseq20P 

(0)

DRVRSEINAVMQENNGKLITTALNSMSYL*RCLKESLRLYPSTPYIVQVSCKNIKLQ(1)

SYILPSGTIILIPIKMIHN(1)

 

>CYP4AB_fragment3 Linepithema humile (Argentine ant) Lh4ABseq15i 120aa 2 exons

INCOMPLETE short scaffold missing 400aa on N-term

95% to Lh4ABseq6i

(1)

SYIVPSGTILHIPIKFIHRNSDFWPNPDVFDPDRFLPENIQNRHSFSYLPFSAGARNCIG(1)

QRFAMLELKAIIATLVHNFYLEPIDYLKDLQFRLDLVTRVADPIRVKFIPIEQMQPFKAN*

 

>CYP4AB_fragment4 Linepithema humile (Argentine ant) Lh4ABseq16i 80aa 2 exons

INCOMPLETE short scaffold missing 300aa on N-term, 100aa on C-term

82% to Lh4ABseq10i 

(0)

GYETTAISISFTILLLAEHKNIQ(0)

DRVRKEVSAVMLENNGKLTMTAINNMPYLERCLKESLRLYPSLPNIMRVASEDLKIR(1)

 

 

>CYP4AB_fragment5 Linepithema humile (Argentine ant) Lh4ABseq17i 155aa 3 exons

INCOMPLETE short scaffold missing 250aa on N-term and internal exon (N's)

83% to Lh4ABseq25P

(1)

KRKRLALLDLLIAASLNNKMSDLDIREEVDTFVFG(0)

SYIVPSGALLYIPVKFIHKNPDFWPNPDVFDPDRFLPENIQNRHPFSYLPFSAGARNCIG(1)

QRFAMLELKAIIATLVHNFYLEPVDYLKDLRFRLDLVTRVADPIRVKFIPIEQMQPFKAN*

 

>CYP4AB_fragment6 Linepithema humile (Argentine ant) Lh4ABseq18i 139aa 3 exons

INCOMPLETE short scaffold missing 300aa on C-term, SEQUENCING ERROR

missing ?? at 482, GC donor on first intron

72% to Lh4ABseq3 

MIITLMLLCIFLILLCHYLIHHGRFWQLIDQIPGPPAFLLIGNTLMWCCSSLE(1)

HVRKGFIYTFIYPWLGTGVFTSEA(1)

TKWRKRRKMLTPAFHFDILKQFVNVLIEEGNDLTQRLNDNEGLIVNDLIFFISHHMLNAICG(1)

 

>CYP4AB_fragment7 Linepithema humile (Argentine ant) Lh4ABseq19i 94aa 2 exons

INCOMPLETE short scaffold missing 400aa on N-term

89% to Lh4ABseq13a

(2)

NPDFWPNPGVFDPDRFLPENIENRHTFSYLPFSPGSRNCLG(1)

QRFAMMELKIIMASLVRNFYLEPVDYLKDLQFTMDLVNRVAHPIRAKFIPIKV*

 

>CYP4AB_fragment8 Linepithema humile (Argentine ant) Lh4ABseq1i 200aa 4 exons

INCOMPLETE short scaffold, missing 300aa on N-term

94% to Lh4ABseq3 

(0)

GHDTVAISICFTILLLAEHKNIQ(0)

DRVRSEISAVMLKNNGKLNVAALNDMPYLERCLKESLRLYPSVPIIVRVASEDVKLQ(1)

SYIVPAGTLIAIGIKLIHRNPDFWPNPDVFDPDRFLPENIKNRHPFSYLPFSAGSRNCIG(1)

LRFAMMELKAIIAPLVYNFYLEPVDRLKDFRFRIDLLNRVVHPIRVKFIPIEQMQPFKAN*

 

>CYP4AB_fragment9 Linepithema humile (Argentine ant) Lh4ABseq28i 80aa 2 exons

INCOMPLETE short scaffold missing 300aa on N-term and 100aa on C-term

80% to Lh4ABseq20P

(0)

GHETTSISICFTILLLAEHKNIQ(0)

DRVRSEINAVMQENNGKLTTTALNNMPYLERCLKESLRLYPSAPFILRVPCKDIKLR(1)

 

 

>CYP4AB_fragment10 Linepithema humile (Argentine ant) Lh4ABseq4P 68aa 1 exon

PSEUDOGENE FRAGMENT C-term exon only, frameshift, upstream from Lh4ABseq5i

67% to Lh4ABseq1i  

(1)

