236 total P450 sequences from sacred lotus

     (9 contig sequences are also included that are redundant)

     (2 Lotus japonicus sequences are included, temporarily)

167 sequences are complete or with minor sequence gaps

     (This is about 90 sequences less than Arabidopsis)

69 sequences are pseudogenes, or one exon fragments

 

all sequences were manually reviewed and revised as needed.

 

D. Nelson

March 5, 2012

 

Update on March 23

 

357 P450 sequences are found in lotus

172 are genes (160 complete and 12 incomplete)

185 are pseudogenes

 

 

 

Blast searches failed to find CYP728, CYP729, CYP733, CYP749 families

 

CYP51 family (2 genes, 0 pseudogenes)

 

>CYP51G1a maker-scaffold_5-snap-gene-84.25-mRNA-1

81% to CYP51G1 Arabidopsis

8439395

MDLKENKFLSVGLLIVATMVVAKFLSAFLMPKSRKRLPPTIKTWPVLGGLIRFLKG PVVMLREEYPKLGSVFTLNILNKKITFFVGPEVSAHFFKASESDLSQQEVYRFNVPTFGP GVVFDVDYSVRQEQFRFFTEALRVNKLKGYVDQMVVEAE (0)

DFFSKWGESGEVDLKYELEHL

IILTASRCLLGREVRDQLFADVSSLFHDLDNGMQPISVIFPYLPIPAHRRRDQARKKLAD IFANIIVSRKRADKSENDMLQCFIDSKYKDGRPTTDGEITGLLIAALFAGQHTSSITSTW TGAYLLTHQKYLSAVLDEQKSLMKQHGDNIDHDILSEMDVLYRCIKEALRLHPPLIMLLR SSHSEFSVTTRERKQYDIPKGHIVATSPAFANRLPHVYKDPDRYDPDRFAAGREEDKVAG AFSYISFGGGRHGCLGEPFAYLQIKAIWSHLLRNFELELVSPFPDIDWNAMVVGVKGKVM

VRYKRRRLSVE* 8437392

 

>CYP51G1b maker-scaffold_7-augustus-gene-12.22-mRNA-1

81% to CYP51G1 Arabidopsis

92% to CYP51G1a maker-scaffold_5-snap-gene-84.25-mRNA-1

1283357

MDLKENKFLSVGLLVVA

TLLVAKLLSAFLMPKSRKRLPPTIKTWPVLGGLLRFLKGPIVMLREEYPKLGSVFTLNLL NKKITFFIGPEVSTHFFKASESDLSQQEVYKFNVPTFGPGVVFDVDYSVRQEQFRFFTEA

LRVTKLKGYVDQMVVETE (0)

DFFSKWGESGEVDLKAELEHLIILTASRCLLGREVR DQLFADVSSLFHDLDNGMQPISVIFPYLPIPAHHRRDEARKKLANIFAKIIYSRKHSGKT ENDMLQCFIDSKYKDGRPTTDGEITGLLIAALFAGQHTSSITSTWTGAYLLTHQKYLSAV LDEQKNLMKQHGDNVDHDILSEMDVLYRSIKEALRLHPPLIMLLRSSHTEFSVTTREGKQ YDIPEGHIVATSPAFANRLPHIYKDPDRYDPDRFAAGREEDKATGAFSYISFGGGRHGCL GEPFAYLQIKAIWSHLLRNFEMELISPFPETDWNAMVVGVKGKVMVRYKRRRLSVD* 1285919

 

>CYP51G15P pseudogene scaffold 0

13129977-13130033 (+) 254-276

77% to CYP51G1 maker-scaffold_5-snap-gene-84.25

DMLQCLIDLKYPTTDGEIT

13130036-13130140 (+) 278-312

LLVAALLAGQHTNSITSTWNGAYLLIHQNYLSAVL

 

>CYP51G16P pseudogene scaffold 41

68% to CYP51G1 maker-scaffold_5-snap-gene-84.25

253001-253069 (+) 378-399

HIVVTSPASINR*LPYIYKNPYR

253068-253175 (+) 401-440

DPYRFAAGREENMVAGAFSYISFDGDLGEPFLHLQL

 

>CYP51G17P pseudogene scaffold 41

253001-252933 (-) 409-434

DMVAGAFSYISFGGGRHGCLGEP

 

>CYP51G18P pseudogene scaffold 61 2352789-2352995 (+) 201-278

71% to CYP51G1 maker-scaffold_5-snap-gene-84.25

LVHDLDNGMHPISVIFPYLPIQAHRHRDQTRKKLAERPCKTENDMLL*LIDSKYKDCWPTTDDEE

ITGL

2355886-2355984 (+) 278-311

LITALLAGQHTSSITTTWNGAYLLTHQKYLISI

 

>CYP51G19P pseudogene scaffold 114 898588-898499 (-) 283-312

80% to CYP51G1 maker-scaffold_5-snap-gene-84.25

LFIGQYTNSITSTWTKAYLLIHQKYLSALL

 

>CYP51G20P pseudogene scaffold 132

61% to CYP51G1 maker-scaffold_5-snap-gene-84.25 

1074624-1074803 (+) 187-262

GREY-TQR*RDVSYLFHDLYNGMQPISVIFSYFPIPTHCHCDQA*CVCKTENDMLKCFIHS &

1074805-1074960 (+) 263-314

KYKDNWPTINKGITGLLIVALLAK*HTSSITSM*IGTYLLTHQKYLSTVLDK

 

>CYP51G21P pseudogene scaffold 133

54% to CYP51G1 maker-scaffold_5-snap-gene-84.25

102872-102928 (+) 264-282

HKEGQPTTNGEINGLLLPS &

102930-103022 (+) 288-318

HWTNTTST*TGAYLLTHQKYLPVLLVEEKKI

 

CYP71 family (8 genes, 12 pseudogenes)

 

>CYP71AN9 maker-scaffold_38-snap-gene-18.17-mRNA-1a protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.20 eAED:0.22 QI:0|0.2|0.16|1|0.2|0.16|6|0|750

57% to CYP71AN1 cottonwood nearly complete, fused at end
1810491

MAEQQVILLPLLSLPLLLLFSLVFLFRLRRCSIKLPPSPLGIPIIGNFHQLGALPHRSLK ALSQKYGPLMLLHLGSVPVLVVSSADISMEITKTQDINFANRPVTTAAQTLLYGCTDVGF SPYGEYWRQVRKISVLQLLSANRVQSFRFTREEEVALLIKKISHSCQLRSSVNLSELLPN LSHNLISRAAFSSKFEVEDDDSRRIGHLTMEVFSLLGVFSFRDFFPYLGWIDTVTGLDGR LKRTSQELDKLLDQVIQHHLVSTTQRSKGGQRDGEDFLDILLQAQKDTTLDIPITRDNIK AIILDMFIGGSYTTAITVEWTMAELVRHPIVMRKVQEEVRSVVGKKSKVEEDDIRQMAYL KAVIKEILRLHPPAPLLVPRESIRATNVNDYHIPAKTRVFINVWAIQRDPKLWENPEEFI PERFINNPVDFQGRDFHFLPFGAGRRGCPGIQFGLASTELILANLLYWFDWELPGNLKLE

ELDIDEDFGITVHKKTPLHLAPQFHFSE* 1808778

 

>CYP71AN10P scaffold 38 1802951-1803196 (+)

67% to CYP71 JcCB0202231.10, 61% to CYP71AN1 cottonwood
96% to CYP71AN maker-scaffold_38-snap-gene-18.17

MAEQQVILLPLLSLPLLLLFSLVFLFRLRRCSIKLPPSPPRIPIIGNFHQLGALPHRSLKALSQKFGPLMLLHLGSVPVLVV

 

>CYP71AN11P pseudogene (join two models)

maker-scaffold_38-snap-gene-18.17-mRNA-1b

maker-scaffold_38-snap-gene-18.18-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.43 eAED:0.48 QI:0|0|0|1|0|0|2|0|237

56% to CYP71AN1 cottonwood
83% to CYP71AN maker-scaffold_38-snap-gene-18.17-mRNA-1a

1800063 MAE*QGIRFPLLSLPLLFLFSFVCLFRLRRCSVKLPPSPPGIPIIGNFHRLEVLPHHSLK

ALSQKYGPLMLLHLGSVLVLVVSSADMSVEISKTQDINFANRPVTTAARTLLYCCTDV (1)

GFAPYGEYWRQVRKISVLQLLSAKRVQSFTREEKVALLINKISHSCQLRSSVNLSELLPI &

LSHNLISRAAFSSKFEAEDDDSRRIGHLTREVMSLLGMFSVRDFFPYFGWIDTVTGLDGK

LSRTSQELD &

LMDQVIRDHVSTTDDQRS*DQRDEEDFLDILLQAQKISTLDIPITRDNIKAIML (0)

DMFIGGSDTTAITVEWSMAELVRNPKVMRKSQ

EEVRRAVGKKSKFEEDDIPQMAYLKAVIKETLRLHPPSPFLVPRESIRATNVNGYHISP

KTRVFIN (0)

VRAIQRDPKLWENPEEFTPERLIMNNPVDFQSQDFHFLPFGAGRRGCP

GIPFGLAAIELILANLLYWFDWELPAGNTKMEDLDVDEDFGITVHKKNPLHLVPKFHFSE* 1798279

 

>CYP71AN12P scaffold 14 3795329-3795279 (-)
76% to JcCB0095131.10
64% to CYP71AN maker-scaffold_38-snap-gene-18.17

DPKIRKNPE*FIPEWFM

 

>CYP71AN13P scaffold 139 1453050-1453424 (+)

61% to JcCA0204781.10, 61% to CYP71AN1 cottonwood
new pseudogene uptream of augustus_masked-scaffold_139-processed-gene-14.2
83% to CYP71 augustus_masked-scaffold_139-processed-gene-14.2

KNDISRMDYLHRIIKETLRLHPPGPFLIPRESITATTIDGYHIPSKTRVFINAWAIQRDPKLWDNPHEFIPERFI

NNPIDF

NEETIDMTEAFGLAVFRKTPLYLLPKLHFS

 

>CYP71AN14 augustus_masked-scaffold_139-processed-gene-14.2-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.27 eAED:0.27 QI:59|1|1|1|1|1|2|349|508

51% to CYP71AN1 cottonwood complete
59% to CYP71AN9

MAVLPAILLQLLQQQQGLLLLVSLFVSFLFLFRASRASLNKPNFPPSPPKLPIVGNFHQL GTLPHRSLAALSEKYGPLMLLHLGSFPTLVVSSANMAREIIKTQDLVFSNRFATKATNTF SYGCTDIAFSPYSEYWREVRKICFIKLLTGKRVKSFKFVREEKVATMMEEISRSCQLGIP VDIGQLMQTMTYSLISSVTVGRNRREKDGSRRLRNLIKEVLVIMGAFSMQDFFPFLGWID TLTGFRGKIKKTWKELDAVLDQIIQQHLNSERNDGEVDEQDFVGTLLQAQKDLNLSRDNV KAVTLDMFVAGIDTSTVTLDWAMAELAKKPNVMKKAQEEVRRVVGQKSKVEEDDISRMDY LHRIIKETLRLHPPGPFLIPRESITATTIDGYHIPSKTRVFINAWAIQRDPKLWDNPHEF IPERFINNPIDFNDQDLQLLPFGVGRRRCPGMSFGLASLELTLANLLYWFDWEFPILTNE ETIDMTEVSGLNVFRKTPLYLLPKLHFS

 

>CYP71AN15P augustus_masked-scaffold_44-processed-gene-2.4-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.23 eAED:0.27 QI:0|0|0|1|1|1|2|0|192

51% to CYP71AN1 cottonwood mid region
77% to CYP71AN9 maker-scaffold_38-snap-gene-18.17-mRNA-1a

200454 EHPMAEQQGILLPCSLPLLLLFSVVFLFRLRECSVKLPV &

SPTRIPIIRNFHPLGTLPHRSLKALSQKYGPLMLLHLGSVPLLVVSTIEMSMEITKTQDN

NFATRPSTTAAKKLLYGCNDLGFAPYGKYWRQMKKMSVLRLLSVKRVQSFRFIREEEVAL

LIENISHLCQLRNSINLSELLTILSNNLISRAAFGSKFEEEDDNSRRIGPLTREVMPLLG

MFSVQDFFP &

LGWIDTVTGLDGRLKRTSQELDKLQGQVIRDHVSTTDDQRSKDQRDGEDILDILFQTQKD

STLDITITRDNIKEIILVIFI

QEEVRRVVSKKSKFEEDGIPQMAYLKAVIKETLRESTRAINVNGYHILAKT & 199362

VFINVWTIQR 199331

 

>CYP71AN16P scaffold 8 6066063-6065803 (-)

37% to CYP71 JcCA0088631.10
82% to CYP71 augustus_masked-scaffold_44-processed-gene-2.4

FLPLEWIDTVIGLDGRLKRMSQELDKLLDQVIRDHVSTTDDQRSKDRRDGEEFLDILLQAQKDSTLDIPIT*DN

IKAIIL (0)

 

>CYP71AN17P maker-scaffold_16-snap-gene-13.25-mRNA-1 protein Name:"Similar to CYP71A4 Cytochrome P450 71A4 (Solanum melongena)" AED:0.37 eAED:0.37 QI:0|0|0|0.5|0|0|2|0|155

CYP71 maker-scaffold_16-snap-gene-13.26-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.32 eAED:0.32 QI:0|0.25|0|0.8|0|0|5|0|391

53% to CYP71AN1 cottonwood
79% to CYP71AN maker-scaffold_38-snap-gene-18.17-mRNA-1a
87% to CYP71 augustus_masked-scaffold_44-processed-gene-2.4-mRNA-1

1305865 MAEQQGILLPCSLPLLLFSFVFLFRLRGC SIKLPPSPTRILVIGNFHQLGTLPHRSLRALSQKYGPLMLLHLGSVPLFVVSSLEMSIEI TKTQDTNFATRPSTTAAKKLLYGCNDLGFAPYGKY

*RQMKKMSVLRLLSVKRVQSFRFIREEEVALLIKKISHACQLHNSIYLSEL

LTFLSDNLISRAAFSSKFEEEDENSRRIGPLTREVMSLLGMFSVQDFFP*

IGCIDTVTGLDG

RLKRTSQELDKLLDQVIRDHVSTTDDQRSKDQREGEDFLHILLQAQKDSTL

DIPITRDNIKAIIL (0)

DMFIGGSDMTAITVEWSMTELIRNPKVMRKAQEEVRRVVGKKSKFEEDDIPQMAYLKAVT

KETLRLHPPASFFIPRESIRAINVNGYHIPAKTRVFIDVWAI 1304408

 

>CYP71AN18P pseudogene (join two models)

augustus_masked-scaffold_133-processed-gene-8.3-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.32 eAED:0.32 QI:0|-1|0|1|-1|1|1|0|117

CYP71 augustus_masked-scaffold_133-processed-gene-8.4-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.35 eAED:0.36 QI:0|-1|0|1|-1|1|1|0|97

54% to CYP71AN1 cottonwood N-term
79% to maker-scaffold_38-snap-gene-18.17-mRNA-1a
833502 MAEQQGILLPFLSLPFLLLFSFVFLFRLRRCSVKLPPSPPRIPIIGNFHQLGTLPHRSLR ALSQKYGPLMLLHLGSVPLLVVSSSEMSMEITKIQDTYFATRPATTAAKKLLYGCND*GF
APYGDYWRQMKKISVLRHLSVKRVQSFRFIREEEVALLIEKISHACQLRNSINVSELLPI

LSDNLVSRAAFSSKFEEEDDNSRRIGPLTREVTSLLGMFSARDFFP 834179 &

(113 aa deletion)

834179 LGKKSKFEEDGIPHMAYLKAVIKETLRLHPPALFLIPRESIRATN 834313 &

834316 NGYHIPVKTRVFINVWAIQR 834375

 

>CYP71AN19P augustus_masked-scaffold_0-processed-gene-60.1-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.18 eAED:0.18 QI:0|0|0|0.5|1|1|2|0|120

59% to CYP71AN1 cottonwood EXXR to PKG region
solo pseudogene fragment

6004373 MAEQQGEVRRVVGKKSKFEEDGIPQMAYLKAVIKETLRLHPP    

        APFLIPRESIRATNVNGYHIPAKTRVFINVWAIQR 6004143

 

>CYP71AN20P pseudogene

maker-scaffold_43-augustus-gene-19.30-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.08 eAED:0.18 QI:0|1|0|1|1|1|2|0|272

48% to CYP71AN1 cottonwood, mid to EXXR, motif is wrong
76% to CYP71AN maker-scaffold_38-snap-gene-18.17-mRNA-1a
1893426

QSFRFIREEEVALLIEKIYHACQLRNSINLSELLPILSDNLISRAAFSSKFEEDDDNSRR IGPLTMEVMSLLGMFSVRDFFPYLGWINTVTGLDRRLKRTSQELDKLPDQVIRDHVTTIV IEDQRSKDQRDAEDFLDILLQAHKDSTLDIPIPITRDNIKAIILDMFIGGSDTTAITMEW SMTEIVSNPKVMRKAQEEVRRIVGKKSKFEKDDIPQMAYLKVVIKETLTLHPPAPFLILR

EATVSQ &

YRIPAKTRVFINV*AIQRE &

VKRWENPKR*KVER 1894428

 

>CYP71AN21P pseudogene

closest to NNU_002314

47% to CYP71 JcCB0202231.10
85% to CYP71AN17P maker-scaffold_16-snap-gene-13.25

scaffold 4 268951-269535 (+)

ILGNFHQLGTLPHRSLRAPSQKYGLFILLLVVSSLEMSMEIAKTQDTNFATRPSTTAAKKLLYGCNDLGFA

PYSEYWRQMKKMSVLRLLSVKRVQSFRFIREQEVALLIEKISRACQLRNSINLIELLTILSNYLISRAAFSRKFE

EEDDDSRRIGPLTMEVMSLLGMFSVQDFFP 269478 &

scaffold 4 269478-269729 (+)

LGWIDTITGLDGRLKRTSQELDKLLDQVIRGHVSTIDDQRSKDQRDGEDFLDILLQAQKDSTLDIPITRDN

IKAISL (0)

scaffold 4 269962-270249 (+) 396-497

DMFIGGSDTTAITVEWSMTELVKNPKVMRKAHEVRRVVGKKSKFEEDDIPQMAYLKVVIKETLRLHPPAPFFIP

RESIRAINVNGYHIPAKTNL

 

>CYP71AN22P maker-scaffold_16-snap-gene-13.28-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.45 eAED:0.61 QI:0|0|0|1|0|0|3|0|119

CYP71 augustus_masked-scaffold_16-processed-gene-13.0-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.23 eAED:0.23 QI:0|0|0|1|1|1|2|0|201

52% to CYP71AN1 cottonwood missing KYG motif
mid after C-helix, 55% to CYP83F1v1 Populus trichocarpa 
55% to CYP71AP1 cottonwood last part
88% to maker-scaffold_16-snap-gene-13.25

1328504 MAKQGILLPCSLPLLLLFSFVFLLRLRGCLVKLPLSPTRIPVIGNFHQLGTLPHRTLMALSQ

KYRPLMLLHLGSVPLLVSSLEMSMEITKTQDTNFATRPSTTAAKKLLYGCNDLGFAPYG

EY*RQMNKMSVLRLLSVKRVQSFRYIREEEVALLIEKISHACQLCNSINLSELLTIISGN

LISRAAFSSKFEEEDDNSRRIGPLTRVVMSLLGI

DMFIGGSDMKAITVEWSMTELIRNPKVMRKAQEEVRRVVGKKFKFEEDDIPQMAYLKAVT

KETLRLHPPAPFLIPRESTRAINANGYHIPAKTRVFIDVWAIQR 1327289

 

>CYP71AP7 maker-scaffold_7-snap-gene-69.23-mRNA-1a protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.23 eAED:0.26 QI:259|0.5|0.33|1|0.5|0.66|3|0|481

fusion

69% to CYP71AP1 cottonwood, revised seq complete
apparent ohnolog with CYP71AQ augustus_masked-scaffold_5-processed-gene-23.0-mRNA-1
possible gene loss in a cluster since this one does not have high percent ID
6937920

MDLTQWCLWETIPLQTLLPSSCLLTFIIILLGLVLIVKHQLYPTRNLNLPPGPSKLPIIG NLHQLGEMPHLSLFRLSQKFGPIIYLQLGEVPVMVVSSARTAKEVLKTHDLAFASRPQLF SAKHLFYNCTNIVFSPYGAYWRHIRKIAVLELLSAKRVQSYSFVREEEVARLVHRVASSY PSTTNLSKMLGLYANDVVCRVALGRGFSQGGEYDKYGFQKMLLEYQELLGGFSLGDFFPS MEWMHTITGLKSRLRRTFRRFDQFFNEVIEDHLSKHSSSRSRKEEHKDFVGILLDMQKNS DDLDTPLTLDNIKAIILDMFAAGTDTTFITLDWGMTELVMNPRVMEKAQAEIRSIVGDRR SVSEDDLPQMHYLKAVIKEIFRLHPPVPVLVPRESMELVTIDGYDIPKKTRIFVNAW 6936560

AVGRDPESWENPEVFEPERFMGTSIDFKGQDFQLIPFGAGRRGCPAITFGAASI ELAMAQLLHSFDWELPPGIEAKDLDMTEVFGISMHRICDLIVVAKPRFV* 6936248

 

>CYP71AP8P pseudogene

maker-scaffold_7-snap-gene-69.23-mRNA-1b

mid region 45% to CYP71AQ1 cottonwood
55% to CYP71AQ4 maker-scaffold_178-snap-gene-6.18-mRNA-1

6928681 AFAPYGEYRRKLRKI & 6928637

6928622 RSFRSIREEEVALMIASIAGYSSVPINLSDMVLSHLN 6928512

(29 aa gap)

QELLGCSTISDFLPWMGWINKINGLGAKLKKVF*ELDEFYENVIRDHID

(gap 93 aa)

YLKLVIKEGLRLHPPPPAPLPVPR*TIADCKINGYDIPAKTSVYKCTTIATDPKC &

E*FLHNNIDFKGLDFELLPFVAGRRGCPGTNFDIQVIELVLSNLFYTFDWELPEWVENRG

CGIVDTQGEIGLNI* 6927916

 

>CYP71AP9P scaffold 48 1210504-1210370 (-)

68% to JcCB0501871.10, 75% to CYP71AP1 cottonwood
88% to CYP71AP maker-scaffold_7-snap-gene-69.23

NFKGQDFQLIPFGAGRRGCPAITFGAASIEFDIAQRLHSFDWELP

 

>CYP71AP10P scaffold 149 75130-75441 (+)

60% to CYP71AP JcCA0223841.10, 61% to CYP71AP1 cottonwood
79% to CYP71AP maker-scaffold_7-snap-gene-69.23-mRNA-1a

YLKAVIKERFWLRPPLPVLVPRESMEHITTDGYGYDIPKKAQIFVNACAMGRYRESWENPEVFEPERFMGTSNDF

KGQDF*LIPFGVRRRGYPAITFGAESIEL

 

>CYP71AQ2 augustus_masked-scaffold_5-processed-gene-23.0-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.04 eAED:0.04 QI:0|1|0|1|1|1|2|0|535

56% to CYP71AQ1 cottonwood complete

MSSLLQVLEEKQTIPFHPFSLFLTILFSYFLFLFVFNGFSNFTRRSTQAKEYRLPPSPFK LPIVGNLHQLLLSSPNMHRTLRSLSQCHGPLMLLQLGNIPTVVVSSPDIAREILKTHDII FASRPKVIAAERLLYNYKDLASAPYGEYWRQVRKICILQLLSVKKVQSFRRVREEETALL IENIRRSCFSSPSLSAPVNLSESLVSLTNDIICRVAFGRKYSGGEGGRRFRRLMSEFGAL LGMFNVGDYIPSFAWVNYFNGLNTRLEKTFRELDCFLDQVVKDHVDRKKKKENGDGVDED DLVDTLLEIAEDGTIGIPLETENIKAIILDMFAAGTDTTYTVMEWVMAELLKHPEAMKEL QEEVRSVSGSGGKPIVTQDETERMGYLKLVIKETLRLHPPLALLVQREASEDVKIQGYDI PAKTRVIINAWAIGRDGGSWEEAEEFKPKRFLMSRNDLVDFNGREVRYIPFGAGRRGCPG TQFGMAVNELVLANLVNSFDWKLPGGASARDLDMTEGSGGTIHKKLPLLAVATPH

 

>CYP71AQ3 maker-scaffold_178-augustus-gene-4.24-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.05 eAED:0.05 QI:82|1|1|1|1|1|2|150|528

59% to CYP71AQ1 cottonwood complete

MSPWLQRLWPDGRQGIFLGTLPLSLIFLLSSIFLFLFSLGYRSRIKSHNLPPSPFRLPVI GNLHQLVSTSHRDLHSLAQRHGALMLLHLGNSPTLVVSSADTAREIMKTHDLIFSSRPKR SNSWRLLYNHKDVALAPYGEYWRQIRRICVLQLLSVKRVQSFQPVREQETALLIENIQRS CSSSPSSSALVNLSDALVSLTTDVICRVSFGRKYSGGGEGSKKFKQMLKELMYLLGVFNV GHFIPWLAWVDYISGLNARAEKCFREMDCFLEQVIEEHIHQGNKTGGGEEDLVDVLLAIA KDKTIGIPIERDNIKAIMLDMFVAGADTTHTAMEWAMAELLRHPEVMKELQEEVRNTSSG KPYVTEEEVEKMQYLKLVIKETLRLHPPVPLLVPRESTQDVKIEGYNIPAKTVVLINAWA IGRDPASWEEPEKFQPKRFLTSASNLNIDFKGNDFRLIPFGAGRRGCLGIQFAMVANELV LANLLHKFDWKLPGGSSGEDLDMTEASGTTAHKKHPLVAVAIPHQCQI

 

>CYP71AQ4 maker-scaffold_178-snap-gene-6.18-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.04 eAED:0.04 QI:0|0.5|0.33|1|0.5|0.66|3|269|504 
56% to CYP71AQ1 cottonwood complete

MVGGPTRPLSWSLSFILSDLLLVLLSVQFGLQKSNQQKQSPFRLPIIGNLHQLGSCLHRD LHSLAQRHGALMLLHLGNSPALVVSSADRAREIMQTHDLIFSSRPQTSNARRLLYNYKDV ATAPYGEYWHQVRRICVLQLLSVKKVQSFRSVREEETALLMENIQHSCSSSASSSALVHL SDATRWFLSRTMVALGRKYSGTERKKFKQMLRELLDLLGDIRVGDFIPWLAWVDYVRGMK SRVEKNFREIDAFLEKVIEEHIHGDHGGSEQDLVDVLLATAKDGSIGIPLERDSIKAIIL DMFSAGTDTTHTAMEWAMAELLRHPKVMKELQEEVRNVSSGKPYITEKEVEKMQYLKLVI KETLRLHPPIPLLVPRESTQDVKIEGYNIPAKTMVIINAWAIGRDPASWEEPEKFQPKRF LITSAGNNLIDFKGNDFQLIPFGAGRRGCPGTQFAITVNELVLANLLYKFDWKLQGGEDL

DMTESTGDTVRKKHPLVAIATPHY

 

>CYP71AQ5P pseudogene

snap_masked-scaffold_6-processed-gene-11.17-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.08 eAED:0.09 QI:0|0|0|0.5|1|1|2|0|165

54% to CYP71AQ1 cottonwood, N-term missing first 42 aa
84% to CYP71AQ maker-scaffold_178-snap-gene-6.18-mRNA-1

1101253 LHQLGSCLHRDLHSLAQRHGTLMLLHLGNSPALMVS STDRAREIMQTHDLIFSSRPQTSNARRLLYNYKDVATAPYGEYWRQVRRICILQLLSVKK VQSFRSMREEETTLLMENIQHSCSSTASSFALVNLSDALVSVTKY 1101675

LICRVALGRKKSGTE*EKFKQMLRELQNLLG &

SVGDFIPWLAWVDYVRGMNNRVE 1102034

 

>CYP71AQ6P scaffold 7 9399877-9399728 (-)

56% to CYP71 JcCA0311741.10
94% to CYP71AQ maker-scaffold_178-snap-gene-6.18

LHQLGSCLHRDLHSLAQRHCTLMLLHLGNSPALVVSSADRAREIMQIHDL

 

>CYP71AQ7P scaffold 52 2606350-2606940 (+)

49% to CYP71 JcCA0311741.10, 54% to CYP71AQ1 cottonwood
79% to CYP71AQ maker-scaffold_178-snap-gene-6.18

LHQLGSCSHRDLHSLAQRHGALMLLHLGNSPALVVSSVDRAQEIMQTHDLIFSSRPQTSNARHLLYNYKDVVTAPYGEFWRQVRRICVLQLLSVRRCNHFDR*ERKRPLLMENIQHSCSSLNSSSSLVNLSDALVSVTNDVICRVALGRKYSGTEREKFKKMLRELQDLLGDVSVGDFIPLLAWVDYVRRMKSRVEK

 

>CYP71AQ8P augustus_masked-scaffold_124-processed-gene-17.6-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.03 eAED:0.03 QI:0|-1|0|1|-1|1|1|0|207

63% to CYP71AQ1 cottonwood I-helix to end, pseudogene

1760929 DMFTAGTNTTYTLLEWVMAELLRHPGIMKEMQDEMRGIIGSRPNITEEDIEQMHYLKMVIK ETLRLHPPIPLLIPRESTQDVKIQGYDIPTKTRVIINSWAIMRDPLSWERAEEFHPKRFM NAAGSSIDFRGHDFQMIPFGAGRRGCPGKEFAAAINELVLANLLHKFDWTLPNRASGKDL DMEEDSGITIHKKSPLLVATPHYCYHE* 1760303

 

>CYP71AQ9P augustus_masked-scaffold_124-processed-gene-17.0-mRNA-1 protein Name:"Similar to CYP71AJ1 Psoralen synthase (Ammi majus)" AED:0.44 eAED:0.44 QI:0|-1|0|1|-1|1|1|0|95

56% TO CYP71BF1 Carica papaya 
68% to maker-scaffold_124-snap-gene-17.45

1773846 EIRVIIVSKLNIAEEDIEQMHYLKMVIKETLRPHPPIIFLC*FEGNQLKISKYRCNH

HQVPGRL*FMRDPLAWEKSEEFHPKRFLNADSSCNDFRGHNFQLIPFGLVRRGCPGMEFS

VAIDELVLANHLHMFDWTLPNGASGKDLDMTEASGITIHKKSIS* 1773361

 

>CYP71AQ10P maker-scaffold_124-snap-gene-17.45-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.18 eAED:0.18 QI:550|0|0.5|1|1|1|2|0|331

58% to CYP71AQ1 cottonwood C-term part, missing I-helix motif
65% to CYP71AQ maker-scaffold_178-augustus-gene-4.24-mRNA-1

1781006 MSGIVQLLQQNTLSHPISSLVLLLLFFLFVFRFSCRTRRKQVKLPPSP

WKLPVIGNLHQLGMLPHRTLQSFPRRHGPLMLIHLGSQPTLVVSSAEVAQQIMKTHD

LIFSSRPKSSIGDRLFYSSADIAFSPYGEYWRQMRRICILQLLSTKRVQSFRSVRKEETA

LLVEKIQQSCYSSPSLSA &

MVDLTEMLVSLTNDVICRVAFGRKYRGDEGGKRFMKLMMELGSLLGTFCVRDFIPSLAWV DYLSGLDARVDKISRDLDCFLDQVIKDHVDGEKRNDGCGGEDDFVDILLRVERDSTIGIA

VTRDNIKAIVL (0)

DMFAAGT &

TPHTLLEWAMAELLRHPEIMKEVQDEVRRIIGSKPSITEEDIEQMHYLK MVIKETLRLHPPAPLLVPRESTQDVKIQGYDIPAKTRVIINAWAIGREPLSWERAEEFHP MRFMNADSSCIDFRCHNFQLIPFGAGRRGCPGIEFAVAMDELVLANLLHMFDWTLPNGAS GKDLDMDEASGLTIHKKSPLLLVATPHNNIE* 1778395

 

>CYP71AQ11P augustus_masked-scaffold_124-processed-gene-17.8-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.27 eAED:0.27 QI:885|1|1|1|1|1|2|425|208

64% to x CYP71AQ1 cottonwood mid to PKG

1802288 ISSLVLLLLFFLFVFRFSCRTRRKQVNLPPSSWKLPVIGNLQQLGMLPHRTLQSFARRHG

LLMLIHLGSQPNLVVSSAEVAQLIMKTHDLIFSSRPKSSIADRLFYSSVDIFF &

PYGEYWRQMRRICILQLLSTKRVQSFRSVRKEETALLVEKIQQSCYSSPSLSAMVDLSE

MLVSLTNDVICRVVFGR*YGGDEGGKRFKKVLTEFVSLMGIFCVRDFIPSLGWVDYLSG

LDARVEKNFRELDCFLDQIIKDHVDGDKRNDGCGGEEDFVDVLLGVEKDSTVGITVTRD

SIKAILL (0)

DMFGAGTDTTHTVLEWAIAELLRHPEIMKEVQDEVRMIGSKPSITEEDIEQMHYL

KMVIKETLRLHPPLPLLVPRESTQDVKIQGYDIPAKTRVIINAWAIGREPLSWES &

EEFHPRRFMNADSSCIDFRGHNFQLIPFGAGRRGCPGMEFAVAMDELVLANLLHMFDWT

LPNGASGKDLDMEEASWITVHKKSLLVVVATPHNNNVIVNGFSC* 1800570

 

>CYP71AQ12P scaffold 222 711136-711537 (+)

50% to CYP71 JcCA0204311.10, 50% to CYP71AQ1 cottonwood
87% to CYP71 augustus_masked-scaffold_124-processed-gene-17.8

SPSRELNWGYMRRICIL*LPSKKRVQ

GRGLRSCLWNLGHCWVLFCVKDFIPSLRWVDYLSGLDARVEKNFKELDCFLDQVINYN

 

>CYP71AQ13P scaffold 62 827803-827402 (-)

40% to JcCB0095131.20, 65% to CYP71AQ1 cottonwood
84% to CYP71 augustus_masked-scaffold_124-processed-gene-17.8

DEGGKRFKKLLMEFVSLLGTFCVKDFIPSLGWVNYLSGLDARVENNFKELDCFLDQVINYN

 

>CYP71AQ14P scaffold 1

54% to CYP726 JcCB0542951.10
56% to CYP71 augustus_masked-scaffold_124-processed-gene-17.8

10692995-10692783 (-)

304 PVFNAGTDTTGTTLEWAMAELIKNPTVMKRAQFEVR 340 &

10692775-10692452 (-) aa 342-374

VVGEKPRVEEDLRQMEYLHSVKKETMRLHPLLP &

10692675-10692313 (-) aa 376-498

LLLPHESTAAIELQGYHIPKGTRILIWAIGRDPKSWTSPELFWPERFTDSSSISWGAIFSLIPFGAGRRICPGIKFG

MVMVEIALANLLHRFDWDLADGGKKEALDMTEGCGIGTHKNFPLVPIKPLP

 

>CYP71AT60 snap_masked-scaffold_253-processed-gene-5.8-mRNA-1 protein Name:"Similar to CYP71A9 Cytochrome P450 71A9 (Glycine max)" AED:0.29 eAED:0.29 QI:0|0|0|0.4|1|0.6|5|0|375

56% to CYP71N1 Musa acuminata (banana)
55% to CYP83F1v1 Populus trichocarpa

identical to augustus_masked-scaffold_64-processed-gene-0.2-mRNA-1

duplicate seq

54% to maker-scaffold_16-snap-gene-34.10
56% to CYP71AS4v2 Vitis, 56% to CYP71AT7 Vitis
619805

MDVSILCLLPILILLLSILFILQTKK

MVIVERNVNVPPGPSRLPIIGNLHQIGKLPHRSLWQLAKQHGPLMHLQLGHVSTVVISSA KMAEEVLRTHDLQFCSRPPLVGPRKLSYQFKDIAFSPFGEYWRDLKKICFVQLFNTKKVQ SFQFIRENEVDLMXDLIARSSCSSPGTPINISEIMLSLVNNIICRIALGKRFQDEVCTRS RFQDMLQEAQALLGGFYVEDYFPSIGWIIDVLIGQTSRLEKNFREMDDFYQSVIDEHLNS ETQEVLGHEDIIHVLLQIRKDAIGGIDLTIDHIKAALMDIFVAGTDTSTAALVWGMTELM KNPRVMRKAQDEIRNAIRKKRMVEESDLEQLQYLRAVVKEILRMHPPGPLLAPRETMEEC KISGYNIFPKTRVIVSPWAIGRDPKCWENPEEFYPERFMDGSIDFKGLHFELVPFGAGRR HCPGINLGAAIVTLALSNILYSFDWKLPCGMNKEDIDMEETPGLTTHKKLALHLVPISYN

QHL* 618135

 

>CYP71AT60 augustus_masked-scaffold_64-processed-gene-0.2-mRNA-1 protein Name:"Similar to CYP71A9 Cytochrome P450 71A9 (Glycine max)" AED:0.07 eAED:0.07 QI:0|1|0|1|1|1|2|0|483

55% to CYP83F1v1 Populus trichocarpa
56% to CYP71AS4v2 Vitis, 56% to CYP71AT7 Vitis
54% to maker-scaffold_16-snap-gene-34.10
54% to maker-scaffold_76-snap-gene-12.37

3773 MDVSILCLLPILILLLSILFILQTKK

MVIVERNVNVPPGPSRLPIIGNLHQIGKLPHRSLWQLAKQHGPLMHLQLGHVSTVVISSA KMAEEVLRTHDLQFCSRPPLVGPRKLSYQFKDIAFSPFGEYWRDLKKICFVQLFNTKKVQ SFQFIRENEVDLMXDLIARSSCSSPGTPINISEIMLSLVNNIICRIALGKRFQDEVCTRS RFQDMLQEAQALLGGFYVEDYFPSIGWIIDVLIGQTSRLEKNFREMDDFYQSVIDEHLNS ETQEVLGHEDIIHVLLQIRKDAIGGIDLTIDHIKAALMDIFVAGTDTSTAALVWGMTELM KNPRVMRKAQDEIRNAIRKKRMVEESDLEQLQYLRAVVKEILRMHPPGPLLAPRETMEEC KISGYNIFPKTRVIVSPWAIGRDPKCWENPEEFYPERFMDGSIDFKGLHFELVPFGAGRR HCPGINLGAAIVTLALSNILYSFDWKLPCGMNKEDIDMEETPGLTTHKKLALHLVPISYN

QHL* 2103

 

>CYP71AT61P scaffold 120 1256471-1256229 (-)

46% to JHS05H19r.10, CYP71B3 Arabidopsis thaliana
65% to CYP83 augustus_masked-scaffold_64-processed-gene-0.2

EKKMVEESDLEHLQ*LKSVVKEILRIHPLDTLLSPQETTEECKISGYNIYPNAIRAIVSHWTIRTDPESWEIKPK

EFYPEK

 

>CYP71AT62 maker-scaffold_16-snap-gene-34.10-mRNA-1 protein Name:"Similar to CYP71B6 Cytochrome P450 71B6 (Arabidopsis thaliana)" AED:0.17 eAED:0.17 QI:30|0|0.33|0.66|0.5|0.33|3|0|487

57% to CYP71AT3 Vitis, 59% to CYP71AT7 Vitis, 60% to CYP71AT8 Vitis
53% to CYP83F1v1 Populus trichocarpa, revised seq complete 
51% to CYP71AT1 Lycopersicon esculentum
50% to CYP71N1 Musa acuminata (banana)

3425968 MLQLQLLAFLLVFPLYFLFRLLKHGRFHVIPRNGILPPGPPKLPFIGNLHQLSGSSPHRV LRQLSMRYGALMSLQLGFVPTLVVSSATMAREFLKTHDLNFATRPSLLCQQKLSYNGSDL AFAPYGDHWREVKKICTLELFSAKRVQSFRFIREEEISLLVKSISQLASSSSSANLTQMV FDLTNNIICRIAFGKSFKHEGCQKSSFHELLFEAQALMGRFAFTDYFPVVGWLFDALTGL HARLKRNCRGLDLFYQHVIDDHLDPRRPNPEKEDITDILLRMQKDGLSSIDLNMNDIKAMIM (0)

NIFFAGTDTSSAVVIWAMTELSKNPKVMQK

AQDEIRGLIGNKGYVDEDDLHQFHYLKCVIKETLRLHPPGPLLVQREARNHCTIDGFD IYPKTRVIINAWAIGMDPETWENPEEFLPERFSDGSVDFKGQHYEYIPFGSGRRMCPGMN LGMVTVEHTLSNLLYSFDWDLPVGIKMEDIDMDELPGVAVHKKNDLRLLPINFNGH* 3428709

 

>CYP71AT63 maker-scaffold_68-augustus-gene-4.12-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.05 eAED:0.05 QI:27|1|1|1|1|1|2|297|559

56% to CYP71AT3 Vitis, 57% to CYP71AT8 Vitis
55% to CYP83F1v1 Populus trichocarpa
51% to CYP71AT1 Lycopersicon esculentum (tomato)
51% to CYP71N1 Musa acuminata (banana)
79% to CYP83 pseudogene maker-scaffold_229-augustus-gene-0.8 not ohnologs, no synteny
78% to CYP83 maker-scaffold_68-snap-gene-5.25 same scaffold tandem duplication
66% to maker-scaffold_16-snap-gene-34.10

MSMFLPFLLALPLLFLVFLSLKNIKKGYEKPRNNKNLPPGPPKLPFIGNLHQFSTTSSLNHRRLHQLSMRYGP LMSLQLGSKPTVVISSARIAREVLKTHDLEFASRPSFVCQQKLSYGGHDIAFAPYGECWR ELRKICITELFNTKRVQSFRCIREDEIFQLIKSISGQLAASSSTPVNLTDVALALSNNII CRIAFGKTFQHESCYKCSFSQLLKEAQALFVSFAFADYFPSLGWVFDILSGLPRRLERNF QGLDLFYSQVIEEHLDPKRPKPQEEDIADVLLRMHKDHSSSLHLKMEHIKALFMNIFIAG TDTTAATVVWAMSELAKKPIAMKKVQDELRSLVGNKGHIDEDDVNQLHYLKYVVKETLRL HPPTPLLLPRETINHCKIDGXDIYPKTQVFVNGWAIGMEPEIWKNPEEFIPERFIDGSVD FKGQHFEFIPFGSGRRICPGMHVGVATVELILANLLYSFNWELPDGMKNEDIHMDELPGI

TVKKKTPLLLLAINTYNEF

 

>CYP71AT64P maker-scaffold_68-snap-gene-5.25-mRNA-1 protein Name:"Similar to CYP71A26 Cytochrome P450 71A26 (Arabidopsis thaliana)" AED:0.12 eAED:0.12 QI:0|0.2|0|0.83|0.2|0.16|6|0|472

51% to CYP83F1v1 Populus trichocarpa
88% to CYP83 pseudogene maker-scaffold_229-augustus-gene-0.8
pseudogene, frameshift = &
496129 MLFHDLTMSLVLPFLLCLPLFFFFFSLKKKRRVDKELVGTGTGLLPPGPPKLLFIGNFHQ FTTTSSLHRRLHHLSRRYGPLMPLQLGSRPTVVVSSARIAKEIMKTHDLEFAGRPSFVCQ &

(16 aa deletion)

KNWRELRK

ICITELFSTKRVQSFRCIREDEIFQLIKSISVSRFLQSSTPVNLTDVALALSNNIICRIAFGK TFQHESCYKCSFSQLLKEAQALFINFAFADYFPSLGWVFDILSGLSRRLERNFQGLDLFY SQVIGEHLDPKRPKAEKENITDILLRMHKDQSISVDLKMEHIKGVLMNIFIAGTDTNSAA VVWAMTELAKKPIVMKKTQDELRGLIGNKGYVDEDDLNQLHYLKCVVKETLRLLHPPAPL LVPRETRNHCRIDGYDIYPKTQ 490582

VIVNAWAIGMDPEIWKNPEDL &

490532 FIPERFMDGNIDFTGQHFEFIPFGAGRRICPGMHLGVT IVELTLANLLYSFNWELPDEMKKEDIDMDELPGISVHKKNPLCLLAISYI* 490257

 

>CYP71AT65P scaffold 68 510115-509897 (-)

56% to JcCB0199391.10, 49% to CYP71AH1 tobacco
64% to CYP83 maker-scaffold_68-snap-gene-5.25

MRKIPVTELFSTKRVQSYRSIREEEIFHFSIDQVDFSIICLFHSCELYLTDVALVLTKNIICRIAFGKTFQHE

 

>CYP71AT66P Scaffold 3 8264767-8264874 (+)

74% to JcCA0149291.10
84% to scaffold 68 510115-509897 (-)
81% to CYP83 maker-scaffold_68-snap-gene-5.25 aa 180-206

EMRKISITELFSTKGVQSFRSIREEEI

 

>CYP71AT67P scaffold 26 1673180-1673287 (+)

50% to JcCB0123521.10
61% to CYP83E1 Medicago sativa
68% to CYP83 maker-scaffold_68-augustus-gene-4.12
84% to scaffold 279 398298-398155 (-)

RYDPLISLQLGSKPAVVVSSARITVKVMKEVDFSR

 

>CYP71AT68P scaffold 27 4390974-4390861 (-)

60% to CYP83F JcCA0154731.20
63% to CYP83G1v1 Medicago truncatula
72% to CYP83 maker-scaffold_68-augustus-gene-4.12

FSTRYGLLISLQLGSKPAVVVSSARLAMKIMKTHDLEL

 

>CYP71AT69P scaffold 29 4665208-4665077 (-)

51% to JcSR432238r.10, 56% to CYP71J1 Asparagus officinalis
69% to CYP83 maker-scaffold_68-augustus-gene-4.12

FWNNLKEFIQERFMDRSVDFKGQHFEFILFAADRTICHGMHFGF

 

>CYP71AT70P scaffold 40 108620-108763 (+)

63% to JcCB0501871.10, CYP71J1 Asparagus officinalis
72% to CYP83 maker-scaffold_68-augustus-gene-4.12

DLEIWKNLEEFIPETFMDRFVDFKGQPFEFILFEAGRRICLVMHFGFG

 

>CYP71AT71P scaffold 76 90965-90867 (-)
66% to JHS05H19r.10, 66% to CYP797C1v1 Selaginella mollendorffii
60% to CYP71AT1 Lycopersicon esculentum 
81% to CYP83 maker-scaffold_68-augustus-gene-4.12
87% to scaffold 307 70207-70055 (-)

DPEI*KNPKEFIQERFMDRSVDFKGQHFEFIPF

 

>CYP71AT72P scaffold 94 35615-35514 (-)

50% to CYP83F JcCA0154731.20, 56% to CYP71AT1 Lycopersicon esculentum
65% to CYP83 maker-scaffold_68-augustus-gene-4.12

RYGXLVSLQLGSTPVVVVSSARIAMKVMNEVDFS

 

>CYP71AT73P scaffold 207 950198-950016 (-)

68% to CYP83F JcCA0154731.20, 63% to CYP83D1 Glycine max
73% to CYP83 maker-scaffold_68-augustus-gene-4.12

VVVSSARMAREIMKTHDLDFSSRPSLLCQQKLSYGGTDMAFAPYGDFWREIRKICVVELFS

 

>CYP71AT74P scaffold 221 585858-585950 (+)

50% to JcCB0741061.10, 65% to CYP83E1 Medicago sativa
72% to CYP83 maker-scaffold_68-augustus-gene-4.12

PLISLQLGSKPAVVVSSARIAMKVMKEDDFS

 