QRFAMLKIKAVIATLVHNFYLESIDNPLIESIDCLKDFRFRLDLINRVIHPIRVKFISIEQMQPFEAN*

 

>CYP4AB42 Linepithema humile (Argentine ant) Lh4ABseq5i 239aa 7 exons

INCOMPLETE missing 3' end of 1st exon N's, short scaffold missing 250aa on C-term

83% to Lh4ABseq8i

MIFIIFVLLY(1)

EQLKTLEKYLKIYYPVAKLWIFNHAGVSASHPDDVQ(0)

TILSNSKEHIGKGFVYTFLNPWLGTGLLTSEG(1)

TKWHERRKMLTPAFHFNMLKQFVDIFIEEGNYMTQCLKDIEGSTVNDLIFFTSHHTLNVICG(1)

TAMGISLKDMGAFQQQYRKTVYEITKLILAR(2)

LMSPWFYSDMIFALSPMGKRQAKNLKILHGFTEK(0)

IIAERKQYHKSTNGQYLKQFENNSVNNNEEIIGS(1)

 

>CYP4AB_fragment11 Linepithema humile (Argentine ant) Lh4ABseq6i 120aa 2 exons

INCOMPLETE short scaffold missing 400aa on N-term

96% to Lh4ABseq17i

(1)

SYIVPSGAILYIPIKFIHRNPDFWPNPDVFDPDRFLPENIQNRHPFSYLPFSAGARNCIG(1)

QRFAMLELKAIIATLVHNFYLEPIDYLKDLRFRLDLVTRVADPIRVKFIPIEQMQPFKAN*

 

>CYP4AB43P Linepithema humile (Argentine ant) Lh4ABseq9P 372aa 8 exons

PSEUDOGENE 4stop codons, missing internal exon, 2 frameshifts, 2 unmatched intron splices

56% to Lh4ABseq25P

MIITLMLLCILLILLCYYLIYHGRFWQLIDQIPGPPTFLLIGNTYSY(0)

IYYVTFTSE*ARSQPRIKNVYINLFQTCSVGMFNI(9)

RKKRLAVLDLLIAMSDNNKMSDLDIREE(0)

DRVRSEINAVMQENNGKLITTALNSMSYL*RCLKESLRLYPSTPYI(0)

MYLNLDCNEFCTDWTSNSIYYVQCELKIF*IINRFQIKVMYQRSHYDLQLHHG(9)

NFWPNPDVFDPDRFLPENTQNRHT(9)

RNQDFWPNPGVFDPDRFLPENIQNRHTFSYLPFSAESRNCIGIFRNQDFWPNPEVFDPDRFLPENIQNRRCYCALLPH(9)

KGQPSNLIQQFYTIAMMELKIIMASLIHNFLFEPIDYLKDLQFTLDIVSRVARPIRAKFIAIKV*

 

>CYP4AV7 = old CYP4AV6 Linepithema humile (Argentine ant) Lh4AVseq1 497aa 8 exons .

65% to CYP4AV1 honeybee

MIASVLLAGGSWVTGFLFCCLLSLLLVLLMQRGKFLYALRKVPYPSALPIIGNAYQLNCTQEE(1)

FFQKLVKWAGEFGDIFLVWVGLRPFIFLYRVESVQPLLHSSEHIDKSLEYQYLKPWLGTGLVTSTG(1)

QKWHFRRKLLTPTFHSNLIEVYLKNVKEETDVLISCLGKEVGCWFDVVPYVKRAALDIICG(1)

TAMGYKLNAQKKLNNKYVEAVDK(2)

IASIVQMRFTNVWIASDSIFKLTKAGKVHNHSLDIIHEFVGK(0)

VISERKLKRDGNFNEPMKKKKALLDLLLDISQDGTILSDDDIREEVNTFMYAGHDTLATSISWTLYALGRNPQYQ(0)

EKILDECDELLGSAEVTVDNIHKLTWLEACIKEQMRLFPVAPLIARQIYKPIEIM(1)

GSEIPRGSTVLINSYLLHRDPRHFPEPQVYRPERFLPDKPRLPLYAFIPFSAGSRNCIG

WKFALMVVKVAVLLILKTYRVEALDKEDQLRFISELVLVNANGIRLKLTPRKR*

 

New CYP4 subfamilies

 

>CYP4CX1 Linepithema humile (Argentine ant) Lh4CAseq1i 284aa 7 exons

INCOMPLETE short scaffold, missing 230aa on N-term

79% to Lh4CAseq9i 

(2)

EIWKCRISNLLFHSNVLFNLSTIKWRQQKQLNCLNLL(0)

MEQMRHAFDKRVATKTNSETVL(1)

FDILLEACHNGRLTQQEFWDHMITMSLA(0)

ATDTTAITINFVIFMLANFPEVQ(0)

EKAYKELSEIYGIESPKSVPIKYNDLQHMNYLNRVIKETMRLFPAIPFIGRILTEDVKIG(1)

ETILPKGADTIMSIFHMHRNKKHWSNPLMFDPDRFLPEKEGHCSKYFMPFSNGRRNCIG(1)

QKYAMISMKVILITLIRTFEFKVDKNIKIEDIELNTDIALCTVDPLKVKIQKRDY*

 

>CYP4CX_fragment1 Linepithema humile (Argentine ant) Lh4CAseq2i 76aa 2 exons

INCOMPLETE short scaffold, missing 450aa on N-term

93% to Lh4CAseq4i 

KRKHYLKYFMPFSNGLRNCIG(1)

QKYAMISMKVILATLIRTFEFKVDKNIKIDEIKLNTDISMSTVDPLKVKIKKRDY*

 

>CYP4CX2 Linepithema humile (Argentine ant) Lh4CAseq3i 254aa 6 exons

INCOMPLETE short scaffold, missing 230aa on N-term, upstream from Lh4CAseq4

92% to Lh4CAseq4i

(0)

LLQRKHVFEKSVVAKSNSKTFL(1)

IDILLEACHEGRLTRQELLDHVNTMLSA(0)

AIDTTAVTINFVTFMLANFPEVQ(0)

EKAYKELSEIYGNESPKSVPIKYDDLQKMDYLNQVIKETMRLFPAVPVIGRILTEDLKIG(1)

ETILPKGAETIMSILHMHRNKKHWSNPLMFDPDRFLPEKKEHYSKYFIPFSNGLRNCIG(1)

QKYAMISMKVILATLIRTFEFKVDKNIKIDEIKLNTDISMSTVDPLKVKIKKGLLNLTNVTI*

 

>CYP4CX3 Linepithema humile (Argentine ant) Lh4CAseq4i 419aa 10 exons

INCOMPLETE missing internal exon (Ns)

, downstream from Lh4CAseq3

80% to Lh4CAseq13, ~38% to CYP4CA1

MFVTVILITLICLGVSYILSNFWRRSFIKKVNTFPGPKAYPLVGSVPYFLRVNISD(1)

IEQVTNTLVNNFSSPFRFWVGNTAYIGLYDGEHVK(0)

AVLQSRCFEKSSIYKIFKPVFRTGLVTSSG(1)

MISSING ~70 AA

(1)

MIYEETCFSIKEIWRYRLSNIFLHPNVIFNLSTTKWRQQKQLNCGILLINE(0)

LLQRKHVFEKSVVAKSNSKTFL(1)

FDILLEALHKGRITLQENQDHIITMLSA(0)

VIDTTAVTINFVTFMLANFPEVQ(0)

EKAYKELSEIYGNKSPKSVPIKYDDLQKMDYLNRVIKETMRLFPAAPLIGRILTEDLKIG(1)

ETILPKGAEIIMSILHMHRNKKHWSNPLMFDPDRFLPEKKEHYSKYFMPFSNGLRNCIG(1)

QKYAMISMKVILATLIRTFEFKVDKNIKIDEIKLNTDITMCTVDPLKVKIKKRDY*

 

>CYP4CX4 Linepithema humile (Argentine ant) Lh4CAseq5i 251aa 6 exons

INCOMPLETE short scaffold, missing 100aa on N-term

86% to Lh4CAseq1i

(1)

SLWSSHRKIVERFFTPNNLQGEFNIF(0)

(1)

FDILLEACHKGRLTQQELWDHMVTMLLA(0)

ATDTTAVTINFVIFMLANFPEVQ(0)

EKAYKELSEIYGIKSPKSVPIKYDDLQKMNYLNRVIKETMRLFPAIPVVARFLTEDLKIG(1)

ETILPKGADVFMSIFHMHRNKKHWSNPLMFDPDRFLPEKQKHCSKYFIPFSNGLRNCIG(1)

QKYAMISMKIVLATLIRTFEFKVNKNIKINDIKLNMDISLCTIDPLKVKIKKRDY*

 