>CYP71AT75P scaffold 229 67197-67045 (-)

75% to JHS05H19r.10, 55% to CYP71BC1 Vitis vinifera
53% to CYP83 maker-scaffold_68-augustus-gene-4.12
67376 QLHYPMQGSLHFISQK*NIYKPLAPRKTRNHCKIEHG*DIYPKTQVIVNG*AIGMNLEMW &

EHKLEFIPERFMDGSIDFKGLHFEFIPFAFCPVVIYDELGWEIHQMIIAKL

 

>CYP71AT76P scaffold 279 398298-398155 (-)

48% to JcCB0537261.10, 58% to CYP83G1v1 Medicago truncatula
72% to CYP83 maker-scaffold_68-augustus-gene-4.12

RYGSLVSLQLGSKPAVVVSSARITLKVMKEVNF*IDQVNFSRIFFNRP

 

>CYP71AT77P scaffold 307 70207-70055 (-)

70% to JcCB0095131.10, 68% to CYP71BC1 Vitis vinifera
80% to CYP83 maker-scaffold_68-augustus-gene-4.12

DPKIWKNPKEFIQERFMDGSFDFKGQHFEFIPFGEG*RICPVGFGVM*SEV

 

>CYP71AT78 maker-scaffold_76-snap-gene-12.37-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.03 eAED:0.03 QI:62|1|1|1|1|1|2|316|522

54% to CYP83F1v1 Populus trichocarpa complete
50% to CYP71AT1 Lycopersicon esculentum (tomato)
50% to CYP71N1 Musa acuminata (banana)
64% to CYP83 maker-scaffold_76-augustus-gene-12.35-mRNA-1a
60% to maker-scaffold_16-snap-gene-34.10

MLRQIPTVSVQTMLIFLCFLLVFTSFLLLLLLSRNNKDGASSRKGLLPPGPPRFPVIGNL HQLGKFSLHRALHELSRRYGPLMSLQLGCVSTVVVSSARMAREVLKTHDLQFADRPFLVS VQKLTYNGLDLTFSPYGEYWRELRKICIIGFFSIKRVQSFQSIREDEVSILIKSISQLAD SSKLVNLSKMMFSTTSNIICGIAFGKNFHEEGCERSTFYGLLDEYQVSMGSFAFANYFPS LGWILDTLTGFNSRLERIFQGFDSFFRQVIEEHLDPKRLKHDRGDITDLLLQMHKDHTSE IDLTLDHIKAVMTDILLAGTDTTTATLVWAMTFLAKHPRVMEKAQEEVRNLIRNKQNISE YDLHQLHYLKCVVKETLRLQPAAPLLVPRESRKQCNLDGYKIHPKTQILVNAWTIGRDPE FWENPEEFRPERFINSSIDFKGQCFEYIPFGSGRRICPGINFGMVIVELVLANLLYSFDW ELPPGIKTADIDMEELSGLTVHKKNALCLLASNYTEHCTSLL

 

>CYP71AT79 maker-scaffold_76-augustus-gene-12.35-mRNA-1a protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.09 eAED:0.09 QI:0|0.4|0|0.83|0.6|0.33|6|0|1111

3 genes fused

52% to CYP83F1v1 Populus trichocarpa complete, fused
49% to CYP71N1 Musa acuminata (banana)
66% to CYP83 maker-scaffold_76-snap-gene-12.37

MLLLLCSLVFPPLILVLLLKIRASTRNGVLPPGPPRFPIIGNLHQLSNSTLHCTLQQLSR RYGPLVYLQLGGVPAVVVSSAEMAKEILKILDLESSGRPFHANVYKVTYKKSDMVFSSYG EYWRERRKICIIALFCTKSVQSFRFIREDEISILLKSISKFASASNPVNLSEMIFSTANN IICRIAFGKSFPHESSEGSAFYEMLDERHALAGRFAFANYFPSVGWMLDALTGLNAKLER DFQRFDSFHKQIIEDHLDPKRTKPEKEDIVDTLLRMQKDKTSTIDFTLDTIKAILMDILI AGADTTTSTLVWAMTLLAKNPTVMKKAQNEVRSLIGNKGKITEDDLHQFHYLKCVIKETL RLQPPAPLLVPRETMKHCIIDGYHIYPKTQLLVNAWTIGRDPEYWENPEEFIPERFTKSS IDFRGQHFEFIPFGSGRRICPGMQLGVVIVELILANLLYSFNWELPEGIKEEDIDMEALF AIIMHKKNNLHLVATKCNDHHYLNSQISTQI

 

>CYP71AT80P maker-scaffold_76-augustus-gene-12.35-mRNA-1b

50% to CYP83F1v1 Populus trichocarpa, fused
72% to maker-scaffold_76-augustus-gene-12.35-mRNA-1a
91% to CYP83 pseudogene maker-scaffold_76-augustus-gene-12.35-mRNA-1c
pseudogene

1258286 MFLLLSSLALLTLLILFLISKSHKFHGSS RSRLLPPGPSGLPLIGNLHQLGKSPLHCTLHQLSRRYGPLMYLQLGCVPAVVVSSAGMAK EIFKTHDLESSGRPLPVTIQKETYNRLDLVFSPYGEYWREVRKICIIILFCTKSVQSFRF IREDEISILIQSISKSAATSNPINLSEMIFSTANSIICRMAFSKSFHRGASETSSFYEML DERHALIRSFAFANYFPYVGWMLDSLTGLNTRLERNFQQFESFYRQTIEGHLDLKRQNPE KEDIIDTLLRMQKDKSSAIDFTLDHIKAIVT (0)

DILIAGVDTTTATLVWALTLLAKNPKVMKKAQNEVRSL 1259712

1259985 SFNWELPKGIKEEDIDMEGSLGITMHKKNALHLVATNYNDHH 1260110

 

>CYP71AT81P pseudogene

maker-scaffold_76-augustus-gene-12.35-mRNA-1c

49% to CYP83F1v1 Populus trichocarpa, fused
91% to maker-scaffold_76-augustus-gene-12.35-mRNA-1b

1265777 MFLLLCSLLLLTLLILFLISKSHIFHGSSTSRLL

PPGPTGLSLIGNLHQLGKSPLHCTLHQLSRTYGPLMYLQLGCVPAVVVSSAGMAKEIFKTHDLE SSGRPLPVTIQKETNNRLDLVFSSYGEYWREVRKICIIILFCTKSVQSFRFIREDEISIL IESISKSAAALNPVNPSEMIFSTANSIICRMAFSKSFHHGASETCSFYEMLDERHALIRS FAFSNYFPYVGFVLDSLTGLNTRLERNFQQF 
*SFYRQAIEEHLDPKRQKHEKEDIIDTLLRMQKDKSSTIDLTLDHIKAIVT (0)

DILVAGVDTTTATLVWALTLLAKNPKVMKKAQNE 1267154

(gap)

1267493 SFNWELPKGIKEEDIDMEGSLGITMHKKNALQLVATNYNYHH 1267618

 

>CYP71AT82P scaffold 62 2663793-2664149 (+)

55% to CYP83F JcCA0154731.20, 57% to CYP71N1 Musa acuminata
88% to CYP83 maker-scaffold_76-augustus-gene-12.35-mRNA-1a
EDIVDTLLRMQKDKTSTNDLTLDTIKEILMDILMAGADTTTATLVWVMTLLAKNPIVMKKAQNEVRSLIGKKGKITEDDLHQFHYLKCVIKETLRLQPPVPLLVPRETMQHYTVDGYNI

 

>CYP71AT83P pseudogene maker-scaffold_229-augustus-gene-0.8-mRNA-1

protein Name:"Similar to CYP71A9 Cytochrome P450 71A9 (Glycine max)" AED:0.11 eAED:0.11 QI:140|1|1|1|1|1|2|375|368

50% to CYP83F1v1 Populus trichocarpa (cottonwood)
stop codon is missing, frameshift at &
88% to CYP83 maker-scaffold_68-snap-gene-5.25
73659

MSLVLPFLLCLPLFFFYFSLEKKRRVDKEPAGTGTGLPLPGPPKLLFIGNFHQFTTSS &

SSLHRGLRHLSMRYCPLLPLQLGSRPTVIVSSTRIAREIMKTYDLEFAGRPSFVCQQKMSYGGHDIAFAPY GEYWRELRKICITELFSTKGVQSFRCIREDEIFQLIKSISGPLAASSSTPVNLTDVALTL SNNIVCRIAFGKTFQHESCYKCSFSQLLKEAQALFVSFAFADYFPSLGWAFDILSGLSRR LERNFQGLDLFYSQVIGEHLDPKRPKPEKENITDILLRMHKDQSISVDLKMEHIKGLM
NIFIAGTDTNSAAVVWAMTELAKKPIVMKKAQDELRGLIGDKGYVDEDDLNQLHYLKCVVKE TLRLHPPTPLLVPHETRNHCRIDGYDIYPKTQVIVNGWAIGMDPEIWKNPEDL (0)

FIPERFMERFMDGNIDFKGQHFEFIPLEAGRRICPGMHLGVTIVELTLANLLYSFNWELPD

GMKKEDIDMDELPGISVHKKNPLRLLAISYI 69983

 

>CYP71BG6 maker-scaffold_5-augustus-gene-38.10-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.04 eAED:0.04 QI:91|1|1|1|1|1|2|257|522

69% to CYP71BG1 Solanum tuberosum

MEDLTAFFTLSVSVIITVLVVTLTKWNRSPAITPPSPPKLPILGHLHLLTDMPHHSFSQL AQKLGPIIYLQLGRIPSLVISSARLAREVLKTHDHAFASRPQIIAAQYLSFGCSDVTFSA YGPYWRQARKICVTELLSSKRVSSFQRIRDEEVNLLLASLSALSGKETDMSHRFFSLANN VLCRVAFGSRYVDDESRVEGAGGSKSRLPEILTEAQALFAGFSIGDFYPALEWVNWLTGL KRRLERNLGDLRTVCDEIIKEHLEKRKTSSGSAATTDDASDREDFVDVLLRVQKGGDLEV PITDDNLKALVLDMFVAGTDTTSATLEWAMTELARHPDVMKKAQTEVRSVFGSKGRVEEG DLQQLVYMKAVIKETLRLHPPAPLLVPRESIEKCVLDGYEIPAKTRVFINTYAIGRDPLS WEHPLEYNPERFIGTNIDVKGQDFELLPFGGGRRGCPGYSFGLATIEIALARFLYHFDWA LPNGVTADDVDLTEIFGLATRKKVALLLVPTTIKDYEFKRTG

 

CYP72 family (10 genes, 3 pseudogenes)

 

>CYP72A226 maker-scaffold_3-augustus-gene-9.23-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.06 eAED:0.06 QI:28|1|1|1|0.75|0.8|5|33|517 
NNU_001352
83% to 9.26 = NNU_001351, tandem dupl. after WGD
58% to CYP72A5 Zea mays complete
MAELFIAVILVLCVLVLSWAWSVLYSIWWRPMKLEKCFREQGIEGPPRIWLHGNLKDEVR MRNEALSKPMNLSHDIAPRVVPFVHQTIEKYGNMSVTWFGRTPRINVMDPDLIKDILSNK FGQFEKPKSNPLIRLFVDGLVSHEGEKWAKHRRIINPAFHIEKLKRMLPAFYTSCFEMIT KWEKLVALEGSCELDIWPELQNLTGDVISRTAFGSSYDEGRRIFQLQNEQAKIVMDVALS IYIPGYRLLPTKRNNRMKEIDREVRGLLRRIVNKREKAIKLGEASKDDLLGLLLESNFKE IREHGNEKNIGMNVDEVIEECKLFYFAGQETTSNLLVWTMVVLSMHPEWQMRAREEVLQS FGKDKPDFDGINHLKVVSMILYEVLRLYPPAVALTRQTYKKVKLGDVYLPPRVELSLPTI LIHHSRELWGEDAQEFKPERFLGGVSKAANNQVSFIPFGWGPRICIGQNFAMIEAKMALA LILQHFSFELSPSYAHAPCTIITLQPQYGAQIILHKL 
 
>CYP72A227 maker-scaffold_3-snap-gene-9.26-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.09 eAED:0.09 QI:0|1|1|1|0.75|0.8|5|5|517 
NNU_001351
62% to CYP72A5 Zea mays complete
MAELLIVVILAFPVLILSWIWSVVYSIWWKPMKLERNLREQGLKGPPHRLLSGNLKDELR MRKEAWSRPMNLSHNIVPRVVPFTHQTIKTYGKMSVTWFGRTPRVNIMHPELIKDILSNK FGHFEKPKLNQLIKLLANGLANYEGEKWAKHRRIINPAFHIEKLKRMLPAFYTSCSETIT RWEKLVALKGCCELDVWPEFQNLTGDVISRTAFGSSYDEGRRIFQLQNEQAKLVVQAALS IYIPGYSLLPTKRNNRMKEIDREVRGLLRGIINKREKAIKLGEASQNDLLGLLLESNFKE IQEHDNAKNLGMNIDDVIEECKLFYFAGQETTANLLVWTMVVLSMHPEWQIRSREEVLQA FGKDKPDFDGLNHLKVVTMILYEVLRLYPPAVILTRHTYKKIKLGGIYLPPGVELLLPTI LIHHSRELWGEDAQEFKPERFSSGVSKATKNQVSFFPFGWGPRICIGQNFAMTEAKMALA LILQQFSFELSPSYAHAPYTIITLQPQYGAQIILHKL 
 
>CYP72A228 maker-scaffold_3-augustus-gene-9.24-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.07 eAED:0.07 QI:0|1|0.8|1|0.75|0.6|5|202|527 
NNU_001350
65% to CYP72A226, 67% to CYP72A227
54% to CYP72A5 Zea mays complete
MNMIGEYFFISSAFLIFGLILLWAWRFLNWVWLKPKKLERFLREQGIKGHSYGLLYGTLR EESRMMKEVQSKPTNLSHDIAPRVLPFIHQTFKDYGRTSLCWIGTSPRVNILDPTLIRDI LSNKFGQFQMPKLNPLVRLLVTGLLSYEDDQWAKHRRIISPAFHQEKLKLMLPAFYASFA ELVSRWNKLTTPKGSCELDIWPEIQNVTTDVISRALFGSGYEEGQKIFQLQNELSKLTLQ VLQSVYIPGFRFLPTKKNNRMKEIEKEIQTVLTGIINKKEATPSVGEVSSSDLLSLLIDS NKNYIQEHGSKKNAGMTIKEVIEECKLFYFAGQETTSNLLVWTMVVLSMHMDWQTRAREE VLKFFGNDIPSYGGLSHLKIVTMILYEVLRLYPPTVTIGRSTYKNTKLGEISLPPGVHLE MPILLLHHDLEFWGEDAQEFKPERFAEGVSKATNNQVSFFPFGWGPRICIGQNFAMTEAK MALAMILQHFSFELSPSYTHAPCFVLTLQPQYGAQIIFHKLEHASFS 
 

>CYP72A229P scaffold 3 894797-894528 (-) aa 5-94

85% to CYP72A maker-scaffold_3-augustus-gene-9.23
exon 1 upstream of maker-scaffold_3-augustus-gene-9.24

LFVAVISVLCVLILSWTWRVLYSIWWRPMKLEKWLREQGIKGPPHIWLHGNLKDEVRMRKEAWSKPMNLSHDIAP

RVVPFVHQTVEIYGK

 

>CYP72A230P scaffold 3 879095-878820 (-) aa 3-95

62% to CYP72A maker-scaffold_3-augustus-gene-9.24
exon 1 upstream of maker-scaffold_3-augustus-gene-9.24

ELLLISSALLFGLVLSWACRIVNWVWWRPKKLEKHLREQGIKGLPYRFLYGSLKENQRLVMEARSKPTNLSHDIVPRVAPIYHQLVKAYGNL

 

>CYP72A231a scaffold 3 1028894-1029181 (+) aa 1-96

65% to CYP72A maker-scaffold_148-augustus-gene-8.22
possible N-term to maker-scaffold_3-snap-gene-10.13
MGELEFMDWVVISSVLILSWVAIVLYWIWWRPKKLEQRLKQQGIKGHPYRLLFGNLREEMRLEKEAMAKPISLSHNIVPRVIPFVHQTIQNY (1)

 

>CYP72A231b maker-scaffold_3-snap-gene-10.13-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.08 eAED:0.08 QI:0|0.66|0.25|1|0.33|0.5|4|0|416 
NNU_001355
59% to CYP72A5 Zea mays missing the N-term
73% to maker-scaffold_148-augustus-gene-8.22
72% to maker-scaffold_3-snap-gene-9.26

1042893 GRMSISWFGRTPRVYITDPELIKEILFTKFGHFERPKPNPLTKSFLRGLLSYEGEKWAKHRR LINGAFHLEKLKRMLPAFYASCSDLVTRWDSLIASKGSCELDVQPELQCLTGDIISRAAF GSSYEEGRRVFQLLNEQLNLVIQSAMFLPTKRNNRMKETRRELRTILEGIVSKREKVIKM GETTTDDLLGLLLESNLKEIQEHGNLKNVGMSIDEVIEECKLFYFAGQETTSVFLTWTMV VLSMHSEWQSRAREEVIQVFGKNKPDFDGLNQLKIVTMILYEVLRLYPPATIFGRHTYKE VRLGNICLPMGVHLSLPIILLHHSHELWGEDAQEFKPERFSEGVSKATKNQLSFFPFSWG PRICIGQNFAMIEAKMALTLILQHFSFHLSPSYTHAPHTVASLHPQHGAQIILRKL* 1045704

 
>CYP72A232P maker-scaffold_3-snap-gene-11.22-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.17 eAED:0.17 QI:0|0.33|0.2|0.6|0.66|0.4|10|0|510 
NNU_001359
59% to CYP72A5 Zea mays missing the N-term
71% to maker-scaffold_3-snap-gene-9.26
1178132 GKISFFWVGTSPRVTIVEPNLIRDILSN KLGHFEKPKLNPLVKLFTTGLANYEGEQWAKHRRIINPAFHQGKLKRMLPAFHTSCHELV SRWEELATPEGSCELDVWPEFQNLTGDAISRTAFGSNYEEGKRIFQLQNEQAKLILQHLQ SIYIPGVRFLPTTRNNRIKEIERELQTLLRYIINKREEALKLGEASKDDLLSLLIESNQS EIQEHGNISNAGMSIEEVIEECKLFYFAEQETTSNLLVWTMIVLSKHVDWQMRAREEVLQ VFDNNKPNHDGLNHLKIVTMIFYEVLRLYPPAFLLLRSIYKKVKLGHFTLPPGVQLALPT ILIHHDRGLWGEDAEERDFKCNKEPSLLLPVWLGPRICIGQNFAMIEAKIALAMILQRFS FVLSPSYAHAPSTVITLQPQYGAQIILHKL*
 
>CYP72A233 maker-scaffold_161-snap-gene-1.18-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.11 eAED:0.11 QI:0|1|0.6|1|0.75|0.6|5|0|501 
53% to CYP72A7 Arabidopsis thaliana
MRDLAFIFAIVVIFILVVSCWKVLYLIWWRPMKLEKYLKKQGIKGPPYRLLYGNLKEERK MKEEAQSKPISLSHNITQRVVPLTDHTMKKYGKMSVVWYGVTPTLHIMDPEQVKDILSNK IEQFQKLHNPFTEQLLPGLANYEGEKWAKHRRIITPAFHLEKLKRMLPAFLAGCNELIRK WDQLVEPEGSCELDMWPEVQNLTGDIISRTAFGTSYEEGMRIFQLLNEHAKIIIQDLIYT FIPGYRLLPTKMNKRIKEINREVEALLRGIIKQRELSIKLGEATKDDLLGLLLESNFKEI QEHGAMSNEELMEECKLFYFAGQETTANLLLWTIVVLSMHQVWQKRAREEVLEIFGENKP DFDQLNRLKIVPMILYEVLRLYPPVFLSARCSDKKIKLGKTCLPPGIQLLIPIISIHHSR EFWGEDAEEFKPERFYEGVSKAAKTQAFFPFGWGPRICIGQNFAMAEAKVALAMILQHFS 
FELSPSYTHAPMGVITLQPQY 
 
>CYP72A234 augustus_masked-scaffold_1788-processed-gene-0.0-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.08 eAED:0.08 QI:6|1|1|1|0.66|0.5|4|5|424 
63% to CYP72A5 Zea mays missing the N-term exon off contig
86% to CYP72A maker-scaffold_3-snap-gene-9.26-mRNA-1
2033 GNMSVIWNGRTPRLNIMDPELVKDILSNKFGHFEKPNFNPLTSLLARGLAKQEGEKWAKHRR IINPAFHMEKLKRMLPAFYTSCSEMITRWEKLVAMEGCCELDVWPELQNLTGDVISRTAF GSSYDEGRRIFQLQNEQAALVIQSMLSIYIPGCRLLPTKRNKRMKEIDREVRSLLRGIIN KREKAIRLGEASDDDLLGLLLESNFKEIHEHGSGKNLGLSIEEVIEECKLFYFAGQETTA NLLVWTMVVLSMHPEWQIRAREEVLQAFGKNKPDFDGLNHLKIVTMVLYEVLRLYPPIFI ITRYTYKKMKLGDVYLPPGVQLLLPTILVHHSKQLWGEDAQEFKPERFSGGVSKATKNQV SFFPFGWGPRICIGQNFAMMEAKMALTLILQHFSFELSPSYAHAPYTVITIQPQYGAQII 
LHKL 
 
>CYP72A235 maker-scaffold_83-augustus-gene-20.23-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.07 eAED:0.07 QI:532|1|1|1|1|1|5|561|528 
60% to CYP72D1 Populus trichocarpa complete
56% to maker-scaffold_3-snap-gene-9.26
57% to augustus_masked-scaffold_1788-processed-gene-0.0
MEDFVKAFFISNPRFWILLLLLLVVLFGCVKVVYSVWWRPKWLENQLKQQGIEGAPYKLL HGYMKDYVRLLTEACSKPMNLNHQIAPRVLPFIYQTVQQYGKICYTWLGTAPRLIISDPE LFRLVFTDKSYQFQKPPLNPLVDLLQLGLSTLEGDKWAGRRKMISPAFHQNKLKGMVPAF TVSCNNLIERWKKLVSPQGSCELDVWPDLSNFSSDAISRAAFGSSYEEGKRIFELQKEQA LLVLEAYQSLYFPGLRFIPTKKNRRRYSLDNEIKRMLRDMIHQKRHAMITGESSSDNLLG LMLQCSDLIDTQVNVKNLSNDQMTIEDLIEECKLFYFAGQETTAVWLAWTMIVLAMHQDW QEKAREEVLQICGKRTPDMDAISHLRLVTMILNEVQRLYPPVVNLFRYTHKKTKLRDISL PAGIELYFPTYLMHHDPDIWGEDAQEFRPERFSEGFSKASKDQVAFYPFGWGPRFCLGQG FAAIEAKMALAMILQHFSFKLSPTYAHAPYTVITLQPQHGAQLILHQL 
 
>CYP72A236 maker-scaffold_148-augustus-gene-8.22-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.07 eAED:0.07 QI:1182|1|1|1|0.25|0.4|5|262|518 
NNU_022262
70% to CYP72A226 maker-scaffold_3-augustus-gene-9.23 NNU_001352
71% to CYP72A227 maker-scaffold_3-snap-gene-9.26 NNU_001351
62% to maker-scaffold_3-augustus-gene-9.24 NNU_001350
72% to CYP72A231a+b maker-scaffold_3-snap-gene-10.13 NNU_001355
62% to maker-scaffold_3-snap-gene-11.22 NNU_001359
56% to CYP72A5 Zea mays
MGEFVFISATVILCILILSWVWRMLYLIWWRPMKLERYLKEQGIKGPPYKLLVGNLKDES RLRKEALSKPMNLSHNIAPRVAPFVLQTIQNYGKMSVSWSGRTPRIYITDPELIKDILLY KFGHFERSKPNPFARSLASGLVSYEGEKWVKHRRIINPAFHLDKLKRLLPVFSISCCDLI TRWEKLVPSEGSYEMDVWPELKNLSGDIISRAAFGSSYEEGRRIFQIQEEQASLIMQDAM SIHIPGLRFLPTKRNNRMKEMEREVRALLEGIISKREKAMRMGEACTNDLLGLLMEFNFK EIQEHGNLKNVGMSIDEVIGECKLFYFAGRETTSILLTWTMLVLSMHSEWQLRAREEVLQ VFGKNKPDFNELNQLKIVTMILYEVLRLYPPVFRISRWTYKKIKLGEIFLPPGVELSLPI ILLHHSIEFWGDDAQEFKPERFAGGVSKATKNQVTFFPFSWGPRICIGQNFALMVVKMAL AMILQRFSFELSPTYCHAPCTVLTLQPQYGAQILLHKL 
 
>CYP72A237 maker-scaffold_148-snap-gene-8.26-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.15 eAED:0.15 QI:60|0.75|0.8|1|0.75|0.8|5|90|499 
NNU_022263
67% to CYP72A231a+b maker-scaffold_3-snap-gene-10.13 NNU_001355
67% to CYP72A236 CYP72A maker-scaffold_148-augustus-gene-8.22-mRNA-1
66% to CYP72A227 maker-scaffold_3-snap-gene-9.26 NNU_001351
65% to CYP72A226 maker-scaffold_3-augustus-gene-9.23 NNU_001352
60% to maker-scaffold_3-augustus-gene-9.24 NNU_001350
59% to maker-scaffold_3-snap-gene-11.22 NNU_001359
55% to CYP72A5 Zea mays
MGMAMAMGEISFIALCGVMLTGAWVFYWIWWRPMKVERGLKEQGIRGHPYRLLFGNKKEE ARLRKEALSKPVGSLSHNIVGRVIPFVHHTIQTYGEMSLSWNGRTPIVYVTDPELVKDIL FNKFGHFERDKLNPLTKLLVKGLVSYDGEKWATHRRIINPAFHPEKLKGMLPAFSTSCSE LITRWERLADSKGSCEVDMWPELQILSRDVISRSAFGSSYEEGRRIFELQYELAHLVVQA AMSIYIPGFRFLPTKKNKRMKEIAREVRALLEEMVNKREEILKKGGGSTNDLLGLLLKYN QEHDISKDVRMSIDDVIEECKLFYFAGQETTSVLLTWTMIVLSIHPEWQLKAKEEVLQV

FGRNKPDFDGLNHLKI (0)

811005 VTMILYEVLRLYPPVVMLNRYTNKKIRLREISFPSGVLFSMPVVFLHHSKELWGEDAQEFNP ERFSGGVLNATNNHVSFYPFGWGPRLCIGQNFALLEAKMALTMILQHFQFELSPSYCHAP HKGLTLEPQYGAQIILHKL 
 
>CYP72A238P pseudogene maker-scaffold_148-snap-gene-8.27-mRNA-1 
protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.58 eAED:0.58 QI:0|0|0|0.5|0.66|0.5|4|0|127 
NNU_022264
53% to maker-scaffold_3-augustus-gene-9.23 NNU_001352
57% to maker-scaffold_3-snap-gene-9.26 NNU_001351
57% to maker-scaffold_3-augustus-gene-9.24 NNU_001350
52% to maker-scaffold_3-snap-gene-10.13 NNU_001355
58% to maker-scaffold_3-snap-gene-11.22 NNU_001359
46% to CYP72A5 Zea mays N-term
817993 REKGIKEPPYEFLYGSLGDNSRMTKETLSKPMILSHDIVPRVLPFLHQTVQNY (1) 818151
827283 GKASVNWIGTFPRVTIADPTLIKGIVSRNFGHFEKPKAS

KLLTTGILYYQGEK*AKHKRIIKPAFHQEKLK

LFFTSCSELVSR*EKLATPEGSCELD

VWPELQNISGDVL

FGSNYEEGRQIFHLQIEQSDHLIFQSFQSALISGLRYI 829927

 

>CYP72A239P scaffold 36 3986360-3986109 (-) aa 89-176

70% to CYP72A maker-scaffold_148-augustus-gene-8.22

LKNASKMSVSWSRRTRIYITDLELMEILLYKFGHFERSKPNPLARLLVGGLVSYEEEKWVKHRRIINPALHLEHLKV

VFYSLTC

 

>CYP72A240P scaffold 38 2474009-2473758 (-)

72% to CYP72A maker-scaffold_148-augustus-gene-8.22

KNASKMSVSWSRRTRTYITDLELMKEILLYKFEHFERSKPNPLARLLAGGLVSYEGKKWVKHRRIINPAFHLEN

LKVVFYSLTC

 

>CYP72A241P Scaffold 141 191753-191833 (+)

77% to CYP72A maker-scaffold_148-augustus-gene-8.22 aa 153-179
62% to CYP72A5 Zea mays

GLVRYEGEKWVKYRRIINPTFHQENLK

 

>CYP72A242P scaffold 65 3052273-3052067 (-)

52% to CYP72A maker-scaffold_3-snap-gene-9.26 aa 119-186

WFGTQPRLSIVDPGMIKEVLSTKFGYYTIDKPTPPVMALLGNGLLNLTGLDWVRHRRAINPAFTIDKLK

 
>CYP72A243P scaffold 32 
79% to CYP72A maker-scaffold_3-snap-gene-11.22

3587194-3587316 (+) aa 295-335

LESNQSEIQEHCNKNNAGMNIEEVIKECKLFYFSRQETTCV

3587325-3587615 (+) aa 354-415

AWEEVLQFIIGSNEPNHGGLNHLKI (0)

VTMIF*EVLRLYPPAFLFLRSIYKKVKMGKFTLPLGVQ

 

>CYP72A244P scaffold 53

71% to CYP72A maker-scaffold_3-snap-gene-11.22

3060321-3060395 (+) aa 281-305

KLGEANKDDLLNLLIESNQREIQEH

3060413-3060463 (+) aa 310-326

NAGMNIEEVKVECKLFY &

3060466-3060630 (+) aa 324-385

FAGLETILNLFVWTMIVLSKHVHRQMHAKEEVLQVFGSKNGLNHLKIVIIFLGSV

 

>CYP72A245P scaffold 28 2788429-2790485 (-)

65% to CYP72A augustus_masked-scaffold_1788
55% to CYP72D maker-scaffold_83-augustus-gene-20.23

2790485-2790285 (-) aa 29-96

47% to CYP72D maker-scaffold_83-augustus-gene-20.23 aa 68-135

WLVLWRPKSLDKCLEAARHPRLV*GDMKHFFNFIK*A*SRPMNLTHKIAPRVDPFTFTIAQQYGKLT

2788963-2788559 (-) aa 103-202

52% to CYP72A augustus_masked-scaffold_1788-processed-gene-0.0

aa 84-183

TPRLIILDPELTREALSNKLHQFQKPPV &

DPLILVLTGGLTSLEGEKWAKHRRIINPAFHLEKLK &

AMLPAFLTSCSKPIERWHELVSSEGCCELDVWSE

2788875-2788429 (-) aa 131-243

63% to CYP72A augustus_masked-scaffold_1788-processed-gene-0.0

aa 112-149 then 181-224

NLTADVISRVAFGSSYEEGKSILQLQREQAELVLEAMQTLY

 

>CYP72A246P scaffold 42 497396-497530 (+)

92% to CYP72A  maker-scaffold_83-augustus-gene-20.23

LHRPSTTFTVSCNNLIXRWKKLVSPQGSCELDV*PDLFNFSSDAI

 

>CYP72A247P scaffold 79 2115530-2115706 (+) aa 321-379

84% to CYP72A maker-scaffold_83-augustus-gene-20.23

EIK*FYFADQEKTAVWLTWTMIVLAMHQDWQEKAREEVLQICGKRTHDIDAISHIRLVS

 

>CYP72A248P scaffold 129 1750081-1750260 (+)

92% to CYP72A maker-scaffold_83-augustus-gene-20.23
52% to CYP72D1 Populus trichocarpa

IFPPSFSLARALEIQLHRPSTTFTVSCNNLIKRWKKLVSPQGSCELDV*PDLFNFSSDAI

 

>CYP72A249P scaffold 724 8158-8328 (+) aa 183-236

84% to CYP72D maker-scaffold_83-augustus-gene-20.23

WTALVPADKPQGSCELDVWPDLSNFSSDAISRAAFGSNYEEGKRIFELHKEQAVLVL

 

>CYP72A250P maker-scaffold_24-snap-gene-21.16-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.26 eAED:0.36 QI:28|0|0|1|0|0|2|0|68 
43% to CYP72A7 Arabidopsis thaliana I-helix

2182968 SYFACHRFLPTIENSR

2183016 MGEIHREVETLLRGTIEKQQKTIKMGSDTD*FF*V*EV
GENGNSENIGMTIEDVIEECKLFYFAGHESISN 
LLTWTLMI 2183252

VTMILYEVLSLY

IGEFTFRAGVEFFVSLHPVHHNSE*WGEDAMEFNPERFAKGVPTASKDQISFFPFGWG 2184028

 
>CYP72A251P pseudogene
maker-scaffold_153-snap-gene-1.24-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.69 eAED:0.70 QI:0|0|0|0.33|1|1|3|0|122 
46% to CYP72A7 Arabidopsis thaliana PERF region
46% to CYP72D maker-scaffold_83-augustus-gene-20.23-mRNA-1

174565 DNELTTEEMIEECKLFYFTGQHTTCVACSLSVCPTSIAMHQDWQ

QSARAEVIKVCGRNTPTLESL

VTMILHEVLRLHPPV

SDLHSGAQRLK

173274 MMEEITLHIGIQLVFIILLFIQHEHELWGEDAEDFKPEKFKGVSEATKNQLMFY 173113
 

CYP73 family (3 genes, 0 pseudogenes)

 

>CYP73A102a maker-scaffold_9-augustus-gene-6.6-mRNA-1 protein Name:"Similar to CYP73A16 Trans-cinnamate 4-monooxygenase (Populus kitakamiensis)" AED:0.01 eAED:0.01 QI:328|1|1|1|1|1|3|320|505 
ohnologs 96% to CYP73A102b augustus_masked-scaffold_11-processed-gene-3.2
87% to CYP73A5 Arabidopsis thaliana
MDLLLLEKALVALFFAIVLAITISKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTD LAKKFGDILLLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT VYGEHWRKMRRIMTVPFFTNKVVQQYRYGWEDEAARVVEDVKNNPEAATKGIVLRKRLQL MMYNNMYRIMFDRRFESENDPLFVKLRALNGERSRLAQSFEYNYGDFIPILRPFLRGYLK ICKEVKERRLQLFKDYFLEERKKLASTKPTDNTGLKCAIDHILDAQQKGEINEDNVLYIV ENINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGVQITEPDTYKLPYLQAV IKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAQWKNPEEFRPER FLEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLD 
TTEKGGQFSLHILKHSTIVAKPRVF 
 
>CYP73A102b augustus_masked-scaffold_11-processed-gene-3.2-mRNA-1 protein Name:"Similar to CYP73A16 Trans-cinnamate 4-monooxygenase (Populus kitakamiensis)" AED:0.01 eAED:0.01 QI:63|1|1|1|1|1|3|230|505 
ohnologs 96% identical to CYP73A102a maker-scaffold_9-augustus-gene-6.6
87% to CYP73A5 Arabidopsis thaliana
MDLLLLEKSLIALFFAIVLAITISKLRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTD LAKKFGNIFLLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT VYGEHWRKMRRIMTVPFFTNKVVQQYRFGWEDEIAQVVEDVKKNPEAATNGIVLRKRLQL MMYNNMYRIMFDRRFESEDDPLFVKLKALNGERSRLAQSFEYNYGDFIPILRPFLKGYLR ICQEVKEMRLQLFKDYFLEERKKLASTKPTDHNGLKCAIDHILDAQQKGEINEDNVLYIV ENINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGVQITEPDTHKLPYLQAV IKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANNPAQWKNPEEFRPER FLEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLD 
TTEKGGQFSLHILKHSTIVAKPRVF 
 
>CYP73A103 maker-scaffold_32-augustus-gene-47.17-mRNA-1 protein Name:"Similar to CYP73A12 Trans-cinnamate 4-monooxygenase (Zinnia elegans)" AED:0.03 eAED:0.03 QI:62|1|1|1|1|1|3|448|533 
64% to CYP73A5 Arabidopsis thaliana complete
MDKLVNKSISLVLLTIMFLSSTKFLFFYLSIPFPSTLISITLPLLLFIISFITSNKKGNL PPGPISFPIFGHWLQVGDDLNHRFLASLCQKFGRIFLLKLGARNLVVVSDQELASEVLHT QGVEFGSRPRNVVFDIFTGNGQDMVFTIYGDHWRKMRRIMTLPFFTNKVVHQYSDMWEDE MNLVVKDLYNNQKVREEGIVIRRRLQLMLYNIMYRMMFDTKFTSQEDPLFIQATKFNSER SRLAQSFDYNYGDFIPFLRPFLRRYLNKCRELQSKRLAFFNNYFVEKRREIMAANGDKHK ISCAIDYIIDAQVKGEISEDNVLYIVENINVAAIETTLWSMEWAIAELVNHPTVQHKIRE EIATVLKGAPVTESNLSQLPYLQATVKETLRLHTPIPLLVPHMNLEEAKLGGYTIPKETK VVVNAWWLANNPAWWKNPEEFRPERFLEEEGGIDAVATGKVDFRYLPFGVGRRSCPGIIL ALPILGLVIAKLVTNFELKTPKGVKAIDVSEKGGQFSLHIANHSTIAFQPVEA 
 

CYP74 family (5 genes, 0 pseudogenes)

 

>CYP74A23 augustus_masked-scaffold_34-processed-gene-17.5-mRNA-1 protein Name:"Similar to CYP74A Allene oxide synthase, chloroplastic (Linum usitatissimum)" AED:0.10 eAED:0.10 QI:0|0|0|0.5|1|1|2|0|588 
63% to CYP74A1 Arabidopsis thaliana complete
77% to augustus_masked-scaffold_13-processed-gene-69.1-mRNA-1 (ohnolog)
60% to CYP74A snap_masked-scaffold_13-processed-gene-68.21-mRNA-1
60% to CYP74A maker-scaffold_13-augustus-gene-68.27-mRNA-1
Note: ohnolog with these three sequences in a gene cluster
On scaffold 13
MNRLTNPAHCQALISQLTLQAYQASSMASSSQNTFLLHNQSRLFDAKMLSSLHSLQLPSP ARTKRLTHRGSSVRPIVASSTDVPLTTTTDPPPTASPAPKLPLRKIPGDYGLPFIGPIKD RLDYFYNQGRDKYFSSRVLNYQSTVFRANMPPAYFIASNPNVIVLLDGKSFPVLFDVSKV EKKDLFTGTYMPSTQLTGGYRILSYLDPSEPKHAKLKQLLFFLLQSSRYRVIPEFHTAFT ELFETLESQIAAKGKEGFGDINDQACFNFLARAFYEANPPESKLGTDGPSLVAKWVIFHL GPILTLGLPKLLEELLLHTFSLPPILIKSDYQRLYDFFHGASGRILDEAKKMGIEREEAC HNLLFATCFNSFGGMKILFPSLVKYIGGAGSALHEKLAEEVRSAIRSNGGKVTMAAMEQM PLMKSVVYEALRIDPPVPFQYGRAKRDLVIESHDATFEVKKGEMLFGFQPFATKDPEIFD RPEEFVPDRFVGEGEKLLKHVIWSNGPETESPTVENKQCAGKDFVVWVSRLFVVELFQRY DSFEIETEYRKITTMKEMVEVVEAGEGAITAGGLVHQWSKLQKQVNEH 
 
>CYP74A24 augustus_masked-scaffold_13-processed-gene-69.1-mRNA-1 protein Name:"Similar to CYP74A Allene oxide synthase, chloroplastic (Arabidopsis thaliana)" AED:0.02 eAED:0.02 QI:0|-1|0|1|-1|1|1|0|544
63% to CYP74A1 Arabidopsis thaliana
77% to CYP74A23 augustus_masked-scaffold_34-processed-gene-17.5 (ohnolog)
MAIPFSASQNIFLQTQPRIDAGIASSSLLPPYSPRLQSPARSKSLKLARRLSLRPIVASL SELPSSTTTATPSTPPPKLPLRKIPGDYGLPFIGPTKDRLDYFYNQGREDYFRSRIQKYR STVFRANMPPGHFIASNPRVIVLLDGQSFPVLFDVSKVEKRDLFTGTFMPSTQLTGGYRV LSYLDPSEPNHAKLKQLIFFLLQSSRQRIIPEFHATFTELFETLESELAAKGKADFGGPN DQACFNFLARAFYGANPSESKLGHDGPNLVAKWVLLQLGPLLTLGLPSLVEDLLLHTFRL PPVLVKSDYQRLYDFFYQVSGRILDEGEKMGIKREEACHNLLFATCFNSFGGMKILFPNL LKFTGRAGPKLHRQLAEEIRSAVRSNGGKVTMAAMEQMPLMKSVVYEALRIEPPVALQYG KAKRDLVIESHDAAFEVKEGEMLFGYQPFATRDPKIFERAEEFVPDRFVGEGEKLLKHVL WSNGPEAESPTVENKQCAGKDFVVLVSRLLVVEMFQRYDSFEIEVGKSALGAAITLTSVK 
RASF 
 
>CYP74A25 maker-scaffold_13-augustus-gene-68.27-mRNA-1 protein Name:"Similar to CYP74A Allene oxide synthase, chloroplastic (Linum usitatissimum)" AED:0.04 eAED:0.04 QI:0|0|0|1|1|1|2|0|448 
~58% to CYP74A1 Arabidopsis thaliana
97% to CYP74A snap_masked-scaffold_13-processed-gene-68.21-mRNA-1
MYSTSSTVRRRPVSFTEREESPNSNLPIKQIPGNYGLPFIGPIKDRLDYFYNQGRDEFFK TRIQKYGSTVFRANMPPGPFMASNPNVVVLVDAVSFPVLFGVSKVEKRDLLTGTYMPSTA LTGGYRVCAYLDPSEPNHTKLKRLIFLLLSSRHSKYIPEFHKSFSVLFDNLETEIKNKGE ANFNNLNDKTSFDYLLKAYFDKDPAETKIESKGSNYVTKWLFFQLCPLITLGLPKLVSFV EDILLHTFPLPPFLVKSDYMKLYDVFYTSAAALLDEAEKMGLNRKEACHNLLFVTCFNAY GGMKILFPALMKWVGLAGEELHKQLADEIRAAVKAEGGVTL
(seqeunce gap 42 aa)
AYEVKKGEMIFGFQPFATKDPKIFDK AEEYIACRFVGEGEKLLKYVFWSNGRETENPTEGNKQCPGKDFVVLVARLLLVELFLRYD SFTVEASTILFGPSVTVKSLTSVGSPSQ 
 
>CYP74A26 snap_masked-scaffold_13-processed-gene-68.21-mRNA-1 protein Name:"Similar to CYP74A Allene oxide synthase, chloroplastic (Linum usitatissimum)" AED:0.07 eAED:0.07 QI:0|0|0|0.66|1|1|3|0|468 
58% to CYP74A1 Arabidopsis thaliana
86% to maker-scaffold_13-augustus-gene-68.27
revised seq complete
MSSSTSSTVRRRPVSSTEKEESPNSSLPMKQIPGNYGLPFIGPIKDRLDYFYNQGRDEFF KTRMQKYGSTVFRANMPPGPFMASNPNVVVLLDAVSFPVLFDVSKVEKRDLFTGTYMPST ALTGGYRVCAYLDPSEPNHTKLKRLIFLLLSSRHSKYIPEFHKSFSVLFDNLETEIKNKG EANFNNLNDKTSFDYLLKAYFDKDPAETKIESKGSNYVTKWLFFQLCPLITLGLPKLVSF VEDILLHTFPLPPFLVKSDYMKLYDVFYTSAAALLDEAEKMGLNRKEACHNLLFVTCFNA YGGMKILFPALMKWVGLAGEELHKQLADEIRAAVKAEGGVTLNAIEKMPLTKSA
VYEALRIEPPVMFQYGKAKK
DLVIESHDAAYEVKKGEMIFGFQPFATKDPKIFDKAEEYIASRFVGEGEKLLKYVFWSNGRETENP TEENKQCPGKDFVVLVARLLLVEFFLRFDTFTVERTSQPRRQVRFGGW 
 
>CYP74B17 maker-scaffold_599-augustus-gene-0.4-mRNA-1 protein Name:"Similar to CYP74A Allene oxide synthase, chloroplastic (Linum usitatissimum)" AED:0.03 eAED:0.03 QI:0|1|0.5|1|1|1|2|143|486 
61% to CYP74B2 Arabidopsis thaliana
MAMTMLKMMTPPPASSMPSLTPTPPMPQIRTIPGTHGLPLIGPLSDRLDYFWFQGPETFF RKRMEKYKSTVFRTNIPPAFPFFPSVNPNVIAVLDCKSFSHLFDMDLVDKKNVLVGDFMP SVSFTGNIRVSVYLDPSESKHALVKNFATDILKRSSGIWASEFVSNLDVMWNTIEKDITS KGSASFPVPLQRCIFRFLIKCLVGADTSNSPEIADNGFAMLDAWLALQLLPTVKIGILQP LEEIFLHSFAYPFFLVKGSYQKLYDFVKKEGREVIERGETQFQLGEEETIHNLLFVLGFN AFGGFSVFLPSLITTLGSGKTGLQDKLRQEVREKVGSSSLGFDSVREMELVQSFVYETLR YNPPVPLQFARARKDFILSSYDSSYEIKKGELLCGYQLLAMRDPKVFDEPETFQPERFTK EKGQQLLNYLYWSNGPQTGSPSTSNKQCAAKDHVVVTACLFLADLFLRYDSFTTDGSSIT 
AVEKAK 

 

CYP75 family (4 genes, 0 pseudogenes)

 

>CYP75A51 snap_masked-scaffold_340-processed-gene-1.18-mRNA-1 protein Name:"Similar to CYP75A3 Flavonoid 3',5'-hydroxylase 2 (Petunia hybrida)" AED:0.02 eAED:0.02 QI:0|0|0|0.5|1|1|2|0|277 
72% to CYP75A17 Glycine max, N-term half, runs into seq gap
contig10625 EST continues the sequence
CYP75A51 is 98% to CYP75A52 with only 3 aa diffs at the N-term
so the EST may be matching the other gene
154426 MAFDIVLAQELVAAAILFFVTRLFIRRVISKPRKLPPGPKGWPIIGALPLLGGMPHVALA RMAKQYGPVMYLKMGTCGMAVASTPDAARAFLKTLDLNFSNRPPNAGATHLAYNAQDMVF ADYGPRWKLLRKLSNLHMLGGKALDDWAQVRTIELGHMLRAMNDACRRGEPVVVPEMLTY AMANMIGQVILSRRVFATKGSESNEFKDMVVELMTKAGLFNIGDFIPSIAWMDLQGIEGG MKKLHKRWDGLISKMIFEHKATAHERKGKPDFLDV 153596