>CYP4CX_fragment2 Linepithema humile (Argentine ant) Lh4CAseq6P 60aa 1 exon

PSEUDOGENE FRAGMENT N-term exon only, upstream from Lh4CAseq7

45% to Lh4CAseq4i

MSTIIFASVVLTTLVCVAISYLFLNYRRRQSFIKAVNTLPGPRLFPFIGNIYIFAQKNLG(1)

 

>CYP4CX5 Linepithema humile (Argentine ant) Lh4CAseq7 453aa

9 exons downstream from L4CAseq6P

37% to  CYP4CA1 Nasonia, 66% to Lh4CAseq4i

MTYLSVTEKYHYDITVICFAMRDYPQSIIFFLKANSTSLNKINILLSYKKLFSDFLYVIDTMIDIY

PSPFRFWIGNKAFIEIYDADQIK(0)

TVLQSRCFDKSLFYDTAKPLFGEGLITSPT(1)

FTWIPHRKLAGPTFNTHNLRGFFNKFVEHSLIFTDELEKLNKNEIIFHKPILKTTXXXX(1)

XXXXXXXXXXXXXXXXXXXXXXXXXXXX

LEQSKSTLIKPDITENNKREKTCKFVN(0)

NFVLQEINQLFDNYLSTISFCSNNIVFTNFWEAYRGKSLTRKEFYDNIISIILA(0)

ASDTTAVVMYFVTFVLANLPEIQ(0)

EKAYKELLGIYGNKSPKSAPVKYEDLQHMDYLTRVIKETMRMFPAVPAIGRCLREDLKID(1)

EFTLPKGVDVIIPIVSVHRNKKYWPNPLMFDPDRFLPEKKVDSSNYYIPFSDGLRNCIG(1)

AKYAMMSMKVILATLIRTFEFKTDKKIKVDEIKLKMNITLEPVNPIKVKIEKRDLQ*

 

>CYP4CX6P Linepithema humile (Argentine ant) Lh4CAseq8P 449aa 12 exons

PSEUDOGENE extra 'A' at 142664, multiple stop codons, unmatched intron sites,

scaffold cuts off C-term

76% to Lh4CAseq13

MFATITLATLICLEMCYVLSNFWHRSFIKKINTLPDPKTYPLIGSALYFLGVNITG(1)

IIQVANILANDFSSPFRFGNTAYIGVYDGEQIK(0)

AVLQSRCFEKSSLYKIFKPLLKTGLITSPV(1)

SLWSSHRKVIKNIFTPNNLRVHSNIFVEQSLAFMDELEKVEKDGNGIIFLDF(9)

I*LFLLSPFCSTKIEYNI*MQKYVTYSTFLNFLYAKTCFFL(1)

(1)

LPHPPYSPDIAPSDYHLFWSMAHA(1)

KCNIQNLSIYKVKKDNSISIFFNFF*FVHKC**LFYKYIRVDS*V(9)

TCFSIKEI*KCRISNIFLHLNVIFNLSTTKWRQQKQLNSIN(2)

QTKQRTHAFDKHVSTKSNSET(1)

TVFDILLEACHKGKLTQQKVCNHMITMLLA(9)

ATDTTAATINFVIFMLVNFPEVQ(0)

EKAYKELSEIYGTESPKSVPIKYDDLQKMDYLNRIIKETMRLFPAAPFIGRILTEDLKIG(1)

 

>CYP4CX7 Linepithema humile (Argentine ant) Lh4CAseq9i 355aa 8 exons

INCOMPLETE missing 130 on N-term (N's)

78% to Lh4CAseq13

(1)

FLWKIHRKLMGKFFTPNNLRVHSNIFVEQSLAFMDELEKVEKDGNKIIFFDFVYKHMLNLSLE(1)

TCFSIREIWKYRLSNIFLHPNVIFNLSTAKWRQQKQLNCLNLLINE(0)

IVQRRHAFDKRMAIESNSETVL(1)

FDFLLEACHEGKLTQQELLDNVFTMLFA(0)

ATDTTGTTINFVIFMLANFPEVQ(0)

EKAYKELLEIYGTNSPKSVTIKYDDLQQMNYLNRVIKETMRLFPAVPLIGRILTEDVKIE(1)

LILPKGTDTLMSILHMHRNKKHWSNPLMFDPDRFLPENEVHCSKYFMPFSYGLRNCIG(1)

QKYAIISMKVTLATLIRTFQFKLDKNIKIDEIKLNTDIALCTIEPLKVKIKTRDY*

 

>CYP4CX8 Linepithema humile (Argentine ant) Lh4CAseq10i 291aa 7 exons

INCOMPLETE missing 130 on N-term (N's)

89% to Lh4CAseq4i

(1)

SVSLWSSNRKMVERIFTPNNLRIYSNIFVDQSLVLTGELEKVEQNGNEIILLDFLYRYILNIACV(1)

(98 amino acids missing)

LDILLEAWHEGRITLHECDDHMITMLFA(0)

ATETTAVTMNFVIFMLANFPEVQ(0)

EKAYKELSEIYDTKSPKSVPIKYDDLQKMDYLNRVIKETMGL(2)

LFPAAPVIGRILTEDLKIG(1)

ETILPKGAETIMSILHMHRNEKHWSNPLMFDPDRFLPEKEEHYSKYFMPFSTGLRNCIG(1)

RKYAMISMKVILATLIRTFEFKVDKNIKIDEIKLNTDISMSTVDPLKVKIKKRDY*

 

>CYP4CX_fragment3 Linepithema humile (Argentine ant) Lh4CAseq11i 86aa

2 exons INCOMPLETE missing 400 on N-term

89% to Lh4CAseq1i

(1)

ETILPKGADTIMSILYMHQNKKHWSNPLMFDPDRFLPQKEGHCSKYFMPFGNGRRNCIG(1)

QKYAMISMKATLATLIRTFEFKIDKNI*

 

>CYP4CX_fragment4 Linepithema humile (Argentine ant) Lh4CAseq12i 60aa

1 exon INCOMPLETE single exon form 330-400

88% to Lh4CAseq1i 

(0)

EKVYKELLEIYSTESPKSVPIKYDDLQHMNYLDRVIKETMRLFPAIPFIGRILTEDLKIV(1)

 

>CYP4CX9 Linepithema humile (Argentine ant) Lh4CAseq13 470aa 11 exons

Downstream from LhCAseq14

remove cyan and replace with ETAM exon

35% to CYP4CA1 Nasonia

MFVTVILITLICLGVSYILSNFWYRSFIKKVNTLQGPKAYPLIGSALYFWGVNIKE(1)

ILQVANKLVKNFSSPFRVWFGNIAYICVYDGDQIK(0)

AVLQSRCFEKSSIYNIFKPVLRTGLLTSSV(1)

SIWSSNRKMMERIFTPNHLRMYFNIFVQQSLALTDELEKVEQNSNEIILLDFLYRYNLNIACGKNK(1)

XXXXXXXXXXXXXXXXXXXXXXXXXX

YRLSHIFLHSNVIFNLSTTKRRQQKLLNNGILLINE(0)

ILQRKHAFDKFEATKSNSETLL(1)

FDILLEASHEGRLTQQEHLDQVITMLFA(0)

ATDTTALTINFVTFMLANFPEVQ(0)

EKVYNELSEIYGTESPKSVPIKYDDLQKMEYLNRVIKETMRLFPSGPLIGRILTEELKIG(1)

EIILPKGADILMSIFHMHRNKKHWSNPLVFDPDRFLPGNLKHCSKYFMPFSTGLRNCIG(1)

QKYAMISMKVILATLIRTFEFKLDKNINIYDIKLSIDATLCTVNPLKVKIEKRNY*

 

>CYP4CX10 Linepithema humile (Argentine ant) Lh4CAseq14 376aa 10 exons

SEQUENCING ERROR A inserted at 1158510, missing internal exon Ns,

early stop codon cuts off 25aa on C-term, upstream from Lh4CAseq13

76% to Lh4CAseq4i

MFVTVTLITLICLGVSYILSNFWRRSLIKKIYNLPGPKAYPLVGSALYVLGIITND(1)

IMQIVNTLVNDFSSPFRVGFGSIAYIGVYDGEHIK(0)

AVLQSRCFKKSSLYKVFKPALGTGLITSHE(1)

MISSING ~70 AA

TCFSIKEIWKYRINNIFLYPNVIFNLSTTKWKQQKQLNSITLLIDE(0)

QKKHILDKSEATKSNNNTFL(1)

FDVLLEALHKEKITLQECDDHMFTMLFT(0)

AIDTTAITMNFVIFMLANFPEVQ(0)