IYANRDNSDGERLTETNIKALLLNLFSAGTDTSSSIIEWALAEMLNNPSILRRAHEEMDQ

VIGRNRRLEESDIAKLPYLQAICKETFRKHPSTPLNLPRVAIEACEVNGYYIPKGTRLSV

NIWGIGRDPVVWENPLSFTPERFLSGRNAKIDPRGNDFELIPFGAGRRQ

 
>CYP75A52 maker-scaffold_340-augustus-gene-1.34-mRNA-1 protein Name:"Similar to CYP75A3 Flavonoid 3',5'-hydroxylase 2 (Petunia hybrida)" AED:0.06 eAED:0.06 QI:0|1|0|1|1|1|2|0|507 
75% to CYP75A17 Glycine max complete
MAFDIVLARELVAASILFLVTRLFIRRVISKPRKLPPGPKGWPIIGALPLLGGMPHVALA RMAKQYGPVMYLKMGTCGMAVASTPDAARAFLKTLDLNFSNRPPNAGATHLAYNAQDMVF ADYGPRWKLLRKLSNLHMLGGKALDDWAQVRTIELGHMLRAMNDACRRGEPVVVPEMLTY AMANMIGQVILSRRVFATKGSESNEFKDMVVELMTKAGLFNIGDFIPSIAWMDLQGIEGG MKKLHKRWDGLISKMIFEHKATAHERKGKPDFLDVIYANRDNSDGERLTETNIKALLLNL FSAGTDTSSSIIEWALAEMLNNPSILRRAHEEMDQVIGRNRRLEESDIAKLPYLQAICKE TFRKHPSTPLNLPRVAIEACEVNGYYIPKGTRLSVNIWGIGRDPVVWENPLSFTPERFLS GRNAKIDPRGNDFELIPFGAGRRICAGTRMGIVLVEYILGTLVHSFDWRMPDGVELNLDE AXGLALQKAVPLSAMVTPRLAPTAYAA 
 
>CYP75B61 maker-scaffold_19-snap-gene-33.9-mRNA-1 protein Name:"Similar to CYP75B2 Flavonoid 3'-monooxygenase (Petunia hybrida)" AED:0.03 eAED:0.03 QI:246|1|1|1|0.5|0.66|3|390|516 
70% to CYP75B1 Arabidopsis thaliana
MTPLALVALTSFVAFLIYFFLNFSNRYPRPLPPGPKPWPIIGNLPHLGPVPHHTIAALAR VYGPLLHLRLGSVHVVVAASASVASQFLKTHDANFSSRPPNSGAKHIAYNYHDLVFAPYG PRWRLLRKICSVHLFSGKALDDFRHVRQEEVAVLTRALSRSGTSPLNVGQLLNVCTTNAL ARVMLGRRVFESDDGTGNRKSDEFKEMVVEIMVLAGVFNIGDFVPSLEWLDLQGVAAKMK KLHARFDAFLNKILEEHKVKGGGSGRHTDLLSTLLSLKEDADGEGGKLTDTEIKALLLNL FTAGTDTSSSTVEWALAELIRHPDVLARVQQELDSVVGKDRLVTESDIAQLTFLQAVMKE TFRLHPSTPLSLPRIAAENCEINGFFIPKGSTLLVNVWAIARDPAVWPEPLKFRPERFLP GSEHAHVDVRGNDFELMPFGAGRRICAGMSWGLRMVLFLTATLVQAFDWVLPEGQTPENL NMEEAYGLTLQRAVPLLVHTRPRLAPHVYCATSTAQ 
 
>CYP75B62 maker-scaffold_1-augustus-gene-69.8-mRNA-1 protein Name:"Similar to CYP75B2 Flavonoid 3'-monooxygenase (Petunia hybrida)" AED:0.07 eAED:0.07 QI:239|1|1|1|1|1|3|282|513 
70% to CYP75B1 Arabidopsis thaliana
MTLLAFVSFTLFVAFLIYFLFNLLNRYPRPLPPGPKPWPIIGNLPHLGTVPHHSLAAMAR TYGPLLHLRLGSVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPYG PRWRMLRKICSVHLFSGKALDDFRHIRQEEVAVLIRALAGAGKAAVNVGQLLSVCTTNAL ARVMLGRRVFGSGEGTGDQKSEEFKEMVVELMVLAGVFNIGDFVPALDWLDLQGVASKMK KLHARFDNFLNGILDEHRVMGGGSEGHTDLLSTLLSLKDNVDGEGGKLTDTEIKALLLDL FTAGTDTSASTVEWALAELIRHPDMLARAQRELDAVVGKDRLVTESDISQLTYLQAVIKE TFRLHPSTPLSVPRMASEGCEINGYYIPKGSTLLVNVWAIARDPAIWPEPLQFRPERFLP GSKHANVDVRGNDFEVIPFGAGRRICAGMNLGLRMVHLLTATLVHALDWGLQEGQMAEKL NMEEAYGLTLQRAVPLTVHPRPRLAPHVYRASS 
 
CYP76 family (3 genes, 1 pseudogene)
 

>CYP76F31 maker-scaffold_115-augustus-gene-18.18-mRNA-1 protein Name:"Similar to CYP76C2 Cytochrome P450 76C2 (Arabidopsis thaliana)" AED:0.08 eAED:0.08 QI:0|1|0|1|1|1|2|0|500

51% to CYP76T1 Populus trichocarpa complete
60% to CYP76F2 Vitis

MENSNSSLLLLFCFICTFIYFLASGRRGSRSGSPKLPPGPIPLPLVGNLXKLGNKPHEAL TELAKAYGPVMTLKLGCLTTVIISSSSMAKEVLRKNDQALSARIIPDSVRACNHHQVSMV WSPPSPQWRNMRKICNTEIFSSKKLDSMQGLRCQKVEKLVAYVRDNSRAGRAVNIGQAAF VTSLNLLSNTFFSVDLVHLGSDSAQDFKTLIWAVMEEVGRPNLADYFPILRWIDPQGVRR RLSSHFQRLLEIFDEMIDQRLQLRALLASPTHNDNSDVLDVLLNHTKDNASQFGRNELRH FILVGTDTTSSTLEWAMAELLRKPEAMVKARMELEETKQNGKSIEESDIVRLPYLQAVVK ETFRLHPPAPLLLPHRAEIDVEICGFTLPKDAQVLVNVWAIGRDPTKWENPHCFSPXRFL NSAIDFKGRDFDLIPFGAGRRICPGLPLAFRMVHSMLASLLHSFDWKLEDGTTTEQMDMD

DCFGLTLQKAEPLXAVPVHV

 

>CYP76F32P scaffold 557 58538-58744 (+)

57% to CYP76 BABX01005733.1a, 61% to CYP76AA1 Cycas rumphii
84% to CYP76 maker-scaffold_115-augustus-gene-18.18

CPGLPQAFRMVHLLLASVLHLLDWKLEDGTTREQMDMDDCFGLTLQQAEPLVAVPVHV*HFS

 

>CYP76F33P pseudogene
maker-scaffold_31-snap-gene-48.11-mRNA-1 protein Name:"Similar to CYP76B1 7-ethoxycoumarin O-deethylase (Helianthus tuberosus)" AED:0.08 eAED:0.08 QI:0|0|0|0.75|0.33|0.25|4|0|476 
50% to CYP76T1 Populus trichocarpa
48% to CYP76B4 Medicago sativa
56% to CYP76 maker-scaffold_115-augustus-gene-18.18-mRNA-1
frameshift = &
MNETTVLSWISCLLAFIYVLTCWKSRSDKLPPGPFPLPVVGNLFNLGKKPHESLAKLSKI HGPLMTLKLGSLTTVVNNDQLFASRSIPDAARALNFHQASMVWLPYSPRWRFHRRIANTE IFAAKKLDASQGLRCRKVHELAAHVRDNCQTRSAVDIGQAAFITTLNLISNTILSTDLAS FDSGSAQELKALVHRAMEEGGRPNPMDYFPILRRIDPQGIRRRMAINVAGFYKLFDEIIDQRL &
VQRTKLVSVGSKEDVLDALLNQKTEND*EFGRTHIKILLL (0)

ELFVAGTDTTSSTVEWAMAELLRSPETMAKARL ELKQKIGDRNLVEESDIDQLPYLQAIVKETLRLHPPVPFLIHRAESNVEICGYMVPKDAQ LLVNVCTLDRDPSFWVNPDSFIPERFLNSDIDFRGHHFELIPFGAGRRMCPGLSGATRMI HLMLASLIHFFDWEPPGEMSPEDMDMGDKFGLTLQKSQPLRAIKPVPKTNSKRSKS

 
>CYP76AG1 maker-scaffold_0-augustus-gene-99.15-mRNA-1 protein Name:"Similar to CYP75B2 Flavonoid 3'-monooxygenase (Petunia hybrida)" AED:0.05 eAED:0.05 QI:14|1|1|1|1|1|3|240|520 
48% to CYP76Z1 Picea sitchensis complete
MDQLHAFASATVTYLSQLPRPAALSLAAFFLLLPLILRRRTWYNAPPGPIGWPILGYLPY LSDRLHEDLFHLAKTYGPLFSLRMGQRPAIVVSSPEMAREVLKHKEASFSSRTITEAVRC IAYDGTSLVFVPYGSRWRLLRKIITSEFFSSRAIELFQPVRRQQVEGLLRTLYTSSKSKT PVNVADSMFVVSSNLTSNIAFSKSLFDTTKKEGRELKDMVWEVLETVAVPNLADMLPFLK VFDPQGLKRRLSKVGMRFDKFLEQLIDERLKEREKGFKKNGKMDMLDVFLDYRSEKEDEL KQFSRVDIKGILLDMFMAGGDTTSSTIEWGMTEILKKQESHKKILAELDQVVGKHRFVEE SDIPKLTYFQAAVKEVFRLHPAVPLLVPRRTNEACEVSGYSVPKHAILFLNVWGMGRDPK IWPEPCEFKPERFLGSSVDVKGQDFEILPFGTGRRSCVGMPLGHRMVHYSLASLLHAFEW DFPSDVLEDTTEKVGITLQKVKVLIGVPKPRLQDSVYQLQ 
 
>CYP76AG2 maker-scaffold_10-augustus-gene-29.16-mRNA-1 protein Name:"Similar to CYP75B2 Flavonoid 3'-monooxygenase (Petunia hybrida)" AED:0.03 eAED:0.03 QI:35|1|1|1|1|1|3|254|523 
47% to CYP76Z1 Picea sitchensis complete
74% to maker-scaffold_0-augustus-gene-99.15
MNQLNPLASTLTTYITSLPLSTLLTFFASVATFSLLPIIFRRRNWRNAPPGPIGWPLMGY LPYLTERLHEDLYHLAKTHGPLFSLRMGQKPAIVVSSPDITREILKHQDATFSSRTITEA VRCVTYDATSLVFVPYGARWRLLRKILTTEIFSSRAMELFQPTRKQQVRGLLKTLYGAWK SNTPANIADSTFVVSANLISNLVCSKSLFDNTKEGRELKEMVWEILEVVGAPNLADLIPL LKVLDPQGLKRRVWKVVKKFDDFFEKLIGERLEDRKKGVKTNENGRLDMLDVFLDYRSEK KDDELKQFSRVDIKGMLSDMFVAGTDTSSSTVEWGMTEILKRPEIYKKILAEIDEVVGKE RFVEETDIPKLTYFQAAVKEVFRLHPGVPLLIPRRTNEATEVCGYHVPKHAIVFVNVWGM ARDPKVWTEPYEFRPDRFLGSDKDVKGQDFDVLPFGTGRRSCVGMPLGHRMVHYSLASLL HAFEWDFPADILEDMTEKVGITLQKAKGLIGVPKPRLSESVFQ 
 

>CYP76AG3P  scaffold 43 1939259-1939420 (+)

46% to JcCB0537261.10 (CYP706?)
82% to CYP76 maker-scaffold_10-augustus-gene-29.16

LFVISSLDITREILKHQDATFSNLIITKVVRCVTYNATSLVFVPYRARWRLLRK

 

CYP77 family

 

>CYP77A21 augustus_masked-scaffold_4-processed-gene-17.0-mRNA-1 protein Name:"Similar to CYP77A2 Cytochrome P450 77A2 (Solanum melongena)" AED:0.13 eAED:0.14 QI:0|-1|0|1|-1|1|1|0|291

66% to CYP77A4 Arabidopsis thaliana C-term half
1782033

MAAASFSFSLSTLSPYYNLIFTG LAFLVSALIFVLSTRSKSKRLRLPPGPPGWPVVGNLFQVARSGKPFFQYVRDIRLNYGPI

FTLKMGTRTLI

(125 aa sequence gap)

IDDMMKTVLITLDPRIDDFLPILSPFFSKQRKRSMQVREEQIRTILPFIEKRRSLLKNNPETS FAYLDTLFDLEIEGRKSRPTDTELVSLCSEFLNGGTDTTATALEWGIARLIENPEIQSKL YTEIKSKVGDRKVDEKDAEEMVYLNAVVKELLRKHPPTYFALTHAVTQPATLGGYDVPTD ANVEIFLPAIAEDPSIWSEPEKFNPDRFATGKEDADITGVKGVKMLPFGGGRRICPGLGL GTVHVNLLLARMVQEFEWSLHPSQQKVDLSEKLEFTVVMKKPLRAVVKPRI*

 

>CYP77A22 augustus_masked-scaffold_124-processed-gene-0.4-mRNA-1 protein Name:"Similar to CYP77A2 Cytochrome P450 77A2 (Solanum melongena)" AED:0.00 eAED:0.00 QI:0|-1|0|1|-1|1|1|0|520

69% to CYP77A4 Arabidopsis thaliana
48% to augustus_masked-scaffold_102-processed-gene-3.5-mRNA-1

MASFSSSSSSSFSLSTLSPYYHLIFTGLAFLVSAFIFFISSRSKSKRLNLPPGPPGWPVV GNLFQVALSGKPFFQYIRDLRPKYGPIFTLKMGTRTMIIVSSAELIHEALIEKGQVFANR PRENPTRTVFSCDKFTVNSALYGPVWRSLRRNMVQGMLSSTRLKEFRDVRSLAMDRLIDR LRAEAKSNDGLVWVLKNARFAVFCILVSMCFGVEMDDKDIERIDDMMKTVLITLDPRLDD FLPILSPFFSKQRKRVMEVRQEQIQTVLPFIEKRRSILKNPGSDMTAAPFAYLDTLFDLE VEGRKSSPNDAELVTLCSELLNGGTDTTATALEWGIARLIENPDIQSKLYAEIKSTVGDR KVDEKDIENMVYLNAVVKELLRRHPPTYLSLTHAVTQPATLGGYDVPTDANVEIFLPPIS EDPNLWSEPEKFNPDRFASGKEEADITGLKGLKMVPFGVGRRICPGLGMATLHVNLMLAR MVQEFEWSAHPSQRKIDFSEKLEFTVVMKNTLRAVIRPRT

 

>CYP77B12 augustus_masked-scaffold_102-processed-gene-3.5-mRNA-1 protein Name:"Similar to CYP77A3 Cytochrome P450 77A3 (Glycine max)" AED:0.01 eAED:0.01 QI:0|-1|0|1|-1|1|1|0|512

67% to CYP77B1 Arabidopsis thaliana

MELMDLLILLAAALLVRLWWRYWSVTGGGSKNLPPGPPGWPLVGNLVQVLLQRRPFIYVV RDLRTKYGPIFTMQMGQRTLIIITSAQLIHEALVQKGPLFASRPADSPTRLLFSVGKCTI NSAEYGPLWRTLRRNFVTELINPTRIKQCGWIREWAFDNHLKRIKKEALETGSVGVMTNC RLTICNILICICFGARISDARVKEIEAVLKDVMLMTTPKLPDFLPVFTPFFRRQLKEAKK LRRKQVECLVPLVRSRRAFVECEGNPTGDAAGWNEDIVSPIGAAYIDSLFKLEPSGRGKL GEEELVTLCSEVMNAGTDTSATAVEWALLHLVMDQDIQQKLYEEIVDSVGKDGKITEEDV EKMRYLGAIVKETFRRHPPSHFVLSHAATHETELGGYTIPADANVEFYTAWVTEDPSVWK EPGAFRPERFLDGDGVDVDVTGSRGVKMMPFGAGRRICPAMTLGTLHVHLLLARMVQAFK WVPAPDVPPDPTETFAFTVVMKNPLRAAILPR

 

CYP78 family (7 genes, 3 pseudogenes)

 

>CYP78A84 maker-scaffold_1-augustus-gene-77.4-mRNA-1 protein Name:"Similar to CYP78A4 Cytochrome P450 78A4 (Pinus radiata)" AED:0.00 eAED:0.00 QI:0|1|1|1|1|1|2|673|567

65% to CYP78A5 Arabidopsis thaliana

TLSARLLPLPFCWDTLHPYSSATHNPLKPPNLHHFSSFLNLPYPQTTK 3 UTR

MSSENHLLFLPQASHSSVLNFEVATCVLLLAIVFSFWLAPGGLAWALSKAKSRIAIPGPSGFPLVGLLFAFT GSTTHRVLAKLAQCLNAKPLMAFSVGFTRFIISSHPETAKEILNSSAFADRPVKESAYEL LFHRAMGFAPYGEYWRNLRRISATHMFSPKRIAGFGSFRREIGSRIVEEIRDMMVKNGMV EVKKVLHFGSLNNVMMSVFGRTYDFKEGGDGFELEGLVSEGYELLGIFNWSDHFPVLGLL DLQGVRKRCRRLVTKVNAFVKNIIEEHRRRRVNGALDDESDRNFVDVLLDLEKEDRLNDS DMIAVLWEMIFRGTDTVAILLEWILARMLMHPDIQAKAQSEIDAVVGATRSVSDSDLPNL PYLQAIVKESLRMHPPGPLLSWARLAVHDVHIGEFFIPAGTTAMVNMWAITHDEGIWSEP AEFKPERFMKEEVSIMGSDLRLAPFGSGRRVCPGKAMGLATVQLWLAQLLQSFKWAPSDN GVDLSECLKLSLEMKNPLVCVAVSRLA

 

>CYP78A85 maker-scaffold_19-augustus-gene-23.17-mRNA-1 protein Name:"Similar to CYP78A4 Cytochrome P450 78A4 (Pinus radiata)" AED:0.03 eAED:0.03 QI:327|1|1|1|1|1|2|521|519

68% to CYP78A5 Arabidopsis thaliana

MLSDYHLFFIPKSAHSSVLSFELAACVLLLVLVFSFWLAPGGLAWALASSKSRTAIPGPS GFPLLGLLFAFTGSAAHRVLAKLAQCFNAKPLMAFSVGITRFIISSHPETAKEILNSSAF ADRPVKESAYELLFHRAMGFAPFGEYWRNLRRISSIHLFSPKRIAGFGSFRREIGLKMVD KIRASMVMKGKVEVKKVLRFGSLNNVMMSVFGRSYDFSEGGDGSELEGLVSEGYELLGIF NWSDHFPVLGWLDLQGVRRRCRKLVAKVNVFVKNIIDEHRKRRVDGVVDDESASDFVDIL LDLEKEDRLSDSDMIAVLWEMIFRGTDTVAILLEWILARMVLHPDIQAKAQSEIDSVVGS TRSVSDSDLPNLPYLQSIVKESLRVHPPGPLLSWARLAVHDVHIGENFIPAGTTAMVNMW AITHDEGIWSEPTEFKPERFMKEEVSIMGSDLRLAPFGSGRRVCPGKAMGLATVQLWLAQ LLQSFKWVPSDNGVDLSECLKLSLEMKNPLTCEAVPRVT

 

>CYP78A86 maker-scaffold_0-augustus-gene-124.25-mRNA-1 protein Name:"Similar to CYP78A3 Cytochrome P450 78A3 (Glycine max)" AED:0.03 eAED:0.03 QI:55|1|1|1|1|1|2|295|525

51% to CYP78A5 Arabidopsis thaliana, complete
54% to maker-scaffold_26-augustus-gene-34.24
75% to CYP78A38Vitis

METKIERFWVFALASKCSAFSSTNLLSSLLLLGLACLTVVFLYWAYPGGPAWGRYWWKKG TRAKPIPGPRGFPVFGSMNLMTGLAHRRQAAAAEQCGASRLMAFSLGETRVVVTCNPNIA KEILNSSVFADRPVKESAYSLMFNRAIGFAPYGVYWRTLRKIAATHLFCPKQINASEEQR FRIASQMVSMFAGRKEEIRVRDILKRASLNNMMCSVFGRLYALESSSEETDQLSKLVEEG YQLLGKLNWSDHLPWLAGFDVQRIRFRCSKLVPQVNRFLNRILSEHRAQTRDRNRDFVDV LLSLQGTEKLSDPDMVAVLWEMIFRGTDTVAVLMEWILARMVLHPDIQSKVHQELDEVVG KSRPVRESDIEAMVYLPAVVKEVLRLHPPGPLLSWSRLAITDTTVDAKHVPAGTTAMVNM WAITRDPQVWSEPSKFMPERFVSGEADVEFSIMGSDVRLAPFGAGRRSCPGKTLGLTTAT FWVASLLHELEWVASDQNPIDLSEVLRLSCEMAKPLTVKVRPRRT

 

>CYP78A87 maker-scaffold_48-augustus-gene-11.18-mRNA-1 protein Name:"Similar to CYP78A3 Cytochrome P450 78A3 (Glycine max)" AED:0.03 eAED:0.03 QI:87|1|1|1|1|1|2|375|528

52% to CYP78D2 Populus trichocarpa

METEIERLWVFALAAKCRAFSSDNLVSSVILLVFAWLSLTFIYWAYPGGSAWGKYWFWLK KGPSAKPIPGPRGLPVVGSINLMASLAHRQLAAAAQQCLANRLMAFSLGETRVIITCNPD VAKEILNSSVFADRPVKESAYSLMFNRAIGFAPYGVYWRTLRRIAATHLFCPKQINGSED QRFRIAAQMVSMVGHRKGEFSVRDTLKRASLNNMMSSVFGRQYELSSSCEETDELSRLVE EGYDLLGKLNWSDHLPWLAGLDYQNIRSRCSKLVPKVNRFVNRIIAEHRTKTGKNNQDFV DVLLSLQGSDKLSDPDMVAVLWEMIFRGTDTVAILIEWILARMVLHPDIQSKVQQELDEV VGKSRPVLEPDIQAMVYLPAVVKEVLRLHPPGPLLSWARLAITDTTVDGKQVPAGTTAMV NMWAITRDPQVWSDPLKFMPERFVSRKEDEVEFSVMGSDLRLAPFGSGRRTCPGKALGLT TVTFWVATLLHEFEWIGSVQNPVDLSEILRLSCEMANPLTVRVNRRRA

 

>CYP78A88 maker-scaffold_26-augustus-gene-34.24-mRNA-1 protein Name:"Similar to CYP78A11 Cytochrome P450 78A11 (Oryza sativa subsp. japonica)" AED:0.03 eAED:0.03 QI:0|1|0.5|1|1|1|2|282|538

51% to CYP78D2 Populus trichocarpa
79% to CYP78A39 Vitis

MELGLVSKDTSWWVFTLPAFLGTRNLFDGLILLAVLLASVSVGLLTWAFAVGGIAWKSGR NQRGRASIPGPRGLPVFGSLFSLSRGLAHRTLASMASTLGATQLMAFSLASTPVVVASDP HTAREILTSPYFADRPLKQSAKKLMFSRAIGFAPNGTYWRLLRRIASSHLFAPKHIAAHE TGRQMDCSAMLNGIAREQSARGAVTLRKHLQAAALNNIMGSVFGKRYDVEQDSEEVRELR EMVKEGFELLGAFNWSDYLPWLSYLYDPFRINQRCSALVPRVRKLVRGIIEEHRRRGSGK VSDNADFVDVLLSLDGEEKLGEDDMVAVLWEMIFRGTDTTALLTEWAMAELVLNPSMQAK LQSELDMVVGGRCVTDADVANLPYLQAVVKETLRVHPPGPLLSWARLSTSDVELSNGMLI PANTVAMVNMWAITHDSKVWEDPLAFKPERFVESEGGINLDVRGNDTRLAPFGAGRRVCP GKNLGLVTVSLWVAKLVHNFKWVVDPENPVDLSEMLKLSCEMKKPLSAVAVPRNVVNF

 

>CYP78A89 maker-scaffold_239-snap-gene-0.13-mRNA-1 protein Name:"Similar to CYP78A11 Cytochrome P450 78A11 (Oryza sativa subsp. japonica)" AED:0.01 eAED:0.01 QI:448|1|1|1|1|1|2|364|533

51% to CYP78D2 Populus trichocarpa, complete
79% to CYP78A39 Vitis

MEFCLVSKDSWWVFTLPAFLGTQNLFDGWVLISLILAFVSVGLVTWAFTVGGVAWKNGRH RKGRVPIPGARGLPVFGSLFSLSRGLAHRTLASMASSLGATQLMAFSLGSAPVVVASDPH TAREILTSPFFADRPLKQSAKKLMFSRAIGFAPNGTYWRLLRRIASSHLFSPKRIAAHEP GRQADCSAMLNGIAKEQSVRGSVALRKHLQSAALNNIMGSVFGKRYDVEQDSQEMSELRE MVKEGFELLGAFNWSDYLPWLSYFYDPFHINERCSALVPRVRKLVRGIIEEHRLRGSGKA SDNADFVNVLLSLDGEEKLEEDDMVAVLWEMIFRGTDTTALLTEWVMAELVLNPSVQAKL QSELDRVVGDKSVTDADVANLPYLQAVVKESLRIHPPGPLLSWARLSTSDVQMSNGMLIP ANTTAMVNMWAITHDSKVWEEPLVFKPERFMESEGGINLDVRGNDMRLAPFGGGRRVCPG KNLGLVTVSLWVAKLVHHFKWVVDPENPVDLSEVLKLSCEMKNPLSAVADPRN

 

>CYP78A90 maker-scaffold_5-augustus-gene-53.17-mRNA-1 protein Name:"Similar to CYP78A4 Cytochrome P450 78A4 (Pinus radiata)" AED:0.01 eAED:0.01 QI:119|1|1|1|1|1|2|309|520

69% to CYP78D2 Populus trichocarpa 
72% to CYP78A37 Vitis
59% to maker-scaffold_1-augustus-gene-77.4

MTKMYLLPNLCLFIFCFGATNQSLTLWPLFLPFAIFFLFLSLLNSWLVPGGFAWRNHHRN SPQLRGPIGWPLLGSISHMSRLAHRKLAEISASLDGDANRLMAISLGATRVIISSHPDTA KEILSGSAFSDRPMKESARLLMFERAIGFAPSGDYWRHLRRIAANHMFSPKRVAALEGLR RRIADDMVDQVWKEMESRGEVEPRGILHKGSLSNVIESVFGRGLCSDGEQLGSMVREGYD LIAQFNLEDYFPLGFLDFYGVKRRCHKLAARVKCFLGEIIKERRKEECKGRDDFLSVLLT LPKEDQLNDSDMVSVLWEMIFRGTDTIAILLEWIIARMVLHPDVQAKAQQEIDECMGSHR EVQDSDIPSLPYLQAIVKEVLRLHPPGPLLSWARLAIHDVHVGKFFVPAGTAAMVNMWAI THDESIWKDPLAFKPERFIEEDVGIMGSDLRLAPFGSGRRVCPGKTLGLATVHLWLAQLL HRFTWLPAQPIDLSECLRLSLEKKQPLACHVVPRESAAFM

 

>CYP78A91P scaffold 5 1981957-1982448 (+) aa 126-291

69% to CYP78A JcCB0658201.10 
93% to CYP78 maker-scaffold_26-augustus-gene-34.24

YWRLLRRIASSHLFAPKRIAAHEPGR*MDCSAMLNGIAGEQSARGAVTLCKHLQAAALNNIMGSVFGKRYDVGQD

SEEVRELREMVKERFELLGTFNWSDYLPWLSYLYDPFRINQRCSALAPRVRKLVRGIIEEHRRRGSGKVSD

NADFVNVLLSLDGEEKLE

 

>CYP78A92P pseudogene fragment

maker-scaffold_1-snap-gene-136.15-mRNA-1 protein Name:"Similar to CYP78A3 Cytochrome P450 78A3 (Glycine max)" AED:0.10 eAED:0.37 QI:0|0|0|1|0|0|3|0|158

47% to CYP78A5 Arabidopsis thaliana, C-helix region
46% to CYP78D2 Populus trichocarpa
74% to maker-scaffold_0-augustus-gene-124.25

13633323 GMRGFLMFGSMNLMAGLVHRQLVADAE*CGAIQ 3633421 &

13633421 FNLGETRVIITCKPDVAKEILNISVFADRLVKQLAYSLMF NRAIGFAPYGVYWRMLRKIVATHLFCPKQINRSEEQRF*ITNQMVSSL 13633693

 

>CYP78A93P pseudogene join two models

maker-scaffold_14-snap-gene-71.22-mRNA-1 protein Name:"Similar to CYP78A3 Cytochrome P450 78A3 (Glycine max)" AED:0.38 eAED:0.46 QI:0|0|0|1|0|0|2|0|160

41% to CYP78D2 Populus trichocarpa
42% to CYP78A5 Arabidopsis thaliana

CYP78 maker-scaffold_14-snap-gene-71.21-mRNA-1 protein Name:"Similar to CYP78A3 Cytochrome P450 78A3 (Glycine max)" AED:0.45 eAED:0.79 QI:0|0|0|1|0|0|2|0|113

45% to CYP78D2   Populus trichocarpa aa 100-132, yellow does not match
49% to Vitis vinifera 78A25
69% to maker-scaffold_0-augustus-gene-124.25
concatenated pseudogene

7090822

SLANLLSSLLLLGLACLTVALLYWAYLGTRAKPIPGSRGFPVFGSMN

LMAGLVHRRLATVTEQCRASWLMAFNLGESRVIVTCNLDVAKE &

LMAGLVHRRLATVTEQCRASWPMAFNLRESRVIVTCNLDVVKEILNSFVFVDCPVEEST

YRLMFN*AIGFTPYGVYWRMLRKITTTHLFYPKQINGLEEQRF*ITNQMVS 7091458

 

>CYP78A94P augustus_masked-scaffold_31-processed-gene-0.4-mRNA-1 protein Name:"Similar to CYP78A3 Cytochrome P450 78A3 (Glycine max)" AED:0.18 eAED:0.18 QI:0|-1|0|1|-1|1|1|0|114

51% to CYP78D2 Populus trichocarpa C-helix region
80% to maker-scaffold_0-augustus-gene-124.25

38667 GFPVFGS

MNLMASLVHRRLAATAEQCGASRLMAFSLEKTRVIVTCNPDVAKEILNNFVFANRLVKES AYSLMFNRAIRFTPYGIYWRMLQKIAATHLFYPKQINGSEEQRFQIASQMVSSL 38305

 

CYP79 family (1 gene, 0 pseudogenes)

 
>CYP79A60 maker-scaffold_11-augustus-gene-7.27-mRNA-1 protein Name:"Similar to CYP79A2 Phenylalanine N-hydroxylase (Arabidopsis thaliana)" AED:0.00 eAED:0.00 QI:145|1|1|1|1|1|2|632|588 
61% to CYP79A2 Arabidopsis thaliana, complete
MTAKTNATSSLLALRWGTDAADAAFTGLSGILFGSTTLSTTALLLLASLFFLLLQLRSET HKKFSPAAAPPLPPGPLPWPIVGNLPELFINKPSFRWILGLMKELNANIACIRLGNVHII PVNCPEIAREFLKKQDALFASRPITMGTQYSSRGFLSIAVAPWGDQWKKMRRVVASEVIT PARLRWLLDKRVEEADNLIRYIFNQCNSSNSKLNGTMAARAAGGVVDVRVAVRQYSGNVI RKMMFNKRYFGQGSPDGGPGAEEIEHVDALFTVLSLLYAFCVSDYMPCLRWLDLNGHEKI MKKAIRIVNKYHDPIIDDRIKKWRGCGKDVFSSATKKEPQDLLDVLISAKDTDGKPLLSS EEIKAQTADLIYAAVDNPSNAVEWALAEMINQPEILRKAVEEIDSVVGNLRLVQESDFPR LNYVKACAREAFRLHPIAPFNLPHVSNADSTVAGYFIPKGSHVLLSRIGLGRNPKVWDEP LRFKPERHLQLDNGRAEATAAEVELVEPDLRFISFSTGRRGCMGAALGSAMTVMLLARLL QGFSWQVPPGLSQIDLSESTNDLFLAKPLRAFAKPRLPMHLYTQTTNN 

 

CYP80 family (3 genes, 2 pseudogenes)

 

>CYP80P1 maker-scaffold_148-augustus-gene-5.23-mRNA-1a protein Name:"Similar to CYP80B2 Probable (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 (Coptis japonica)" AED:0.05 eAED:0.05 QI:0|0.5|0|1|0.5|0.33|3|0|575 
52% to CYP80C1 Populus trichocarpa, fused
C-helix is missing in a 13 aa deletion, possibly not functional
50% to CYP80 maker-scaffold_12-augustus-gene-22.11-mRNA-1
C-term revised
53% to CYP80E3 Vitis, 51% to CYP80K1 Vitis
511885 MEIMAQAALAGEVINLLFPVFLSLCLFFLFIKLIKSASSATGPPLPPGPHPWPVVGNIFR LGRKPHVRLSQLAQVHGPLMSLSLGRQLIVVASSPATATQILKTHDKILCGRYAPVSSRRN
DQLKYLDNFLWTELFSTRAIDSQAALREKKVRELIRYLGSKEGEVVNIGEVMFATVFNI LCNLFLSKDFISLEDDEIMKGGIKRLLRSISEVASTPNLADLFPILGPLDIQGLNKKARE LFVKITAMWEDIIKERREAQSAGGHVSRQRDLLDVLIDNNFSDDQINN 511022
LLL
510589 KLFTAGTHTSSSTIEWAMAEMMKNQESLVKARIELAREIKRENQVREADLCNLVYLNACLKETLRLHPP APFLLPHRAIKTCTVMNYTIPKDSQVFVNVWAIGRDSMAWSNPLSFNPERFLSSNLGFMG NNFEFIPFGAGRRICPGLPMAGKQIQLIMASLIYCCNWSLPNGTHPSTLNMNDKLGV

VLQREQPLLLIPKLRRRNY* 509972

 
>CYP80P1-de2b pseudogene
maker-scaffold_148-augustus-gene-5.23-mRNA-1b 
57% to CYP80K1 Vitis vinifera, 420 bp downstream of
maker-scaffold_148-augustus-gene-5.23-mRNA-1a 
54% to CYP80 maker-scaffold_148-augustus-gene-5.23-mRNA-1a
509552 EEIVREFDLWQLPFLNACVKEALRLHLHAPFLPLYQVVDTRL VMKYAIQEVSQIFVNMWAIGHDPVAWNDPLSFKLE*FLQLDLEF 509295
 

>CYP80P2P scaffold 40 2538365-2538511 (+)

56% to JcCA0258831.10 (CYP80?), 52% to CYP80C1 Populus trichocarpa
56% to CYP80 augustus_masked-scaffold_844-processed-gene-0.0
70% to CYP80P1-de2b

LTFLNPCVKETMRLHLPAPFLLFQAIDTCSMMKYTIQEVSQIFVNMCVI

 
>CYP80Q1 maker-scaffold_12-augustus-gene-22.11-mRNA-1 protein Name:"Similar to CYP80B2 Probable (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 (Coptis japonica)" AED:0.04 eAED:0.04 QI:139|1|1|1|1|1|2|331|485 
50% to CYP80G1 Aquilegia formosa x Aquilegia pubescens (Ranunculales)
complete
51% to CYP80E3 Vitis, 52% to CYP80K2 Vitis
79% to maker-scaffold_12-augustus-gene-22.10
MALLVSFIFFLLSILSVVLFLKPSPNNLPPGPFSWPIIGTLLPKLKKQPHVELSKLAQRF GPLMLLKFGVEPVVVASSHVAAVEVLKNQDRLLSGRFAPHSVRIKGYIEHSMVWADCTDY WKMVRKVWRTELFSTKMLDIQAHAREEKVSELMKFLIRKEGEKVNFADVIFGSILNILGA LIFSKDVYDFEDRTDNNLGMKGMIRQLMILAAIPNLADLYPILGGSDFQGLRKASAACVK RMNESWAAIVKQRRKNDDHSKNDFLQVLLDSGFSDPQIDAMLLETFGPGSDTSTSTIEWA MAELLRNPEKLVKVREELDRVIRRSNNVKESDLPNLPYLHACVKETLRLHPPVTFLLPHR AMETCQMMNYTIPKGCQLMVNTYAIGRDSKTWEKPLSFLPERFLNSELDYQGNDFQYIPF GAGRRICPGLSLATRVVRLILASLLHTFDWSLPDGMHPDELDMNDKFGLALQKDIPLVVI 
PKLRK 
 
>CYP80Q2 maker-scaffold_12-augustus-gene-22.10-mRNA-1 protein Name:"Similar to CYP80A1 Berbamunine synthase (Berberis stolonifera)" AED:0.14 eAED:0.14 QI:0|0|0.5|1|1|1|2|215|365 
49% to CYP80G1 Aquilegia formosa x Aquilegia pubescens (Ranunculales)
48% to CYP80B2 Coptis japonica
49% to CYP80E3 Vitis, 49% to CYP80K2 Vitis
MALLALFILFLLSILSLVLFLKPSSKKLPPGPFSWPIIGTQLPSPTMKPNLELFKLAQRY GPLMLFRFGFENVVVASNHVAAMEVLKNQDRVLSGRFKANSVRVKGYIEYSMVWADCTDY WKMVRKILRTELFSTKMLDVHAHVREEKVSELMKFLRRKEGEEVNFVDVIFGCILNMLG

ALIYSKDVYDFEDKTDINLGMKGMIRQLMILAATPNIADLYPIFFDGSDFQGLRKESAAC

VKRMSESWAAIINERRKNNDHTKNDLLQVLLDSGFSDPQIDAIFL (0)

ETFGPGSDTSASTIEWALAELLRNPEKLVKLHEELDRVIGRNNTVKDSDLPNLPYLHACVKETLRLHPPVPFLIPHI ALESCEVMNYTIPKGSEVLVNLYAIGRDPTTWDNPNSFLPERFLNSEVDYQGNHFQYIPF GAGRRMCPGMSLGTRVVRLILAALVHTFDWSLPGGMHQDELDMADRFGVGFQKETPLVVI 
PTLRK*
 

>CYP80R1a  scaffold 844 22257-22084 (-) N-term

67% to CYP80C JcCA0261201.20, 77% to CYP80C1 Populus trichocarpa
56% to CYP80 maker-scaffold_148-augustus-gene-5.23-mRNA-1a

NILDMGKKPHISLAHFAKIHGPVISLRLGTQLLVVGSSPAAAAEILKTHDALLSARHV

 
>CYP80R1b augustus_masked-scaffold_844-processed-gene-0.0-mRNA-1 protein Name:"Similar to CYP80B2 Probable (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 (Coptis japonica)" AED:0.04 eAED:0.04 QI:0|0|0|0.5|1|1|2|0|202 
62% to CYP80C1 Populus trichocarpa, C-term half
64% to CYP80E3 Vitis, 63% to CYP80K1 Vitis
62% to maker-scaffold_148-augustus-gene-5.23-mRNA-1a
N-term is in a seq gap
10642
ELFLAGTETTSTTVEWAMVELLKNQEAMKKLNEELARKMNGNDIREFDLPQLSYLSVCI KETLRLHPPTPFLLPHKALETCTVMNYTIPKDSQIFVNLWAIGRDPEVWDDPLAFKPERF MNSELDFKGNDFEFTPFGAGRRICPGLSMGSKQLHLILASLFHSFEWYLSDDTDPMQLDT 
KEKFGLTLQKEQPLLLIPKSKV* 10037
 

CYP81 family (4 genes, 0 pseudogenes)

 

>CYP81B49 maker-scaffold_2-snap-gene-79.19-mRNA-1a protein Name:"Similar to CYP81E1 Isoflavone 2'-hydroxylase (Glycyrrhiza echinata)" AED:0.07 eAED:0.07 QI:0|0.66|0|1|0.33|0.25|4|0|942 
62% to CYP81B1v1 Helianthus tuberosus, complete
65% to CYP81B27 Vitis
83% to maker-scaffold_70-augustus-gene-5.19 not ohnologs, no synteny
MDVLLYLYYFVLFFLGFLLFSKFQFGKKRKLPPSPLTLPIIGHLYLLFKKPLYRTLAHIS NKYGPISFLRFGSRPVLLVSSPSAAEECFTTNDILFANRPRLFAGKYIGYNYSSIAWSSY GNHWRNLRRISTIEILSTTRLQMFSRSRTNEIRSMIRRLASSGSKVVDMKSTFFELTLNV MMMMIAGKRYYGENVGELDKAKHFQDLVTETLYLAGASHIGDYLPALSWIGLNGLKKRMM RLQQKRDEFIQELIEEHRRMKTDDSSSSNSASDSGERQTMIDVLLSLQKAEPEYYTDKII 
KGLVL (0)
GLLSAGTDTSAGTMEWAMSLLLNNPDVLKKAQDEVDNHVGQGRLLDESDLSKLPY LRCIINETLRMYPAGPLLVPHESSEDCVIGGFDIPRGTMLLVNLWAIHNDPKIWEEPGKF EPERFEGLEGRRDGFKLMPFGSGRRGCPGEGLAERVVGLALGSLIQCFEWERVGDDLVDM TEGAGGLTLPKAQALKAKCKPRPKMMNLLSQP* 7978150
 
>CYP81B50 maker-scaffold_2-snap-gene-79.19-mRNA-1b
60% to CYP81B1v1 Helianthus tuberosus, missing N-term
7983924
FGSRPVLLVSSPSAAGECLTTNDILFANRPRLLAGKYIGYNY LSIGSASYGNHWRNLRRISSLEVFSTNRLQMFSRSRTNEVRSMILRLASSGTKEVDMKLM FFELTLNVIMMMIAGERYYGENVEEESEKARRLHDIVTETFYLSAATHIGDYMPALRWVG FNRLQERLMRLHQKRDEFMQELIEEHKKMKTDDSFISSSSSESGERKKTLIDVLLSLQEA 
EPEYHTDDIIKSLVL
DLIAAGTDTSSGTMEWAMSLLLNHPDVLKKAQAEIDNHVGQGRLF HESDLSKLPYLRCIINETLRMYPAAPLLVPHESSEDCVVGGFDIPHGTLLLVNMWAIHND PKIWEEPRKFKPERFEGLEGRRDGFKLLPFGSGRRSCPVEGLAERMVGLALGSLIQCFEW EMVGDDLVDMSEGAGGLTLPKARVLKAKRKPRPTMVDLLSQL 7989334
 
>CYP81B51P scaffold 2 7695801-7695385 (-)

65% to CYP81 JcCB0480461.10

66% to CYP81E maker-scaffold_70-augustus-gene-5.19
IFTMGTDTSALTMEWATSLLLNHPGTLLKAREEIDNNIGEGRLLDESDIAKLPYLNCIINETLRLYPASSDLVPHVSSEDCTIGGFEIPSRTIPLANAWAVHRDPNLWVDPTSFKPERFHGVEWEKGGFKFMPFGLGRR
 
>CYP81B52 maker-scaffold_70-augustus-gene-5.19-mRNA-1 protein Name:"Similar to CYP81E1 Isoflavone 2'-hydroxylase (Glycyrrhiza echinata)" AED:0.02 eAED:0.02 QI:0|1|0|1|1|1|2|0|511
83% to maker-scaffold_2-snap-gene-79.19-mRNA-1a
60% to CYP81B1, complete
MEILLYYFVLFFFGFLLLSKYRLVKKWKLPPSPLALPIIGHLYLFKNPLYRTLADISNRY GPILLLRFGSRPVLLVSSPSAAEECLTTNDILFANRPRLLAGKYIGYNYLSIGSASYGNH WRNLRRISSLEIFSTNRLQMFSRSRTNEVRSMILRLASSGTKEVDMKLMFFELTLNMIMM MVAGKRYYGENVEEESEKTRRLNDIVTETFYLSAATHIGDYMPALRWVGFNRLQERLMRL HQKRDEFMQELIEEHKKMKTDDSFISSSSSESGERKKTLIDVLLSLQEAEPEYHTDDIIK SLVLDMIAAGTDTSSGTMEWALSLLLNHPDVLKKAQDEVDNHVGQGRLLDESDLSKLPYL RCIINETLRMYPAGPLLLPHESSEDCVIGGFDIPRGTMLLVNLWAIHNDPKIWEEPRKFK PERFEGLEGRRDGFKLMPFGSGRRGCPGGGLAERVVGLALGSLIQCFDWERVGDDLVDMT EGAGGLTLPKAQALKAKCKPRPKMMNLLSQP 
 

>CYP81B53P  scaffold 69 2767537-2767262 (-)

53% to CYP81 JcCA0147611.20, 58% to CYP81B3v2
78% to CYP81B maker-scaffold_2-snap-gene-79.19
PY*TLAHISNRYGQISFLRFCFRPILLVSSPSVAEECFTTNDIHPLCQHPCLFAGKYIGYNYSSIAWSSYGNHWCNLKHISTLEILSTSHLQ
 
>CYP81Q35 maker-scaffold_112-augustus-gene-17.19-mRNA-1 protein Name:"Similar to CYP81E1 Isoflavone 2'-hydroxylase (Glycyrrhiza echinata)" AED:0.02 eAED:0.02 QI:144|1|1|1|1|1|2|772|515 
59% to CYP81Q7 Vitis vinifera
MFMEHTWYSVSLFLFFLLVSGKLFFRRKTRLKNLPPSPTALPIIGHLYLIKEPFYRTVRS LFDRYGPILFLYFGSRPALIVSSASAVEECFTKNDVIFANRPYFLIGKHLHYEHTTVATA SYGPHWRNLRRLTTLEIFSTTRLNMFSGIRHQEVRLLLSKLFQSSRQGFVQVELKSKFAE LTFNIMMRTIAGKRYYGDDIEEKDLEDARRFRDIIREFFEVGGATNLGEFLPIVGWMDCK GVERRMKALKKKIDAFLDGLIDEHRRKQEFEGEEKKNLMYILLSLQQDDPQYYTNEIIKG IIMMMLIAGTETSATTIEWAMALLFNHPEVLKKARAELDAYVGQDRLMDEQDIPKLHYLQ GVVNETLRLYPPAPLLAPHESSEDCSVGGYDVPRGTMLFVNAWAIHRDPKLWDDPTSFKP ERHHQGDEGVVVEPFKLIPFGLGRRGCPGAGLANRVVGLTLGTLIQCFEWERVSEHMVDM TEGKGLSMPKATPLEALCQPRQTMTKVLSQLSNTI 
 

CYP82 family (3 genes, 1 pseudogenes)

 

>CYP82D50 maker-scaffold_37-augustus-gene-44.15-mRNA-1 protein Name:"Similar to CYP82A3 Cytochrome P450 82A3 (Glycine max)" AED:0.02 eAED:0.02 QI:0|1|0|1|1|1|2|0|529

56% to CYP82C2 Arabidopsis thaliana
64% to CYP82D14 Vitis

MDSLLQSPTNIGALLAVLVFIYYLSSLISKNIEVKKRKMAPEAAGAWPVIGHLPLLGGPE LPHITLGAMADKYGPAFTIRLGVRRALVVSDWEVAKECFTINDRALATRPSGVAMKHMGY NYAMFAFAPYGPYWREVRKIATLELLSNRRLEMLKHVRVSEVNMSVRELYGLWLKNKNAT GADSVKVEMKRWFGDLTLNNVLRMVAGKRYFGATAACGSAEAVRCQTVMRSFFRLVGQFV IADAIPFLGWLDMQGHEKAMKRTAKELDSILEGWMEEHRKMRLSNDEANGEQDFMDVMLS ILKDSKLSGYDADTINKATCMNLILGGNDTIKVCLTWALSLLVNNQEVLKRVQDELDRHV GKDRNVEESDMKKLEYLQAVVKEALRLYPPAPLSGPHEAMEECTVAGYHVPVGTRILVNL SKIQRDPRVWSDPLEFRPERFLTSHVGVDVLGQHFELIPFGSGRRACPGTSLGLKVVHLA LARLLHAFHLHTPSGAPVDMTESFGLTNLKATPLEVLLLPRLPSHLYQY

 

>CYP82D51 maker-scaffold_0-snap-gene-12.22-mRNA-1 protein Name:"Similar to CYP82A3 Cytochrome P450 82A3 (Glycine max)" AED:0.21 eAED:0.21 QI:0|1|0|1|1|1|2|0|529

56% to CYP82C2 Arabidopsis thaliana
62% to CYP82D14 Vitis, 61% to maker-scaffold_37-augustus-gene-44.15
 
 

MNFQEATAVVFFGLVLVLAFISFNHLLPETNTKARQAPQPSGAWPIIGHLHLFRASELLH PKLGAMADKYGPAFMLRLGMRRALVVSSWDAAKQCFTTNDKVFSTRPRTVAIKHMGYNYA LPGFAPYGPYWREMRKISTVELLSHRRLDMFKHIRTSEIDLSMKDLYTRWVKNGHGSPVL VEMKQWFSDLTMNIVTRMIAGKRYFGAANYTDFSEEEVQKCKKAITEFMHLVGIFVVSDA LPFLGWLDLQGHERAMKRTAKQLDHMLESWLKEHRCKKRASEGIATADERDFMDVLLSIL DDHQCIGYGTDTVVKATCLGLILGGSDTTSVTLTWALSLLLNNRQALKKAQDELDTKVGR DGLVEESDIRNLVYLQAIVKETLRLYPAAAVSAPREAMEDCTVAGFHIPAGTQLLVNIWK LQRDPSIWPHPCEFSPERFLTSHAADIDVRGQHFELLPFGSGRRACPGISFAIQVLHLTL ARLIQGFDLGTPCCDAMVDMTQGIGLTNHKKTPLDVLLTPRLHPLLYGY

 

>CYP82D52P pseudogene (join two models)

maker-scaffold_0-snap-gene-12.21-mRNA-1 protein Name:"Similar to CYP82A1 Cytochrome P450 82A1 (Fragment) (Pisum sativum)" AED:0.47 eAED:0.49 QI:0|0|0|1|0|0|2|0|101

snap_masked-scaffold_0-processed-gene-12.9-mRNA-1 protein Name:"Similar to CYP82A1 Cytochrome P450 82A1 (Fragment) (Pisum sativum)" AED:0.44 eAED:0.56 QI:0|0|0|1|1|1|2|0|110

71% to CYP82D maker-scaffold_0-snap-gene-12.22-mRNA-1 (adjacent)

1187736 MINFQEVVVFFGLVLLFAFIFFCYHLVVGRRRRRRTNSKPRQAPQPSGAWPIIGYLHLF 1187912 &

1187912 PAFMLQLGMRLAMVVSSWEVAKECFTANDKVFSTHTRYN*AMPAFAPYGPYW

        REMRKISTVELLCHRELDMLKHVWTSEIGLSMKN 1188169

 

        GSLVLGGSETTAVTLTWALS

 

1188681 VAGFHIPAGT

 

        IDVRGQHFELLPFGSGRRACPGICFGTQVLHLALARLIQGFGDG 1188947

1188956 MTQGIGLTNHKKNPLDVFLTPRL 1189024 &

1189026 DPPMLYGH* 1189052

 

>CYP82D53P scaffold 355 110379-109963 (-)

65% to CYP82C JcCA0015251.20, 65% to CYP82H1 Ammi majus
66% to CYP82D maker-scaffold_0-snap-gene-12.22

DIKKLVYIQAIIKETLRLYPTAPFLPPREAIEDCTIAGFSVPAGTQLIVNVWKIHRDPRVSPDPLEFRPERFLTSHKDVDLRGQHFEFLQFGSGRRSCPGLSFGLQMLHLTLARLLHGFELEPHFDVSIDFTIAEAPPL

 

>CYP82D54P scaffold 2184 8792-8214 (-)

56% to CYP82C JcCA0270761.10, 53% to CYP82C2 Arabidopsis thaliana
58% to CYP82C maker-scaffold_0-snap-gene-12.22
63% to CYP82D14 Vitis
EGDDALRCKKAIRDFFHLVGLFILPDAIPFLGWLDLQGYKRAMKRTTKELDCFLDVWLQEHKHRILSSDARDEKDFIDIMLSILEYSKLPDHNXGTIIKSTCL ()
NLILGGNDTTTLTLTWCISLLLNNRHAMKKAQEELDIQVGRERIVEESDIENLKYLQAIIKETFR

 

>CYP82D55 maker-scaffold_5-snap-gene-93.26-mRNA-1 protein Name:"Similar to CYP82A3 Cytochrome P450 82A3 (Glycine max)" AED:0.02 eAED:0.02 QI:0|0|0|1|1|1|2|0|549

53% to CYP82H1 Ammi majus, revised seq complete
56% to CYP82D14 Vitis, 55% to maker-scaffold_37-augustus-gene-44.15

MDFSSLPLLYSSATTTVVTTTLVLVVVYGLYWIGWNNGVVGNYKKKRDQARPRPPEPPGA WPIFGHLAQLGGPKPLFRTLGDMADRNGPVFMLRFGMYPTLVVSRWDVARECFTTNDRAL ASRPTSVAGKYLSYGGAIIGFAPYGAYWREIRKIATLELLSNRRIESLKHIQFAEVGKCI RELYELWVRKQRRPFTVEMNQWFGDLTMNVIVKMVIGKRYFNTTDPSDEDKEARQFRRAI IEFSKLAGVSVASDAIPFLEWMDLQGHKSAMKKASKEMDSIAVGWLDEHRDRRRGNRNRD DQQQDDDFMDVLLSILEEDTHLSTYDRDTVVKATAL (0) 9316484

9315666 ALILAASETTAITLSWALSLLLNNRHVLRKV RDELEKCVGKDREVKADDIKNLVYLQAVVKETLRLYPPGPLSVPHEAIEDCCVHGFRVPA GTRVLVNLWKIQRDPTLSSDPSQFRPERFLTVTGAGSTTHINVDVRGQHFELIPFGSGRR ICPGISFALHTIHMTLARLIHEFELGTPSQAPVDMTEGSGLTMPRITPLQVIFTPRLPFL

QVQYNNTNQ

 

>CYP82D56P scaffold 942 24079-23774 (-)

53% to JcCB0894651.10, 44% to CYP82A6 Pisum sativum
54% to CYP82 maker-scaffold_5-snap-gene-93.26

NRPSTVAIRLLGYNRAMFGFAPYGSYWREIRKIATLQLLSNNRLEMLKHIQASEIDMSIRHLYELWVNKTTATASLDQGRPNQVLVEMKQWFGNLTLNIITR

scaffold 942 23579-23214 (-)

64% to CYP82D maker-scaffold_0-snap-gene-12.22
63% to CYP82H1 Ammi majus

QEELDIQVGRERIVEESDIENLKYLQAIIKXTFRLYPAAPLSAPQITTEDCTVAGFYVPSGTRLVTNIWKIQRDPAV

WMDPSNFNPERFLTRHTNLDVWGQHFELITFGLGRRSCPGINLAL

 

CYP84 family (2 genes, 1 pseudogene)

 

>CYP84A45 maker-scaffold_68-augustus-gene-14.18-mRNA-1 protein Name:"Similar to CYP84A1 Cytochrome P450 84A1 (Arabidopsis thaliana)" AED:0.03 eAED:0.03 QI:352|1|1|1|1|1|2|209|510

70% to CYP84A1 Arabidopsis thaliana

MESAALHPLYMILFYAVPPLLFLLGVFVRFRRKPYPPGPKGLPVIGNMNIMDQLTHRGLA KLAKEYGGLIHLRLGFLHMVVVSTPEMARQVLQVQDNIFSNRPANIAIRYLTYDRSDMAF AHYGPFWRQMRKICAMKVFSRKRAESWTSVREEVDSIIRSVAGKAGSPVNLGVLVFSLTM NITYRAAFGSDIRHGQEKFVAILQEFSKLFGAFNLGDFIPWLGGLDLQGFNKRLYGARRS LDAFIDKIIDAHLAKRKNKRTNEAEEDNDMVDDLLAFYDEEDDEKDESGNLQVSRDNIKA IIMDVMFGGTETVASAIEWAMAEMMRSPDDLKRVQQELVDVVGLDRRVQDSDLEKLTFLR CVVKETLRLHPPIPLLLHETAEDAEVGGYFIPKQARVVINSWAINRDPAAWDEPETFKPS RFLKEGAPDFRGSNFEFIPFGSGRRSCPGMQLGLYTLELAMAHLLHCFTWELPDGMKPSE LDMNDVFGLTVPRAERLVAIPTPCLQCPLF

 

>CYP84A46P scaffold 6 10541183-10540923 (-)

48% to CYP84A JcCB0578261.10
64% to CYP84A maker-scaffold_68-augustus-gene-14.18

MMRSPEDLKRVQQELVDVVGLE*RVQDLDLEKLTFLSCVIKEKL*LHLPISLLHETVESLATSSRSKHGW

*WAINRDPEAWDELEMF

 

>CYP84A47P scaffold 106 1108989-1108459 (-)

72% to CYP84A JcCA0156071.10, 70% to CYP84A1 Arabidopsis thaliana
92% to CYP84A maker-scaffold_68-augustus-gene-14.18

NMNIMDQLIHRGLAKLAKEYGGLIHLWLGFLHMVVVSTPEMARQVLQVQDNILSNRSANIAIRYLTYGRSGMAFA

HYGPFWRQMCKICDMKVFSRKRAESWTSVREEVDSIIRLVAGKVGSPVNQGELVFSLTMNITYRAAFGSDIR

QG*EKFVAILQEFSKLFGAFNLGDFIPWLG

 

>CYP84A48 maker-scaffold_34-augustus-gene-35.5-mRNA-1 protein Name:"Similar to CYP84A1 Cytochrome P450 84A1 (Arabidopsis thaliana)" AED:0.02 eAED:0.02 QI:170|1|1|1|1|1|2|88|512

71% to CYP84A1 Arabidopsis thaliana
83% to maker-scaffold_68-augustus-gene-14.18 (ohnologs)

MESSLQQPLPMILFFVLSLLFLLGLFVRLRRKPYPPGPKGLPVVGNMNMMDQLSHRGLAK LAKEYGGLVHLRLGFLHMVVVSNPEMARQVLQVQDNIFSNRPANMAIRYLTYDRADMAFA HYGPFWRQMRKICVMKVFSRKRAESWSSVRDEVDSIVRAVAAKAGSPVNLGGLVFQLTMN VTYRAAFGSDICEGQEKFVAILQEFSKLFGAFNLVDFIPWLNWFDPQGFNKRLARARRSL DVFIDKIIDAHLAKRKNKKSDNTEEDNDMVDDLLAFYDEEAKKGESDDLQGSIKMTRDNI KAIIMDVMFGGTETVASAIEWAMAEMMKSTEDLKRVQQELADVVGLDRIVQESDFDKLTF LKCVIKETLRLHPPIPLLLHETAEDAEVAGYAIPKKSRVVINAWAVNRDPGSWDQPETFK PSRFLEQGAPDFKGSNFEFIPFGSGRRSCPGMQLGLYALELTMAHLLHCFTWELSDGMKP SELDMNDVFGLTAPRAERLVAVPTPRLQCPLF

 

>CYP84A49P pseudogene

maker-scaffold_69-snap-gene-23.27-mRNA-1 protein Name:"Similar to CYP84A1 Cytochrome P450 84A1 (Arabidopsis thaliana)" AED:0.03 eAED:0.07 QI:56|0.5|0|1|0.5|0.33|3|0|421

80% to CYP84A maker-scaffold_68-augustus-gene-14.18-mRNA-1
63% to CYP84A1 Arabidopsis thaliana, missing the N-term
frameshift = &

LLMVVVSTPEMARQVLQVQDNIFSNRPTNIAVRYLTYYRSRMVFAHYGPFWRQMRKIFVTKVFSR

&

SVRE*VDSVIRTVAGKAGSPVDVGELALSLMTNITYRAAFGSDIREGQEKFVDIIQELSRHFGAFN LGDFIPWLGRVDLQGFSKRLARARRSLDEFIDRIIDAHLAKRKNRANETEEDNDMVDDLL SFYDEDAKNGESEDLQGSINLIRDNIKAIIM (0)
DVMFGGTETIASVIEWAMAEMIRSPA DLSRVQQELVDVVGVDRRVQDSDFEKLTFLRRAIKETLRLQPPVPLLQHETADDADIGGY AIPKQAQVVVNAWAINRDPEAWDEPETFKPSRFLKEGAPDFKGSNFEFIPFCSGWRSCPG MQLALYTLELAVAHLLHCFTWDLPDGMKLSELDMNDVFGLTLPRAERLVAIPTPSLQFPLF* 

 

CYP85 family (2 genes, 2 pseudogenes)

 

>CYP85A1-de2b4b8b9b Scaffold 19 CYP85 pseudogene exons 2, 4, 8, 9

42% to CYP85A1 Arab.

2163856 QLLPKIDQSMRSSYLSYWD 2163756

2163188 LSEEEIIDQLLTILYYSG 2163135

2163019 HNYFLLFVGVNRLYPGKEWSIPPLLVCFSVSS*ASNR*EPMTNSILKFPRVAAPNG 2162852

2162851 LHRRLSNY 2162828

 

>CYP85A1 maker-scaffold_19-augustus-gene-21.23-mRNA-1 protein Name:"Similar to CYP85A1 Cytochrome P450 85A1 (Solanum lycopersicum)" AED:0.16 eAED:0.16 QI:79|1|1|1|0.87|1|9|107|514

65% to CYP85A1 Arabidopsis thaliana, complete
81% to maker-scaffold_1-augustus-gene-80.12-mRNA-1 (ohnologs)

MCAVVSLLGKQSSGLYIPLTDLNVSNGASEHIHFIYGSLNSVVSVLSFLGEP  (3 UTR)

2169477 MAVLVVVFGVVLGLCICTALLRWNEVRYRKKGLPPGTMGWPVAGETTEFLKQGPSFMRNQRAR (2?)

YGSLFKSHILGCPTIVSMDPELNRYILLNEGKGLIPGYPQSMLDILGKCNIAAVHGPLHKSMRGA LLSLISPVMIREQLLPKIDKFMRSHLSNWDGKTIDIQEKTKE (0)

MALLSSLNQIAGTESSLIAEGFKPEFYKLVLGTLSLPINLPGTNYRRGFQ (0)

ARKNIISMLKTIIERRRASSSIHHDMLGGLLRGEDSRYKLSDEEIIDQLITILYSGYETVSTTSMMAVKFLHDHPRALEQLR (0)

EEHLEIRRSKGPEDPINWNDYKSMSFTRA (0)

VILETARLATIVNGVLRKTTHEMKLN (1?)

GFVIPKGWKIYVYTREVNYDPLLYPEPFTFNPWRWL ()

DKSLESHNYFMLFGGGSRLCPGKELGVAEISTFLHYFVTRYR (2?)

WEVGGDKLLKFPRVEAPNGLHIRVSSY*

 

>CYP85A23 maker-scaffold_1-augustus-gene-80.12-mRNA-1 protein Name:"Similar to BA13 Cytochrome P450 85A (Phaseolus vulgaris)" AED:0.09 eAED:0.09 QI:0|1|0.88|1|0.87|0.88|9|327|520

58% to CYP85A1 Arabidopsis thaliana

MAVLVLVFGVVVLGLCICTALLRWNEVRYRKKGLPPGTMGWPVFGETTEFLKQGPNFMKNKRA RYGSLFKSHILGSPTIISMDPEVNRYILLNEAKGYVPGYPQSMLDILGKCNISAVHGPTH KTIRGAMLSLISPIMIRDRLQPKIDAFMRSHLSSWDGKTIDIQKKTKEMALLVSLMQIVG HESNLIVEAFKSEFYKLVLGTLSLPISLPGTNYSNGLLARKNIVNILKTIMEGRRACPSN QQDMLDCMLREEDPRYKLNDEEMIDQLITIVFSGYETVSTTSMMAVKYLYDHPKALDKLR EEHFTIRKNKGPEEPINWNDYKSMSFTRAVIFETARLATIVNGVLRKTTQEMELNGFVIP KGWRIYVYTREINYDPLLYPDPFTFNPWRWMDKSLESHNYFFLFGGGGRLCPGKELGIVK ISMFLHYFVTRYRWEQDGGEIRKFPRVEAPNGLHIRVSNL

 

>CYP85A24P pseudogene (join two models)

snap_masked-scaffold_2-processed-gene-19.9-mRNA-1 protein Name:"Similar to BA13 Cytochrome P450 85A (Phaseolus vulgaris)" AED:0.42 eAED:0.42 QI:0|0|0|0.5|1|1|2|0|60

68% to CYP85A1 Arabidopsis thaliana N-term

CYP85A maker-scaffold_2-snap-gene-19.31-mRNA-1 protein Name:"Similar to CYP85A1 Cytochrome P450 85A1 (Solanum lycopersicum)" AED:0.38 eAED:0.38 QI:0|0|0|1|0|0|2|0|84

1889199 MAVLVVVLGLCICTALLRWNEVRYRKKGLPLGTMGWPVVGETTEFLKQGPSFMRNQR (2)

1889026

YGSLFKSHILGCPRIVSRDPELNRYILLNEGKGLIPGYPRSMLDILGKCNIAAVHG &

MRRALPSLISPVMIKEQLLPKIDKFMRSHLGNWDGKSIYIQEKTKE ()

MALLSLLNQIAGTESSLIVEAFKPEFYKLVLGTLSLPINLPGTNYKRGFQ ()

ARYNIISILKTIIERRRASSSIHHDMLG &

1878595 WLLRGEDSRYKLSDEEIIDKLITILYSGY 1878509

 

>CYP85A25P pseudogene

maker-scaffold_86-augustus-gene-5.26-mRNA-1 protein Name:"Similar to BA13 Cytochrome P450 85A (Phaseolus vulgaris)" AED:0.06 eAED:0.06 QI:0|1|0.75|1|1|1|4|0|278

64% to CYP85A1 Arabidopsis thaliana 

MAVLVMVFGVVLGLCICTTLLRWNEVRYRKKGLPPGTMGWPVVGETTEFLKQGPSFMRNQ RARYGSLFNSHILDCPTIVSMDPELNRYILLNEGKGLIPSYPQSMLDILGKCNIAAVHGP LHKSMRGALVSLISPVMIREQLLPKIDKFMRSHLSNWDGKTIDIQEKTKEMALLSSLNQI AGTESSLIAEAFKPEFYKLVLGTLSLPINLPGTNYRCRFQARKNIISILKTIIERRRASS SIHHDMLGGLLRGEDSRYKLNDEEIIDQLITILYSGYR 544201

 

>CYP85A26P scaffold 1

85% to CYP85A maker-scaffold_19-augustus-gene-21.23

3374523-3374600 (+) 154-179

PQFILDILGKCNIAVVHGPPHKSMRG

3374618-3374737 (+) 185-222

ISPVMIREQLLPKIDKFMRSHLSNWDGKTIDIQEKTKE

3375083-3375184 (+) 223-256

LASLSSLNQIVGTESSLIVETFKLEFYKLVLGTL

 

>CYP85A27P scaffold 62

84% to CYP85A maker-scaffold_19-augustus-gene-21.23
54% to CYP85A1 Arabidopsis thaliana

2798822-2798935 (+) 108-155

FLRPQNRYGSLFKSSMDPELNRYILLNEGKGLIPGYSQ

2799191-2799397 (+) 156-222

SMLDILGNCNIAAVHGPLHKSMRGALLSLISSVMIREQLLPKIDKFMRSHLSNWDGKTIDMKEKTKE (0)

2804573-2804725 (+) 223-272

MALLSSLN*IVGTESSLIAEAFKPEFYKLVLGTLLLPINLPGTTYRRGFQ

2804820-2804969 (+) 281-329

LKTIIERRRTSSSIHHDMLGGLLRGEDSKYKLSDEEEIIDQLITILYSSY

 

>CYP85A28P scaffold 73 2229968-2230054 (+)

65% to CYP85A1 Arabidopsis thaliana

VSGFVIPKGWTIYVYTREVNYDPLLYHVP

 

>CYP85A29P scaffold 116 121573-121334 (-)

87% to CYP85A pseudogene, 60% to CYP85A1 Arabidopsis thaliana

VLLNEGKGLIPSYPQSMLDILGKCNIATAHGPLHKSMRGGLLSLISPIMIGKQLLPKIDKFIRSHLSNWD

 

>CYP85A30P scaffold 180

83% to CYP85A maker-scaffold_1-augustus-gene-80.12

1159618-1159848 (+)

116-192

YGNLFKSHILGCPTIISMDPKVNRYILLNEVKGFVPGYS*SMLDILGKNNISAVQGPTHKTIRGAMLNLISPIMIRD

192-238 1159853-1159993

DRLLPKIDEFMRSHLSSWDGKTIDIQQKKKE

222-271 1160410-1160559 (+)

QMAMLAALMQIVGPESNLVAEAFKT*FYKLVLGSLSLPINLPGTNYSNGF

 

CYP86 family (6 genes, 2 pseudogenes)

 

>CYP86A71 augustus_masked-scaffold_30-processed-gene-43.1-mRNA-1 protein Name:"Similar to CYP86A1 Cytochrome P450 86A1 (Arabidopsis thaliana)" AED:0.00 eAED:0.00 QI:0|-1|0|1|-1|1|1|0|512

76% to CYP86A1 Arabidopsis thaliana, complete
79% to CYP86A30 CAAP02004642.1 Vitis
67% to CYP86A augustus_masked-scaffold_14-processed-gene-15.0

METLLAFFLAAAITSAYFLWFNVLARKLTGPKVWPIVGSLPYLIANRSRVHDWIAQNLRQ TGGTATYQTCTLALPFVARKQGFFTVTCHPKNIEYVLKTRFDNYPKGPTWQEAFHDLLGQ GIFNSDGDTWLIQRKTAALEFTTRTLRQAMARWVNRTIRLRLWSILAKAEAQRSSVDLQD LLLRLTFDNICGLTFGKDPETLSLELAENSFAIAFDSATEATLQRLLYPSFLWRIKKALG LGAESTLKKSLTIVEKYITDAIEARKESPSDDLLSRFIKKRDLEGHLFPSSVLRRIALNF VLAGRDTSSVALSWFFWLVMNHPRVEKRIIDEISSVLKKTRGEDQRKWVEEPLGFDEVDQ LVYLKAALAETLRLFPSVPEDFKYVVSDDVLPDGTVVPAGSTITYSIYSVGRMKTIWGED CMEFRPERWLSAEGDRFESPKEGYKFIAFNAGPRTCLGKDLAYLQMKSVAAAVLLRHRLS LVPGHRVEQKMSLTLFMKNGLRVYVHPRNLGQ

 

>CYP86A72 augustus_masked-scaffold_99-processed-gene-2.0-mRNA-1 protein Name:"Similar to CYP86A2 Cytochrome P450 86A2 (Arabidopsis thaliana)" AED:0.04 eAED:0.04 QI:0|-1|0|1|-1|1|1|0|545

66% to CYP86A1 Arabidopsis thaliana, complete
90% to augustus_masked-scaffold_14-processed-gene-15.0 (ohnologs)

MAYLLWFRLISRSLKGPRVWPLLGSLPGLIDNADRMHDWIAENLRACGGTYQTCICAIPS LARKQGLVTVTCDPQNLEHILKTRFDNYPKGPTWQAVFHDLLGEGIFNSDGDTWLFQRKT AALEFTTRTLRQAMARWVNRAIKLRFCPILKAAQLESKPVDLQDLLLRLTFDNICGLAFG KDPQTLSPGLPENGFASAFDRATEASLQRFIFPEFIWKLKKWLRLGLEVTLTESVEHVEK YLADVIKTRKLELLNQHQGGTHHDDLLSRFMKKKESYSDSFLQHVALNFILAGRDTSSVA LSWFFWLVMQNPRVEEKILREICTVLMETRGNNPSKWVDEPLAFEEVDRLIYLKAALSET LRLYPSVPEDSKHVAADDVLPDGTFVPAGSAITYSIYSAGRMKFTWGEDFLEFRPERWLS PDEKQFEAQHPFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLSLAPGHCVEQKMS LTLFMKYGLKVNVHHRDLTAIASSIHRETEGKLWGVEGLAVKCNGVTPAACDDRRVGVEM IVEVA

 

>CYP86A73 augustus_masked-scaffold_14-processed-gene-15.0-mRNA-1 protein Name:"Similar to CYP86A2 Cytochrome P450 86A2 (Arabidopsis thaliana)" AED:0.02 eAED:0.02 QI:0|0|0|0.5|1|1|2|0|572

65% to CYP86A1 Arabidopsis thaliana, complete

METSTVMLLVAGVVAYLFWFRFISRSLNGPRVWPLLGSLPGLIENADRMHEWIAENLRAC GGTYQTCICAIPFLARKQGLVTVTCDPKNLEHILKTRFDNYPKGPTWQAVFHDLLGEGIF NSDGDTWLFQRKTAALEFTTRTLRQAMARWVNRAIKLRFCPILKTAQLESKAVDLQDLLL RLTFDNICGLAFGKDPQTLSPGLPENGFATAFDRATEASLQRFIFPEVIWKLKKLLRLGM EVTLTESVEHVEEYLSSVIKTRKLELQSQHEGGTPHDDLLSRFMKKKESYSDAFLQHVAL NFILAGRDTSSVALSWFFWLLIHHPNVEDKILREICTVLMETRGDNPSKWVDEPLAFEEV DRLVYLKAALSETLRLYPSVPEDSKHVIADDVLPDGTFVPAGSAITYSIYSAGRMKFTWG EDCLKFRPERWLSPDEKQFEAQHPFKFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRL TVAPGHRVEQKMSLTLFMKYGLKVNVHERDLTAIAASIPKENTEEKLWGRVVDGMAVNCN GGTQAVSDGRRVGLEMVVEGGDEGYSIAISDD

 

>CYP86B13 maker-scaffold_226-augustus-gene-7.11-mRNA-1 protein Name:"Similar to CYP86B1 Cytochrome P450 86B1 (Arabidopsis thaliana)" AED:0.06 eAED:0.06 QI:0|1|0|1|1|1|2|0|573

71% to CYP86B1 Arabidopsis thaliana, complete
76% to CYP86B7   gi|147836212|emb|CAN75428.1 Vitis
50% to CYP86C augustus_masked-scaffold_5-processed-gene-26.3

MIVSSNQTAFFSVKLPSDFISKHLFLLPEIQAIE LFVALIVFAAIRSLRQEKRHGLPIWPFFGMLPSLLLALRADIYEWISGVLNRQNGTFTFR GPWLTSVNCVVTADPRNLEHLLKTKFASFPKGGFFRTTVRDLLGDGIFNVDDNPWRRQRK TASIEFHSAEFRNMTSESLVELVHSRLLPVLEDSIRQSVPIDLQDVLLRLTFDNVCMIAF GVDPGCLRPGLPEIPFARAFEDATEATVIRFITPITLWKIMRYLDLGIERKLRRSIRQVD QFAEEVIRTRKKELSVDSNEKRVKSDLLSVFMGLKDEDGKPFSDKFLRDICVNFILAGRD TSSVALSWFFWLLDRHPAVEQQILKEICCIVRQRVNSDKGESNGPLVLRPDEVKKMDYLQ AALSEALRLYPSVPVDHKEVIEDEVFPDGTKLKKGTKVIYAIYAMGRMESIWGKDCREFK PERWLRDGRFMSESAYKFTAFNGGPRLCLGKDFAYYQMKFAAASIIYRYHVKVVENHPVV PKLALTMYMKYGLKVTLCRRDESELRTNLTAVS

 

>CYP86C11 augustus_masked-scaffold_5-processed-gene-26.3-mRNA-1 protein Name:"Similar to CYP86B1 Cytochrome P450 86B1 (Arabidopsis thaliana)" AED:0.01 eAED:0.01 QI:0|-1|0|1|-1|1|1|0|528

59% to CYP86C1 Arabidopsis thaliana, complete
78% to augustus_masked-scaffold_7-processed-gene-67.0 (ohnologs)

MLEKALFSDFSQTKELLAAHVRVSGVAAAVLGLFIFTALVQKLTNKGPLLWPVLGIMPTL FFNINRAYDWITETLIKSGGTFRFRGMWTSGAYVIVTSDPSNIEYMLKTRFKNFPKGQYF RERFSDLLGDGIFNADDDLWKEQRRIATSEMHSRRFLQYSLQTIQDLVHQKLLKLLNKLA VSGESIDLQDVLLRFTFDNICTAAFGVDPDCLAIDLPEVPFAKAFELATEFSVLRFVTPP LLWKSMKYFGVGSEKRLKEAVEIVHKFAEKTVIDRRTENCKLGNLNGRSDLLSRIIEMED PDEKGKKKLSDKFLKDFCISFTLAGRDTSSVALAWFFWLLHEHPRVEQRILEEIKEMIDL RESKKGKVDDVTFSMDELKKMVYLEATLSETLRLYPSVPVDFKEVQEDDVFPTGTDVKKG ARVFYSIYSMARMEDIWGKDCREFKPERWIKDDGELVNESQFKFAVFNAGPRLCVGKKFA YMQMKLVAASILLRYSVKVVEGQTIVPKLTTTLYMKNGLMVTLQPRMK

 

>CYP86C12 augustus_masked-scaffold_7-processed-gene-67.0-mRNA-1 protein Name:"Similar to CYP86B1 Cytochrome P450 86B1 (Arabidopsis thaliana)" AED:0.01 eAED:0.01 QI:0|-1|0|1|-1|1|1|0|535

61% to CYP86C1 Arabidopsis thaliana, complete

MGSSGTGKFVLSQGQLTTKWLFAQVRVSDVAVALLGLFIFTALARRLTNKGPMLWPVLGI IPTLFFHINQLYDWGTQTLIKCGGTFHFRGMWMGGAHGIVTVNPSNIEYMLKTRFRNFPK GKYYRERFSDLLGDGIFNADDELWKEQRRAATSEMHSSRFVQYSLRTIQDLVHQKLLKLL NKLAVSGDRVDVQDVFLRFTFDNICTAAFGVDPDCLAIDLPEVPFAKAFELATESTLFRF IVPPFVWKFMKLLGIGSEKKLKEAVQIVHKFGEKTVTGRRVELSKLGSLNDRSDLLSRLI EVEDPEQKGKKKFSDKFLEDFCISFILAGRDTSSVALTWFFWLLHKHPRVEERIIDEIKE IVGQRKSKKEKDEDVIFSIDELKKMVYLQAALSESLRLYPSVPMDFKEVQEDDVFPDGAF VKKGARVFYLIYSMGRMEDIWGKDCKEFKPERWMKNGELVSENQFKYAVFNAGPRLCVGK KFAYMQMKMVAASILLRFSVKVVEGQTIVPKLTTTLYMKNGLLVTFEPRLLHLLP

 

CYP87 family (3 genes, 1 pseudogene)

 

>CYP87A23 maker-scaffold_2595-augustus-gene-0.2-mRNA-1 protein Name:"Similar to CYP87A3 Cytochrome P450 87A3 (Oryza sativa subsp. japonica)" AED:0.11 eAED:0.11 QI:27|1|1|1|0.5|0.44|9|142|472

69% to CYP87A2 Arabidopsis thaliana, complete

MSVALCIGAFIITCIMHWVYNWRNPRCNGKLPPGSMGLPLLGETLQFFAPNTSSDIPPFI KERMEKYGPVFRTSLVGRPVVISTDSDLNYFIFQQEGRLFQSWYPDTFTEIFGRQNVGSL HGFMYKYLKNLVLNLXGPENLKEKLLPEVEEAARKSLHLWTCQNTVELKEAISTMIFNLT AKKLIXYDATKSTEXLRENFVAFIKGLISFPLDIPGTQYHKCLQGRKKAMKLLKDMLXER RAMPXKRHGDFFXLVVEELEKQGTVLTESIALDLMFXLLFASFETTSLALTLGMKFLSDH PSVLKXLTEEHEAILRRKENGDSGLTWKDYKSMTFTFQVIXEIVRLANIVPGIFRKALHD IHFKGYTIPAGWGVIVCPPAVHLNPAKYEDPVAFNPWRWDGVELNGATKHFMAFGGGMRX CXGTDFTKXQMAVFFHCLVTKYRWTAVSGGDILRTPGLXFPNGFHIQISEKK

 

>CYP87A24 maker-scaffold_99-snap-gene-0.11-mRNA-1 protein Name:"Similar to CYP87A3 Cytochrome P450 87A3 (Oryza sativa subsp. japonica)" AED:0.10 eAED:0.10 QI:23|1|1|1|1|1|8|228|479

54% to CYP87A2 Arabidopsis thaliana, complete
56% to CYP87A14 Vitis

MAEMLVSVSLCVAASLIICIVHLVQKWRNPKCSTGRLPPGSMGLPLIGETLQFFSPHYSF DIPPFLKERIKRYGSLFKTNLVGRPVIVSTDSEFNHYILQQEGKLVELWYMDSFMKLLGD QVLTTSASLSIHKHLRNLVLSYFGPESLKKMVPEVAEMARQTLHFWSTQEAIEVKKSTED MFFDFGSRKLFSFDLSNSTENIIKNKFADFWEGLISFPLNIPGTTFYKCLKARENVLKML RNLIKERRNQPKRIKGDFLDKLIEEMEKEGAFLTEEAIVQLIFLLTFASFETTSLTLTLA IKFLTDHPQVLMALTDEHEAILRSRETADSAITWEEYKSMTFTSQVINEVLRLSNVAPGI FRRALTDIQVKGYTIPAGWTIMICPQTLHFDPSKYKDPLAYNPWRWEGCGANTWSKNFNP FGGGMRLCAGADFSKMLMEMFLHFLVTKYRWKRIKGGEIVGNPATSFPNGFHIQVSEKK

 

>CYP87A25P pseudogene scaffold 4

74% to CYP87A maker-scaffold_99-snap-gene-0.11
54% to CYP87A2 Arabidopsis thaliana

8549213-8549109 (-) 410-444

GYTIPKGWTIMLCPLTVHVDPSKYKDPLTYNPWRW

8548956-8548780 (-)

FNPFGGGMRICAGAEFNKMLMEMFLHFLVTKYRWTTIKGGEIVRTPGISLPNGFHIQVS

 

>CYP87A26P possible pseudogene (join 2 models)

maker-scaffold_169-snap-gene-3.13-mRNA-1

pseudogene fragment

CYP87A maker-scaffold_169-snap-gene-3.12-mRNA-1 protein Name:"Similar to CYP87A3 Cytochrome P450 87A3 (Oryza sativa subsp. japonica)" AED:0.42 eAED:0.43 QI:0|0|0|0.6|1|1|5|0|217

56% to CYP87A2 Arabidopsis thaliana, 
~60% to maker-scaffold_99-snap-gene-0.11-mRNA-1

364220 MGSVTILGRQ (0)

LEYRYITHWIYRWRNPKCNGRLPPGSMGLPLLGENLQFFTSYNSFGIPPFIEKRMQR (2)

YGPLFKTSLLGQRVVISTDPEFNHYILQQEGKLVELWYMDSFMELIGQQVSSNTVHRH

VKSIVMNDFGVESLKGTTILDVEQMVRQTLLSWSRMETIEVRMATQN (0)

MAFELGAKKLISYDSTN (2)

(32 aa gap, with repetitive seq. inserted)

SSYIFLVQARKSVIKMLRDMLKERRASSISKKSSDDFLDHVIQEMEKEGTFFTEEAS VQLIFALIFATFETTSMALILAIKFLTDNPAVLNELT (0)

EEHEAILRRRRNMDSAITWEKYRSMTFTLM (0)

VIHEVLRLANIVTGIFRRALKDIQIN (1)

GYTIPAGWTIMVCPFTLHLNPSKYGDPLAFNPWRWK (0)

GLAQNTSKNFIAFGGGKRSCVGAEYSKVVMAVFLHSLVTKHRYFFLP* 358650

 

>CYP87F1 maker-scaffold_69-snap-gene-9.17-mRNA-1 protein Name:"Similar to CYP87A3 Cytochrome P450 87A3 (Oryza sativa subsp. japonica)" AED:0.31 eAED:0.31 QI:42|0.45|0.25|0.75|0.36|0.33|12|0|530

47% to CYP87D1 Populus trichocarpa
47% to CYP87B6 Vitis vinifera
52% to CYP87A maker-scaffold_99-snap-gene-0.11
52% to CYP87B9 Vitis
GC boundary at GMEK

933640 MGEMFSIWLCFEGLFIIGITHLVYKWRNPKCRGRLPPGSMGMPLIGETFQFFTHGN

SLDLPPFLKKGMEK (2)

YGSLFKTSVAGRPVVISSDPEFNYFIINQEGK LVQKWYMDSLSKTTDRGEFPTTVSADKITKYLRNLVLKHFGPETLKQKLLPPVEEMVRRH

LRLWSTKESVEVQLS

LLSMVFDLTAKLLFNYETDITQLSESYVSQLFTNFSEIMMCFPLNIPGTALYRALK

NKEKAVNMLKGILEERRRAIPNRSHGDILDHVIQDMRDETFLSDNFVAT TMFSILSANIEPIATSIALAIILLTDHPSVLQELR

DEHEAIISSRRVNNTDSTITWDEYKSMTFTSY

VINETFRLANITFGILSKAIRDIEIN

GYTIPSGWTIMIVPTAVHLNPNLFEDPLAFNPWRWK

DLGSTASCKNFLTFGGGMRACLGADYCRMVMAIFLHILVTNYR

WTKIKGGDIIRTPILQFPNGFHIKIWEMKSWRTTERVFTER* 935912

 

CYP88 family (2 genes, 0 pseudogenes)

 

>CYP88A39 contig_21551 = maker-scaffold_60-snap-gene-23.20

          Length = 32958

66% to CYP88A3 Arabidopsis thaliana
80% to CYP88A contig_27481
79% to CYP88A maker-scaffold_96-snap-gene-17.22

26151 MEVGFIWEVYLVLLLVLAAS

26211 FALYILLKRANAWFYERRLGEKRLSLPPGDLGLPLIGNMWSFLRAYKSGDPDSFISTFLQR (2?) 26393

28613 YGRTGVYKAFMFGSPSIMVTLPESCRQVLMDDETFGPGWPKATCDLIGRKSFIGISDEE 28789

28790 HRRLRRLTAAPVNGQEALSVYLGYIEDCVKSALEKWAGMETIEFLTELRKLTFKIIMYIF 28969

28970 LSSESEHIMEALEKEYTALNYGVRAMAINLPGFAYHKALK (0)

      SRKNLVAILNSVVKERRQRMMSCPPPAKKDMMDVLMYV 29329

29330 EDENGRRLSDDEIIDVLVMYLNAGHESSAHITMWATVLLQKHPELFQKAK (0)

29692 AEQEEIVRNRLPTQKGLTLKEIRQMDYLSK (0) 29781

29889 VIDETLRLINISLVVFREARKDVNIS (1?) 29969

30068 GYSIPKGWKVLVWFRSVHLDAEIYPNPKEFNPSRWD () 30175

30303 GYTPKAGTYLPFGAGSRLCPGNDLAKLEISIFLHYFLLNYQ (2?) 30413

30955 LERLNPECPVRYLPHTRPIDNCLARIRKISSPAM* 31059

 

>CYP88A39 maker-scaffold_60-snap-gene-23.20-mRNA-1 protein Name:"Similar to KAO2 Ent-kaurenoic acid oxidase 2 (Arabidopsis thaliana)" AED:0.08 eAED:0.08 QI:271|1|1|1|0.85|0.87|8|557|495 
79% to maker-scaffold_96-snap-gene-17.22 (ohnologs)
MEVGFIWEVYLVLLLVLAASFALYILLKRANAWFYERRLGEKRLSLPPGDLGLPLIGNMW SFLRAYKSGDPDSFISTFLQRYGRTGVYKAFMFGSPSIMVTLPESCRQVLMDDETFGPGW PKATCDLIGRKSFIGISDEEHRRLRRLTAAPVNGQEALSVYLGYIEDCVKSALEKWAGME TIEFLTELRKLTFKIIMYIFLSSESEHIMEALEKEYTALNYGVRAMAINLPGFAYHKALK SRKNLVAILNSVVKERRQRMMSCPPPAKKDMMDVLMYVEDENGRRLSDDEIIDVLVMYLN AGHESSAHITMWATVLLQKHPELFQKAKAEQEEIVRNRLPTQKGLTLKEIRQMDYLSKVI DETLRLINISLVVFREARKDVNISGYSIPKGWKVLVWFRSVHLDAEIYPNPKEFNPSRWD GYTPKAGTYLPFGAGSRLCPGNDLAKLEISIFLHYFLLNYQLERLNPECPVRYLPHTRPI 
DNCLARIRKISSPAM* 

 

>CYP88A40 contig_27481 = maker-scaffold_96-snap-gene-17.22

          Length = 79939

64% to CYP88A3 Arabidopsis thaliana

17061 MELGSLWVAFVSVLAGFFAFYGLLRRANGWLYERKLGEKRFSLPPGDLGWPLIGNTWSFLRAFKY 16867

16866 DDPDSFISSFVNR (2?) 16828

10737 YGRTGVYKAFMFGSPSIMLTLPEPCRQALMDDEAFIPGWPKSTYKLIGRKSFLGTVDDE 10561

10560 HKRLRRLTAAPVNGHEALSVYIEFIEDCVKSTLDKWVGMGQIEFLTEIRRLTFRIIVHIF 10381

10380 LSTESEQMMEGLEKEYTALNYGVRAMAINLPGFAYHKALKVR (2?)

10160 KKLVAILQSAVNARRQRRANCPPPTKKDMMDALLDVKYENGKMLTDEEI 10014

10013 IDILVMYLNAGHESSGHITMWATVLLQNHPEIHQKAK (0) 9903

 9711 AEQEEIIRKRPPTQKGLTLKEIRQMDYLSK (0) 9622

 9520 VIDETLRLINISSVVFREARKDVNVN (1?) 9443

 9296 GYTIPKGWKVLVWFRSVHMDSEIYSDPKEFNPSRWD 9189 ()

 8922 GFTPKAGTYIPFGAGSRLCPGNDLAKLEISIFLHHFLLNYR (2?) 8812

 8485 LERLNPDSPLRYLPHTRPIDNCLARIRKISSATM* 8381

 
>CYP88A40 maker-scaffold_96-snap-gene-17.22-mRNA-1 protein Name:"Similar to KAO2 Ent-kaurenoic acid oxidase 2 (Arabidopsis thaliana)" AED:0.09 eAED:0.09 QI:244|1|1|1|0.71|0.62|8|191|492 MELGSLWVAFVSVLAGFFAFYGLLRRANGWLYERKLGEKRFSLPPGDLGWPLIGNTWSFL RAFKYDDPDSFISSFVNRYGRTGVYKAFMFGSPSIMLTLPEPCRQALMDDEAFIPGWPKS TYKLIGRKSFLGTVDDEHKRLRRLTAAPVNGHEALSVYIEFIEDCVKSTLDKWVGMGQIE FLTEIRRLTFRIIVHIFLSTESEQMMEGLEKEYTALNYGVRAMAINLPGFAYHKALKARK KLVAILQSAVNARRQRRANCPPPTKKDMMDALLDVKYENGKMLTDEEIIDILVMYLNAGH ESSGHITMWATVLLQNHPEIHQKAKAEQEEIIRKRPPTQKGLTLKEIRQMDYLSKVIDET LRLINISSVVFREARKDVNVNGYTIPKGWKVLVWFRSVHMDSEIYSDPKEFNPSRWDGFT PKAGTYIPFGAGSRLCPGNDLAKLEISIFLHHFLLNYRLERLNPDSPLRYLPHTRPIDNC 
LARIRKISSATM 

 

CYP89 family (7 genes, 5 pseudogenes)

 

>CYP89A78 augustus_masked-scaffold_111-processed-gene-2.7-mRNA-1 protein Name:"Similar to CYP89A2 Cytochrome P450 89A2 (Arabidopsis thaliana)" AED:0.12 eAED:0.12 QI:0|0|0|0.5|1|1|2|0|558

56% to CYP89A2 Arabidopsis thaliana, complete
62% to CYP89A39 Vitis
74% to CYP89A augustus_masked-scaffold_44-processed-gene-0.7 
(only limited synteny)

MEVWFVVLASLCICAALKFLLELLSLSSNKPRKLPPGPFSVPVISNFLWIRKPSSEIECI LRHLRTKYGSIIRLNIGFRPAIFITTHELAHKALIQHGAIFADRPPALGPNRLISSNQHN ISSAAYGPLWRLFRRNLTSEILHPSRIKSYSHARKWVLDILINRLREQAISGEPVCAVDH FQFAMFCLLVLMCFGEKLDEKVIRDVETVQRKLLTSFNGLNILVFLPKLGKIIFRKKWNE FYEMRRSQESVLFPLIRARREQEKKQSEEGKSTEMVVCYVDTLLNLRLPDGRKLTEEEIM SLCSEFLNAGTDTTFTALQWIMANLVKHPHIQEKLVSEIEGVVGSGEEIKEEDLQKMPYL KAVVLEGLRRHPPGHFVLPHAVTEDITLDGYLVPENATVNFMVAEMGWDPKVWEDPMEFM PERFLPRGNGGEEFDITGTREIKMMPFGAGRRICPAAAMALLHLQYFVANLCLTSDQLQK SKPLQVCSPLVGFDYLNCSNEKALTSENFENHGSMKHYKCSDFVDVKTAKDTNLNMVLPN

GFKDAVVPQREENQLAMT

 

>CYP8979P pseudogene (join two models)

augustus_masked-scaffold_111-processed-gene-2.0-mRNA-1 protein Name:"Similar to CYP89A2 Cytochrome P450 89A2 (Arabidopsis thaliana)" AED:0.17 eAED:0.17 QI:0|0|0|1|1|1|2|0|337

CYP89 pseudogene

augustus_masked-scaffold_111-processed-gene-2.1-mRNA-1 protein Name:"Similar to CYP89A2 Cytochrome P450 89A2 (Arabidopsis thaliana)" AED:0.39 eAED:0.39 QI:0|-1|0|1|-1|1|1|0|107

48% to CYP89A2 Arabidopsis thaliana missing middle
66% to CYP89A augustus_masked-scaffold_44-processed-gene-0.7-mRNA-1
56% to CYP89A39 Vitis

215252 MWLLLFASFCICAAMKLLLDLPAVFFTVPIVGDMVWFQKSYLEIEHILRD

LRTKYGSIIKLHIGFRPAIFITPHELDHKALIQHGATFSERPSGIGPHHFVSGNQNVIGS

THSPLWRLLRKNLTSEILHPSRFKSYIRSRKWILVILTNRLKEQAKSGEPVCMADHFQYA

MFCILVRMCFGEELDEKIIRDVQTV*FKYVTGFERFNILSLVPRLTKIIFRKQWKEFCEV

RRNLESVLIPLIRARQEQEKKKQSEGGEGERVVCYVDTLLNLRLPDGGRKLREDEIVSRC

SEFLGAGTDSTSITLQGIMANLVKHPHIQAKLLSEIEGMVGSGEEIKEEDLQKMPYLKAV

VLEVLRRHPPAHISLPHS &

VTEDFALDGYLIPKNARVNFALAEMGRDPKVWEDPMEFKSERFLTRGDGMPQAFDLT

GSREIKMMPFGAGRRICPGLALALLQLQYFVANLIREFEWTVKDGEEVDLSEKQYTILI

MMKNRLRTHISPRRV* 216749

 

>CYP89A80 augustus_masked-scaffold_111-processed-gene-2.2-mRNA-1 protein Name:"Similar to CYP89A2 Cytochrome P450 89A2 (Arabidopsis thaliana)" AED:0.01 eAED:0.01 QI:0|-1|0|1|-1|1|1|0|514