EKAYKELSEIYGIESPKSVPIEYDDLQKMEYLNRVIKETMRLFLAAPLIGRILTEDLKIG(1)

ETILPKEADIIMSIFYMHQNKKYWSNPLIFDPDKFLPEKEVHCSKYFMPFSTGLGNCIG(1)

QKYAMISMKIILATLIQTF*

 

>CYP4CX_fragment5 Linepithema humile (Argentine ant) Lh4CAseq15P 113aa

2 exons PSEUDOGENE FRAGMENT missing 400aa on N-term, in frame stop codon

90% to Lh4CAseq5i

(1)

ETILPKEADAIISIFHMHRNKKH*SNPLMFDPDRFLPEKQKHCSKYFMPFSNGPRNCIG(1)

QKYAMISMKIVLATLIRTFEFKVNKNIKIDDIKLNMNISLCTMDPLKVKIKKRIY*

 

>CYP4BW6 Linepithema humile (Argentine ant) Lh4BWseq1i 428aa 8 exons

INCOMPLETE can't find 1st exon, GC donor on sixth intron

48% to CYP4BW4 Nasonia, 47% to CYP4C1 

(1)

RTKWFCSFLDKFKDGIFINWIGTQPFINVYKPEYLE(0)

IIFPSTTNITKGTTYDLLRPWLGNGLLTSTG(1)

TQWFHDRKLIGPTFHFSILDQFAVILSEKAEIMTKCLEKEMEKNPGKAINIFPFAINVALDVICG(1)

MGVNIHAQEVVTPYTSIVHR(2)

TSILTLDRLFRPWYWIDWFFHSMPAGKEYKSVLNILHGFTKEVCQKR(1)

XXXXXXXXXXXXXXXXXXXXX

KRKRKAFLDLLLDQNEKDDFPLTDDELRAQVDTFMFE(0)

GHDTTAVAITWVLFCLGNNLEHQEKVHEELDEVFKDSEIPATVKELSQLKYLDRVIKETLRIFPSV

PVITRKLAEDVKIG(1)

DHTLPKDIDVTLAIILAHRNPEVWPDPLKFDPNRFLPENSKNRNPYAYVPFSAGPRNCIGQRFALL

EEKTVLTAILRKWRVKSVKTFETIHYGGSLILRPIEEVLIHFTSKT*

 

>CYP4CY1 Linepithema humile (Argentine ant) Lh4BZseq1i 395aa 8 exons

Can't find first exon

39% to CYP4BZ1 partial alignment, 30% to CYP4BZ2 over 429 aa

(1)

LIDYLMTITKKYGTLSRLVLGTDVFVVLTKPEDYK(0)

LVLTNVNGNNKTSVTKQWYPLLGNGIIRASG(1)

TTHRLRRKIIQPFLNIKYLTDYVTFFDNYSHNCADLLEKEIGGHIFDIKPYMAQYAADIFLGKNY(0)

MLIYNFFRLIKCVWKTIIKPWQQIEWIFCLSDNKKKMCTAQKTVQDFIYN(0)

IAMQKKTMECNGLNYDSEYFEKSVIGNYSSHMKQLFDDETNKSCA(0)

XXXXXXXXXXXXXXXXXXXXXXXXXXX

EKLRKEILTIFGNDNLDVKRLMTIRYLHMVIQETLRLFPASPIISRQLTGDIQLE(1)

SCVLPDGCLVMIPIFAIHRNPMYWDKPEEFIPERFSSENSSTRHRYTYIPFGTGPRDCLG(1)

QRYTFLSVGAAIVNLLRRFRFVATGSVKDVKLTNDILLRSRDGIKLSVFRLEDH*

 

>CYP4CY2 Linepithema humile (Argentine ant) Lh4ABseq14i 212aa 4 exons

INCOMPLETE short scaffold missing 200aa on N-term

82% to Lh4BZseq1i

(2)

LMKYMYKKMATPWLQLEWIFSLSDNAKQQSVGQKMIRNFVHK(0)

EKLRKEILLTFGNDKIDAKRLTSIRYLNMVIQETLRLFPPAPIIARQLTEDIKLE(1)

SCVLPNGCYVIIPVFTIHRDPAYWNKPEEFIPERFSPKNSSSHHRYTYIPFGTGLRACPG(1)

QRYTFLSVGAAIVNLLRRFRFVATGSVKDVKLTNDILLRSRDGIKLSMFRLEDHR*

 

Mito clan (6 sequences)

 

>CYP12K1 Linepithema humile (Argentine ant) Lh12seq1 528aa 8 exons.

54% to CYP12K1 Nasonia, probable ortholog

MMRARFLIREINGSHSPWEMLRRARSIATPIEHGETNATNDLQNARSVNDIPGPKALPVLGNWFRFIPYIG(1)

EYGNANMITRLRMLREQYGNIVKLDGLLNSRSTVFLFSPELCEKMYRNEGTWPLRQSMECMHYYRTSRKDIYGEMYGLPTS(2)

QGKIWHNFRSKVNPYMMQPRMVQAHIAPISKVTSDFVERMRTLKDPKTLELPDNFLNELYKWALES(1)

ICLIAMNCRLGCLRPNLTADSEPQIMINCVHDMFDLIYRLEILPSLWKVYNTRNLRKFFRVMDTFNE(2)

IIGKHIERAETKLRETTDGTDLQDHSVLEKLLRIDKQTAHIMALDMLTGGVDT(0)

TGNMAAGLLYYLATNPEKQEKLREEVMSVLPDKTSPVTHNVLSQTKYAKACIKESLRLFPVAIGTLRTVPTDVCLGGYKIPKG(0)

YDVLLVHELLTLEPTQFPRPEEYIPERWLRGNTKFPSAKEAHPFSYMPFGFGPRTCIGRRFSEMEVETLVLT(0)

VIRNFRIEWHHGPFEYESRFINTVSTPMRLKLVDL*

 

>CYP301A1 Linepithema humile (Argentine ant) Lh301seqA1 520aa 9 exons

T replaces conserved C in heme-binding sequence, tail-to-tail with Lh301seqA2

82% to CYP301A1 honeybee

MRCRPLQPCKSLHRRIVLRDFCNGTIASECPHASSSSQGIASSYVKSYDEVPGPRPIPILGNAWRLLPLI

GQYQISDVGKISQMFYDEYGKIVRLSGLIGRPDLLFVFDADEIEKVYRQEGPTPFRPAMPCLVQYKSIVRKDFFGKLPGVVG(0) vhgep?

WKEFRTRVQKPVLQPQTVRKYITPIEIVTEDFIKR(2)

IEEIKGDDDELPGDFDNEIHKWALEC(1)

IGRVALDVRLGCLGRTLSPDSEPQKIIDAAKFALRNVAALELKAPYWRYIPTPLWSRYVRNMNYFVE(2)

ICMKYIDAAIIRLKSKKAMNESDLSLVERILAKETDPKIAYIFALDLILVGIDT(0)

ISMAVCSILYQIATRPEEQEKIHQELLQILPDPSVPLTTSHLDRATYTKAFIREVFR(2)

VYSTVIGNGRTLQNDTVICGYKIPKG(0)

IQVVFPTLVTGNMEEYVADAKTFKPARWLKDADNEKLHPFASLPYGYGARMCLGRRFADLEMQVLLAK(0)

LLRSYKLEYHHKPLNYNVTFMYAPDGELKFKVIKR*

 

>CYP301B1 Linepithema humile (Argentine ant)

Lh301seqA2 517aa 10 exons Tail-to-tail with Lh301seqA1

69% to CYP301B1 Nasonia, 73% to CYP301B1 honeybee, 50% to CYP301A1 honeybee

MATLRQHAKELLRRFVRIDAKNDRAIDTLAVDAGEQETLRHRSYSAIPGPKPMPLLGNTWRFLPYLG(1)

NFDIQTIDKLSRKLHAQYGDIVKIEGLLGRPDMVFVYDANEIERIFRREEKMPHRPSMPSLDYYKHVLRKDFFQDNPGVIAV(2)

HGESWYNFRSKVQQVMLQPRTARMYISAIEEASVAFLRR(2)

IAKIRNHKSEVPDDFLNEMHKWSLES(1)

IARVALDVRLGCLDDNADAETQGLIDALITFFKNVPVLELKIPFWKIFNTPTWKQYVNALDTIVS(2)

TISKYTAAALSRAENDVNSDKELSLLERVLAREGDTKVASILALDLFLVGVDT(0)

TSTSVASVLYQLALHPEKQALAYEEICNVLPQRDAPLEATNIDNLKYLRACIKETLR(2)

MYPVVIGNGRSMTSDTIISGYRVPKG(0)

VQVVFQHYVISNMEKYFPRSCEFLPERWLRDDGIRHAFASLPFGYGRRMCLGRRFAELEMIIVISK(0)

ILQFYKVEYHHKRLEYYINPMYTPKGPLKLRFIDRQ*

 

>CYP302A1 Linepithema humile (Argentine ant) Lh302seqA1 507aa 8 exons .