53% to CYP89A2 Arabidopsis thaliana, complete
61% to CYP89A39 Vitis

MEVWFIFLVSLCVGAVVKLLLSLFSHDTVTDCPKILPPGPPSVPIISSFYWLCKSLLDLE PILRDLRTKYGPIVKLPTGSTPTIFITNHELAHKAIVQHGATFADRPPALPHASIFSSNQ HNIGSAKYGPLWRLLRRNIITEILHPSRVKSYGSGRKWVLDTLINKLKQQAESGEPVRPR DHFRYSMFGLLAFMCFGEKLDEKVIRDIEEVEQKILINFNNNNILAFMPRLGKFLFRKRW NEVYELQRSRESVLLPLVRARQEKQMRRDNEEKDKMIVSYVDTLLDLRHPDGGRRLTEVE MVNMCGEFLGGGSDTTSTTLQWIMANLVKHPEIQSKLCSEIEGVVGSGEEIKEEDLQKMP YLKAVVLEGLRRHPPAHFLLPHAVTEEIKIDGYVVPKNSIIYFMVAEMGWDPKVWEDPME FKPERFLGGGDDGGEQVFDITGSREIKMMPFGAGRRICAGFGLALLHLECFVANLVREFE WTAVDGEEVDLSEKLEFTVVMKNPLRAHISPRMR

 

>CYP89A81P pseudogene (joined two models)

maker-scaffold_111-snap-gene-3.32-mRNA-1 protein Name:"Similar to CYP89A2 Cytochrome P450 89A2 (Arabidopsis thaliana)" AED:0.30 eAED:0.53 QI:0|0|0|1|0|0|7|0|397

CYP89 maker-scaffold_111-snap-gene-3.31-mRNA-1 protein Name:"Similar to CYP89A2 Cytochrome P450 89A2 (Arabidopsis thaliana)" AED:0.43 eAED:0.75 QI:0|0|0|1|0|0|2|0|87

61% to CYP89C3 Zea mays, C-term
40% to CYP89A2 Arabidopsis thaliana, N-term half
~60% to CYP89A39 Vitis

318149  MELEVYWFILLASLCICGGLKLFLPRLLPLNSVKHKINLPPGPFTVPVIHNLFW IRNIYGSIIKLHFGFRPAIFITDHELAHKALIQHVSIFADRPLALDPNRSIPSNQYNISS ATYGPLWRLFRRNLTSEILNPCRLKSYGYAQ 318629

(gap 37 aa)

324345 LCFGEKLDENIIKDIETIQQRVLTSFGRFNVLALVPRL

GKIIFQKKLKELYELRRNKKSVLIPLIRVRQEGKKKQSSKKEGKDETVLCYVDTLLN

L*LPDRG*KLTEEEIVSLRSEFLNVGTNTTSTALQWIMENLVKHPQVQAKLLSKIN*WVV

GSGEEIKEEDLQKMPYLKAVVLEGLRRHPLAHFVLPHAVKKDITLDGYLVPKNEIVNFMV

AQMGWDPNVWVDPMEFKPWK &

EMLDITGSREIKMMPFGAGR

ICPGIYLALLHLEYFVANLVREFEWTAKDGDEVDLSEKLVFTTMMKKPLRAQILPRKLESI 327200

 

>CYP89A82 augustus_masked-scaffold_111-processed-gene-4.2-mRNA-1 protein Name:"Similar to CYP89A2 Cytochrome P450 89A2 (Arabidopsis thaliana)" AED:0.21 eAED:0.21 QI:0|0|0|0.5|1|1|2|0|631

50% to CYP89A2 Arabidopsis thaliana, almost complete, fused
72% to CYP89A augustus_masked-scaffold_111-processed-gene-2.7-mRNA-1
399278

MEVWFILFTSLCICATLKFLLDHCSLSSDKHKKLPPGPFALPIICNILWNRKSLSEIECILRD

MHTKYGSIIRFNFGFHQAISITTHELAHKALIQHGAIFADRPSALDPNSFITTNRYSISS ASCGLLWRLFRRNLTSGILHASRVKSYGHTRKRVLQILINRLKEQDKSNESICVVDYFQY AMFCFLVHMCFGEKLNEEIIRDIETIQRKLLTSFGQFNMLALVPILGKIIFRKKRNKLYE LRRNQLSVLIPLIRARKEHEKKTQCQVGEGDMVVCYVDTLLNLRLPNGGRKLTEEEIVPL CSEFLNAGTDTTSTAMQWIMANLVKYPCIQAKLLSEIEGVVGPGEEIKEDDLKNMPYLRA VVLEGLRRHPPSHFLIPHTVTEDITIDGRLVPKNAIVSFTITDMGWDPKVWEDPMEFKPE RFLTGDDGLEQKVFDITGSREIKMMPFGAGRRICPGLSVALLHLEYFVANLVKEFEWTTK DGDEVDLTEKQVFTVVMKNPLRVHLSPRNIG* 400822

 

>CYP89A83P scaffold 15  4011759-4011514 (-)

69% to CYP89A JcCB0156811.10
84% to CYP89A augustus_masked-scaffold_111-processed-gene-2.7

TTFAVLLWIMANLVKHPHIQAKLLSKIEGVVGFGEEIKEEDLQKMSYLKAVMLEGLRRPPRGHFLLPHAVTEDIT

IDGYLVP

 
>CYP89A84P scaffold 86 1376475-1376173 (-)
68% to CYP89A JcCB0883391.10, 58% to CYP89A2 Arabidopsis thaliana
76% to CYP89A augustus_masked-scaffold_111-processed-gene-2.7
LTKKEIVSLCGEFLNGSADTTSIVL*WIMENLVKHPHVQAKLLSEIEGVMGFREEIKEEDLQKMPYLKAVVLEGLRRHPLGHFLLSHEVTEDVTIDGYLVP

 

>CYP89A85 maker-scaffold_44-snap-gene-0.31-mRNA-1a protein Name:"Similar to CYP89A2 Cytochrome P450 89A2 (Arabidopsis thaliana)" AED:0.03 eAED:0.04 QI:0|0|0|1|0|0.25|4|0|975

53% to CYP89A2 Arabidopsis thaliana, revised seq. complete

50615 MEIWFIILASLCISAALKSLLDLLSFNQKKLPPGPFTVPIIGNFLWIRKSFYDIEIILRN LRTKYGSIIKLQIGSRPSIFIANHELAHKALIHHGATFADRPPALAPNRVISSNQHSISS AAYGPLWRLFRRNLTHEILHPSRIKSYGNARVWVLEILTNKFREQANSGQPVCVMDHFRY AMFCLLVLMCYGEKLDEKIIKDVESVQRKMNTSFGRFSVLAYMPRLGKI

(gap 18 aa)

ESVLIPLIRAX

QEQEKKLQNNEGKTDDTVVCYVDTLLSLQLPDGRRKLTEEEIVSLCSEFLTAGTDTTFTA LQWIMANLVKYPHIQAKLFSEIEGVVNSGSEIKEEDLQKMPYLKTVVLEGLRRHPPAHFV LPHAVREDITIDGYVIPKNAAVNFMVAEMGWDPKVWKAPMEFKPERFLTGNVDGGKVFDI TGTGEIKMMPFGAGRRICPGLGLALLHLEYFVANLIRDFEWTAVDGDEIDLSEKVEFTVV

MKNPLRAHISPRMKKNISITRSI* 49056

 

>CYP89A86 maker-scaffold_44-snap-gene-0.31-mRNA-1b

58% to CYP89A2 Arabidopsis thaliana, revised seq. complete
~65% to CYP89A39 Vitis, about 19 aa short before I-helix

44351 MEVWFIFFASLCVCFSLKSLLNLLSHNKHKPKDLPPG

PFSLPIIGNLFWFRKSFFDLEPLLRNLRT KYGPILKLQIGSRRLIFITNHQLAHKALIQHGATFADRPPPLPMTRIFSSDQHNISSAAY GPLWRLLRRNITSEILHPSRVKSYGHARKWVLQILINKLRQEAESGEPVRVVDHLRYVMF CLLVFMCFGDKLDEKVVRDIENVERKILLGFRRYNILSLMPRLGKILFRKRWNEVYELHR SRESVIAPLVRARQERGKEETVVCYADTLLDLRLPDGGRKLTTGEMVSLCSEFLNGGTDT TATALQWIMANLVKYPNIQAKLLSEIERVVGCGEEIKEEDLQKMPYLKAVVLEGLRRHPP GHFVLPHAVTEDTKIDGYVVPKKAIVNFMVAEMGRDPEVWEEPMEFRPERFLGNGDGDQE VFDITGSREIKMMPFGAGRRICPGLGLALLHLEYFLANLVREFEWKAVDDVDLSEKLEFT

VVMKKPLEAQIFPRR* 42846

 

>CYP89A87P augustus_masked-scaffold_44-processed-gene-0.7-mRNA-1 protein Name:"Similar to CYP89A2 Cytochrome P450 89A2 (Arabidopsis thaliana)" AED:0.17 eAED:0.17 QI:0|-1|0|1|-1|1|1|0|331

74% to CYP89A augustus_masked-scaffold_111-processed-gene-2.7-mRNA-1
55% to CYP89A2 Arabidopsis thaliana, pseudogene
frameshift = &

This sequence has expression data so it may not be a Pseudogene

http://genomevolution.org/CoGe/FastaView.pl?featid=304239018&gstid=1

67150 MEIWFIILASLCISAALKSLLDLLSLNHNKLPPGPFTVPIIGGFLWIRKSLYDIEISLRN

LRTKYGPIIKLQIGFRPVIFIANHDLAHKALIQHGATFADRPPALATSRVFSSN &

NNIIAGVYGPLWRLFRRNLTHEILHPSRIKSYGNARN*ILEILTKKLREQANSKQPVRV

MDHFQYAMFCLLVLMCLGEKLDEKVIKEVESVQRKAITSFGRFNVIAFMPRLGKI

VFRKKWKELYQIRHNQ

ESVLIPLIRARQEQEKKNQKGESILCYVDTLLSLQLPDGGRKLTEDEMV TLCSEFLNAGTDTTSTALQWIMANLVKHPHIQAKLVSEIEGVVKSGEEIKEEDLXKMPYL XAVVLEGLRRHPPGHFVLPHAVTEDITIDGYVIPKNATVNFMVAEMGWDPKVWKDPMEFK PERFLIGDVDGGEVFDVTGTREIKMMPFGAGRRICPGLGLALLHLEYFVANLIRDFEWTA GYGDEVDLSEKLEFTVVMKNPLRAHISPRIK* 65635

 

>CYP89A88P scaffold 8 3446393-3446187 (-)

61% to CYP89 JcCB0036011.40
63% to CYP89A maker-scaffold_44-snap-gene-0.31-mRNA-1b

TTSTCL*WIMENLEKHLDIHVKLFLEIARVVKLEEEIKEEFL*KMPYLKAMVLEGLVRHPPTYPMLEPR

 

>CYP89A89P scaffold 24 4883698-4883886 (+)

56% to CYP89 JcCB0036011.40
59% to CYP89 augustus_masked-scaffold_111-processed-gene-4.2
79% to CYP89 pseudogene

AGTDTTASAFQRIMESLVKHQDVQAKLFSEIKEVTRPVEDIKEDDLQQMPYLKVGVQLGRVHP

 

>CYP89A90 maker-scaffold_452-snap-gene-0.9-mRNA-1 protein Name:"Similar to CYP77A3 Cytochrome P450 77A3 (Glycine max)" AED:0.02 eAED:0.02 QI:0|0|0|1|0|0.5|2|0|398

49% to CYP89A2 Arabidopsis thaliana
89% to augustus_masked-scaffold_44-processed-gene-0.7
58% to CYP89A39 Vitis (top part)
contig02718 matches and fills part of gap

MEIWFIILASLCISAALKSLLDLLSLNHNHNKLPPGPFTVPIIGDFLWIRKSLYDIETSV RNLSTKYGPIIKLQIGFRPVIFIANHDLAHKALIQHGSTFADRPPALAPRSIITSNQHHI GAGAYGPLWRLFRRNLTHEILHPSRIKSYGNARIWVLEILTNKLREQANSGQPVRVMDHF QHAMFCLLVLMCFGEKLDEKVIKEVESVHRKLITSFGRFNVIAFMPRLGKIVFRKKWEEL YQLRHNQESVLIPLIRARQEQEKKNQKGESILCYVDTLLSLQLPDGGRKLTEDEMVTLCS EFLNAGTDTTSTALQWIMANLVKHPHIQAKLVSEI

EGVVKSGEEIKEEDLQKMPYLKAVVLEGLRRHPPGHFVLPHAVTENITIDGYVIPKNATVNFTVADLGWDQ

(24 aa sequence gap)

DITGTREIKMMPFGAGRRICPALGLALLHLEYFVANLIRDFEWTAGDGEEIDLSEKMEFT

VVMKNPLRAHISPRIK

 

>CYP89A91P pseudogene maker-scaffold_15-snap-gene-16.15-mRNA-1

protein Name:"Similar to CYP89A2 Cytochrome P450 89A2 (Arabidopsis thaliana)" AED:0.12 eAED:0.15 QI:28|0|0|1|0|0|3|0|365

37% to CYP89C3 Zea mays, fragmented, pseudogene?

1592545 MEFWFVLLVS &

LCISVSLRSLFYLLHPKSSKGLPPGLSMFFIVSTFIWQRKSLRDLEPILRSLHAKYGPIV

RLQIGSFLSISISDHALTHQAL &

LTQHGDGAIFADRPATLAPHQVVSNNLNMAAAPYGAIWRLLRRNLASXILHPSQIKSF

DDGRKWVLEKLTNKLRQQARSGEPVHVTDEFRHALFSLLVLMCSGQKLDEMALRDMEAAQ

QKLLLAFLQIN

IFSFLPIFRKTIFRKQWDEVRKIRREQDNILLPLIRARQEQKKNNRSCDKEEDKMFISYV

DTLLDLQLPGPADKGIRKLREENMLGLCSEFLNAVTDTTASAFQWIMASLVKHQNVQEKL

FSEIKEVTRPGEDIKEDDLQRMPYLKAVVLEGLRRHPPVHLLFPHAVTEDISIDGYVIPK

NAXVRFMVADMSWDPKVRKDPMDFNPERFMTSCDGEQKGGEV 1593871

 

>CYP89A92P pseudogene maker-scaffold_37-snap-gene-8.27-mRNA-1

protein Name:"Similar to CYP89A2 Cytochrome P450 89A2 (Arabidopsis thaliana)" AED:0.16 eAED:0.30 QI:0|0|0|1|0|0|3|0|256

45% to CYP89A2 Arabidopsis thaliana
44% to CYP89C3 Zea mays, fragmented, pseudogene?
67% to CYP89A augustus_masked-scaffold_44-processed-gene-0.7-mRNA-1
887713

VESVQWKLITSSSRFNVLVFMPILGKILFQKKWKKLYQLEHNQESILIPLIRAQQEQEKK &

EPIVCYVDMLLSLELLDGGRKLDGRRVVALCSEFLNVRTDTTSITLQWIMA

NLV*HPHIQAKLFSEIDGVVKSGEEEKDL*KMSYLK

VVLEGLRRHPQNH

HAIIEDITIEGYVIPKKAIVNSMVVEMG*DPK

VRKDPMKFK

GPHGEEVFDITE

IREIKKMSLSARMRICPGLGLALLHLENIVANLMRDIERTVVDGDEADLFKKLELTVVTN

NSLRPHTSPKMK* 886548

 

>CYP89A93P pseudogene maker-scaffold_6-snap-gene-27.27-mRNA-1

protein Name:"Similar to CYP89A2 Cytochrome P450 89A2 (Arabidopsis thaliana)" AED:0.19 eAED:0.38 QI:0|0|0|1|0|0|3|0|336

CYP89 maker-scaffold_6-snap-gene-27.26-mRNA-1 protein Name:"Similar to CYP89A2 Cytochrome P450 89A2 (Arabidopsis thaliana)" AED:0.40 eAED:0.49 QI:0|0|0|1|0|0|2|0|94

revised sequence joins two models

69% to CYP89A augustus_masked-scaffold_111-processed-gene-2.7-mRNA-1
42% to CYP89A2 Arabidopsis thaliana

2777513 MEVWFIVVASLCI &

LCASLKFLLDLIYRKLPPGPFIVPLLTNFLWKDTPFSEIESVLRHLRAKYGSIF

KLDVGFRRPPTCPYSPHPARRHLCRSSAGSRPPNNQYTINSVAYGPLW

RLFRRNLTSEIIHPSRVKSYGHARKWVLDILISRLRKQAKSGEPLCVEDHFHYTLFCLSV

FMCF*EKFDEKVIRDVESAQRKLLTNFGRFDILALLPKSGKFIF &

RKKWNELYQLRCNQESVLIPLIRARREQQMKKKKQSEEGKG

EIVVGYVDTLLNLQLPDGGRMLTGKEIVSLCGSFSTA

(gap 57 aa)

GLKRHPPGHFLLPHAVIEDVTIDGYLVPNNAI &

VNFMIAEMGWDPKVWEDPM &

KFRPERFLTRGNGAEEFDITGTREIAMMPFGAGR &

RICPGLTLALLHMEHFVWPIWLGNLSGRSGILDTFTIVMKKPLRAHMSPRRV* 2776190

 

CYP90 family (7 genes, 0 pseudogenes)

 

>CYP90A31a maker-scaffold_12-augustus-gene-0.14-mRNA-1 protein Name:"Similar to CYP90A1 Cytochrome P450 90A1 (Arabidopsis thaliana)" AED:0.08 eAED:0.08 QI:472|1|1|1|0.57|0.75|8|401|486

78% to CYP90A1 Arabidopsis thaliana complete

MEVLLSVLLCSSSLYLLFFLLRYSRFSLRKLGLPPGSLGLPFIGETLQLIAAYKTENPEP FIDARVARYGSLFTTHVFGEPTVFSADPEANRLILQNEGKLFECSYPSSISNLLGKHSLL LMKGSLHKRMHSLTMSFANSSIIRDNLLVDIDRLVRLNLDSWTGLVFLQEEAKKITFELT VKQLMSFDPGEWTESLRKEYLLLIEGFFSVPLPFFFTTYGRATKARTKVAEALRLIVRKR REESRGGKSKKKDMLAALLEGGEGGFSDEEIVDFLLALLVAGYETTSTIMTLAVKFLTET PLALAQLKEEHDGIRAAKEQSEEGLQWSDYKSMPFTQCVINETLRVANIISGIFRRAMAD VNIKGYTIPKGWKVFASFRAVHLDHDHYKEARTFNPWRWQQSNTGGATSGTVNLFTPFGG GPRLCPGYELARVEISVFLHHLVTRFSWVPAEEDKLVFFPTTRTLKRYPINVQRRIKIPA

KTGEGE

 

>CYP90A31b maker-scaffold_30-snap-gene-49.26-mRNA-1 protein Name:"Similar to CYP90A1 Cytochrome P450 90A1 (Arabidopsis thaliana)" AED:0.09 eAED:0.09 QI:0|0.85|0.75|1|0.57|0.75|8|241|504

76% to CYP90A1 Arabidopsis thaliana
88% to CYP90A maker-scaffold_12-augustus-gene-0.14-mRNA-1 (ohnologs)

MEFLLLCFLISSSSLYLLFLLLRYFRFRHRKLGLPPGNLGFPLIGETLQLIAAYKTENPE PFIDVRVARYGNLFTTHVFGEPTVFSADPEANRFILQNEGKLFECSYPSSISNLLGKHSL LLMKGSLHKRMHSLTMSFANSSIIKDNLLVDIDRLVRLNLDSWTGHVFLQEEAKK (0)

ITFNLAVKQLMSFDPGEWTESLRKEYLLLIEGFFSVPLPFFFSAYGRAIKAR KKVAEALRLIVGKRRRESEGGEVKKKDMLAALLEGGEGGFSDEEIVDFLLALLVAGYETT STIMTLAVKFLTETPAALAQLMEEHDQIRARKERNSEEESLQWNDYKSMPFTQCVINETL RVANIISGVFRRAMTDVNIKGYTIPKGWKVFASFRAVHLDENHYKDARTFNPWRWQQSNT GGAATATGNLFTPFGGGPRLCPGYELARVEISVFLHHLVTRFSWDPADEDKLVFFPTTRT

LKRYPINVQRRRKIAARTEEKDEK

 

>CYP90A32P scaffold 4 1206444-1206127 (-)

75% to CYP90A maker-scaffold_30-snap-gene-49.26
67% to CYP90A1 Arabidopsis thaliana

IPKGWKVFASFRAVHLDENHYKDSRTFNPCRW

NLFTPFGGGPRLCPGYELA*LEISVFPHHLVTRFRYDL

 

>CYP90A33P scaffold 63 2160562-2160320 (-)

85% to CYP90A maker-scaffold_30-snap-gene-49.26
67% to CYP90A1 Arabidopsis thaliana

QAQKKVVEALRLIVGKKRRESEGGEGKKKDMLAALSKGGEGGFSDEEIVDFLLNLFVAGYETT

STITTLAVKFLTKTPTAL

 

>CYP90A34P scaffold 70 2339593-2339721 (+)

93% to CYP90A maker-scaffold_12-augustus-gene-0.14
93% to CYP90A1 Arabidopsis thaliana

FSDKEIVDFLFALLVAGYETTSTIMTLAIKFLTETPLALAQLK

 

>CYP90B20a maker-scaffold_13-augustus-gene-45.8-mRNA-1 protein Name:"Similar to CYP90B1 Cytochrome P450 90B1 (Arabidopsis thaliana)" AED:0.08 eAED:0.08 QI:166|1|0.85|1|0.83|0.57|7|492|561

77% to CYP90B1 Arabidopsis thaliana

4494976 MAAEIELLLLLSPSILALFLVWLLIKRKERTLKLPPGNMGWPFLGETISYLKPYSATSVG EFMEQHISRYGKIYKSNLFGEPTIVSADAGLNRFILQNEGRLFECSYPRSIGGILGKWSM LVLVGDMHRDMRMISLNFMSNVRLRTHLLPEVERHTLLVLRSWKENSTLSAQDEAKK

FTFNLMAKHIMSMDPGKLETEQLKKEYITFMKGVVSAPLNLPGTAYWKALR (0)

SRSTILKVIERKMEERIRHMRDECERREED

DLLGWVLKHSNLSTEQILDLILSLLFAGHETSSVAIALAIYFLQDCPKALQQLR

EEHLKIARAKKQAGESQLNWDDYKKMEFTHC

VISETLRLGNVVRFVHRKAIKDVRYK

GYDIPSGWKVLPVFAAVHLDPSTYDHPQHFNPWRWQQ

GANSNATMSI

NFMPFGGGPRLCAGSELAKLEMAVFMHHLVLNYQWELAESDHALAYPFVD

FPKGLPIKVHKIQHHHTTTSYDSNIHLTLNSLSLPC* 4491347

 

>CYP90B20b augustus_masked-scaffold_33-processed-gene-48.0-mRNA-1 protein Name:"Similar to CYP724B1 Cytochrome P450 724B1 (Oryza sativa subsp. japonica)" AED:0.10 eAED:0.10 QI:94|1|1|1|0.85|0.75|8|170|499

68% to CYP90B1 Arabidopsis thaliana

MREGEFRGITASLISMTGMELLLILSLSILTLVLVWRLVNNKEKEVKLPPGKMGWPFLGE TMGYLKPHPATSMGEFMEQHIARYGKIYKSNLFGEPTIVSADAGLNRFILQNEGRLFECS YPRSIGEILGKWSMLVLVADMHRGMRMIAVNFMSNVRLRTHFLPEVERHCLLVLMSWEEN STFSALDEIKKFTFNLIAKQIMSMDPGTPETEQLKREYLTFMKGVVSVPLNLPGTAYRMA LQSRSRILKIIERKMEERNRKMGDECQRIE

EDDLLGWVLKHSNLSTEQSLDLILSLLFAG HETSSIGISLAIYFLHDCPKAIQQLREEHLKIATDKKQAGDQSQLNWDDYRKMEFTQCVI CETLRLGSVVRFVHRKAIKDVQYKGFVIPSGWKVLPVFTAVHLDPSIYDNPQCFNPWRWQ NTSMAASNNFMPFGGGPRLCAGAELAKLEMAVFIHHLVLNYEWELALAEPDQALAFPFVD FPKGLPIKVHKIHHNLGPI* 4807486

 

>CYP90C13a contig_7492 28470-33473 (-) strand

          Length = 56364

33473 MKLVLGFWVLVGFVGWCWWKRKSKKRLENKAAIPRGSSGWPLIGETLDFIASGYTSRPV 33297

33296 SFMEKRKAL (2?) 33270

32610 YGKVFRSHILGVPIIISTDPDVNKVVLQNNGSIFIPFYPKSITELLGKSSILQMNGNLQ 32431

32430 KRVHGLIGSFLKSPQLKARITREIEKAVDQTMGTWKEGNLVYMQEETRN (0) 32284

32189 ITFQVLVKALMSVGPGEDLQFLRREFGEFIKGLVCLPIKLPGTRLYKSLK (0) 32040

31938 AKERLLKMVRRIVEEKKMKMENTDERGPPMDAVDVLLCDSGEAADEKQRLPLDFISG 31768

31767 NIIGMMIPGEDSVPMLMTLAIKYLSDSPLALRQLQ () 31663

30582 EENMELKRRKAHLGEDYAWTDYMSLPFTQN (0) 30493

30401 VINETLRMANIINAVWRKTLKDIEIKG ()

30221 YFIPKGWCVLASFVSVHMNEENYEDPYRFDPWRWE (0) 30117

28812 RKGGNFNYNNCFTPFGGGQRLCPGFELSRLEVSIFLHHLVTRY 28684

28562 RWVAEEDCIVNFPTVKMKRKLPVVVTSISS* 28470

 

>CYP90C13a scaffold 98 629363-628794 (-) 115-280

622879- 630121 (-)

NNU_019288

64% to CYP90C1 Arab.

84% to CYP90C maker-scaffold_13-augustus-gene-24.19 (ohnolog) 

MKLVLAFWVLVGFIGWCWWKKKKKKKEKEQLENQSGIPKGTLGWPLIGETLNFIASGYTS

RPVSFMEKRKSL (2)

YGNVFKSHILGMPIIISTDPDVNKVILQNNGSIFVPFYPKSITELLGKSSILQMNGNLQK

RVHGLIGGFFRSPQLKVRITREIENAVNKAMEAWRDGDLVYMQEETRN (0)

ITFQVLVRVLMSVGPGEDLQFLKREFGEFIKGLVCLPIKLPGTRLYKSLK (0)

AKERLLKMVKRIVEERKMRMESIDERGPLMDAIDVLLCDAGETEDKQHLPLDFISGNII

EMMIPGEDSVPMLMTLAVNYLSESPLALKQLV (0)

EENMELKRQKTQLGEDYAWTDYMSLPFTQN (0)

VINETLRMANIINGVWRKVLRDIEIK (1)

GYFIPKGWCVLASFISVHMNEENYENTNQFDPWRWQ (0)

RKGGNINNNYCFTPFGGGQRLCPGLELSRLEVSIFLHHLVTRFR (2)

WVAEEDYIVHFPTVKMKRKLPVFVTPISS*

 

>CYP90C13b maker-scaffold_13-augustus-gene-24.19-mRNA-1 protein Name:"Similar to ROT3 3-epi-6-deoxocathasterone 23-monooxygenase (Arabidopsis thaliana)" AED:0.10 eAED:0.10 QI:418|1|1|1|1|1|9|266|483 
64% to CYP90C1 Arabidopsis thaliana, complete
ohnolog with scaffold 98 629363-628794 (-) 115-280 (75%)
MKLVLGFWVLVGFVGWCWWKRKSKKRLENKAAIPRGSSGWPLIGETLDFIASGYTSRPVS FMEKRKALYGKVFRSHILGVPIIISTDPDVNKVVLQNNGSIFIPFYPKSITELLGKSSIL QMNGNLQKRVHGLIGSFLKSPQLKARITREIEKAVDQTMGTWKEGNLVYMQEETRNITFQ VLVKALMSVGPGEDLQFLRREFGEFIKGLVCLPIKLPGTRLYKSLKAKERLLKMVRRIVE EKKMKMENTDERGPPMDAVDVLLCDSGEAADEKQRLPLDFISGNIIGMMIPGEDSVPMLM TLAIKYLSDSPLALRQLQEENMELKRRKAHLGEDYAWTDYMSLPFTQNVINETLRMANII NAVWRKTLKDIEIKGYFIPKGWCVLASFVSVHMNEENYEDPYRFDPWRWERKGGNFNYNN CFTPFGGGQRLCPGFELSRLEVSIFLHHLVTRYRWVAEEDCIVNFPTVKMKRKLPVVVTS 
ISS*

 

>CYP90D20 augustus_masked-scaffold_162-processed-gene-2.0-mRNA-1 protein Name:"Similar to CYP90D2 Cytochrome P450 90D2 (Oryza sativa subsp. japonica)" AED:0.05 eAED:0.05 QI:555|1|1|1|0.85|0.75|8|228|502

63% to CYP90D1 Arabidopsis thaliana, complete
orthologous region is scaffold 28 between RH20 and CTR1, no ohnolog

MMSYSKLSRMDMSLIISVVAILLSSIILCRSWRRRIRSSTHRGGQLPLGSLGWPLVGETL EFISCALSDHPESFMDKRRRMYGKVFKSHILGSRTIISTDAEVSKFILQSDAKVFVPSYP GSLTELMGKSSILQINGSLHRRIHGLIGAFLKSSHLKDQITQDMQKYVQQSMGRWKDDKL IYIQDETKNIGFQILVKVLISLDPGKEMEYLRQQFQEFIAGLISLPINLPGSRLHRSLQA KKRMVKLVQEIIQDKRKEGSPTVPRDVIDVLLGDTNDQLTDELISDNMIDLMIPGEDSVP VLITLAIKYLSDSPLALQQLTEENMKLKTLKAQAGEPLCWSDYMSLSFTQNVITETLRMG NIIVGVMRKAMKDVEVKGYLIPKGWCVFTYFRSVHLDEHLYDWPYQFNPWRWQDKDPSTC NFTPFGGGQRLCPGLDLARLEASIFLHHFVTQFRWVAEGDSVVNFPTVRMKRGMPIWVKR

RSNLQSPTSEKVAGQQNQMNDK

 

CYP92 family (1 genes, 0 pseudogenes)

 

>CYP92A57 maker-scaffold_83-snap-gene-8.33-mRNA-1 protein Name:"Similar to CYP75B2 Flavonoid 3'-monooxygenase (Petunia hybrida)" AED:0.02 eAED:0.02 QI:67|1|0.5|1|0|0|2|283|509 
58% to CYP92B3 tobacco
81% to CYP92A39 Vitis
MEAPSWAVYALAWLLSLALVILSGHFRRRRANLPPGPKPWPIIGNLNLIGPLPHRSIHEL SKKYGPIMQLRFGSRPIVVGSSVEMAKQFLKIHDITFASRPKMAAGKYTTYNYSDITWSP YGPYWRQARKMCLMELFSVKRLESYEYIRVEELRAVLKGLYASSGKPIVLKDHLSTLSLN VISRMVLGKKYTDESETSIVTPGEFKKMLDELFLLNGVVNIGDYIPWIDFLDLQGYVKRM KILSKKFDKFLEHVIDEHNARRQGVEGYVAKDMVDVLLQLADDPTLEVKLHREGVKGFTQ DLIAGGTESSAVTVEWAISELLKRPEMFKKATEELDRVIGRERWVEEKDIPQLPYIQAIV KETMRMHPVAPMLVPRFSREDCEIAGYDIPAGTEVFVNTWTIGRDPTLWDAPDEFRPDRF IGRDIDVKGQDFELLPFGSGRRMCPGYSLGLKVIQASLANLLQGFTWNLPDKMKPENLNM EEIFGLSTPKKIPLVAVVEPRLPTHVYGQ 
 

CYP93 family (4 genes, 3 pseudogenes)

 

>CYP93A43P pseudogene (join two models) maker-scaffold_18-snap-gene-30.27-mRNA-1a

protein Name:"Similar to CYP93A2 Cytochrome P450 93A2 (Glycine max)" AED:0.07 eAED:0.07 QI:0|0.42|0|1|0.28|0.12|8|0|1299

CYP93A augustus_masked-scaffold_18-processed-gene-30.6-mRNA-1 protein Name:"Similar to CYP93A3 Cytochrome P450 93A3 (Glycine max)" AED:0.47 eAED:0.47 QI:0|-1|0|1|-1|1|1|0|102

60% to CYP93A4 Populus trichocarpa
frameshift = &
56% to maker-scaffold_18-augustus-gene-30.20-mRNA-1
55% to maker-scaffold_18-snap-gene-30.27-mRNA-1b

3006310 MIDLQGYGILFLVCLFSIIAVRAIISTVRTPSRLPPSPIPL PIVRHLHILRPFPHLAIYKLSNRYGPLLHLLIGSDPSIIASSPETASEILKTHDLAF

SSRS*SSAIEHLSYGNADFSFTPYGPYWKF

MKKICMSELLGGQTLDQLLPVRIEEIKWLLRSILNKSEAGEAVGVRAELIRMTNN

VISRMTMSKQCLETED*

AEEVKAVVEEALEIAGTFNLSDYIGFCRNFDLQGLRKRFKDIHERLDRMMEMILREHEQVRGEKG MGDEAKDLLHILLDVAEAENSEMKLSRENIKAFILDIFVAGTYTSAISMEWALAELINHP SVFEKAREEVDVVIGKSRSVEEPDIPNLPYLQAIVKETLRRHPVEPLIPRESTKDCVSW &

GYKIPAETTAYVNIWAIGRDPKHWDNPLEFQPERFIAQEGSSTGAQLDVRGQHFHFLPFGSGRRSCP GASLALQLMETTLASLIQCFEWKVGDGKDILT*

3014784

 

>CYP93A44 maker-scaffold_18-snap-gene-30.27-mRNA-1b

59% to CYP93A4 Populus trichocarpa, revised seq. complete

3021628 MADDIQGFAMLFLL

GLISIVVVTLTSILYKRRRKLRLPPGPLALPIIGHM HLIGSIPHQSFHKISNRYGPLIHLLLGSVPCVVVSSAEAAKEVLKSHDHDFSDKPITLAT NYITYGADVVFSPYGPYFKFMKKLCMSELLNGQVLNQFIPLRKEELQRFLQSIFKRACTA EPVDVRQEVLSLTLNTITRMVMNTRCSAEEDQAQEAIMAVQDALELIGRFNLSDYIGFCR NLDLQGVKKRMKDVRHRFDNIIDKIITDHEEARREKMGDGGDRVETLLDLLLDIYEDEEA EIRLTKTNVKAFILDLFLGGSDTSGLTIEWAMSELINNPPVLEKAREEIDLVVGKSRLVE VSDLPNLPYLQAIVKETLRLHPGIPLILRSSTRYCKIWGYDIPAKTTTFVNVWAIGRDPK YWDNPLQFRPERFMIEDGSNKLNQIDVRGQHFQMLTFGSGRRICPGISFALQTVQTTLAS VIQCFEWKFGNGKNVKVDMEESVSISLPKAHRLICVATPRLNPLPLT* 3025012

 

>CYP93A45 maker-scaffold_18-snap-gene-30.27-mRNA-1c

60% to CYP93A4 Populus trichocarpa, revised seq. complete

3029523 MADTQGFAMDFLLGLISIVVVTSILYKMRNKNKLHLPPG

PLALPIIGNLHLIGSIPHQSFQKISNRY GPLIHVLLGSVSCVVVSSAEIAKQMLKSQELDFSSRPVPLATNYITYDTADFIFTPYGPY WRFMKKLCMSELLNGQILNQFIPLRKEELHRFLQSIFDKSILGKAIDVRQEVMRLSNNTV TRMTMNTRCSGTEDQAEETIMVAQDALELAGRFNLSDYIGLCKVLDLQGFGKKMKDTRRR FDNIIDKIIMEHEEARSQKKKMGSTSDGGNHHGVKTLLDLLLDISEDEEAEMRLTKANIK AFILDLFLAGTDTSGMTIEWAMSELINNPSVLEKAREEIDLVVGKSRLVEESDIPNLPYL QAIVKETLRLHPPAPLILRQSTRDCKLWGYDIPGNTRTFINVWAIGRDPKYWDNPLQFQP ERFMMIEDGGSNKSSQIDVRGQHYQFLPFGSGRRMCPGLTLGLQTVQTGLACMIQCFEWK FGEGKQAKVDMEEGASITLPRAHHLICDAVPRLNPLPIT* 3031233

 

>CYP93A46 maker-scaffold_18-augustus-gene-30.20-mRNA-1 protein Name:"Similar to CYP93A1 Cytochrome P450 93A1 (Glycine max)" AED:0.02 eAED:0.03 QI:0|1|0|1|1|1|2|0|528

59% to CYP93A4 Populus trichocarpa
82% to maker-scaffold_18-snap-gene-30.27-mRNA-1c
71% to maker-scaffold_18-snap-gene-30.27-mRNA-1b
MAVIDGYAMEFLVYLITTLVLTSISIYLFRTRNKHKVRLPPGPLALPIIGHLHLMSSIPH QSFQKLSNRYGPLIHILLGSVPCIIVSSPEVAKEVLKSQELDFTSRPMSLAVNYLTYDSA DFIFAPYGPYWRFMKKLCMTELLNGQILNQFVPMRKEELRRFLKSIFNMSLLGKAINVRQ QVMRLTNNTITRMMMNTRCSETEDQAEQVIMVAQEATELAGTFNLSDYIGICRHLDLQGF GRRMKDTRRRFDNIIDKIIMEHEEARSQKKKMGSTSDGGNNHGVKTLLDLLLDICEDEEA EVRLTKSNVKAFLLDLFLAGTDTSAVTIEWAMSELINNPSVLEKAREEMDLVVGKSRLVE ESDIPNLPYLQAIVKETLRLHPGAPLVLRASTRDCKLLGYDIPGNARTLVNVWAIGRDPK YWDNPLQFQPERFMMIEDGKNKSSQIDVRGQHYQFLPFGSGRRICPGLTLGLQTVQMGLA SMIQCFEWKVGDGKHAKVDMEESASLTLPRAHHLICVPVPRLNPLPLT 

 

>CYP93A47P pseudogene scaffold 18 3052751-3053348 (+)
57% to CYP93A PSEUDOGENE

3052751 IVGKSRMVEQSPNIPNLP &

3052806 YL*AIVKKTLKLHPVASLIPRE*TKYYTIGDYKIPLKTRAYVNVYC & 3052943

3052951 IGKDLDHLDNPTQAR

LDVRGQNFHFFPFGRERR 3053348

 

>CYP93A48P pseudogene maker-scaffold_18-snap-gene-30.29-mRNA-1

protein Name:"Similar to CYP93A3 Cytochrome P450 93A3 (Glycine max)" AED:0.10 eAED:0.10 QI:0|0|0|1|0|0|4|0|378

49% to CYP93A4 Populus trichocarpa
60% to CYP93A maker-scaffold_18-snap-gene-30.27-mRNA-1b

MADIQGYAIRIPLSLITTVVVRFIFNKTIRTKLPFPPGPLALPIIRSLHYIGSIPHRSLR YGPLIHILLGSLPCISPPMRQPNKQVLKSHELTFSSRPVTIAGHYLAYESANIVTVPYGP NWKFMKKLMSELLSGQVLNQFIPVKKEEVQRFILSILNKSRVGKAVDVRHEVMKLTYNIV SRMRSSRTEDQAEETMGVAQDVAELAHGYNISDYVGLCRDLDLQGLRKRMKDIRERLDNN NIIEKIIMENEEARRLKKMGDGGGVKNLLDIVLDISEDEEAEIRLTETNIKGFIL (0)

3067224

DLFAGGTETSAVTIEY

(deletion of 8 aa)

PALLEKEREKMDLVVGKSILVEESGIPHLP*LKAI

VKETLRLHPAFPLDPRKSNIDCKIWGCNIPAKT*

VFLNFWEIGRDPNYWANPFQLQPQRFMIEDGSKKKNRQIRVRGQNFQLQPFGSGRRMCPGISLAL QMEQTGLASMVQFLGRKQVRDEMHTRIDMQEKAPFNLQTD* 3067891

 

>CYP93A49 maker-scaffold_41-snap-gene-6.11-mRNA-1 protein Name:"Similar to CYP93A3 Cytochrome P450 93A3 (Glycine max)" AED:0.02 eAED:0.02 QI:149|1|1|1|1|1|2|69|520

59% to CYP93A4 Populus trichocarpa, complete

MMEMDLQSLATLFLVGLISTILVRTVLSRTSRPRLRLPPSPMALPVFGHLHLLGPSPHQA FHKLAARYGPLFYLRLGSVPHVVVSSPEIAKDFLRTHELAFSARPQSEAARQISYNFADF SFIPYGPYWKFMKKLIMSELFGSRMLDKFLAIRHDETQSFIKFLVNKSEARQEVHLSGEL IRLTNNVISRMAISRRCSGNDDEAEEVKNLIMEIADLLAAFNIGEFVPLLKSFGSKGFDE RVKDVHRRFDVIMEKVITEHEEARRKKEEIKGDGVKDILDMLLDIAEDENSEIRLTRENI KAFLLDIIAAGTDTTALTIEWALAELINHPPLFKKLREELDSVVGKRKLVEENDIPNLPY LQAVVKETLRLHAPAPLIVRQSVRHCNIRGYDIPANARMFVNLWSISRDPNYWEDPFTFN PERFMPSGKNGWNSMDVRGQYFHFMPFGTGTRACPGTTLALHLLHVTIAAMIQCFDWKVL NVGKDGLVDMAEGTGLATPMAHHLVCQPIIHFNPFSVTES

 

>CYP93A50P pseudogene maker-scaffold_12-snap-gene-27.13-mRNA-1

protein Name:"Similar to CYP93A1 Cytochrome P450 93A1 (Glycine max)" AED:0.11 eAED:0.12 QI:0|0|0|1|0|0|2|0|108

58% to CYP93A4 Populus trichocarpa I-helix to EXXR
88% to maker-scaffold_41-snap-gene-6.11

2764211 LV*DIIAPGTDTSALTIEWALTEVTN 2764288

2764285 HPPFFKKLREELDSVGKTKLVEESDIPNLPYLRAVIKETLRLHAPAPLIVRQSVRYCNI

RGYDIPANARMFVNLWSISRNPNYWEDPFTFNPE 2764566

 

>CYP93A51P PSEUDOGENE maker-scaffold_13-snap-gene-44.20-mRNA-1

protein Name:"Similar to CYP93A3 Cytochrome P450 93A3 (Glycine max)" AED:0.12 eAED:0.12 QI:0|0|0|1|0|0|2|0|143

57% to CYP93A4 Populus trichocarpa, heme signature frameshifted
64% TO CYP93A4   Populus trichocarpa

4389424 IVGKNRLVEESDIPS 4389379 &

4389377 LANLPYLQAIVKETLRLHPVGPLIPRESTKECVIGGYNIPAKTRAYVNVWAIGRDPK 4389207

HWDNPLKFRPERFITQDGINSGAQLDVRGHRFRFLPFGSGRR &

PGTSLALQVVETTLASIIQCIEWKVGD*ENNQNIEVDMTEGAGMTLP

RAYPLVCIPIVHLNPFP 4388884

 

CYP94 family (13 genes, 6 pseudogenes)

 

>CYP94A35 augustus_masked-scaffold_257-processed-gene-0.0-mRNA-1 protein Name:"Similar to CYP94A2 Cytochrome P450 94A2 (Vicia sativa)" AED:0.01 eAED:0.01 QI:0|-1|0|1|-1|1|1|0|509

60% to CYP94A1 Vicia sativa, complete
86% to augustus_masked-scaffold_257-processed-gene-0.4 tandem duplication

MPPPNSLLFPSLLFLLSFFFILIFSRQVGKKSSSPPVSKLPRSYPLIGSAFAIFKNRNRR NQWFAELIRDSSNGTFILHRFLGVRHVLTANPANVQHILKTQFHLYPKGHTARVNLSDFL GDGIFNADGDNWKFQRQVSIHEFSTRSLRKFVETVVEAELSDRLVPILSKAAAENSVLNL EDILQRFAFDNICKIAFGFDPQYLLPSLPSAEFAVAFDDAARITSERLNSVVPAIWKLKR ALDIGSEKRLRIAISQVREFAQKVVREKTRELEEKSSLETVDLLSRILSSGHLDEKLVTD MVISFILAGRDTTSATLTWFFWLVSGDSHVEEEILKEIRDKSETPDYDEVKDMVYIQASL CESMRLYPPVPSDSKEAAMDDVLPDGTIVKKGMRVTYLPYAMGRMEGLWGQDWREFRPER WLERDEVTGKWRRFVARDPYTYPVFQAGPRVCLGKDMAFLQMKRVAAGILRRFRVVPAME KGFEPFFISTLTSKMKGGFPVRIEERKGR

 

>CYP94A36 augustus_masked-scaffold_257-processed-gene-0.4-mRNA-1 protein Name:"Similar to CYP94A2 Cytochrome P450 94A2 (Vicia sativa)" AED:0.01 eAED:0.01 QI:0|-1|0|1|-1|1|1|0|508

57% to CYP94A1 Vicia sativa, complete

MVLLNYSLFSSSILLFIVPFLFILISGLHLGKKSSSSPVSKLPRSYPLIGSAFAIFKNRK RRNQWFAELMRDSPTGTFVLHRFFGVRHVLTANPSNVQHILKTKFHLYPKGHTARVNLSD LMGDGIFNADGDNWKFQRQVSGHEFSTRSLRKFVETVVEAELSDRLVPILSKAAAENSVL DLEDILQRFTFDNICKIAFGFDPQYLLPSLPATEFAVAFDNAVRITSERMYSIFPATWKL KRALNIGSEKQLRISVSQVREFAQNIVREKTRELEQKSSLETVDLLSRILSSGHLDEKFV TDMVISFILAGRDTTSAALTWFFWLVSNDSHVEEEILKEIRDKPEISVYDEAKDMVYIQA SLCESMRLYPPVPSDTKEAAMDDVLPDGTIVRKGTRVIYLPYAMGRMEGLWGSDWREFKP ERWLERDELTGKWSFMNRDPYTYPVFQAGPRICLGKEMAVLQMKRVAAGLLRRFRMVPAG EKEPFYISTLTSKMKGGFPVRIEERKGS

 

>CYP94A37 augustus_masked-scaffold_3-processed-gene-77.4-mRNA-1 protein Name:"Similar to CYP94A2 Cytochrome P450 94A2 (Vicia sativa)" AED:0.05 eAED:0.05 QI:0|-1|0|1|-1|1|1|0|468

58% to CYP94A1 Vicia sativa 
7709210

MIQLELLISLPFILPLFFFLISGFLGKKSSSSSSATKLP

MSYPLIGSYIALSKNRNRWPEWIAEILRHSPSGTFVLHRPFGVRQVLTANPSNVQHILKT QFYRYPKGHFFRSTLSDLLGDGIFTADGDSWKSQRQISSHAFNTKSLHNFVETVVDTELT KRLIPILSAAAADKSVINLQDILQRFAFDNICKIAFGFDPEYLSPSFPSPEFTTAFDSAI RLSSERFGSINPALWKLKRAFGIGSEKQLQLAVSQIRGFAQRIVREKKRELDEKSSLENG DLLSRILNSGHVDENLVTDLVISFILAGRDTTSAALTWFFWLISSHSHVEEEILREITEN PVAPIYTEVKNMVYTHASLCESMRLYPPVPGDSKEAAEDDILPDGTVVKKGVRVTYLPYA MGRMEALWGSNWPDFRPERWLEKDEVTGKWSFVARDQYTYPVFQAGPRICLGKDMAFLQM KQVVAGVLRRFRVVPAMEEGCEPVYVSYLTSKMKGGFPVRIEERNTKL

 

>CYP94A38a snap_masked-scaffold_2541-processed-gene-0.1-mRNA-1 protein Name:"Similar to CYP94A1 Cytochrome P450 94A1 (Vicia sativa)" AED:0.14 eAED:0.16 QI:0|-1|0|1|-1|1|1|0|196

54% to CYP94A1 Vicia sativa N-term
80% to CYP94A   augustus_masked-scaffold_3-processed-gene-77.4-mRNA-1
runs off the contig, could this join with scaffold 1717?

2105 MIQLELLQLLLLFILPFFFVFLFSGFVGKKSSSSSGIKLPRSYPLIGSYIAVYKNRNRRN EWMTELLKSSPSGTFVLRRAFGARQVLTANPSNVQHILKTQFYLYPKGPFFRSFLSDLLG AGIFTADGDSWKTQRQISSHAFNTRSLRNFVETVVDSELTKRLLPILSTAAAEKSVIDLQ

DILQRFAFDNICKIAFGYDPEYLSPSFx 2725

 

>CYP94A38b augustus_masked-scaffold_1717-processed-gene-0.0-mRNA-1 protein Name:"Similar to CYP94A1 Cytochrome P450 94A1 (Vicia sativa)" AED:0.00 eAED:0.00 QI:0|-1|0|1|-1|1|1|0|305

64% to CYP94A1 Vicia sativa, C-term half, runs off the contig end
83% to augustus_masked-scaffold_3-processed-gene-77.4 (combined seqs)

STEFSTAFEDAVRLSSERFNLINPVFWKLKRALDIGSEKQLRLAVSHVRDFAQSIVREKR QELDKKSSLDTGDLLSRILSSGHVDESLVTDLVISFILAGRDTTSAALTWFFWLISCHSQ VEEQIVREITENPEAPIYDEVKNMVYTHSSLCESMRLYPPVPWDTKEAAGDDVLPDGTVV KKGMRVTYHPYAMGRMESLWGSNWSEFLPERWLEKDKVTGKWSFVGRDSYTYPVFQAGPR ICLGKDMAFLQMKRVVAGVLQRFRIVPAMEEGSQPVYISYLTSKMKGGFPVRIEERVIEQ

VSMSE

 

>CYP94A39P scaffold 86 2256-1993 (-)

72% to CYP94A JcCA0317771.20, 68% to CYP94A1 Vicia sativa
77% to CYP94A augustus_masked-scaffold_1717-processed-gene-0.0

EVRDMVYTHTSLSESMRMYPPVPSDMKEASGDNVLLDGTVVKKGMRITYHPYAMGRMEGLWGSDW*EFSPKRWLE

RDSQNIRKREKTK

 

>CYP94B21 snap_masked-scaffold_7-processed-gene-45.7-mRNA-1 protein Name:"Similar to CYP94A2 Cytochrome P450 94A2 (Vicia sativa)" AED:0.09 eAED:0.09 QI:0|-1|0|1|-1|1|1|0|425

62% to CYP94B1 Arabidopsis thaliana, revised seq complete
71% to CYP94B augustus_masked-scaffold_7-processed-gene-45.1-mRNA-1

4576404 MFLPLFIMFLQGILLFSWVVFFLFFFHGLYYQCAGMFSRHGPASYPFIG CLISFYKNRFRLLDWYTELLAQSPAKTIVVQRLGARRTVITANPDNVEY

MLRTNFSNFPKGKPFTEILGDLLGYGIFNVDGELWRTQRKLVSHEFTTKSLREFVVKTLV EEVEERLLPLLESASANNKVVDMQELLRRFAFDTVCKVSLGMDPGCLDASLTISPLARAF DVASEISARRAAAPVFAVWKIKRLLRMGSEWQLKQAIEDVHRSVEEIIRDKKKKISAGES RGEHDNGDLLSRLISAGHDDDVTRDMVISFIMAGRDTTSAAMTWLFWSLSRHPNTEKEVV KEVVTALGNDEPKSLDYEALKDLPLLKACLCESMRLYPPVAWDSKHSVRADTLPDGTKVG VGDRVTYFPYGMGRMESLWGKDRLEFKPDRWFLEPDKEGGALKEVSPYKFPVFQAGPRVC LGKEMAFIQMKYVVASILRRFELRPVASERKPVFVPLLTAHMAGGFNVNVVVRQRAGRTI

RHEQS*

 

>CYP94B22 augustus_masked-scaffold_7-processed-gene-45.1-mRNA-1 protein Name:"Similar to CYP94A2 Cytochrome P450 94A2 (Vicia sativa)" AED:0.01 eAED:0.01 QI:0|-1|0|1|-1|1|1|0|516

59% to CYP94B1 Arabidopsis thaliana, complete

MPAPVLTADPPTLLITSILLFLLHWFLCRFRRLCKFSGDGLPTYPLIGCLISFYKNRRRL LDWYTDLLADSPMQTIVIRRFGARRTVVTANPDNVEYILTTNFNNFPKGQPFTDILGDLL GCGIFNVDGELWRAQRKLASHEFSTKSLREFVGKTLNQVVKNRLTPVLASAMETDQIVDL QDLLRRFAFDTVCMVSLGIDPGCLDSSLPVSALAGAFDIASEISARRASAPVFAVWKIKR ALCLGSERRLKEAIQHVHGSVEEIIRDKKKLMLNRVRKEEINNNNSNGDLLSRLISSGYD DEVIRDMVISFIMAGRDTASAAMTWLFWLLSCHPHIENEVVKEVEAINTGDSPLDYEALK ELPLLKACLCESMRLYPPIAWDSKHVVEDDTLPDGTRVRAGDRVTYFPYGMGRMEGLWGK DRFEFKPDRWFVEPDKEGGALKEVSPFKFPVFQAGPRVCLGKEMAFVQMKYVMASLLKQF QFKSVGLEEPAFVPLLTAHMAGGLNVLIRPRGRHSI

 

>CYP94B23P scaffold 85 1027284-1027042 (-)
47% to CYP94B1 Arabidopsis thaliana, 54% to JcCB0263831.10
83% to CYP94B snap_masked-scaffold_7-processed-gene-45.7

DDDVNRDMVISFIMAERDTTLTAMMWLFWWFSRHPNTEKDVVKEVVTALGNDKRKSLDYEALKNIPLLKACLYES

MRLYPP

 

>CYP94B24P scaffold 100 508253-508675 (+)

60% to JcCB0263831.10, 54% to CYP94B1 Arabidopsis thaliana
87% to CYP94B snap_masked-scaffold_7-processed-gene-45.7

DMLRDMVISFIMAGRDTTSTAVTWLFWSLCRHPNTEKDVVKEVVITLGNDEQKSLDYEPLKDLPLLKACLCESMR

LYPPMAWDSKHSPP

 

>CYP94B25P scaffold 231 642701-642937 (+)

64% to JcCB0263831.10, 51% to CYP94B1 Arabidopsis thaliana
87% to CYP94B snap_masked-scaffold_7-processed-gene-45.7

DVMGDMVINFIMAGRDTTSAAMTWLFSSLSRHPNTEKDVVKEVVTALGNDERKLLDYEALKNLSLLKACLYESMR

LYPP

 

>CYP94B26P scaffold 5 5487562-5487314 (-)

65% to JcCA0108671.10, 61% to CYP94B1 Arabidopsis thaliana
93% to CYP94B snap_masked-scaffold_7-processed-gene-45.7

ELLGYDIFNVDGELWRTQRKLVSHEFTTISLREFVVKTLVEEVEERLLPLLESASANNKVVNMQELLRRFAFDTV

CKVPLGMD

 

>CYP94B27P scaffold 110 1502682-1502897 (+)

60% to JcCB0263831.10, 50% t0 CYP94B1 Arabidopsis thaliana
68% to CYP94B augustus_masked-scaffold_7-processed-gene-45.1

LSFIMAGRETTSATMTWLFWSLSRHPNTEKDAVKEVVKALGNDEHKSLDYEALKDLPLLKARLYESMRLYPP

 

>CYP94B28P scaffold 7 8483866-8483588 (-)

54% to JcCA0108671.10, 50% to CYP94B1 Arabidopsis thaliana
79% to scaffold 27 5352410-5351925 (-)
72% to CYP94B augustus_masked-scaffold_7-processed-gene-45.1

DLLGCGIFNLLIWCA*RKLASHEFSTMSLQEFVGKTLEEVVTDHLVSVLASAMETGQVVDPRRFAFDTV

CMVSLRIDPGCLDSSLHVSVLARA

 

>CYP94B29P scaffold 18 3903229-3902915 (-)

61% to JcCA0108671.10, 57% to CYP94B1 Arabidopsis thaliana
87% to CYP94B augustus_masked-scaffold_7-processed-gene-45.1

DLLGCGIFDVDGKLWHAQRKLASHEFSTKSLREFVGKMLEEVVKDCLTPVLAYAMETNQVVDLQDLLRRFAFDTV

CMVSLGIDPGCLDSSLLVSVLAGAFDIASE

 

>CYP94B30P scaffold 22 3073414-3073151 (-)

68% to JcCA0108671.10, 58% to CYP94B1 Arabidopsis thaliana
81% to scaffold 27 5352410-5351925 (-)
80% to CYP94B augustus_masked-scaffold_7-processed-gene-45.1

GEPFTDILRDLLGCGIFNFFIWRTQRKLASHEFSTMSLREFVGRTLEEVVTNRLTPVLASVMETSQVVDLQDL

LRRFAFNMVCMVSLG

 

>CYP94B31P scaffold 27 5352260-5351925 (-)

60% to JcCA0108671.10, 54% to CYP94B1 Arabidopsis thaliana
79% to CYP94B augustus_masked-scaffold_7-processed-gene-45.1

WPTNLPSNWVVDFLLQEPLPSLRLVHGPPHRIPDADNRGTSFQCKMDSHH

GEPFTDILRDMLGCGIFN

LLVWRA*RKLASHEFSTKSLREFIGKTLEEVVTDHLTPVLVFAMETSQVVDLQDLLRRFAFDTVCMVSLGIDPGC

LDSLLHV*VLAGAFDIASE

 

>CYP94B32P scaffold 54 680721-681068 (+)

59% to JcCA0108671.10, 57% to CYP94B1 Arabidopsis thaliana
82% to CYP94B augustus_masked-scaffold_7-processed-gene-45.1

DLLGCGIFNVDGEL*RAQHKLASHEFSTKSLREFVGKTLEEVVKDRLMPVLASAMETGQVVDL*DLLRRFAFDTV

CMESLGIYPSCLDSLLPVLVLVGNFDIASEISAKRASTPIF

 

>CYP94B33P scaffold 60 398461-398195 (-)

51% to JcCA0108671.10, 49% to CYP94B1 Arabidopsis thaliana
73% to CYP94B augustus_masked-scaffold_7-processed-gene-45.1

MSLREFVEKTLEEVVTDRLTQVLAFAMKTNQVVDLQDLLKRFAFNTVCMLSLRIDPSCLDSLLHISVLAGAFDIA

FEKSARRASTPIFV

 

>CYP94B34P scaffold 79 1487921-1488331 (+)

64% to JcCA0108671.10, 59% to CYP94B1 Arabidopsis thaliana
92% to CYP94B snap_masked-scaffold_7-processed-gene-45.7

FLKGKPFIEILGDLLGYGIFNVDGELWRTQRKLVSHEFTTKSLRELVVKTVVEQVEERLLPLLESASANNKVVDM

QDL*RRFAFDTVCKVSLGIDPGCMDASLTISPLARAFDVASEISARHAAAPVFAVWKIKRLL

 

>CYP94B35P pseudogene (join two models)

snap_masked-scaffold_54-processed-gene-18.21-mRNA-1 protein Name:"Similar to CYP94A1 Cytochrome P450 94A1 (Vicia sativa)" AED:0.37 eAED:0.43 QI:0|0|0|0.66|1|1|3|0|157

CYP94 pseudogene

augustus_masked-scaffold_54-processed-gene-18.5-mRNA-1 protein Name:"Similar to CYP704C1 Cytochrome P450 704C1 (Pinus taeda)" AED:0.46 eAED:0.46 QI:0|0|0|0.5|1|1|2|0|87

48% TO CYP94B1 Arabidopsis thaliana MID REGION 
67% to CYP94B augustus_masked-scaffold_7-processed-gene-45.1-mRNA-1
54% to CYP94B10 Vitis

1825437 LLLVFLYFGIHWVL*KSSGDDLPTYPLIGCL &

ISFYKNHCHLLDWSTDLLAESPTQTIMVRRFGARRTVVTANP

GEPFTDILGDLLGCGIFNMDGEL*RTQHKLASHEFSTKSLQEFIGKTLEEVVKDRLTPVL

ASTMKTGQVVDLQDLLRRFTFDTVCMVSLGINPSCLDSLLPV*VLAGAFDIASEISARRA

SALIFAI*KIKRMLYLGSKRRLK

SLQEFIGKTLEEVVKDRLTPVLASTMKTGQVVDLQDLLRRF

(146 aa gap)

LGSKRRLKFPVFQSRPRVCLGKEMAFVQMKYMMDLLMKQFKFKSVGLEEPAFVPLLTAHM

AGGLKVLV 1826253

 

>CYP94B36P pseudogene maker-scaffold_224-snap-gene-7.23-mRNA-1

protein Name:"Similar to CYP94A1 Cytochrome P450 94A1 (Vicia sativa)" AED:0.11 eAED:0.18 QI:0|0|0|0.66|0.5|0.33|3|0|259

52% to CYP94B1 Arabidopsis thaliana, missing N-term and internal 190 aa piece
71% to CYP94B augustus_masked-scaffold_7-processed-gene-45.1-mRNA-1

781454 LLLVFLCLCTLWVLCKSSGDVLPTYPLIGCLISFYKNCRRLL

GDWRIDILAEFLTQTIVTGNPNNVEYILTTNYNNF PKGQPFTNILEDLLGCGIFNMDGKLLHAQRKLASHKFNAKSLRKFVGKTLEEVVKYCLTL VLASAMETGQVVDLQDFLRRLAFDMVCMVSLGIVPGCLDSSLPISVLVGDFDIASDICAK

NASAPVFIVWKIKRALCLGSKQCLK

(190 aa gap)

KFPVFQSRPKVCLGKKMAF &

VQVKYMMALLLKQFEFKPVELEGPTFVPLLMAHMADGLKVVVQPRGCHS 782318
 

>CYP94B37P augustus_masked-scaffold_224-processed-gene-7.2-mRNA-1 protein Name:"Similar to CYP94A2 Cytochrome P450 94A2 (Vicia sativa)" AED:0.35 eAED:0.35 QI:0|-1|0|1|-1|1|1|0|173

59% to CYP94B1 Arabidopsis thaliana aa 98-224 region
64% to CYP94B10 Vitis

MTNFNNFPKGQPFTDILGDLLGCGIFNVDGELLHAQRKLASNEFNTKSLREFIEKTLEEV VKDCLMSVLASAMETGQVVDLKDLLRRLAFDTMCMVSLGIDPGCLDSSLPISVLAGAFDI ASEIRTRRVHPLPSSLYGRLKEHCISGPSDASSSRCFNPDPRCAWERRWLLFR

 

>CYP94C33 augustus_masked-scaffold_69-processed-gene-29.5-mRNA-1 protein Name:"Similar to CYP94A1 Cytochrome P450 94A1 (Vicia sativa)" AED:0.10 eAED:0.10 QI:0|-1|0|1|-1|1|1|0|406

65% to CYP94C1 Arabidopsis thaliana, missing the N-term
82% to CYP94C augustus_masked-scaffold_4-processed-gene-26.0-mRNA-1 (ohnologs)

3042540 MESESSFSLQSLQTSFCYFF FSFALSFSLFSLLLFVLRLKLWCNCDVCRSYLTASWSIEFDNLCDWYTHLLKKSPSKTIH VHVLRNTITANPDNVEY

3042831 MLKTRFENYPKGKPFSVILGDLLGRGIFNVDGDTWKFQRKLASLELGSVSIRSFAFEIVT TEIKRRLVPLLSSAAGEGRVLDLQDVFRRFTFDNICRFSFGLDPGCLELSLPISEFAMAF DLASRLSAQRALSLSPLIWKIKRLLNLGSEKKLKKAIRLINVLAKEVIRQRRKMGFSASQ DLLSRFMGTINDDKYLRDIVISFLLAGRDTVASALTSFFWLLAKHPEVAATILNESDRVM GPTQELASFEQIREMHYLHSAVYESLRLYPPVQFDSKFSQEDDVLPDGTAVKRGTRVTYH PYAMGRMEELWGPDCLEFKPERWLKNGIFSPENPFKYPVFQAGLRVCLGKEMSLVEIKSV VLAVVRSFEIQVVEDNDSPRFAPGLTATVSGGLPALVRERRRSSSS* 3044051

 

>CYP94C34 augustus_masked-scaffold_4-processed-gene-26.0-mRNA-1 protein Name:"Similar to CYP94A1 Cytochrome P450 94A1 (Vicia sativa)" AED:0.01 eAED:0.01 QI:0|-1|0|1|-1|1|1|0|503

62% to CYP94C1 Arabidopsis thaliana

MEYEASFLLQSLQSSFCYFFFSFALCFSIFSFLPYLVRLKAWCKCDVCRGYVTSSWSTEF DNLCDWYTHLLKNSPSRTIHIHVLGNTITANPDNVEYMLKTRFDNYPKGKPFSAILGDLL GRGIFNVDGDTWKFQRKMASLELGSVSIRSFAFEIVTSEIKHRLLPFLSSTASDEQDRVL DLQDVFQRFTFDNICRFSFGLDPGCLELSLPMSEFAMAFDLASRLCAKRALSLSPLVWKA KRLLNLGSEKKLKKAIRLINILADEVIKQRRKLGFSTHLDLLSRFMGTVNDDAYLRDIVV SFLLAGRDTVAAALTSIFWLMAKHPEVTTAILEESDRVMGPTQELATFQQLRDMHYLQAT VYESMRLYPPVQFDSKFPQEDDVLPDGTVVKRGTRVTYHPYAMGRMEEVWGPDCLEFKPE RWLKKGIFWPESPFKYPVFQAGFRVCLGKDLALVEIKSVMLAVIRGFEIEVDEPDNSPRF APGLTATVSGGLPVLVRQRRRRS

 

>CYP94C35P pseudogene scaffold 0

58% to CYP94C1 Arabidopsis thaliana
67% to JcCB0545971.10, 59% to CYP94C1 Arabidopsis thaliana
84% to CYP94C augustus_masked-scaffold_69-processed-gene-29.5

9943560-9943787 (+)

LGNTITANPDNVKYMLKTRFENYPKGKPFSVILGDLLGRGIFNVDGDTWKFQRSFAFEIVTTEIKRWLVPHLSSAA

9943673-9944029 (+)

EGRVLDLQDVF*RFTFDNICRFSFRLDPGCL

ELSLPISEFAMAFDMVSRLSTQ*VLLLSPLIWKIKRLLNLGSEKKMKKA

 

>CYP94C36P scaffold 44 3773943-3774398 (+)

70% to CYP94C JcCB0039631.10, 61% to CYP94C1 Arabidopsis thaliana
92% to CYP94C augustus_masked-scaffold_69-processed-gene-29.5

MGRGIFNVDGDAWKFQRKPASLELGSVSIRSFAFEIVTTEIKRRLVPFLSSAAGEGRVLDLEDVFRRFTFDNICR

FSFELDPGCMELSLPISEFAMAFDLASRLSSQRALSLSSLIWKIKRLLNLGSEKRLKKAIRLINVLAEEVIRQGR

IQ

 

>CYP94C37P scaffold 47 (2 different copies of almost the same seq

3144282-3144088 (-)

NYPKGKPFSVTLGDLLGH

GIFNVDGNTWKFQRKLASLELGSVSIRSFAFEIVTTEIKRRLVPLLS

3144080-3143634 (-)

69% to CYP94C JcCB0039631.10, 63% to CYP94C1 Arabidopsis thaliana
92% to CYP94C augustus_masked-scaffold_69-processed-gene-29.5

GIFNVDGDTWKFQRKLASLELGSVSIRSFAIEIVTTEIKRRLVPLLSSAAGEGNVPDLQDVFRRFTFDNICRFSF

GLDPGCLELSLPISDFAMAFDLASKLLAQRALSLSLLIWKIKRLLNLGSEKKLKKGI*LIDVLAKEVIRQGRIQ

 

>CYP94C38P augustus_masked-scaffold_1-processed-gene-35.1-mRNA-1 protein Name:"Similar to CYP94A2 Cytochrome P450 94A2 (Vicia sativa)" AED:0.26 eAED:0.26 QI:0|0|0|0.5|1|1|2|0|163

64% to CYP94C1 Arabidopsis thaliana aa 18-257 region
75% to CYP94C15v1 Vitis

3534641 FSLLLFLLRLKLWCNCNVCRSYLTAS*SIEFDNLCDWYTHLLKKSPSK 3534784

TIHVHVLRNTITANPDNVTRFENYPKGKPFS

3534878 MILGDLLGRGIFNVDEDTWKFQRKLASLELGSILIRSFAFEIVTTEIKRRLVPLLSWTAG KGRVLDLQDVFRRFTFDNICRFSFGLDPGCLELSLPISEFAMAFDLASRLLAQRALSLSP LIWKIKRLLNLGSEKKLKKAIQLINVLTKEVIRQ 3535339

continues on opposite strand joined

53% to CYP94C1 Arabidopsis thaliana N-term seq aa 4-50

3535478 FVFLILSFALSFSLFSLLLFLLRLKLWCNCNVCRSYRTSSW*IEFD 3535341

 

>CYP94D35 augustus_masked-scaffold_315-processed-gene-2.0-mRNA-1 protein Name:"Similar to CYP94A1 Cytochrome P450 94A1 (Vicia sativa)" AED:0.01 eAED:0.01 QI:0|-1|0|1|-1|1|1|0|504

57% to CYP94D1 Arabidopsis thaliana, complete

MDLLFLLLLLFSLLSLCLSVSACCYPSKRKPNSHLAFKSYPLLGIGPDFLRNRHRFFDWT SDILCWSPNNTTAYCRPGMHGILTANPLNVEHILRNNFDNYPKGPSHFHTLKDFLGRGIF NADGNIWKVQRKIASFEFNTKSLRSFAITNVKEEIQTRLVPLLRKTSELNQVVDMQDILE RFAFDNICKLAFNVDPGCLGGDGTAGAEFMKAFDDASLLSVARFFDVHPLWWKTKKALNI GSERRLREAIRMVHDFSDNIIRSRMEEEGGKQSTEDLLSRFVADDLNSPEFLRDIVISFI LAGRDTTSSTLAWFFWLLSSRPDIEHNILDELKSIRTRTRKEIGDAYSFEELREMHYLQA AISEALRLYPPVAMDTKVCLKDDVLPDGTSVRKGWVVTYHAYAMGRMECIWGKDCREFRP ERWLENGSCRQESPFRFSAFHAGPRMCLGKDMAYIQMKSIAASVVERFHIDVVDGLKCPE

LLLSLTIRMKGGLPVRVKERCFHN

 

>CYP94D36 augustus_masked-scaffold_315-processed-gene-2.8-mRNA-1 protein Name:"Similar to CYP94A1 Cytochrome P450 94A1 (Vicia sativa)" AED:0.04 eAED:0.04 QI:0|-1|0|1|-1|1|1|0|474

58% to CYP94D1 Arabidopsis thaliana, complete

MKAVSNVGFKVYPFFGSLPEFFKNRNRFVEWVTDILASNPTNTAVYHRPVNIRGIMTANP LNVQHMLKNNFDNYPKGELFTSHLEDFLGRGIFNVDGHLWKVQRKTASSEFSTKSLRNFV MDIVNEETLSRLVPLLRKASGQKIVVDMQDIMERFAFDHVCKLAFNVDPGCLGGDNTAGA EFMKAFNDAATLSAGRFLYFLPYLWKMKRALNIGSEERLRSAISTVHDFADKIIRSRMQE KEEKQNDEDLLSRFIANESNSPEFLRDIIINFILAGRDTTSTTLSWFFWLLSNRPEVERK ILDELKLIRASNGKKIDDTYSFNELREMQYLQAALSEALRLYPPVALDTKVCRKDDVMPD GTFVGKGWFVTYHAYAMGRMESIWGKDCLEFKPERWLENGVCRRESPFRFPAFHAGPRIC LGKDMAYILMKSITASVIQRFQMEVVDKDKCPELVVSLTLRMKEGLPMRVKERC

 

>CYP94D37 augustus_masked-scaffold_315-processed-gene-2.5-mRNA-1 protein Name:"Similar to CYP94A1 Cytochrome P450 94A1 (Vicia sativa)" AED:0.01 eAED:0.01 QI:0|-1|0|1|-1|1|1|0|507 
59% to CYP94D1 Arabidopsis thaliana, complete

MDLFSLQSLLLFFLLSLYLYLHFHPSCKKSNSNAGFKIYPLIGTLPEFIKNRHRFLDWTT DVLSRTPTNTATFYRPGKVNGIITANPLNVEHMLKANFENYPKGDRFIALLKDFLGQGIF NSDGDLWRVQRKTASFEFNTKSLRSFVMENVKAEIETRLIPLLKRASETNQILDIQDILE RFAFDNVCKLAFDIDPVCLGGDGTTSGEFMQAFEEAARLSAGRFMYLFPFLWKVKKALNI GSERRLKQAISTVHDFADKIIWSRMENRRQKQNNDDLLSRFMEDEFNSAEFLRDIVISFI LAGRDTTSSSLAWFFWILSSRPDIERNILDELESVRARKGKCIGDTYSYDELREMQYLQA ALSEGLRLYPPVAVDTKACREDDVLPDGSFIKKGWFITYHTYAMGRMEAIWGKDCREFKP QRWLESGTCRQESPFRYPIFHAGPRMCLGKDMAYIQMKSIAASVIERFHVDVVDGDKCPE HLLSLTLRIKGGLRVRIKQRCVDKIQS

 

>CYP94D38 augustus_masked-scaffold_311-processed-gene-0.0-mRNA-1 protein Name:"Similar to CYP94A1 Cytochrome P450 94A1 (Vicia sativa)" AED:0.01 eAED:0.01 QI:0|-1|0|1|-1|1|1|0|504

55% to CYP94D1 Arabidopsis thaliana, complete

MYPLSPQSLLFIFLLIIIYLSLYASKKKSSSNVAIKPFPCFGVLPEFIKNRHRFLDWSSE VLARLPTNTLDYHHPGKVHGIITANPLNVEHMLKSNFHNYPKGSRVTSYLEDFLGRGIFN ADGEIWKIQRKTASYEFNTKSLRNFFMKSVEEEIQTRLVPVLKRASVLNQVVDMQDILER FSFDTVCRLSFNMDPGCLGSEGTTGTEFMNAFGEASTYSAGRFFYALPYMWRIKKALNIG SEKRMRKAISIVHDFADDIIKSRMKEKGEKEDTDDLLSRFIANESNSAEFLRDIIISFML AGRDTMTSSITWFFWVLSSRSDVEGNILHEMKSIRNRNGTGSEAFNFDDMGQMHYLKAAL SESLRMYPPVPLDEKQCLQDDIMPDGTFVGKGWCVTYHAYAMGRMESIWGKDCLDFKPER WLENGICRQESPFRFPAFHAGPRICLGKDVAHMQMKMVVASVLSRFHLDLVDKYRAPKQI

LSLTLRMKDGLPMRVRERCEAAID

 

>CYP94F4P pseudogene (join three models)

snap_masked-scaffold_79-processed-gene-3.7-mRNA-1 protein Name:"Similar to CYP94A1 Cytochrome P450 94A1 (Vicia sativa)" AED:0.33 eAED:0.33 QI:0|-1|0|1|-1|1|1|0|172

CYP94 pseudogene

snap_masked-scaffold_79-processed-gene-3.11-mRNA-1 protein Name:"Similar to CYP94A1 Cytochrome P450 94A1 (Vicia sativa)" AED:0.40 eAED:0.44 QI:0|-1|0|1|-1|1|1|0|104

CYP94 snap_masked-scaffold_79-processed-gene-3.14-mRNA-1 protein Name:"Similar to CYP94A2 Cytochrome P450 94A2 (Vicia sativa)" AED:0.45 eAED:0.45 QI:0|-1|0|1|-1|1|1|0|112 
62% to CYP94F2 Vitis vinifera 
49% to CYP94D augustus_masked-scaffold_315-processed-gene-2.5-mRNA-1
362660

LSTLRSFLSFILISLFFFFLAKPQTKRSKTPCPSSYPLIGNLIGFLRNRHRFHDWVAEM

LSSTPSSTLEVNGFLNTHHGICTTNPTDIEHLLRTNFSNYIKGSRFHDVLHDLLGDGI

FNVDGDLWSKQRKIASHEFNNRSLKSFIAHIVQFEISSRLVPYLNAACDNNEILDLQDVF

RKLAFDNICNLAFGVDLAWLSYDDSRTASSASFVQAFEEAVEISSSRFMSP &

RLKRILNVGSEKRLKDAIAVIDDYAMKIIEAREQGGENSYSNQDLLSRFMSWCDHDDLGF

RNCNEKRKFLRDIVISFVLAGKDSTSTALTWFFWLISSSPRCERLIYDELSSLQMPEI (1)

GGIFKYEELKQLHYLHAAITESLRLFPPVPINSRLTVADDVLPDGTYVGAG*WFADYSAY

AMGRMEKVWGPNCREFLPERWLDKDGVFVPSDQYRFPVFHCGPRMCLGKEMVYVQMKSIA

ASVIYGYEIEAVDTKVPSYTQSLLLKMNGGFSVRLKRRSQNRSIGWLSDGLNK* 364228

 

CYP96 family (15 genes, 3 pseudogenes)

 

>CYP96A57 augustus_masked-scaffold_26-processed-gene-29.3-mRNA-1 protein Name:"Similar to CYP86B1 Cytochrome P450 86B1 (Arabidopsis thaliana)" AED:0.02 eAED:0.02 QI:0|0|0|0.5|1|1|2|0|512

54% to CYP96A1 Arabidopsis thaliana, complete
66% to CYP96A18 Vitis, 46% to DR944473.1 Aquilegia
44% to maker-scaffold_2-snap-gene-71.15-mRNA-1b
top hits are all Vitis, no close match in lotus

MTSMAFMGMGYFEMLLLSLAVVCFIYLRRLSRNDSPLPDWPVLGMLPSLLRNIHHVHDWT TKLLEQSRSYTFTFRGPWLAGMDMVWTCDPANVHYIMSTHFSNFPKGPEFKNIFDVLGDG IFNSDSDLWKTQRKVAHGLISRRRFCRFLERTSRKNVEEGLIPVLDHISEQGMIVDLQDV FQRFTFDSTCTLISGIDPGCLSVEFPDVAFSKALDDVEEAIFFRHIVPKSYWKLQRWLGI GEEKKMSRAWKTLDRYIAHCISLKREELNNRTNKNEEEGIDLLTSYMEDDYGSDWLKSDK LLRDTMLNFMIAGRDTTSAALSWFFWLVAKNPSVETKIREELKSNLPAEEAEKWRVFDAG ELSGLAYLHGALCEALRLFPPVPFEHKSPVCPDVLPSGHRVDERTKILFSLYGMGRMEGL WGKDCLEFKPERWITERGRIRHEPSYKFLAFNAGPRTCLGKEVAFTQMKVVAAAFIHNYH VEVIEGHPVSPNLSIILHMKHGLMSKLETPNG

 

>CYP96L1 snap_masked-scaffold_58-processed-gene-11.15-mRNA-1 protein Name:"Similar to CYP86B1 Cytochrome P450 86B1 (Arabidopsis thaliana)" AED:0.01 eAED:0.01 QI:0|-1|0|1|-1|1|1|0|518

42% to CYP96B2 rice, complete, 43% to CYP96A18 Vitis
63% to CYP96 augustus_masked-scaffold_254-processed-gene-4.1
64% to maker-scaffold_58-snap-gene-11.24
62% to CYP96 augustus_masked-scaffold_3-processed-gene-13.3
61% to augustus_masked-scaffold_3-processed-gene-13.2
57% to snap_masked-scaffold_232-processed-gene-5.18

MVITGLGYEILVAIVLLLLSLSLRWLLKQKNKSVILNWPLLGSSPVLLRNILNLHDWFTH VFISLGTYSFYLKGPIFSKLDQFVTCDPQNFEHILKTNPSNYPKGEDFTEAFDILGDGIF NAEGDSWHAQRKTAHWVFRSIDFRSFVSSTVQKKVEQKLLPMLARVAREGTTVDFQDVCM RFTFDSINITIAGRDLGCLSEELPINEVAQAVDDAQAAILFRLFTPTFLWKLLRLLRLGP EKKLARAWQLADASILDIILHKKEQLLKGIDTEENSLLSNFIRSLGEKNDWSEPRVKFLR DTVLNFFMAGRNTTASGIIWFIWLVSRNPRVEEKILQELRLVVSDKLKEGGVEYKKPWVF DSEDLRELVYLHAALCESLRLCPPNPVNVKGVVKEEVLPDGXIVKPGMQVILSMYAVGRM PSLWGDDCLEFRPERWIRPDGTLDKDKISKLLFAFSIGQRSCLGKNMALTNMKLAASAVL FNFQIQVVEDHPISYKPAIMLEVKDGLMIKVKERASWF

 

>CYP96L2 maker-scaffold_58-snap-gene-11.24-mRNA-1 protein Name:"Similar to CYP94A2 Cytochrome P450 94A2 (Vicia sativa)" AED:0.03 eAED:0.04 QI:0|0|0|1|0|0|2|0|505

38% to CYP96D1 rice
40% to CYP96B3 rice, complete
41% to CYP96A17 Populus trichocarpa
64% to CYP96 snap_masked-scaffold_58-processed-gene-11.15-mRNA-1

MTFFFPCVSSAGSEYQVLVAIIVFFLCLRWLFRQKKQQIPPSWPLLGSLPALVCNMNRVL DWWTDVFISLGKNTFYLNCPIFSNLNYVVTCHPKNFEHILKTKADNYPKGRSFDEAFDVL GDGIFNAESDSWLAQRKTAKSIFTTIQFRRFVNDTLQTVVDEKLLPLLARAAREGSTLDL QELIMRFTFDVINITISGKDLGGLYEDFPSDVLSQAIDDGQEAILFRLSTPKPLWSLLRL LRVGPEKKLAKAWETADGCIVDLILRKKEQLLKGIESEANSLLSNHIRSQGENSDWSKAR VMFLRDMVLNFFLAGRNTTAAGVMWFIWAVCRNPRVEEKILQELR

LAISRKQSKEGSKDSSDQEYKNKQQPWS

TFDLDDVGDLVYLHAAICESLRLYPAQPMNLKSAIKGDVLPDGSVVKPGVKIMISMYSLG

RIPSIWGNDCLEFKPERWILPDGTLDNDKISKLFFAFSTGKRSCLGKNTAFAIIKLAAA

AVIFNFQVQVPEDQPVIKPGIMLEMKGGLKIKVKERASRPF

 

>CYP96L3 augustus_masked-scaffold_254-processed-gene-4.1-mRNA-1 protein Name:"Similar to CYP86B1 Cytochrome P450 86B1 (Arabidopsis thaliana)" AED:0.01 eAED:0.01 QI:0|-1|0|1|-1|1|1|0|527

40% to CYP96B2 rice

39% to CYP86B1 Arabidopsis thaliana, complete
63% to CYP96 snap_masked-scaffold_58-processed-gene-11.15

MALAWAFTIPFLPTVSAYHILVAVLLFFILQWFFQRKQYNKVYANWPLLGSFPVLAWNSY KIHEWMTEVFIKLGTNSFYLKGPVLSKLDYLVTCDPQNLEHIFKTNVANYPKGKNFMQIF EILGEGIFNADSESWQTQRKSAHWAFRSVDFRSFVNSTVQKAIQNKLLPVLANVAKEGCP VDLQDLFLRYTFDTINITISGKDLGCLAEGLPTNVVATAVDDAQEAVIYRVLTPTFYWKL LRLLKVGTEKKXAKAREVADNTIYDIIWRKKEEVLKGVESETNSLLSTYIRSQGEKPDWS EARVKFLRDTVLNFFLAGRDTTASGLLWFFWSLNRNPRVEAKLLEELRFVFSQRERKGEX NAVGKKKFMFEPDDLKNLLYLHAAFCETLRLFPPVPLNRKGVVKKDVLPDGSVVKPGMQV LLGVYSLARIPSIWGEDCLEFKPERWIKADGTLDNDMISKLLFAFGGGPRICIGRDMAFT NMKLAAAAILSNFHIQVEDDHPVSLKSTVVLQVNDGLMVHVKERSLF

 

>CYP96L4 augustus_masked-scaffold_3-processed-gene-13.3-mRNA-1 protein Name:"Similar to CYP86B1 Cytochrome P450 86B1 (Arabidopsis thaliana)" AED:0.01 eAED:0.01 QI:0|-1|0|1|-1|1|1|0|524

42% to CYP86B1 Arabidopsis thaliana
62% to CYP96 snap_masked-scaffold_58-processed-gene-11.15

MVSNEFAASISGYQFFLLAILSAVFFLRWFLFFKQKLKNQVIPEWPLLGSLPSVARNFRR LSDWFTEVFLTLGTKTFYLKGLFSKLDYVITCDPHNFEYMLKVNTANYPKGEDFRQIFDI LGEGIFNTDFESWATQRKASHSAFRLIEFRSFVSHTVQKLIDEKLLPLLANVAREGSAID LQDLILRFTFDSIAITTWGKDLGLLSQELPATVAVQAIDDAQEAIICRNFIPTLIWKLMR LLKIGSEKKMAKAWEVADNIILDIILEKKEQLLNGTDESGKNSLLSIFIRSQGQENDWSK SRMKYLRDMSLNFIIAGRDTTASGLVWFFWSVSRNPHVEEKLLEELKLAFAKKKGNGEGK KPWVFDSEDLKELVYLHAAICESLRLYPPVHTQKKSPMKEDIFPDGTTVKPGMQILLSNY ALARMPSVWGKDCLKFKPERWIREDGTLNNEMISKLLFAFGTGPRTCLGKDMAFTQMKMA AAAVLFNYSIQVVEGHPVSLKQSVILEMKDGLMVNVKERDSWCQ

 

>CYP96L5 augustus_masked-scaffold_3-processed-gene-13.2-mRNA-1 protein Name:"Similar to CYP86B1 Cytochrome P450 86B1 (Arabidopsis thaliana)" AED:0.01 eAED:0.01 QI:0|-1|0|1|-1|1|1|0|524

42% to CYP86B1 Arabidopsis thaliana, complete
61% to CYP96 snap_masked-scaffold_58-processed-gene-11.15

MVFNGFAASISGYFLLAILSVFFLMRWVLFFKQKLKNQIIAEWPFLGSLPTVAWNMNRLH DWITEIFISLGIKTFYLKGLFSKLDYVFSCDPQNFEYILKVNSGNYPKGEDMRQIFDILG DGIFNTDFESWATQRRASHSAFRLIEFRSFVSYTVQKVIEEKLLPLLAHVAREGSVIDLQ DVLLRFTFDTIAMTTCGKDPGFLAKELPGNVVAKAIDDAQEAILYRNFVPMLIWKLMRLL NVGSEKKMAKAWEVADNTIIDIILQKKEQLLNGTDESEKINSLLSIFIRSQGQKNEYWSK SRMKFLRDLSLNFIIAGRDTTASGLLWFFWLVCRNPHVEEKILEELKLAFAKKKGNGIGS NKPWVFDSEDLKEFVYLHAAICESLRLYPPVATQKKGPIREDILPDGTTVKPGMQIVLSN YALARMPSVWGKDCLEFKPERWLREDGTTLNNEMISKLLFAFGTGPRTCLGKDMAFTQMK MAAAAVLFNYSIQVVEGHPVSLKRSIILQMKDGLMVNVKERGSW

 

>CYP96L6P pseudogene snap_masked-scaffold_232-processed-gene-5.18-mRNA-1

protein Name:"Similar to CYP86B1 Cytochrome P450 86B1 (Arabidopsis thaliana)" AED:0.26 eAED:0.27 QI:0|0|0|0.75|1|1|4|0|281

45% to CYP96B2 rice
68% to CYP96 pseudogene augustus_masked-scaffold_100-processed-gene-19.3-mRNA-1
580300 MLLAFLSLFFLTWYLKHKNRVILNLPHLGSFPILTGNIHRLHYWLTDVFISQESGSFLL

KVPFFSKLDYLVTCHPLNMEHVLKSNASNYPKGDNFREIFDILGDGIFSADSDSWLEQ &

RKTALLCLKSRDFRNWVNETSSKRVEDQLLPLLTHVARQGSTVDLQDVFFKFALDSIM

SLMFGRDLKYLCSELSTNQ

VAQAFDDAQEALLYRLGMPTLIWKLLRWLNVGREKKLAKAREIADLNIANCISVVRQELLRGVE THGLLSSYIRLSKTDDEFLRDTTLNFLVAGRDTIASVLSWFIWLTSRTPRVEAKILEKLRLVVSEK

KKREGSVDDDKKYWVFDPNDLRGLVYLHAACCESLRLYPPLPMNRKVVIKNDVLPDGNCVRP

GMQILVSTCALGRMPWM*GEDCLEFKPERWIREDGALDQEKLSKLPTFSIGPRACSGKD

ISISQMKLVVSTLLFNFHIQVVEGQSFSIRTTINLGMKNGLMVNIKER 581788

 

>CYP96L7P scaffold 163 1133367-1132849 (-)

34% to CYP96F1 Populus trichocarpa, 33% to JcCB0417811.10
88% to CYP96 maker-scaffold_58-snap-gene-11.24

KKTTAKSIFSTIQFRRFVNDTLQKVVDEKLLPLLARAAREVSTLDLHELIMRFTFDVINITISGKDLGGLYKDFP

SDVLSQAIDDDQEAILFRLSTPKPLWRLLQWLRVGPERKLAKAWETADGCIVDLILHEKEQLLKGIESEANSI

LSNYIRS*GENSNWSKARVMFLRVL

 

>CYP96L8P pseudogene augustus_masked-scaffold_100-processed-gene-19.3-mRNA-1

protein Name:"Similar to CYP86B1 Cytochrome P450 86B1 (Arabidopsis thaliana)" AED:0.08 eAED:0.09 QI:0|0|0|0.33|1|1|3|0|425

36% to CYP96D1 rice

7 aa deletion and frameshift at C-term

frameshift at N-term

68% TO CYP96L5P pseudogene snap_masked-scaffold_232-processed-gene-5.18
1923260 MAIMFLPLVDSGLGFQVLLAFLCLFFLTWYLKHKNPVILNLPLLGSL
LILARNIHRLNCCS &

1923076 (1) GLTIWLPCHPRNVEYILKTNASNFI

RGDSFREIFDILGDRILCADSDSWIEQRK TAHMCFKSMEFRKWVNETSLKEVGDYLLPLLTQAARKGCTVDLQDVFLRFTFNTTMNAVF GRDLKYLTSESPNTVAQGIDEAQEALTYRVLMPTLIWKLQRWLNVGAEKKLAKAREIAER FIEKCISVVRDDFLRGVEKYSLLTTYMKLSKTGDKFLRDTTLNVLVAGRETTASTITWFI WLTSRNPRVEEKIIEELRL

VVSEKKVAERDEGGVEEKKQ

PWVFHPNDLRGLVYLHAACCE TLRLYPSIPVTRRVVMKNDVLPDGSSVGSGMQILVSYYSLGRMPWLWGEDCLEFKPERWI NEDGTPNQEKVSKLFAFSISPRTCIGKDLALTQMKLVTATLLFNFHVQVAEGQSGSI &

MNNGLMVCIKERLN* 1921776

 

>CYP96L9P pseudogene

augustus_masked-scaffold_34-processed-gene-34.1-mRNA-1 protein Name:"Similar to CYP86B1 Cytochrome P450 86B1 (Arabidopsis thaliana)" AED:0.20 eAED:0.26 QI:0|0|0|0.5|1|1|2|0|385

38% to CYP86B1 Arabidopsis thaliana, missing N-term
84% to CYP96L3 augustus_masked-scaffold_254-processed-gene-4.1

3399643

SSAIDLQDLFLKYTF &

GKDLGCLEEGLLVSNVVATAVDDAQEAIISRVFTPSFYWKLLRLFKVGTEKKLAKAQEVADNAIYDIVWRK REEVLKGVESETNSLLSTYVRSQGEKADWSEVRVKFLRDMVLNFFIAGRDTTALGLLWFF WSLYRNPRVEAKILEELRHVVSHQKERKGEVIDDGDAVSVSKKRCMFDPDDLKNLLYLHA AFCETLRLFPPVPLNRKGVIKKDVLPDGSVVKPGMQVLLGVYSLARIPSVWGEDCSEFKP ERWIKEDGSLDNDMISKLLFAFGGGPRICIGRDMAFTNMKWTAVAILSNFHIQVADKDHP

VSLKSTVVLQINGGLMVHVKQRSLF

 

>CYP96L10P scaffold 34 3403232-3403056 (-)

35% to JcCB0417811.10, 36% to CYP96K1 Gossypium hirsutum
71% to CYP96 augustus_masked-scaffold_254-processed-gene-4.1
this seq extends the pseudogene below (upstream)

YVVFLAVVLFFLFRWFLERKQNNHVYSNWPFLVSVPVLFLNSHRIYELLTEAFIKLGSTSFYLKGLVLSNIDYLVT

CYP86 scaffold_34 minus strand near 34.1 but no model, C-helix

51% to CYP96E1 rice
84% to CYP96L3 augustus_masked-scaffold_254-processed-gene-4.1-mRNA-1
scaffold 34 3403055-3402879 (-)

3403055 CNPKNLEHIFKTNIANYPKGKNFMQIFDILGDGIFNADSESWQMQRKDAHSAFRSVGFR 3402879

 

>CYP96L11P scaffold 143 282209-282607 (+)

42% to JcCB0219671.10, 46% to CYP86F1 Physcomitrella patens
80% to CYP96 augustus_masked-scaffold_3-processed-gene-13.3

PQNFEYMLKVNIANYPKG*DFRQIFDILGQGIFNTNFESWET*RKDSRSAFRLIEFRSF (0)

ASSAMVHKLIDEKLLPLLANVAREVFVIDFQDLILKFTFDGIAIT

 

>CYP96L12P scaffold 286

44% to CYP86C Ricinus communis XM_002515007.1
35% to CYP86B1 Arabidopsis thaliana
69% to CYP96 augustus_masked-scaffold_3-processed-gene-13.3

197046-196888 (-) aa 1-53

MVFNEFATSISGYKFLVAVISVFFLRLYLFFKQKLKIQVIPKWPLLGSLPTVS

196847-196731 (-) aa 67-106

FLSLGTKTFSLKGLSKLDYVITCDPQNFEYMLKVNIANF

196726-196496 (-) aa 130-207

TWAT*RKASHSAFKLIEFWNFVSHTVYLEAN**KALTFVS*CG*KRVYLQDLILRFTFDSIAITTWGMDLGLIFQEL

 

>CYP96L13P scaffold 3 4760124-4759624 (-)