66% to CYP302A1 honeybee

MYARIKIEKRRIKKLCVRSCSINFNHINTNVPKSFKNIPGPRSLPIIGTLHKYLPFIG(1)

EYSFTKLHINGLLKLKRYGPLVREEIVPGESVVWVFRPEDIAEIFKAEAGLHPERRSHLALFKYRKDRSDVYNTGGLLPT(2)

NGIDWWRLRREFQKVLSKPRNVVDYLEDTDLVVQEFMQLCSREKTDDFLPLFSRLFLEL(1)

TCLVAFDVRMRCLSEEEKHPNSRSSRLIKAAFITNSATLKLDNGPRLWRFFETPLYRKLRKSQNYMEE(2)

VALEMITQRNRNALICRKESLLEEYFKNESLDVKDIVGMACDMLLAGIDT(0)

TTYTTSFALYHLGRNTNVQEKLRAEAMALLKDHTSPITAEILRNATYTKAVIKETFRMNPISVGIGRILQNDVILSGYLVPRK(0)

TVVVTQNQVICRLPEYFEEPNLFIPERWLRDKSDRLQEKSINPYIVLPFGHGPRSCIARRFAEQSLQVVLLR(0)

ICRSLQFTWCGETLDSISLLINKPDAPIKLKFENLQE*

 

>CYP314A1 Linepithema humile (Argentine ant) Lh314seqA1 513aa 9 exons .

78% to CYP314A1 honeybee

MRSNIGVKLLCIFVFICFSKADKLYADAGDNGRKFKTARNVPGPCALPIFGTRWIYSCFGYYRLNKIHDAYKV(1)

DLNRRYGPLCKEEALWNYLVVSVFSRRDIEAILRRGSRYPLRPPQEVISHYRRTRRDRYTNLGLINE(2)

QGATWQKLRSALTPELTGASTVFGFFPALNIVTDGFIDLIRKRRAGSTTVRGFEELAYRMGLES(1)

TCTLILGRHLGFLKPDSSSTLTTRLAEAIRIHFTALRDAFYGLPLWKLLPTSTYKQLIESEDTIYN(2)

VISELIEATMLEKQDDARDESVEAVFLSILRQKDLDMRDKKAAIVDFIAAGIHT(0)

LGNTLVFLFDLIGRNPEVQEALYKEAQSLAPPGCDLTVDDLRKAKYLRACITESFR(2)

IVPTTPCIARILDEPIELEGYRLDAG(0)

TVVLLHTWIAGLSEDNFKDASKCLPERWLKPMVPHSPLLVAPFGAGRRICPGKRFVELALQLILAK(0)

IVREFEIVVDEELGLQFEFILAPQSPVSLGFRDRMSRAEMT*

 

>CYP315A1 Linepithema humile (Argentine ant) Lh315seqA1 523aa 6 exons .

60% to CYP315A1 honeybee

MHAARRTLQRISRSANLRGDFDVSFSKRRAAGHRPQSFILNIKNVISRNIVDRSAARSSVLSLARDFGTL

ARKEPPESRGIPVFGTILSLAMAGGAQKLHEYVDKRHQELGPIYREQIGPVRAVFVNSPEEFRRIFLRLE

GPMPQHFLPESWKLYNEIRAQRRGLLFM(2)

DGDEWLHFRRILNKTMLLPDSAKLMCAPCQEAAESLTRKWKQYSRDGSTIPNLERQLYMWSIEA(1)

MLATLIGSRWRDCERQMRPEVKDLALMLHRIFEYSATLSMIPAKLAKRLKLPVWTKFVWTVDTILEKVCN

LIPEMTRLDGDGLLRTMMKEGIHGDDAVRIVADFIIAAGDT(0)

TAITMQWALLLLSSRFQLQEQLFHDLRDLSPEEVLRHRLLRGVWREALRLHPVAPFLTRYLPTDATIGDYSVSKG(0)

DLILLSIYSSGRDETDFPEPNEFRPERWIRTKEGYQGVKNPYATLPFAMGVRSCIGRKLAETQMSLALAQ(0)

NFRIECTNRDSIKMILHLISVPSRPIQLKLTEREV*