91% to CYP96 maker-scaffold_58-snap-gene-11.24

LNMDFFKKTTAKSIFSTIQFRRFVNDTLQKVVDEKLLPLLARAAREGSTLDLQELIMRFTFDVINNITISG

KDLGGLYEDFPSDVLLQAIDDGQEAILFRLSTTKPLWRLLRLLRVGRERKLAKAWETADGCIVDLILHKKEQLLK

GIESEANSILSNYIRSQGENS

 

>CYP96M1P pseudogene snap_masked-scaffold_2-processed-gene-71.8-mRNA-1

protein Name:"Similar to CYP86B1 Cytochrome P450 86B1 (Arabidopsis thaliana)" AED:0.16 eAED:0.16 QI:0|-1|0|1|-1|1|1|0|282

38% to CYP96E1 rice, mid to EXXR
72% to CYP96 maker-scaffold_2-snap-gene-71.15-mRNA-1a

7123226 EKFDILGDGLFNADFDKWSTQRKMAHSSFRSAQFRTFLADVTRKIVDDKLIPLLVDLAR

KGCCLDLKDVMSRFTFETTVATVYGRDLGYLSPEFPTNEFLQVVENAEEAMLYRFALPTF

VWKLMRWLKVGTEKKYSKAWATGDALSAEFISQTREELLQGVETNTTLAIYIKS

QKDVSDKLLRDNMLTFNIAGQSTTAASLSWFFWLVCKNPHVEAKILEELGFVFSEKMNKL

LQVKGILMRENEGYGGHGWCLMKVMSGLVYLHAAFCETLRLYPPVKFNTRGVLKEDVLPD

GSVV &

VVLSHYAVGRMPWIWGEDCLEFKHQR*IRDDGTLDLQKIMSNLFAFSTGTRTCVGREMAF

TQMKLAAATLLFNFHVELVDEVLPVSKKPSIICQMKHGLMVKIQERPPWGSVNY* 7121968

 

>CYP96M2 maker-scaffold_2-snap-gene-71.15-mRNA-1b

39% to CYP96F1 Populus trichocarpa, almost complete, fused
53% to augustus_masked-scaffold_3-processed-gene-13.3

7101681 MELVIFFIACVCSSYLIWYLKHRNQVLLQW

PLFGSIPSVVLNMHKINDWIAGIFLSLG TGSFNIKGPKLSKLHYLVTTDPDNLKYILKTNFANFPKGPEFHQKFDILGGGIFNADFDS WAKQREMAHSCFRSSEFRSFLADTTKKVVEDRLVPLLDHVTRQGSSIDLQDVFSRFTFDT SVIAVFGRDLGHLSPDLPTNKFVQAVDDAQEAILYRFAVPTLVWKSMRWLKVGRERKYIE SWKTLDIILAEYISQTKEELRKGVDRNTVLSTYIKSQEDSEQGRWQSGDHLSSVANNGDK FLRDSMLTFTLAGRDTTTAGLSWFFWLICKNPHVEEKILDELRLSFSKKATGRSSSGEKM WPWVFDKSDLKGLVYFHAAFCESLRLYPPLPLNSKGVVKEDVLPDGNVVRPGMEMILSQY AVGRMPWIWGEDCLEFKPERWIREDGTLDLQPMSKFFAFSAGPRSCIGKQMAFTQMKLAA AAILFNFHVHLVEGQSITIKPTLVCLMKNGLMVKLKQRTPWD* 7100119

 

>CYP96M3 maker-scaffold_2-snap-gene-71.15-mRNA-1a protein Name:"Similar to CYP86B1 Cytochrome P450 86B1 (Arabidopsis thaliana)" AED:0.02 eAED:0.02 QI:0|0|0|1|0|0|2|0|1002

42% to CYP96B2 rice, complete, fused
72% to CYP96 pseudogene snap_masked-scaffold_2-processed-gene-71.8

7110964 MELLSQVLLSCVFYFILTWYVKHKNQRQLVLHWPLIGVLPQLVLNMHNINVWLADVFVSL RTRTIHLKGPVFSKLEYLVTCDPENLRYVLKTNFTNFPKGPEFNEKFDVLGDGIFNADFD SWSTQREMAHSCFRSAEFRAFLADITRKIVQDKLIPLLILMASKGSSFDLQDVLSRFTFE TTIAATYGRDSGYLSPEFPTNEFVEAVDNAEEAILYRFAVPAFVWKLMRWLKVGREKKYA EAWATADAFLGEFISQTREELLQGVETNTILAIYIKSPKQISDKFLRDSMLTFNLAGRDT TTVGLSWFFWLVCKNPHVEAKILEELGVVFSAKMNKAAAAGDEGNIQTRVWPWVFDEGDV KGLVYLHAAFCESLRLYPPVPLNSKGVLKEDTLPDGSVVRPGMQIILSHYAVGRMPWIWG DNCLEFKPERWIRDDGTLDLQLMSNLFAFSNGPRTCVGKQMAFTQMKLAAATLLFNFHIE LVEGQSVSIKPSLVSLMNPGLMVRVKERGRVGR* 7109423

 

>CYP96M4 augustus_masked-scaffold_151-processed-gene-11.0-mRNA-1 protein Name:"Similar to CYP86B1 Cytochrome P450 86B1 (Arabidopsis thaliana)" AED:0.01 eAED:0.01 QI:0|-1|0|1|-1|1|1|0|507

39% to CYP96A1 Arabidopsis thaliana complete
55% to maker-scaffold_2-snap-gene-71.15-mRNA-1a

MELSFIGYEAFSLVLLLFISMIWYIQHRKEVLTQWPLLGSFPSLLHHIHHVNEWSVEVFL KHCTGSVVLKGPIYSKLEYLATCHPNNLEYMLKSNFVNYPKGPDYKEKLDILGDGIFNID FGLWLEQRKIAHSCFRSYDFRSFIADTNRKVIGDKLVPLVAHMARQGCTFDLQDLFLRFT FDTIMIILFGRDPECVSLKFHPNKYAQAMDDALEAALYRFAMPNSLWKFMRLLKIGTEKK LADAWETLDLMMSESISLTREDILKGVEGHNLLYMYLKSQRVERNDLSKSGEKFVRDNML NFIFAGRDTTASGLSWFFWLVAKHPHVEAKILQELRLACMKKVRNKWPCVFDSDDLRSLT YLHAAVCESLRLYPPLPLNSKGAVKEEILPDGSITRPGMQIILCFYAVARMPWVWGDDCS EFKPERWISEDGTLDNQQMSKFFTFSLGPRTCIGKETAINQIKLTAAALLYNFHVQVLDS QSVSIKPSLVLHMKNGLLVNIKERVNW

 

>CYP96N1 augustus_masked-scaffold_56-processed-gene-25.1-mRNA-1 protein Name:"Similar to CYP86B1 Cytochrome P450 86B1 (Arabidopsis thaliana)" AED:0.02 eAED:0.02 QI:0|-1|0|1|-1|1|1|0|529

42% to CYP96B2 rice, complete
52% to maker-scaffold_2-snap-gene-71.15-mRNA-1a

MRFMLMLTTFIGCWYPLKRWPETLVAISLCFLSLICYLNHRNKKQLILINWPFLGTLPLV LRNIHRLNEWWTEVFNSLGSSSFYIRVPPFSTPKYLLTCHPSNLDHILRTNFSNYPKGRD FTEIFDILGDGIFSTDETWHAQRKIANLRFTSRKFRDIVAKLSRKVVSDELLPLLAHVAT QESAIDLQDVFLRFTVDSIGRIIFGRDVSSLSTDLPIDELATAFEDAQKAIQYRQVMPTW VWKLLRWLRVGRERKLAEAAKTADTLIGKYILLKREELVKGVEGNDLLSMYMSVQGEMND DFFKSDKFLRDNMLNFVIAGRDTTASGLTWFFWLISKTPRAEAKILEELELVFSKKKESR EGELDTGAKQMWVFDSDDLRGLVYLHAALCETERLYPAVPVIQKGIIREDALPDGTIARP GMLILLSVYAMGRMAWIWGENCLEFKPERWIDDEGKLKHEATSKLAAFGFGPRTCLGKDM AFTQMKMAAAAILFNFHVEVVEGHPVSIKRSTVLQMNDGLKVKMKKRAH

 

>CYP96P1 augustus_masked-scaffold_2-processed-gene-31.1-mRNA-1 protein Name:"Similar to CYP86B1 Cytochrome P450 86B1 (Arabidopsis thaliana)" AED:0.02 eAED:0.02 QI:0|-1|0|1|-1|1|1|0|525

40% to CYP96A1 Arabidopsis thaliana, complete
61% to snap_masked-scaffold_2-processed-gene-32.4
61% to augustus_masked-scaffold_170-processed-gene-8.1

MELQTILTFLSRNLNRWPEFLLALVCFLSIRWYRKHKNEISLRWPILDVLPTLLLNAHRI HSWTVEIANKFGSTIEGRGPVFGRLDILFTCDPRNVEYMLKTNFANFPKGPELIEAFNIL GDGIFNVDYDLWREQRRMANVNFASKDFRNFVARVSRTVVEDGLLPLLVHAAKHESVVDL EDVFMRFAFDNMFMVVFGRNSNHLSVNLPPNELAEAIDDGTEGVFYRHVMPKLWWKVLGW LKLGSEKKLADARKTIDRILSEQVALKKEELRRGEHGSDLITMYITALSKGRHNIKQLST AKDDDVFLRDTALSFLFAGRDTTGTSLSWFFWFVSTNPRVEAKILEELNDVMSRKKNEKN GMSRVEGPLVFDPEDLKELVYLHAALCESLRLCPPLPITRRGVVRKDVLPDGTVVKPGMQ ILISMYAMGRMDYVWGKDYGEYKPERWIDADGKLNQETLSKLFSFIVGPRSCPGKNMAFT QMKAAAATVLFNFHIEVLNGHDIFPMPSMVLHTKNGLVVKVTERV

 

>CYP96P2 snap_masked-scaffold_2-processed-gene-32.4-mRNA-1 protein Name:"Similar to CYP86B1 Cytochrome P450 86B1 (Arabidopsis thaliana)" AED:0.02 eAED:0.03 QI:0|-1|0|1|-1|1|1|0|526

40% to CYP96B2 rice, complete

augustus_masked-scaffold_170-processed-gene-8.1

MEFETLLALIGTQLIKIWPELSVAIFCLLSLRWYHTHKNEVLMHWPILDVYPSILANVHR IHHWIVDIANKISCTIVARGPVFGRLDVVLTSDPRNVDYILKTNFSNFPKGPQLKEAFDL LGDGIFNVDDDKWRLQKRLAHVALVSKEFRNFTGAVTRKLVQDALLPIMLHAAKHGTILD LEDLFMRFAFDSVFTAIFGRSPNSLSLSSPSNELAEAIDDGTEGIFYRHVMPRGLWKLLG WLKVGSERKMIEARKTIDHHLLQHISFKKEEMREGIQSSDLIAMYLTTQAQRGETSIHSE EFLRDTSLSFLFAGRDSTGTSLAWFLWLVSTTPHVEAKILEELKQVKKRKEDPEGLGARG TAEPAEWPWVFDSEDLKELVYLHAAMCESLRLNPPLPLTRRGVVKEDVLPDGTTVRPGQK ILISMYAMGRLEWLWGKDYQEFKPERWVDDKGRISQDAMSKFYPFTVGPRACPGRNMAFT QMKSAAAAVLFNFCIEVVEGQIVNPMSSIVLHMKNGVRVRIKQRVW

 

>CYP96P3 augustus_masked-scaffold_170-processed-gene-8.1-mRNA-1 protein Name:"Similar to CYP86B1 Cytochrome P450 86B1 (Arabidopsis thaliana)" AED:0.02 eAED:0.03 QI:0|-1|0|1|-1|1|1|0|520

40% to CYP96B2 rice, complete
54% to DR944473.1 Aquilegia, 51% to DR932492 Aquilegia
72% to snap_masked-scaffold_2-processed-gene-32.4

MGFHTTLTFFKSDFIDVWLELCLALICLLFVTWYQKNKNQILMYWPILDVYPSILANVHR VHHWIVDIANKINCTIEARGPVFARMDVILTSDPRNVEYILKSNFANFPKGPDLKEALDL LGDDIFTLDDDEWRAHKKIAHIVLASKEFRSFTASVSRKLVGDGLLSLMLQAAKHGNVLD LEDVFMRFAFDSVYTAVLGRNPNSLSLSSAANEIAKAIDDGTEGVFHRHIMPRKLWKLLG WLGVGSEGRLARARKIIDRHLLEHISLKREDLRKGVQGSDLIAMYMSSQAQNGESKAYSD LFLRDTALGFLFAGRDSTGTSLTWFLWLVSTTPRVEEKILDELMQLKKKKEAEGVVRDQK QPWVFDSEDLKDLVYFHAAMCESLRLNPPLPLTRRGVIKEDVLPDGTAVKPGMKIIISMY ALGRLEWLWGKDYLEFKPERWIDQDGKISQEAMSKFFPFTIGPRACPGRNMAFTQMKLAA AAVLFNFRIEVLEGQIVFPMSSIVLHMKNGLKVKIRERVW

 

>CYP96P4P scaffold 3

33% to CYP96D1 rice, 31% to CYP86B XM_002523729.1 Ricinus communis

6490041-6490784 (+)

93% to CYP96P2 augustus_masked-scaffold_170-processed-gene-8.1

MLGDDIFTLDDDEWRAHKKIAHIVLASKEFRSFTVSMSRKLVGDGLLSLMLQAAKHGNVLDLEDVFMRFAFDGVY

TAVLDRNPNLLSLSSAANEITKSIDDETEGVFHRHIMPRKL*KLLGWLGIGSEGRLARARKIINRHLLEHISLKR

EKLHKGVQGSDLIAMYMSSQAQNGESKAYSDLFLRDTALGFLFARRDSMGTSLTWFLWSVSTTPRVEEKI

LDGLMQLKKKEAEGVVRDQKQPWVFDSE &

6490784-6490897 (+)

DLKDLVYFHAAMCESLRLNPPLPLTRRAVIKEDVLPDA

 

>CYP96P5P scaffold 23 4881670-4882584 (+) psseudogene

47% to DR944473.1 Aquilegia

49% to DR932492 Aquilegia DT753668.1, DT769282, DT753125
39% to CYP96A17 Populus trichocarpa
36% to CYP86 clan JcCB0188881.10 

36% to CYP96B2 rice

32% to CYP86B XM_002523729.1 Ricinus communis, 36% to CYP96B2 rice
92% to CYP96 augustus_masked-scaffold_170-processed-gene-8.1
no gene model, adjacent to NNU_009493

MLGDDIFTLDDDEWQAHKKIAHIVLASKEFRSFMASVSKKLVGDGLLSLMLQAAKHG

NILDLEDVFMKFAFNSAYTTVLGRNPNLLSLSSATNEIAKAIDNGTEGVFHRHIMPRKLWKLLGWLGVGSEGRLA

RAQQIINHHLLEHISLKREEMRKGVQGSDLIAMYMSSQAQNGESKAYSDLFLRDIALGFLFAGRDSTGTS

LTWFLWLVSTTPRMEEKILDELMRLKKKKEAEGVVRDQKQPWVFDSEDLKDLVYFHAAMCESLRLNPPLPLTRRG

VIKEDVPPD
 

>CYP96P6Pa scaffold 239a 399712-399404 (-) two seqs concatenated

90% to CYP96 augustus_masked-scaffold_170-processed-gene-8.1
55% to DR932492 Aquilegia

LIAMYMSSQAQNGESKAYSDLFLRDTALGFLFAGRDLAGTSLT*FLWLVSTTPCVEKKILDELIQLKKKKE

AESVVRDQKQP*VFDSEDVKDLVYFHATMCESLRLNPPLPLTRRRVS

 

>CYP96P6Pb scaffold 239b 400189-399404 (-)

34% to CYP96B2

89% to CYP96 augustus_masked-scaffold_170-processed-gene-8.1
48% to DR944473.1 Aquilegia

MLGYVIFTLDDDEW*AHKKIAHIVLASKEFRSFTASVRRKLVDDGLLSLMLQAASNVLDLEDVFIRFAFDSAY

TAVLGRNPNSLSLSSAANEIGKAIDDGTEGVFHRHFISRKLWKLLGRLGVGSEGRLASARKIINRHLLEHISLKR

E*LRKGV*GSD

LIAMYMSSQAQNGESKAYSDLFLRDTALGFLFAGRDLAGTSLT*FLWLVSTTPCVEKKI

LDELIQLKKKKEAESVVRDQKQP*VFDSEDVKDLVYFHATMCESLRLNPPLPLTRR

 

>CYP96P7P scaffold 15

35% to CYP96 JcCB0570151.10, 32% to CYP96B2 rice
93% to CYP96 augustus_masked-scaffold_170-processed-gene-8.1

1757401-1758048 (+)

ICSEMISSLDDDEWRAHKKITHIVLASKEFRSFTASVSRKLVGDGLLSLMLQAAKHGNVLDLEDVFMRFAFNSVY

TVVLGRNPNSFSLSSAAYEIAKAIDDGTEGVFHRHIMPRKLWKLLGWLGVGSEGRLGRARKIIDRHLLEHISLKR

EELRKGVQGSDLIAMYTSSQAQNGESKAYSGMFLRDTALGFLFAGRDSTGTSLTWFLWLVSTTPRM

1758113-1758238 (+)

VFDSEDLKDLVYFHAAMCESLRLNLPLPLTRRGVIKEDVLPD

 

>CYP96P8P scaffold 37

34% to CYP96 JcCB0570151.10, 32% to CYP96H1 Populus trichocarp
88% to CYP96 augustus_masked-scaffold_170-processed-gene-8.1

310663-311187 (+)

RKLVGDGLLSLMLQAAKHGNVLDLEDLFMRFVFDSAYMIVLGRNPNSLSLSSAANEIAKAIDDRTEGVFHRHIMP

RKLLGWLVVGSEGRLARARKIINRHLLEHISLKREELHKGVQGSDLIAMYMSSQAQNGESKAYSDLS

LRDTALGFLFVGRDLTGTSLTWFLWLVSTPPRV

311252-311389 (+)

QPWVFDSEDLKDLVYFHAAMCESLRLNPPLPLTRRGVVKEDVLPDA

 

>CYP96P9 DR944473.1 Aquilegia
DT754699, DT742532.1, DT748890

68% to DR932492 Aquilegia

57% to CYP96 augustus_masked-scaffold_2-processed-gene-31.1
44% to CYP96A18 Vitis vinifera

MDFQWFCQFERWPEFVLAILSFFSIRWYVNHNNSVFMRWPVLDVLPSLLQNVHRVHEWTV

EISNMVGSTIVGRGPIFGRSEMLFTCDPRNVEYMVRTNFSNYPKGSEFLETFDLIGEGIF NIDFEAWHAQRRMAHTLFTSKEFRSYIANVNRNLVQNALVPLLTHSSKNSSVLDFEDVFL RYAFDSIFTVIFGKSSNCLALNATSNEFSNAIDDGTEAMFFRNVIPSPLWKVLRFFRMGT ERKLAEAQKTIDFHLKEYISEKKDELSKGIEGKDLLAAYMKMQAQKEELSSKGDKYLRDT ALSFLFAGRDSSGTSLTWFFWLLSKSPRVEEIILEELRSVYLKKNANSENSHKLKGPWVFDADELKGLV

YLHAALSEVLRLYPPLPMNRKISVKEDILPDGTVMKPGTKILFSMYAMARMEWVWGKDCA

EFKPERWIDADGKLSHDPMSKFFVFNAGPRTCIGKDMAFTQMKLAAAAVLFNFHVEVVEG

QEVLPKPSLVLHTRNGLLVRVKERENLY*

 
>CYP96P10 DR932492 Aquilegia
DT753668.1, DT769282, DT753125
44% to CYP96A30 CAAP02000428.1c Vitis, 
43% to CYP96A18 Vitis vinifera
71% to DR944473.1   Aquilegia
55% to augustus_masked-scaffold_2-processed-gene-31.1
MDFLYVLSLFFHFKKLWPELLL ACFSFFAIRWYVNHKRNVFITRYPILDLLPSLLQNLDRVHDWTVDVSNFLGCTLVGSLPF YRSQFYRYGSVDILYTCNPRNVEYMVKTNFSNYPKGVEFLEVFNLIGNGIFNVDFEPWHA QRRMAHSLLTSKEFRNYISNVNQNLVQNALLPLLTLSAKKSSVVDLENVFLRYAFDSIFT

VIFGKSSNCLSLNGESNAFEKAIDDGTEATFFRNIMPAPLWKLMRFLRVGTEKQLAEAQE

TIDFHLSQYISTKRDELLNGNNDQKDLLATYMKSEALKDSLSSDKNDKFLKDTAFSFLFAGRDTS GTSLTWFFWLIAKTPRVEEKILE ELNSVFTKKRNCENNLNVQGPWVFDSEDLKGLVYLHA ALCETLRLYPPIPLNRKSSLNKDVLPDGTVVKPRTLILFSMYAMARMEWVWGKDCSEFKP ERWIDADGKLSHENMSKFFVFNRGPRTCVGKDMAFTQIKLAA AAVIFNFHVEVVEGHEVVPKPSLALHTKNGLLVKLKERVHVY*

 

>CYP96Q1 augustus_masked-scaffold_165-processed-gene-5.2-mRNA-1 protein Name:"Similar to CYP86B1 Cytochrome P450 86B1 (Arabidopsis thaliana)" AED:0.02 eAED:0.02 QI:0|-1|0|1|-1|1|1|0|520

44% to CYP96B2 rice, complete
63% to augustus_masked-scaffold_165-processed-gene-5.1

MIFSFILAYLEHLSKRWPEVCLASFLGYLSLRCYLTYKTQIIANWPIVGGLPYLLKNVYR LHEWSAELSTIGTSYLFKGPLLGRQELLLTCDPRNVEYILKTNFSNFPKGPEYLETLEVL GQGIFSVDSDSWHQQRKMANKAFGAKDFRSSIATMSQKVVEDKLLPLLKHLQAQVCTIDL QDVLLRYSFDSSCAIILGEIPGSLSPSLSSNEFSQAIDDAREVIFFRNVMPRRWWKLLRS LRMGREREVARILKTLDQYMAHYISSKREDLLRGVEANDLLATYMKFHEDRNDMSLNGDK FLRDTVLNFIFAGRDTVASGLTMFFWLVSKNPRVEKKIMEELRILHAKNVADSSRLMKPN EPCIYRLEDLRSLVYLQAALYESMRLYPPVPLNRKGVLKEDVLPDGNVVRPGMQITFSIY AMGRMQSIWGEDCLEFKPERWFGDDGKLLSESKFKYFVFNIGPRTCIGKDMAITQMKLAV AAILFNFHVEVLDGQSASPKPSTILQLKNGLMVKIKHRVA

 

>CYP96Q2 augustus_masked-scaffold_165-processed-gene-5.1-mRNA-1 protein Name:"Similar to CYP86B1 Cytochrome P450 86B1 (Arabidopsis thaliana)" AED:0.02 eAED:0.02 QI:0|-1|0|1|-1|1|1|0|522

42% to 96A16v2 Populus trichocarpa, complete
63% to augustus_masked-scaffold_165-processed-gene-5.2

MIFPSILASLEYHFRGWPELSLAFLCYLCIRWYLNFKNQVLANFPIVGALPYILKNFHRL HDWYTELASKVGYSYLFKGPIFGGQMIFLTCDPRNVEYILKKNFSNFPKGQKFLETLQVL GQGIISVETETWHHQRKLASKMFAAKEFRSFAAFASQKLVEDALLPTLDHVHAQASVIDL QNLFLRYAFDSSCAIILGRSPGFLSPSFPSNEFSEAMDVAREIIFNRNMMPSRWWKLLRW LGIGAERKVPGAIKAMDRYTSHYVSLMREDLQRGVEANCLLAIYMNSQEERKDALLDEDE FLKDTSLALVYAGRDTVASGLTYFFYLISKTPRVENKLLEELRLLRAIKNTKRNGCGRKH VDGVEMFDLEELRELTYLEAALYESMRLYPPSPLNLKSVLQEDVLPDGSVVRPGMQIIYS TYAMGRLKSIWGEDCLEFKPERWLDDNGHLKAEAKLKFFGFSIGPRNCIGKEMAFAQMKP AAAAMLFNFQVQVLEGQSISPKPSTVLQLKHGLKARITRRIS

 

CYP97 family (3 genes, 1 pseudogene)

 

>CYP97A31a maker-scaffold_35-augustus-gene-19.17-mRNA-1 protein Name:"Similar to CYP97B2 Cytochrome P450 97B2, chloroplastic (Glycine max)" AED:0.11 eAED:0.11 QI:277|0.93|0.93|1|0.93|1|16|568|644

82% to CYP97A3 Arabidopsis thaliana complete

MAANLSLLQVASVPTKSFQTKLHAKRLRPTTTTSTYPTRLNVPVAGTSCYSTITCSSSNG RKPNSGGDGVKSVERLLEEKKRADLYARIASGEFTVQKS

GFLSLLRNGLSKLGVPREFLGFLSKWTDDPEENPKIPEAKGAIKAIRGQAFFIPLYELYLTYGGIFRLTFGPK

SFLIVSDPSIAKHILRDNSKAYSKGILAEILDFVMGKGLIPADGEIWRVRRRAIIPALHQKYVAAMIS LFGQAADRLCKKLDAAASDGEDVEMESLFSRLTLDIIGKAVFNYDFDSLTNDTGIVEAVY TVLREAEDRSVSPIPFWDIPIWKDLSPRQKKVRVALKLINNTLDDLIAICKRMVEKEDLQ FHEEYMNEQDPSILHFLLASGDDVSSKQLRDDLMTMLIAGHETSAAVLTWTFYLLSKNPS VMSKLQNEVDSVLGDRVPTIDDMKKLKYATRVINESLRLYPQPPVLIRRSLEDDMLGKYP IKRGEDIFISVWNLHRCPNHWTDAEKFNPERWPLDGPNPNEINQNFSYLPFGGGPRKCVG DMFASFETVVVLAMLARHFNFQIAPGSPPVEMTTGATIHTTEGLRMTVTRRIKPPIIPTL ERSVVEVDGNNPLKEPSQTMVSSLSISGMDQQLDQPNQVSPAHS

 

>CYP97A31b maker-scaffold_232-augustus-gene-6.31-mRNA-1 protein Name:"Similar to CYP97B3 Cytochrome P450 97B3, chloroplastic (Arabidopsis thaliana)" AED:0.16 eAED:0.17 QI:0|0.83|0.71|0.85|1|0.85|7|0|346

76% to CYP97A3 Arabidopsis thaliana 

CYP97A maker-scaffold_232-augustus-gene-6.31

finished 80% to 97A3 complete

86% to CYP97A maker-scaffold_35-augustus-gene-19.17 (ohnologs)
86% to 97A3
751001-751150 (+) 1-50

MAANLSLLQLPSVPTHSLQSRIRAKKLKHTTTTFTYSTRPNGFVNHPSCS (0)

 

751245 SYSNGQSPDSVDDGVKKVKRILEEKKRAELSARIASGEFTV

RKSFLSVLRNGLSKLGVPTELLDFLSKWNNVSEGQPKIPEAKGAMKAIGGQAFFIPLYELYLTYGGIFR LTFGPKSFLIVSDPSIAKHILRENSKAYSKGILAEILDFVMGKGLIPADGEIWRVRRRAI VPALHQKYVTAMISLFGQATERLCKKLDAAASDGEDVEMESFFSRLTLDIIGKAVFNYDF DSLTNDTGIVEAVYTVLREAEDRSVAPIPFWEIPIWKDISPRQRKVSAALKLINDTLDDLIAICK 753099

 

767662-767967 (+) 351-416

RMVEQEELQFHEEYMNEQDPSILHFLLASGDD (0)

VSSKQLRDDLMTMLIAGHETSAAVLTWTFYLLST (0)

EPSVMSKLQND (2)

771376-771678 (+) 429-483

SVDSVLGDRFPTIDDMKKLKYATRVINE (0)

SLRLYPQPPVLIRRSLEDDMLGGYPIKR (2)

776512-776640 (+) 484-526

GEDIFISVWNLHRCPDHWVEADKFNPERWPLDGPNPNEINQDFS (2)

782985-783113 (+) 506-547

YLPFGGGPRKCVGDMFASFE (0)

784707-784772 (+) 548-561

TVVALSMLVRRFNFQIAVGAPP (0)

784882-785112 (+) 570-644

VEMTTGATIHTTEGLKMTVTRRTKPPIIPTLVTSVVKGDDSSPLKEP

SPTMASSSMGILEADQQYDQQGQISPAHS*

 

>CYP97A32P scaffold 16  48371-48685 (+) 1-101

79% to CYP97A Lotus, 49% to CYP97A3 N-term

MDANLSLLQVPSVPTKSFQAKLQAKRLRPTTTTSTYPTRQNGIMNVPIAGSSRYSTITCSSSNGRKLDSGDDGVK

SVEQLLKEKKRVELYA*IASGKFTVQKSGY

 

>CYP97A33P scaffold 192 402348-402223 (-) 234-275

75% to maker-scaffold_232-augustus-gene-6.31
62% to CYP97A3

YVEAMISLF*QPTDRLCKKLDADASDGVDVERWSRFSCLTTN

 

>CYP97B contig_12339 2029-2917 (-) strand

          Length = 11421

2917 RCQSTSTEEPKTRRNLLDNASNLLTNLLSGGSMGTMPIAEGAVSDLFGRPLF 2762

2761 FSLYDWFLE (0)

2136 HGSVYKLAFGPKSFVVVSDPIVARHILRENAFSYDK 2029

 

>CYP97B contig_12333 19155-19238 (-) strand

Length = 33511

19238 GVLADILEPIMGKGLIPADLDTWKQRRR 19155

 

>CYP97B contig_12332 13402-23712 (-) strand

          Length = 35673

75% to CYP97B3 Arabidopsis thaliana

mid region to aa 432

23712 CSQRTISKFEKLFERENLPEEIVLDLEAEFSSLALDII 23539

23538 GLGVFNYDFGSVTKESPVIK (0) 23479

23174 AVYGTLFEAEHRSTFYIPYWKLPLARWVVPRQRKFQNDLKVINDCLDGLISNAKKTRE () 23001

16376 ETDVEKLQQRDYLNLK (0)

      DASLLRFLVDMRGADVDDRQ (0) 16188

15642 LRDDLMTMLIAGHETTAAVLTWAVFLLAQ

15444 NPSKMKKAQEEIDSVLGQRTITFECLKKLE (2?)

13495 YIRLIIVEALRLYPQPPLLIRRSLVPDVLPG 13403

 

>CYP97B contig_12327a C-term (-) strand

          Length = 45181

1925414 43582 GYKGDKEGYPIPAGTDLF (0) 43526 1925361

1920560 38728 VYNLHRSPYFWDRPHEFEPERFLVPRKSEGIEGWAGFDPCRSAGALYPNE (0) 38579 1920411

1920325 38493 IISDFAFLPFGGGPRKCVGDQFALMESTVALVLLLQKFTVELKGSPESVELVTGA 38329

38328 TIHTKSGLWCKLRKRAS 38278 1920110

 

>CYP97B25-de13b14b contig_12327b C-term second copy (+) strand

79% to 97B3

1914374 32542 VYNLHRSPYFWDRPHEFEPERFLVPRKSEGIEGWAGFDPSRSAAALYPNE (0) 32691 1914523

1914588 32756 IISDFAFLPFGGGPHKCVGDQFALMESTVALALWLQKFTVELKGSPESVELVTGA 32920

32921 TIHTKSGLWCKLRKRASxxxxxxxxxx 32971 1914803

 

>CYP97B25 whole assembly

scaffold 25 1920080-2027475 (-) strand

79% to CYP97B3 Arabidopsis thaliana
missing the first exon (possibly in a seq. gap)
no gene model, closest feature in genome = NNU_009850

 2941  (2) CQSTSTEEPKTRRNLLDNASNLLTNLLSGGSMGTMPIAEGAVSDLFGRPLF 2762

 2761 FSLYDWFLE (0) 2027475-2027296

 2136 HGSVYKLAFGPKSFVVVSDPIVARHILRENAFSYDK (0) 2029 2026697-2026590

19238 GVLADILEPIMGKGLIPADLDTWKQRRR (1) 19155

23712 VIAPGFHASFLEAMVRIFTDCSQRTISKFEKLFERENLPEEIVLDLEAEFSSLALDII 23539

23538 GLGVFNYDFGSVTKESPVIK (0) 23479

23174 AVYGTLFEAEHRSTFYIPYWKLPLARWVVPRQRKFQNDLKVINDCLDGLISNAKKTRE (0) 23001

16376 ETDVEKLQQRDYLNLK (0)

      DASLLRFLVDMRGADVDDRQ (0) 16188

15642 LRDDLMTMLIAGHETTAAVLTWAVFLLAQ (0)

15444 NPSKMKKAQEEIDSVLGQRTITFECLKKLE (2)

13495 YIRLIIVEALRLYPQPPLLIRRSLVPDVLP (1) 13406 1952453-1952361

43585 GGYKGDKEGYPIPAGTDLF (0) 43526

38728 VYNLHRSPYFWDRPHEFEPERFLVPRKSEGIEGWAGFDPCRSAGALYPNE (0) 38579

38493 IISDFAFLPFGGGPRKCVGDQFALMESTVALVLLLQKFTVELKGSPESVELVTGA 38329

38328 TIHTKSGLWCKLRKRASTVCDNVKHG* 38248 1920325-1920080

 

>CYP97C21 maker-scaffold_153-augustus-gene-6.28-mRNA-1 protein Name:"Similar to CYP97B3 Cytochrome P450 97B3, chloroplastic (Arabidopsis thaliana)" AED:0.02 eAED:0.03 QI:0|0.75|0.6|0.8|0.75|0.8|5|0|373

78% to CYP97C1 Arabidopsis thaliana, 
yellow region not conserved in any frame
NNU_022493
629727

MVSSVSLTSLSPCTNPIQQHLHKPIFLCSRNPPHLLSIKSSAERDSTSSSNSNQKLSSNG

SWVSPDWLTSLTRPLSIGRDDSGIPIANAKLEDVSDLLGGALFLPLFKWMNEYGPIYRLA AGPRNFVIVSDPAIAKHVLRNYGKYAKGLVSEVSEFLFGSGFAIAEGPLWT (0)

VRRRAVVPSLHKKYLSIIVDRVFCKCAERLVE

KLKPDALSGAAVNMEAKFS

QLTLDVIGLAVFNHNFDSLTADSPVIDAVYTALKEAEARSTDLLPYWK (0)

IRALCKIIPRQIKAEKAVTVIRRTVEELIVKCKEIVEAEGELIDGEEYVNDTDPSILRFLLASREE (0)

VSSQQLRDDLLSMLVAGHETTGSVLTWTLYLLS ()

DKSSLTKAQDEVDKVLQGRPPTYEDIKELKYLTRCINESLRLYPHPP (00

VLIRRAQVADVLPGNYKVNAGQDIMISVYNIHHSSQ (0)

VWERAEEFVPERFDLEGPVPNETNTDFR (2)

FIPFSGGPRKCVGDQFALLEAIVALAIFLQHFDFDLVPDQKISMTTGATIHTTN (0)

GLYMKLSQRKTQPALVSSSR* 649740

 

>CYP97C22P

scaffold 47 239-307 3793667-3793461 (-)

76% to CYP97C maker-scaffold_153-augustus-gene-6.28 (ohnologs)
52% TO 97C1

NNU_014066 maker-scaffold_47-snap-gene-38.26

SIVLDDSEIPTANAELEDMSDLLGCAPFPRFVQIGE

NNU_014065 maker-scaffold_47-snap-gene-38.27
MEFFCKCAEGLVEKLKPDAVSGTKVNMEAKFSQLT*DVMGLA

VFNCNYDSLTANGLVIDEAYTALKEAE

NNU_014064 maker-scaffold_47-snap-gene-38.28

RKNKAEKAITIIRRTIEELITKCKEIAEAKGELIDEEEYVNE

 

CYP98 family (1 gene, 0 pseudogenes)

 

>CYP98A62 maker-scaffold_200-augustus-gene-3.31-mRNA-1 protein Name:"Similar to CYP98A2 Cytochrome P450 98A2 (Glycine max)" AED:0.04 eAED:0.04 QI:345|1|1|1|1|1|3|197|508

79% to CYP98A3 Arabidopsis thaliana complete

MDLSIFLSSILFISLAYKLYQRLRFKLPPGPRPWPIVGNLYDIKPVRFRCFHEWSQTYGP IISVWFGSTLNVIVSNSELAKEVLKENDQQLADRHRSRSAAKFSREGKDLIWADYGPHYV KVRKVCTLELFTPKRLEALRPIREDEVTAMVESIFRDCTTPDNQGKSILVKKYLGTVAFN NITRLVFGKRFVNAEGIIEEQGKEFKAIVSNGLKLGASLAMAEHIPWLRWMFPLDEAAFA KHGARRDRLTRAIMEEHTVARQRSGNTKEHFVDALLTLQEKYDLSDDTVIGLLWDMITAG MDTTAISVEWAMAEVIKNPRVQQKAQEELDRVVGSDRVLTEADFPNLPYLQCVAKEALRL HPPTPLMLPHKANANVKIGGYDIPKGSNVHVNVWAIARDPAVWKEPLEFRPERFLEEDVD MKGHDFRLLPFGAGRRVCAGAQLGINLTTSMLGHLLHHFHWTPLQGVKAEEMDMSENPGL VAYMATSLQAVPTPRLPSHLYKRVAVDM

 

CYP701 family (1 gene, 1 pseudogene)

 

>CYP701A32 maker-scaffold_13-augustus-gene-75.11-mRNA-1 protein Name:"Similar to KO1 Ent-kaurene oxidase, chloroplastic (Arabidopsis thaliana)" AED:0.07 eAED:0.07 QI:0|0.85|0.75|1|1|1|8|295|556
64% to CYP701A3 Arabidopsis thaliana
TGKIGPTAHKPEDLDRFLSLSHCINCIAYPKLLYHYHSAIHFQLELLSHQLLLLSI 3UTR
MMITEAISDFPVMAYATVVGLGLVAVMFVVRLLSTQRRSSQYPPLPEVPGLPLIGNLLQLKEKK PHQTFTKWAEHYGPIYKIRAGSSTVVxxxxxxxxxxxAMVARFSSISTRKLSKALQILTFNKCMVATSDYD EFHKMVKRFILTGVLGANAQKRFRCHRDTMIENVCNCLLADVRKDPLQAVNFRKIFRNEL FGLALKQALGKDVESSIYVEDLGTRLSREDIFEVLVVDPMMGAIEVDWRDFFPYLRWVPN KSIEMKIQQMYVRRQAVIKALIEEQRKRISMGEEINCYLDFLSSEAKTLTDEQLLMLIWE TIIETSDTTLVTTEWAMYELAKDPMRQDRLYHEIKNICGSDKIAEEHLSQLPYLNAVFHE TLRRHTPVSIVPLRYVNEDTQLGGYHVPAGSEIAINIYGCNMDKNQWEEPELWKPERFLS SNYDPTDLYKTMAFGAGKRVCAGSLQATLISCTAIGRLIQDFEWXLQPGEEENVDTLGLT 
TTKLHPIQAIITPRDQ 

 

>CYP701A33P pseudogene

maker-scaffold_123-snap-gene-2.24

69% to CYP701A3   Arabidopsis thaliana

aa 376-469

225882 RHSPVPIVPLRNVNEDTQLGGYHVPAGSE 225968

IAINIYGCNMDKNQWEDPELWKPKRFLSSKYDPTDLYKTMAFGAGKRVCAGSLQATLISCTAIG 226251

 

>CYP701A34P pseudogene no gene model scaffold_123

identical to maker-scaffold_123-snap-gene-2.24

250391 LNVVFHETLRRHSPVPIVPLRNVNEDTQLGGYHVPAGSE 250507

 

CYP703 family (1 gene, 2 pseudogenes)

 

>CYP703A14a augustus_masked-scaffold_94-processed-gene-1.0-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.07 eAED:0.07 QI:0|1|0|1|1|1|2|0|522

75% to CYP703A2 Arabidopsis thaliana complete

MDLGTLASTLVYAFLFGTIVCLRLWLMKSLQSKGRLPPGPPRWPIFGNLLQLGPLPHRDF ASFCEKYGPLVYLRLGSVDAITTNDPEIIREILLRQDEVFASRPRTLAAVHLAYGCGDVA LAPLGPQWKRMRRICMEHLLSIKRLESFADHRAREAHHLVQDVYDRSQTGKPVNLRQVLG AFSMNNVTRMLLGKQYFGIESAGPQEAMEFMHITHELFWLLGLIYLGDYLPIWRWLDPFG CEKKMREVEKRVDEFHMKIIEEHRKGRERKKEKKGEDDDREMDFVDILLSLPGEQGKEHL EDAEIKALIQDMIAAATDTSSVTNEWAMAEVIKHPEVLGKVQEELDSVVGPNRMVSESDL AHLNYLRCIVRETFRMHPAGPFLIPHESIRPTKINGYDIPAKTRVFINTHALGRNTRIWN DIDEFRPERHLPADGSRVEISHGTDFKILPFSAGKRKCPGAPLGLTFVLMSLARLFHCFD WIPPEGLKPEDIDTTEVYGMTMPKAKPLMAIASPRLAKEMYC

 

>CYP703A14b snap_masked-scaffold_94-processed-gene-0.3-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.25 eAED:0.25 QI:0|0|0|0.5|1|1|2|0|178

73% to CYP703A2 Arabidopsis thaliana N-term
identical to CYP703A augustus_masked-scaffold_94-processed-gene-1.0-mRNA-1

probable assembly error

642 MDLGTLASTLVYAFLFGTIVCLRLWLMKSLQSKGRLPPGPPRWP IFGNLLQLGPLPHRDFASFCEKYGPLVYLRLGSVDAITTNDPEIIREILLRQDEVFASRP RTLAAVHLAYGCGDVALAPLGPQWKRMRRICMEHLLSIKRLESFADHRAREAHHLVQD 157

VYDRSQTGKPVNLRQVLGAFSMNNVTRMLLGKQYFGIESAGPQEAMEFMHIT 1

 

>CYP703A15P pseudogene

maker-scaffold_80-snap-gene-18.19-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.24 eAED:0.42 QI:0|0|0|1|0|0.33|3|0|256

68% to CYP703A2 Arabidopsis thaliana, pseudogene

1871035 MDLGTLASTLVYAFLFGTIVCLRLWLMKSLQSKGRLPPGPPRWPIFGNLLQLGPLPHRD

LASFCDKYGPLDYLRLGSVDAITTNDLEIIREILLRQDE

VFASRPRTLAAVNLAYECGEVALAPLGSQWKRMRRICMEHLLSIKRLESFADHRAR

EAHHLVEDVYDRSQTGKPVNL

LGSFSMNNVTIMLL

LLGKQYFGIESAGPQEAMEFMHITHELFWLLGLIYLGDYLPIWRWLDPFGCEKKMREVEK

RVDGFHMKIINEEHRKGRERKKEKKGEDDDREMDFVDILLSLPGEQGKEHLDE

LDEFRPERHLSA

PADGSR

SHGIDLKILPFSGGKRKCPGA

ALGLTFVLMAIPL

LFHCFDWIPPERLKAEDIDTTEVYGMTMPK

AKPLMAIARPRLDC* 1872733

 

CYP704 family (6 genes, 1 pseudogene)

 

>CYP704A77 maker-scaffold_75-snap-gene-14.33-mRNA-1 protein Name:"Similar to CYP704C1 Cytochrome P450 704C1 (Pinus taeda)" AED:0.10 eAED:0.10 QI:0|0.75|0.6|1|0.75|0.4|5|0|482

66% to CYP704G1 Medicago truncatula
89% to CYP704G maker-scaffold_75-augustus-gene-15.21-mRNA-1
RECENT TANDEM DUPL. 
GC boubdary at TLDIQ
61% to CYP704A19 Vitis

MDFVSDFLTVASVALFLLFSCFCALLAKIFMGKSLMDSRYAPVKGTIFHQFLHFSRIYDY LTQVARTHQTFRFLAPSHSQIYTTDPRNIEYVLKTNFDKYSKGHYNQDILTDLVGHGIFA ADGDRWRQQRKLASFEFSTRVLKDFSCA 1427463

VFRRKAAKLAGIILEFAITNQTLDIQ (0)

DLLMRCTLDSIFKVGFGMDLDCLGGSSKQGVS FIKAFDESNELVSWRYADPLWKVKRFLNMGSEAKLKKNIKIIDDLIYELIQSKRKQLSVK GDSNEKEDILSRFIVESEKDPMTLNDQYLRDIILNFMFAGKDTTSNTLSWFFYMLCKHPL IQEKIAQEVTEAFNGEPNEANIDEFVISNLTDAAMEKMHYLHAALTETLRLYPAVPVDGR CPVEDDVLPDGFRLRKGDSVLYIAYAMGRMARLWGEDAEDFRPERWLKNGIFQPESPFKF VAFHAGPRMCLGKDFAYRQMKIVAMVLLRFFRFRLADENKAVTYRTMFTFHINGGLQLGA

IPRFGLTDSEGI* 1425961

 

>CYP704A78 maker-scaffold_75-augustus-gene-15.21-mRNA-1 protein Name:"Similar to CYP704C1 Cytochrome P450 704C1 (Pinus taeda)" AED:0.07 eAED:0.07 QI:0|1|0.8|1|1|1|5|0|519

64% to CYP704G1 Medicago truncatula complete
62% to CYP704A19 Vitis

MDFFSAFLTVASAALFLLFISFCALLLKIFMGKSVMDPRYAPVKGTIFDQLLYFNRLYDY QTQVARTHQTFRLLAPSHSEIYTTDPRNIEYVLKTNFDKYSKGQYNQDIVTDLVGHGIFA VDGDRWRQQRKLASFEFSTRVLRDFSSAVFRRNAAKLSRIILEFSITNQTFDIQDLLMRC TLDSIFKVGFGMDLDCLGGLSKQGGSFIKAFDESNELVCWRYADPLWKVKRFLNMGSEAK LKKTIKIIDDLIYELIQSKRKQLSVKGDSITNEKEDILSRFIVESEKDPKTMNDQYLRDI ILNFMFAGKDTTANTLSWFLYMLCKHPFIQEKIAQEVTEAFNCETNETNIDEFVISNLTD AAMEKMHYLHAALTETLRLYPAVPVDGKCSEEDDVLPDGFRVKKGDSVYYIAYAMGRMAN LWGEDAEDFRPERWLKNGVFQPESPFKFVAFHAGPRICLGKDFAYRQMKIVAMVLIRFFR FRLADENKAVTYRTMFTLHIHGGLQLGAISRLGLTNSGI

 

>CYP704A79 maker-scaffold_15-augustus-gene-14.8-mRNA-1 protein Name:"Similar to CYP704C1 Cytochrome P450 704C1 (Pinus taeda)" AED:0.06 eAED:0.06 QI:0|1|1|1|1|1|6|153|515

52% to CYP704G1 Medicago truncatula
72% to maker-scaffold_115-augustus-gene-17.10
67% to CYP704A21v2 

MESFYDPITLTFTAFAMLLCLFTLKIFATKTPPEEQKKRRHPIAGTIFNQLLNFSRLHHY MTELASKYGTYRLSRLSRSEIYTADPANVEYILKTNFANYGKGKHNNEILRDLLGDGIFA VDGEKWRQQRKLSSYEFSSSNLRGFSSTVFRRNAANLAKILLQAATSGLSFDIQDLFMKS TLDSIFKVGFGVELDSSGGSTDGTMFAKAFDDSSALTLWRYVDVFWKMKKFLNVGSEAEL RENVKMIDKFVYRLISYKIQQXQNCNTTTGSHMKKQDILSRFLELNETDPKYLRDIIMNF IIAGRDTTATTLSWFFYMLCKHPYIQEKIAQEVQEAIKEKDTSSYDELADNLNDESLGKM HYLHAAISETLRLYPAIPVDMKVCFSDDTLPDGFNVKKGDMVAYQPYAMGRMKSIWGDDA EVFRPERWLNESGLFRQESQFKFTAFQAGPRICLGKDFAYRQMKIFSALLLSSFVFRLSD DQKEVGYRTMITLNIDGGLHLQVSHRLGCEHKIYA

 

>CYP704A80 maker-scaffold_115-augustus-gene-17.10-mRNA-1 protein Name:"Similar to CYP704C1 Cytochrome P450 704C1 (Pinus taeda)" AED:0.08 eAED:0.08 QI:312|1|0.83|1|1|1|6|0|520

51% to CYP704G1 Medicago truncatula
72% to maker-scaffold_15-augustus-gene-14.8
72% to CYP704A21v2 Vitis

MATMDFLSDSVSLTVTALAVVLAILVFKAISTKTSSQRGTKKRYHPIAGTIFNQLLNFHR LHHYMTDLAIKYGTYRLLSPFRNEVYTADPVNVEYMLKTNFANFGKGLHNYEILSDLLGD GIFTVDGEKWRHQRKVSSYEFSAKVLRDYSSVVFRRNAVRLAKMLSDSAASNQIFDIQDL FMKSTLDSIFKVGFGVELDSMGGSSEGTKFAQAFDDSSALTLWRYVDIFWKIKKFLNIGK EATLKKNIKVIDNFMYKLIRSKIEQKQNSDNDTSLKKDDILSRFLELNETDPQYLRDIIL NFLVAGRDTTATTLSWFLYMLCKHPRVQEKVAQEVMEATRAKDASSYDEIAAHLNDEALD KMQYLHAALSETLRLYPAVAVDAKICFSDDTLPDGYSVNKGDMVVYQPYAMGRMKFIWGE DAEVFRPERWLNEDGLFRPESSSKFTAFQAGPRICLGKEFAYRQMKIFSALLLSCFVFKL SDENQVVHYRTMLNLHIDGGLYLRAFHRLRLGSENPEKIA

 

>CYP704B32  augustus_masked-scaffold_19-processed-gene-53.0-mRNA-1 protein Name:"Similar to CYP704C1 Cytochrome P450 704C1 (Pinus taeda)" AED:0.09 eAED:0.09 QI:0|0.8|0.5|1|1|1|6|0|508

73% to CYP704B1 Arabidopsis thaliana, revised seq complete

MEEQNVSSISSSPTGYSKGMVVFICMLISWVFVHRWNQRNMKGPKTWPLVGAAIEQLMNY NRMHDWLVEYLSELKTVTVPMPFTTYTYIADPVNVEHVLKTNFANYPKGEVYHSYMEVXL GDGIFNSDGELWRKQRKTASFEFASKNLRDFSTI

VFREYALKLSYILSQTSAQNQQVDMQ (0)

ELLMRMTLDSICKVGFGVEIGSLAPE LPENCFARAFDTANIIVTLRFIDPLWRIKKFLNVGSEAQLDESIKTIDGFTYSVIRKRKX EIQEARVHSKDVKIKHDILSRFIELSEDPDNNLTDKSLRDVVLNFVIAGRDTTATTLCWF IYMIMTHPHVAAKLYSELKAIEEDRXKEEKLCLLPYDPEDHTSFNERVTQFARFLTYDSL GKLSYLHAAITETLRLYPAVPQDPKGILKDDVLPDGTKLKAGGMVTYVPYSMGRMEYNWG PDAASFKPERWFKDGFFHNSSPFKFTAFQAGPRICLGKDSAYLQMKMTLAILCRFFEFRL VPNHPVKYRMMTILSMEHGLKLTVTRRS

 

>CYP704B33 maker-scaffold_19-augustus-gene-57.17-mRNA-1 protein Name:"Similar to CYP704C1 Cytochrome P450 704C1 (Pinus taeda)" AED:0.06 eAED:0.08 QI:0|1|0.33|1|1|1|3|0|255

76% to CYP704B1 Arabidopsis thaliana, C-term half
almost identical to CYP704B augustus_masked-scaffold_19-processed-gene-53.0-mRNA-1
runs into a seq gap
93% to maker-scaffold_88-augustus-gene-6.19
NNU_008470 ohnolog to maker-scaffold_88-augustus-gene-6.19

5712459 ELSEDPDNNLTDKSLRDVVLNFVIAGRDTTATTXXWFIYMIMTHPHVAAK LYSELKAIEEDRXKEEKLCLLPYDPEDHTSFNERVTQFARFLTYDSLGKLSYLHAAITETLRLYPAVPQ (0)

DPKGILKDDVLPDGTKLKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWFKDGFFHNSSPFKFTAFQ (0)

AGPRICLGKDSAYLQMKMTLAILCRFFEFRLVPNHPVKYRMMTILSMEHELKLTVTRRS* 5713540

 

>CYP704B34P pseudogene maker-scaffold_88-augustus-gene-6.19-mRNA-1

protein Name:"Similar to CYP704C1 Cytochrome P450 704C1 (Pinus taeda)" AED:0.21 eAED:0.21 QI:0|0.33|0.14|0.85|0.66|0.42|7|0|435

73% to CYP704B1 Arabidopsis thaliana
94% to CYP704B augustus_masked-scaffold_19-processed-gene-53.0-mRNA-1

635589 MEEQNLSSISSSPTGYSKGMVVFICMLISWVFVHRWNQRN TKGPKTWPLVGAAIEQLMNYNRMHGWLVEYLSDLKTVKVPMPFTTYTCIEDPVNVEHVLKTNFDNYPK

GEVYHSYMEVLLGDGIFNSDGELWRKQRKTASFEFASKNLRDFSTIV

FREYALKLSYILSQTSAQNQVDMQ

ELLMRMTLDSICKVGFGVEIGSLAPELPENCFARAFDTANIIVTLPFIDPFWRIKKFLNVGSEAQL GESIKTIDSFTYSVIRKRKAEIQEAR

VHSKDDK

IKHDILARFIELSEDPDNNLTDKSLRD VVLNFVIAGRDTTATTISWFIYMIMTHPHVAAKLYSELKAFEEDRAKEEKLR

LLP*DPEDHTSFNERVTQFAGFLTYDSRGKLSYLHAAITKTLRLYPAVPQ

DPKGILKDDVLPDGTKLKAGGMVTYVPY

QAAPRICLGKDSAYLQMKMTLAILCRFFKY

YRMMTILSMEHGLKLIVTRRS* 633318

 

CYP706 family (3 genes, 1 pseudogene)

 

>CYP706J6 maker-scaffold_3-augustus-gene-39.10-mRNA-1 protein Name:"Similar to CYP75B2 
Flavonoid 3'-monooxygenase (Petunia hybrida)" AED:0.01 eAED:0.01 QI:72|1|1|1|1|1|2|20|528 
57% to CYP706J1 Vitis vinifera
96% identical to CYP706J maker-scaffold_3-augustus-gene-39.9-mRNA-1
52% to maker-scaffold_36-augustus-gene-5.19
MGSLPVPDALRWWWQVSNRRDEYARAVLTLSLVVLSISWYAWLTRKSRKADLPLPPGPRG LPLVGNLLSLHPELHVYFAELARTYGPITKLQLGKKLGIVITSPSLAKEVLKDHDTTFAN RDVPAAGRAATYGGLDIVWTPYGPEWRLLRKVCVREMLGTATLDAVYGLRQREVRRTVEY LYSRTGSQVNIGEQMFLTVLNLITSMLWGDTIKGEERSRLGAEFRQAIGEMTALLGMPNV SEFFPILARFDLQGVERKMKVLASQFDRMFDSMIHKRLNIMDEKGREESHDFLQFLLNLK DQGDAKNSLTMNQVKALLMDMVIGGTDTTSNTVEWAIAELMNKPETMRKAQEELERVVGK DNIVEESHLPKLHYLQAVMKEVLRLHPALPLFIPHCPSSSCAVGGYMVPKGARVFVNAWA IHRDPVLWDKPLTFDPERFLIDGKWDYTGKDLSYIPFGSGRRICAGMAMAERMVMYALAS LLHSFDWELPEGAKLQLTEKFGIVLKKATPLVAVPTPRLSDPKLYAGC 
 
>CYP706J7 maker-scaffold_3-augustus-gene-39.9-mRNA-1 protein Name:"Similar to CYP75B2 Flavonoid 3'-monooxygenase (Petunia hybrida)" AED:0.04 eAED:0.04 QI:113|1|1|1|1|1|2|20|528 
57% to CYP706J1 Vitis vinifera
MGSLPVPDALRWWWQVSNRRDEYARAVLTLSLVVLSISWYAWLTRKSXKADLPLPPGPRG LPLVGNLLSLHPELHVYFAELARTYGPITKLQLGKKLGIVITSPSLAKEVLKDHDTTFAN RDVPAAGRAATYGGLDIVWTPYGPEWRLLRKVCVREMLGTATLDAVYGLRQREVRRTVEY LYSRTGSQVNIGEQMFLTVLNLITSMLWGATIKGEERSRLGAEFRQAIGEMTALLGMPNV SDFFPILARFDLQGVERKMKGLASQFDRMFDSMIHKRLNIMDEKGKEEGHDFLQFLLNLK DQGDAKNSLTMNQIKALLMDMVVGGTDTTSNTVEWAIAELMNKPETMRKAQEELERVVGK DNIVEESHLPKLHYLQAVMKEVLRLHPVLPLLVPHCPSSSCAVGGYMVPKGARVFVNAWA IHRDPALWDKPLTFDPERFLIDGKWDYTGRDLSYFPFGSGRRICAGIAMAERMVMYALAS LLHSFNWELPKGAKLQLTEKFGIVLKKATPLVAVPTPRLSDPKLYAGC 
 
>CYP706J8P pseudogene
snap_masked-scaffold_213-processed-gene-8.8-mRNA-1 protein Name:"Similar to CYP80B2 Probable (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 (Coptis japonica)" AED:0.22 eAED:0.22 QI:0|0|0|0.33|1|1|3|0|258 
55% to CYP706G1 Vitis vinifera C-term
58% to CYP706H1 Vitis vinifera
59% to CYP706J maker-scaffold_3-augustus-gene-39.9-mRNA-1
846006

DFVVAGTDTTSTTSEWAMAEIM

(6 aa deletion)
RKIQDELDDVVGKNSTVEELHIPKLHCLDAVVKENLRLHLVAPLLLPRHPSKSCY VARYTIPEGAQVLVNAWGIHRDPEAWDNPLEFHPESFLTKNGKWDYSGNNFHYFPFGTGR RICAGIPLAKRLLPYVLASLLHLFERRFADGTEIDMLEKTGITLKKMIPLVVVPKPRL

LLEKYGYWFCG* 845386

 

>CYP706L1 maker-scaffold_36-augustus-gene-5.19-mRNA-1 protein Name:"Similar to CYP93A1 Cytochrome P450 93A1 (Glycine max)" AED:0.03 eAED:0.03 QI:86|1|1|1|1|1|2|221|512

50% to CYP706J1 Vitis vinifera

MITKVILPLLVTIICIAWYKWVTKDAVDKRSNPPLPSGPRDLPLVGSLPFLSADLHRCFA ELAQTYGPIMKIQLGGKLCIVVSSSSLAGEIMRDHETVFVNRDVSPAADIFSYGGSDMVF SLYGPQWRAIRSVCVKEMLNKTRLDACYSLRRREARGMLSRLYSKVGTPINVGERMFETI SNVIMSMLWGGTLNEEERSIVGVESRKATKEFSALLGRPDISDLFPVLAWFDIQGVKRKT KRIHIRLDQLCQSVIDRRIEIERQQTEESNGQQRKDLVQFLLQLNKEGDPKRPMTSVMMK ALLLDVLLAGSETSATTVEWAMAEMMQHPEILRKVQVELEEVVGMNNVVEESHLPKLQYL NAVIKETLRLHTTLPLILPRRAAQTCIIGGYTIPEGARVFVNLWAIHRDPTNWDNPSQFQ PERFLNETNNWDFNGNDFRYFPFGSGKRICVGVPMARRMVPYILASLLHSFDWKITEEME LDLSEKFGLSIRPAKPVFAIPTPRLSNIQLYV

 

CYP707 family (6 genes, 0 pseudogenes)

 

>CYP707A72 maker-scaffold_33-augustus-gene-20.21-mRNA-1 protein Name:"Similar to CYP707A4 Abscisic acid 8'-hydroxylase 4 (Arabidopsis thaliana)" AED:0.11 eAED:0.11 QI:217|1|1|1|1|1|9|295|479 
60% to CYP707A1 Arabidopsis thaliana
MDVVGVLAIHILFLPTLVLYLYLRKHKSKSQQKNKLPPGSMGWPYIGETLQFYSQDPNVF FAAKQKRYGEIFKTHILGCPCVMLASPEAARFVLVTRAQLFKPTYPESKEQMIGPCALFF HQGDYHTRLRRLVQSSLAPEAIRKLVPDIEAIAVSTLESWSGGDLVNTFRGMKKFSFHVG VLAVFGSLDAYYKQQLEKNYSILDQGYNSFSTNIPGTPYRKAILARKRLNQILSEIIYHK KEKLVEKDLLGCLMNSKDEKGNILTDDQIADNIIGVLFAAQDTTASVLTWILKYLHDNPK LRKAVKAEHKAILLESNDGGNRSLTWAQTRNMHLTYRVILESLRMASIISFTFREAVADV EYKGYLIPKGWKVMPLFRNIHHNPEFFPDTQNFDPSRFEVAPIPNTFMPFGNGIHACPGN ELAKLEMLILIHHLVTKFRWEVEGSQSGIQYGPFPVPQHGLPARFWKQPRSLRQRPGCA 
 
>CYP707A73 maker-scaffold_2-augustus-gene-58.12-mRNA-1 protein Name:"Similar to CYP707A6 Abscisic acid 8'-hydroxylase 2 (Oryza sativa subsp. indica)" AED:0.10 eAED:0.10 QI:150|0.87|0.88|1|0.87|0.77|9|297|511 
60% to CYP707A1 Arabidopsis thaliana, revised seq. complete
79% to maker-scaffold_33-augustus-gene-20.21 (ohnologs)
MEMGDILLYLLLLLPALLSYLFLRKHRRNLEQRLKLPPGSMGWPYMGETLQLYSQDPNVF FATKQKRYGEIFKTRILGCPCVMLASPEAARFVLVTEAQLFKPTYPKSKERMIGPSALFF HQGDYHSRIRKLVQGSLTPEAIRKLVPDIDALAISTLESWSGGHLVNTFQEMKK (0)
FSFHVGILAIFGRLDACYKEQLEKNYCIVDKGYNCFPINIPGTAYH KAVMARKRLGKILSEIICERKSKQLVEKDLLGCLMNSQDEKANVLTEDQIADNIIGVLFA AQDTTASVLTWILKYLHDDPKLLEAVKAEHKAVYDSNGQGNQPLTWAQTRNMPLTNRVIL ESLRMASIISFTFREAVADVEYKGYLIPKGWKVMPLFRNIHHDPRFFPDPQKLDASRFEV APKPNTFMPFGNGVHACPGNELAKLEAYIVVHHLVTKFRWE
VVGSQSGIQYSPFPVPQHGLPAKFWKESGSQSQGDVQERTEAFPKSESPN* 
 
>CYP707A74 maker-scaffold_17-snap-gene-43.19-mRNA-1 protein Name:"Similar to CYP707A2 Abscisic acid 8'-hydroxylase 2 (Arabidopsis thaliana)" AED:0.09 eAED:0.09 QI:305|0.85|0.87|1|0.71|0.87|8|307|450 
61% to CYP707A1 Arabidopsis thaliana
84% to CYP707A maker-scaffold_30-snap-gene-4.25-mRNA-1 (ohnologs)
revised seq complete
MQPPPASLPLLSATYLSHLLFFLSILWFFLLYLIQWRQTRNKHLPPGSMGWPYIGETLML YSQNPDSFFSKRQKRYGDIFKTHILGCPCVMISSPEAAKAVLVSRAHLFKPTYPPSKEKL IGPEALFFQQGDYHSRLKKLVQDSFLPSALRGYVSEIEQIVLKLLPAWENETINTLQEMK KFAFDVAILSAFGAGWGVETERIKRLYHRLEKGYNSMPLNLPGTPFNKSMKARKLLNETL RRVIEKRRERKKQDGGLLGVLLGSKDHKLNHLTDSQVSDNIIGVIFAAHDTTASALTWIL KYLHDNEELLEAVTKEQEGIRRGIIEENREMTWADTRSMLLTSRVIQETLRRASILSFTF REAVEDVEFGGYIIPKGWKVLPLFRSIHHCEDFFPDPEKFDPSRFE (0)
VPPRPNTYMPFGNGVHSCPGNELAKLEILVLLHHLTTTYRWKVVGEDDGIKYGPF
PVPKGGLPVRVIPRNN 
 
>CYP707A75 maker-scaffold_30-snap-gene-4.25-mRNA-1 protein Name:"Similar to CYP707A2 Abscisic acid 8'-hydroxylase 2 (Arabidopsis thaliana)" AED:0.05 eAED:0.05 QI:167|1|1|1|0.14|0.25|8|297|479 
62% to CYP707A1 Arabidopsis thaliana
MQLSLPLTTKNTLSLVLLLVSLLWFFFLYLFQWRQSRYKHLPPGSMGWPYIGETLMLYSQ NPNTFFSKRQKWYGDIFKTHILGCPCVMISSPEAAKAVLVTRAHLFKPTYPPSKEKMIGP EALFFHQGDYHSKIKKLVQSSFLPSALRGSVSDVERIVLKLLPSWENKTVNTLQEMKKFA FDVAILSAFGGGWEVETEQIKNLYHCLEKGYNSMPFSLPGTPFSKAIKARKLLNDTLKRV IEKRRESNKQGGGLLGVLLGSKDDKLNHLSDSQVADNIIGVIFAAHDTTASVLTWVLKYL HDNEELLEAVTKEQEGIRRRIIEGNRRLTWGDTRKMQLTSRVIQETLRRASILSFTFREA VEDVEFGEYLIPKGWKVLPLFRSIHHCADFFPQPEKFDPSRFEVPPKPNTYMPFGNGIHS CPGSELAKLEMLVLLHHLTTTYRWKVAGEDDEGIQYGPFPVPKGGLPIRVNSINANVMD 
 
>CYP707A76 maker-scaffold_95-augustus-gene-11.17-mRNA-1 protein Name:"Similar to CYP707A1 Abscisic acid 8'-hydroxylase 1 (Arabidopsis thaliana)" AED:0.12 eAED:0.12 QI:80|1|1|1|1|1|7|368|473 
77% to CYP707A1 Arabidopsis thaliana
86% to maker-scaffold_44-augustus-gene-12.9
MDTPMFSVAAASPFWVFASLLSLFLLLFTLARVLISGRRSLPLPPGTMGWPYIGETFQLY SQNPNVFFASKVKRYGKIFKTHVLGCPCVMISSPEAAKFILVTKSHLFKPTFPASKERML GRQAIFFHQGPYHMKLRKIVMRAVMPEAIKNIVSDVETIAVSCLQSWDGQLINTFQEMKT YTYNVGLHSIFGKEGALYREELKRCYYILERGYNSMPINLPGTLFNKAMKARKELSQIVA KILHSRRQSKEERNDLLGSFMDEKEGLTDEQIADNVIGVIFAARDTTASVLTWIVKYLGE NPSVLQTVTEEQESIMKSKENGGEDKSLTWADTRKMPISSRVIQETLRVASILSFTFREA VEDVEYGGYLIPKGWKVLPLFRNIHHSPDNFPDPEKFDPSRFEVAPKPNTFMPFGNGAHS CPGNELAKLEILVLLHHLTTKYRWSMVGPHNGIQYGPFALPQNGLPIRLFSKS 
 
>CYP707A77 maker-scaffold_44-augustus-gene-12.9-mRNA-1 protein Name:"Similar to CYP707A1 Abscisic acid 8'-hydroxylase 1 (Arabidopsis thaliana)" AED:0.09 eAED:0.09 QI:0|1|0.85|1|1|1|7|529|515 
77% to CYP707A1 Arabidopsis thaliana
MEIPMFSLVSSPFIFLASLLSLFLLYALAWMLIAGRRRLPLPPGTTGWPYIGETFQLYSQNPNVFFASKVKRYGSI FKTHVLGCPCVMISNPEAAKFVLVTKSHLFKPTFPASKERMLGRQAIFFHQGAYHMKLRK LVMRAVMPEAIKDIVSDIEAIVVDTLRSWDGMLINTFQEMKTYTFNAALLSIFGKDDVLY REELKRCYYILEKGYNSMPINLPGTLFNKSMKARKELAQILAKILCSRRQRKEESKDLLG SFMGEKEGLTDDQIADNVIGVMFAARDTTASVLTWTVKYLGENPSILQAVTEEQETIMRC KEKSGEDRILTWADTRKMPITSRVIQETLRVASILSFTFREAVEDVEYEGYLIPKGWKVL PLFRNIHHSPDNFPDPEKFDPSRFEVAPKPNTFMPFGNGIHSCPGNELAKLEILVLLHHL 
TTKYRWSMVGPQNGIQYGPFALPQNGLPIRLSLKT 
 

CYP709 family (1 gene, 0 pseudogene)

 

>CYP709B6a augustus_masked-scaffold_2533-processed-gene-0.0-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.02 eAED:0.02 QI:8|1|1|1|0.5|0.33|3|1026|289 
49% to CYP709F1 Populus trichocarpa, complete
45% to CYP734A maker-scaffold_12-augustus-gene-69.23-mRNA-1
53% to CYP709B5 Vitis complete
47% to CYP709B1 Arabidopsis thaliana complete

MGYVLVAGTLFLVTVITIAWKAFMDLIWKPYSITKHFQKQGITGPA YHLLSGSVNEMMKIEEEEKQTPMDPSSHNVTPKVLPHYHRWSQQYG

DCFLFWFGTQPRLSIVDPGMIKEVLSTKFGYYTIDKPTPPVMALLGNGLLNLTGLDWVRHRRAINPAFTIDKLK GMTKRMAACALSTLDRWADQVVETNDQCKEIEVHKEFMELTADIIAHTSFGTNYKEGKEV FEVEREL
2423 HRMVIDSVADVYVPGS
EYIPTKWNRRMWMLEKRLRNKLKSIIESKLRTADLGDSNHDYGEDL LGLMMGISEDSKKQQGSSLTVNEIIDECKTFFFAGHETTSNLLTWAMFFLGKDLEWQKRL REEVLSVCGIGVPDADKVSKLKL
MNMVLYETLRLYSPVIFTERKAAQDIKLGDLTIPKDT VVTFPFPIIHRNKKYWGDDADDFNPLRFADGFSKAAKHPNALIAFSMGPRVCIGQNFAML EAKIGMAMILQRFFFTLSPNYKHAPVNNILLQPQFGVPIILKPIHASNA* 1027
 

>CYP709B6b scaffold 2578 2203-2475 (+)

39% to CYP721A augustus_masked-scaffold_13-processed-gene-52.1 aa 27-115
37% to CYP709B1 Arabidopsis thaliana aa 4-94
41% to CYP709B5 Vitis N-term
contig01534 and contig10775 match

YVLVAGTLFLVTVITIAWKAFMDLIWKPYSITKHFQKQGITGPAYHLLSGSVNEMMKIEEEEKQTPMDPSSHNV

TPKVLPHYHRWSQQYGQ

 
contig01534 matches augustus_masked-scaffold_2533-processed-gene-0.0
fills in the gap and completes the N-term

HILFPFPRPCVSEEMGYVLVAGTLFLVTVITIAWKAFMDLIWKPYSITKHFQKQGITGPA YHLLSGSVNEMMKIEEEEKQTPMDPSSHNVTPKVLPHYHRWSQQYG

DCFLFWFGTQPRLSIVDPGMIKEVLSTKFGYYTIDKPTPPVMALLGNGLLNLTGLDWVRHRRAINPAFTIDKLK GMTKRMAACALSTLDRWADQVVETNDQCKEIEVHKEFMELTADIIAHTSFGTNYKEGKEV FEVEREL HRMVIDSVADVYVPGSEYIPTKWNRRMWMLEKRLRNKLKSIIESKLRTADLGD SNHDYGEDLLGLMMGISEDSKKQQGSSLTVNEIIDECKTFFFAGHETTSNLLTWAMFFLG KDLEWQKRLREEVLSVCGIGVPDADKVSKLKLMNMVLYETLRLYSPVIFTERKAAQDIKL GDLTIPKDTVVTFPFPIIHRNKKYWGDDADDFNPLRFADGFSKAAKHPNALIAFSMGPRV CIGQNFAMLEAKIGMAMILQRFFFTLS

 

CYP710 family (1 gene, 1 pseudogene)

 

>CYP710A43 snap_masked-scaffold_18-processed-gene-74.10-mRNA-1 protein Name:"Similar to cyp524A1 Probable cytochrome P450 524A1 (Dictyostelium discoideum)" AED:0.01 eAED:0.01 QI:0|-1|0|1|-1|1|1|0|514

66% to CYP710A1 Arabidopsis thaliana

MDSIWSTLTSVAPYITSLIALLLLLEQVKYLKKKRSLPGPLLVWPFVGSAISLVLNPVKF WDVQAALAKSSSLGVSANYIIGRFIVFIQNTELSHQLFANVRPDAFHLIGHPFGKKLFGE HNLIYMMGQDHKDLRRRIAPNFTPRALATYISLQQRIILQHFKKWESLCSGNPSKPIVLR LLCRDMNLETSQTVFVGPYMTKKAREDFERDYNLFNVGLMKLPIDLPGFGFRKARLAVSR LVKSLTVCAGQSKSKMKSGKEPSCLIDFWMQEAVKEIDAAFEAGESSPPRHTSDVEIGGH IFDFLFAAQDASTSSLLWAVTLLDSHPDVLAKVRAEVSSIWSPESDTLITAEQLTEMKYT QAVAREIVRFRAPATLVPHIAGEDFQLTESYTIPKGAIVFPSVFESSFQGFTDPDRFDPD RFSEERQEDRMYKRNFLAFGAGAHQCVGQRYALNHLVLFIAMFTSILDFKRHRTDGCDDI AYVPTICPKDDCLVHLSRRCARYPSFEQSVILND

 

>CYP710A44P pseudogene

augustus_masked-scaffold_32-processed-gene-42.5-mRNA-1 protein Name:"Similar to cyp524A1 Probable cytochrome P450 524A1 (Dictyostelium discoideum)" AED:0.16 eAED:0.17 QI:0|0|0|1|1|1|2|0|173

67% to CYP710A1 C-term

scaffold 32 4187299-4187210 (-) 258-293

82% to CYP710A snap_masked-scaffold_18-processed-gene-74.10

SGKEPSCSIAVKEIDAAFEAKESSPPQHTS

4187209 DAEIGEHIFDFMFVAQDASTSSLLWAMTLLDSHPDVLAKVR

EVSII*CPESDTLITMEQLT

EMKYTQAVATEIIRLRAPAMLVPHIAREDF QLTESYTIPKGAIVFPSVFESSFQGFTDPNQFSEERQEDRMYKKNFLAFGAGAHQCVGQR YALNHLVLFIAMFMFIIDFKRHRTDCCDDITYFPTICPKDDCLVYRAKFKMKV* 4186594

 

>CYP710A45P pseudogene scaffold 2

88% to CYP710A snap_masked-scaffold_18-processed-gene-74.10

1271573-1271370 (-) 245-304

LTVCAGQSKSIMKSGKEPYCLIDFWMQ*AVKKIDAAFQAWEPSPPRHTSDVKIGGHIFDF &

1271376-1271212 (-) 305-358

LFAAQDASTSSWLWAVTLLDSSHTDVHAKVRAEVSSIWSPESNTLITAEQLTEMK

 

>CYP710A46P pseudogene scaffold 3

80% to CYP710A snap_masked-scaffold_18-processed-gene-74.10 270-383

3894311-3894210 (-) 245-278

LTVCAG*SKSNMKSGKEPSCLIDF*MQEVVKEID

3894205-3893972 (-) 281-358

FEAGESSLPRHTNDVEISGHIFDFLFAV*DTSTSSLLWVVMILDSHPNVLMKIRAEVSSI*FPEFDTLITVEQLTEMK

 

>CYP710A47P pseudogene scaffold 20

6445582-6445788 (+) 263-331

56% to CYP710A snap_masked-scaffold_18-processed-gene-74.10

SCLINFWMQEMVKKINATLETKEPTLPLPFQ*CQIGWHLFYYLFTAQDAFTSSLHWVVALLDLHPKVVA

 

>CYP710A48P pseudogene scaffold 57 6713999-6713829 (-) 272-328

73% to CYP710A snap_masked-scaffold_18-processed-gene-74.10

EQVEGDDVAFEAGKSSPPCHTSDVEIGEHIFDFMFIAQDDLTSSLLWSVMLLDSHQD

 

>CYP710A49P pseudogene scaffold 65

83% to CYP710A snap_masked-scaffold_18-processed-gene-74.10

2947633-2947316 (-) 244-349

SLTVCAGQSKSNMKSGKETSCLIDFWMQEAVKEINAAFEAGESSPPWHTSDIEIGGHIFDFVLAA*DASTSSLLW

AVTLLDSHPDVLAKVRVEVFSIWYPESDTLI &

2947314-2947219 (-) 350-378

TAEQLTEMKYTQPVAREILPSLSIRLPRHLMP

 

>CYP710A50P pseudogene scaffold 310 93447-93268 (-) 243-339

80% to CYP710A snap_masked-scaffold_18-processed-gene-74.10
KPDTVYAGQSKSKEIDTMFGHIFDFLFATQDASTSSLLWALTLLDSHPDVLVKARAKAQN

 

>CYP710A51P pseudogene scaffold 356

72% to CYP710A snap_masked-scaffold_18-processed-gene-74.10

161775-161605 (-) 243-299

ESLTVCAGQSKLNMKSEKEPSCLIDFWMQEAMTEIGTTFEAGESSPSWYTSDVKIGG

158345-158205 (-) 292-339

TKNLSISGHIFDFFSAQEASTSLLL*AVTLLDSHPDVLVKVRAEAQN

158213-158130 (-) 448-475

AQNDALNHLVLFIAMFTSILDFKRHRTD

 

CYP711 family (1 genes, 0 pseudogenes)

 

>CYP711A35 snap_masked-scaffold_28-processed-gene-43.23-mRNA-1 protein Name:"Similar to TBXAS1 Thromboxane-A synthase (Sus scrofa)" AED:0.17 eAED:0.17 QI:329|0.2|0.33|0.83|1|1|6|0|455 
69% to CYP711A1 Arabidopsis thaliana
contig_13500 20251-22368 (-) strand
Length = 69006 

22368 MAFSENTLQPVIGAAIPLTTLP

22302 PISPLILTMLALLAGALLYLYTPYWGVRRLPGPPTVPLVGHLPLLAKYGPDVFSVLAKRH 22123

22122 GPIFR (2?)

      FHMGRQPIVIVADPELCREVGI 21943

21942 KKFKDVSNRSIPSPISASPLHQKGLFFTR (2?) 21856

21663 YTCRDTRWSIMRNSIISVYQPSHLSYLLPSMQTVIDSATLSLPSSEEEDITFSNLSLQLA 21484

21483 TDVIGKAAFGFDFGLSRPRSAAGSVHEGGHSDDQVSDFVKQHIYSTTALKMDLSGSFSIV 21304

21303 LGLLVPILQEPFRQILRRIPGTTDWKVDQTNQKLSRRLDGIVAKRMKEKEPGSKDFLSLI 21124

21123 LRARESETVPKNAFTSDYISALAYEHLLAGSATTSFTLSSILYLVAEHPEVEKKLFREID 20944

20943 GFGPHDVTPTSHDLQHKFPYLDQ (0)

      VIKEAMR 20764

20763 FYTVSPLVAREASREIELGGYHLPK (0)

      GTWVW 20584

20583 LAPGAIAKDPKHFPEPEKFCPERFDPDCDEEKQRHPYAHIPFGIGPRACIGKKFAIQEIK 20404

20403 LSLIHLYRRYVFRHSPNMEKPLALDYGIVLNFKHGVKLRVIKRPCIHLVN* 20251

 

CYP712 family (1 gene, 0 pseudogenes)

 

>CYP712H1 maker-scaffold_18-snap-gene-30.30-mRNA-1 protein Name:"Similar to CYP93A3 Cytochrome P450 93A3 (Glycine max)" AED:0.05 eAED:0.05 QI:0|1|0.5|1|1|1|2|0|518

52% to CYP712D1 Vitis vinifera, complete

MAPITDIQYYCFLFCILLVSTLLFRSYAKKPTNPSTFPPSPPSLPIVGHLHLIGPLLHKS FQSLSRQYGPLISLRLGFSPCIVLSSAALAMEVFRTHDLIFAFRPEFASTQFNIYNGSNF FTAPYGTYWRFMKKLCMTELLADRQLAGFVGVKQEEIRHFLRRLLESSESGKPVDVGAEL TRLTNNIICRMAMTTRCSGSTYESEEVRKLGDEIAKLGGKLGLGEILGPLGKLDPFGYGK KLRNLIVQFDELLEKVLREHENDGAEGTNEGKDLVDILLKTSKDEKAEYKLTRTNIKAFL LDIFAGGTDTSAKAMQWTLAMLINHPDILRKVRAEIEFTVGETRLVEESDIHNLPYLQAV IKETLRLFPVLPIIGRECTEDCKIGGYDVKKKSRVLINLYAIMRDPDSWEDPDSFRPERF LMKSRENLQRQEEIKNQSSKFLPFGGGRRGCPGASHAYTIMHLTVASMVQCFDWVNGDNG LTEVSLEQGAGFNLRMAHPLLCFPIPVAKLQPLIPTVL

 

>CYP712H2P scaffold 20 2502603-2502415 (-)

53% to CYP712 JcCA0306151.20
88% to CYP712 maker-scaffold_18-snap-gene-30.30
nearest feature in genome is NNU_008605

HLHLIGPLLHKSFQSLSRQYGPLISLSMGASPCIILSSAALAMEVFRTHDLMFAFHPKFASTQ

 

CYP714 family (8 genes, 0 pseudogenes)

 

>CYP714A19 maker-scaffold_130-augustus-gene-10.23-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.06 eAED:0.06 QI:161|1|1|1|1|1|5|305|531 
56% to CYP714A1 Arabidopsis thaliana
62% to CYP714A8 Vitis, 59% to CYP714A3 Populus
57% to augustus_masked-scaffold_6-processed-gene-6.1
55% to augustus_masked-scaffold_124-processed-gene-1.6
54% to augustus_masked-scaffold_82-processed-gene-24.6
53% to maker-scaffold_130-snap-gene-10.26
MEVVFLTVNHLFWSMTTVVVVVVVVSLVMYVYSILWLKPEKLREKLRIQGITGPPPCFLR GNVPEMKRIQAGVAAASPSAANSPHDYASILFPYLEQWRKQYGQIYMYSTGTRQHLLVNH PDLVKEMSLSVSWDLGKPLYMGKTLGPMLGNGILRSNGNIWAHQRRIIAPEFFMDKVKGM MDVMVDSALSMLKKWEDRVEMEGGMADVKVDQDLRNFSADVISRTCFGSSYLKGKEIFSK LRALQVTLSKQGFLFWGPAYRNLPTKRNREIRRLERQIESLILKVIKERKEEASLLGSSA KKDLLEMILEGAINGDGHHDTTSIPCNRFIVDNCKNIYFAGHESTAVAAAWCLMLLALYP QWQDRVRAEVVQICGDHRPLDADALQKMKTMKMVIQETLRLYSPAPFLAREVFQDTKIGH IVVPKGVHLWTLIPTLHRDPDIWGEDAHEFKPDRFSNGISEACKLPQAYVPFGVGARMCL GRNFAMVELMVVLSLIISNFSFSLSPTYRHSPSYRMILEPEYGVHLLIRKI 
 
>CYP714G10 maker-scaffold_130-snap-gene-10.26-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.05 eAED:0.05 QI:168|1|1|1|0.75|0.8|5|197|521 
67% to CYP714G1 Populus trichocarpa
67% to CYP714G6 Vitis
62% to CYP714G maker-scaffold_16-augustus-gene-50.8
MVELSIVLKMSFAIVVVGFINLCIHLYNVLWVKPERLRSELGKQGIRGPPRTLVLGNILD MKRAQSAVAKSLREEDASNMTHNLSSRLFPFFEQWRSQYGHIFMFAVGNAQLLHVTQPDI VKEISVCTSLNFGKPSYQHKDRGPLLGQGILTSNGIAWAHQRKIIAPQLYMDKVKGMIDL ITESTISLMNLWKSKIENGGGVGEIKIDEDLRSFSGDVISRACFGSSYSKARDIFLKLRL LQDAMSKKSLTTGIPGMRYVPTKSNREIWRLEKEIRRLILKVVKEREASKQPEKDLLQTI LEGAKEGDLSPEATDRFIVDNCKNIYLAGYETTAVSSLWTLMLLASHPEWQARVRQEVLQ VCGSGKLLPDADMLRRMKLLTMVIHESLRLYPPVAIISREALKDMKFGDIHVPESVNVWT SVTWLHLDPEYWGPDSYKFNPDRFANGIAGACKLPYLYMPFGVGPRICLGQNLAMQELKI LLSLILTNFSFSLSPNYRHSPALRLVIEPEHGIDLLITRLQ 
 
>CYP714G11 maker-scaffold_16-augustus-gene-50.8-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.09 eAED:0.09 QI:0|1|1|1|0.75|0.8|5|124|543
60% to CYP714G6 VITIS VINIFERA, 59% to CYP714G2  Populus
49% to CYP714A8 Vitis
63% to CYP714E maker-scaffold_130-snap-gene-10.26
MGFQFLFSLVVVGAFSLFIHLCNILWVK PQRIRCELQKQGICGPPPSFLLGNIREMKAAKLSVAKSTPEGSQDIFHNCSSTIFPFFHQ WSEKYGRLFMFSLGKMQLLYVSEPNMVKEISQSTSLDLGKPSYQQKELGPLLGQGIITSN GAKWAYQRKIIAPELHLDKVKSMVDLMEEPITLLLNSWKRKIEGEGGIVDIRIDEDLRIF SGDVISRACFGSSYSKGKELFLRLRALQEAIANRRLKLGIPGLRYLPTNSNRNIWGLEKE IHSSISRILDEHNRGRFEKNLLQIILDGSRNGELGPNTTERFIVDNCKSMYLAGYETTAI SATWSLMLLASHPEWQARVRAEILQVCGGQLPNVDILRRMKLLTMVIQEALRLYPPVGVL TREVFKDMKFGEIHVPKGAFLWIAVAILHQDPEFWGADANKFNPERFINGSVGACKFPHL YMPFGFGPRICLGQNLAMLELKMLLARILSEFSFSLSPKYCHSPVLGLVIEPEYGVNLLV QRL 
 

>CYP714G12P scaffold 83 983999-984454 (+) aa 339-446

69% to CYP714G10 maker-scaffold_130-snap-gene-10.26

WTLMLLASHPEWQARVRQEVLDVCGGQLSDADTLRKMKLVLIFIYQQL

KCSCKLAIISREVLKDIKFGDIICSTRR*RVDLGGMVAP*PRIL*LWGPDSHKFSPDRFANGI

 

>CYP714K1 augustus_masked-scaffold_124-processed-gene-1.6-mRNA-1 protein Name:"Similar to cypE Probable bifunctional P-450/NADPH-P450 reductase 2 (Bacillus subtilis)" AED:0.06 eAED:0.06 QI:157|0.75|0.6|1|1|1|5|0|499

54% to CYP714G1 Populus trichocarpa
53% to CYP714G6 Vitis
52% to CYP714A8 Vitis
77% to augustus_masked-scaffold_82-processed-gene-24.6
limited synteny with only 3 genes to augustus_masked-scaffold_82-processed-gene-24.6

MEGIQIFVCSWVVACLSGFCVYLYHVLWLRTEKLREKLRKQGFRGPPPSFLCGNFLEMKR IESMVAMSPRKQDGCLTDDYAPSLFPYLELWRKEYGSAFMFTTGNVQHLYISDPNLVKEI SLCKSWDLGKPSYVIEQLGPLLGRGVTLSNGHLWAHQRKLIASEFFMDKVKGMVGLMVES TLPLLKLWEDLVEAEGGLADIRIDEDLRNLSADVISRTCFGSSYSEGKEIFSLLWKLQKT MSRTTILIRLPILRYLPTRNNREAWRLEKEIEKLILEVVRKRREQNVASSEKDLFQMILE GVYADQLGQKTANSLVVDNCKNIYVAGHETVASAATWTLMLLALHPEWQSRARKEAIE

VLGGCLPNADMLHKMKM (0)

LTMVIQEALRLFPPSSLIAREAFEEIHLDEVCIPKGVNLWIPISTVHRMPEIWGPDSDRFKP ERFAHGIFGACKLPHMYIPFGLGPRACLGQKFAVVELKILLSLILSKFSFSLSPNYIHSP

AFRFVIQPQYGMPLLVQRA

 
>CYP714K2 augustus_masked-scaffold_82-processed-gene-24.6-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.10 eAED:0.10 QI:57|1|0.8|1|1|1|5|0|517 
52% to CYP714G1 Populus trichocarpa, complete
52% to CYP714A8 Vitis, 54% to CYP714A3 Populus, 53% to CYP714E8 Viits
MEGTQIFVSLVLLCFSGFCAFLYEVLWLRAERLRKKLRQQGIRGPPPSFPYGNFLDMKRI KSAMVGMSPLMEKDGSLTSDYTPVLFPYLELWRKEYGPIFTYATGNVQHIYITDPNLVKE ISLHKSWDLGKPSYVIEQLGALLGHGVTMSNGHVWAHQRKLIAPEFFIDKVKGMVGLMVE TTLPLLKLWEDQIEGGGGLADIRVDEDLINLSADVISRACFGSTYSDGKEIFSLFKRLQS TMSGATIFIRIPYLRYLPTKSNREAWRLEQEIEKWISESVTKRREQNVASTEKDLLQMIL EAANADKLEQKTANRLVLDNCKNIYVAGHETVSSAATWALMLLASHPEWQSRIRTEVTE
VFGDGLPNADMLHKMKT (0)
LTMVIQETLRLYPPSSFIAREAFKEKHIDELCIPKGVNLWIPIA TLHRLPEIWGPDSDEFKPERFAQGISGACKLPQMYMPFGLGPRTCLGQKFAMVELKIILS LIVSKFSFSLSPNYIHSPAFKLVIQPEYGINLLIRGA 
 
>CYP714K3 augustus_masked-scaffold_6-processed-gene-6.1-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.06 eAED:0.06 QI:130|0.75|0.6|1|1|1|5|60|489 
53% to CYP714G1 Populus trichocarpa, 52% to CYP714A8 Vitis
67% to CYP714 augustus_masked-scaffold_82-processed-gene-24.6
MEWMEILTGLALALLASVCVYTHSVLWLRPQRLREKLRKQGIQGPRPSILTGNVWEIKTI QSKAAVSSTERHGRLTDDYAALLYPYLEFWRKQY (1)
GPIFTYATGTVQHLYISEPHLVKEISLCRSWDLGKPVYLVKQFWPLLGLGITRSNGQL
WAHQRKIIAPEFFMDKVK (0)
GMVGLMIESALPLLKSWEDRVEGDGGIADIRIDEDLRNLSAD 669538
VISKACFGSSYCYGKEIFSLIWALERTVSFAGVLNKIPAFR (2)
669984 CLPTKNTREAWRLEEEIKELILKVATKRKEESNY
VTSCETEKDLLQMILEAACADQLDQETANRFVVDNCKNIYLAGHETVA SVATWTLMLLASHPEWQSRARTEVFDVSGGGLPDADLLFKMKTLTMVIQETLRLFPPTSF VSREAFEEMQLGGFRIPKGVNIWIPIPTLHRIPEIWGPDSDEFKPERFAHGIFGACKLPQ VFIPFGLGPRTCLGQKFAMAELKTVLSLLLSKFSFSLSPKYVHSPSFKMVLEPQYGMNLL 
VSRRSKAGP 
 
>CYP714L1 maker-scaffold_25-snap-gene-42.12-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.08 eAED:0.08 QI:0|0.75|0.6|1|0.75|0.8|5|0|480 
53% to CYP714G5 VITIS VINIFERA, 53% to CYP714G1 Populus, 51% to CYP714E8 Vitis
revised seq. complete
84% to augustus_masked-scaffold_25-processed-gene-42.3 tandem duplication
4207867 MELQLASVTMLFPFALFGFFSLFLHLYRVLWLKQQLLRSRLHKQGIRGPPPTFVFGN
GLEIKRIQNSKSTAVKTSNKENLSHDFASTLFPCFEKWRKEY (1)
4206368 GDLFTFSLGNLQILYVTNPNMAKEMTLCASMGLGKSGYLQYEFGPLLGRGILTSNGAIWSHQR KTIAPELSMDKVKGMVNLMVESASSIVKTWQGRIESEGGVAEIRADEDMRRTSALIISKV LFGSSFTKALDLISKFKDIQNALTMPTMLKGLPGYRYIPSENNRKIWKLEKEVRSAILKI VKERSTENENDKGDEQDLLQMIIEGAKDGNLGPYTAQDYVLDNCKNIYFAGLETTAISAL WCLILLASHPQWQDRCRAEILEICGGGLPDVDMLRKMKTTTMVVQEVLRLYPPGLFMSRE ALQDIKLGELLVPKGVNIWLSVHALHRDPELWGPDACNFNPERFANGVAGACKLPQTYLA FGMGPRICAGQNFATIELKIVLAVILSNFSFSLSPKYRHSPVFKIIIQPDDGVNLIVRKV 
 
>CYP714L2 augustus_masked-scaffold_25-processed-gene-42.3-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.13 eAED:0.13 QI:0|1|0.6|1|1|1|5|0|519 
53% to CYP714G1 Populus trichocarpa complete, 52% to CYP714G5 Vitis
MELQLVLVKMLFSLALLGFLSLFLHLYRVLLLNPQLLRSRLEKQRIKGPPPTFIFGNVPE MKRMQNSKSTALVASNKEKLSHDFASTIFPCFEKWRKEYGDLFTFSLGNLQILYVTNPYL AKEMTLCSSMSLGKPGYLQYEFGPLLGRGILTSNGSIWSHQRKTIAPELSMDKVKGMVNL MVESASSVVKEWQGRIQSEGGVAEIGVDEDMTRISALIISKFMFGSSFSKALDIISKLKD IQNALTMSTILKGIPGYRYIPTENNRKIWKLEKEVRSMILKIVKERVAEDKPGQDLLQMI IEGAEDGSLGGPYTAEDFILDNCKNVYFAGLETTAITALWCFILLASHPEWQDRCRAEIL EISGGCLPDVDMLRKMKTTTMVIQEVLRLYPPSLLLSREVLQDIKLGEILVPKSVNIWLS VHALHRDPELWGPDACNFNPERFANGVAGACKLPQTYLAFGMGSRICAGQNFAMMELKII LALILSNFSFSLSPKYHHSPVFKIIIQPGDEVKLIVRKV 
 

CYP715 family (2 genes, 0 pseudogenes)

 

>CYP715A17 maker-scaffold_14-augustus-gene-26.16-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.05 eAED:0.05 QI:0|0.33|0|1|1|1|4|0|534 
58% to CYP715A1 Arabidopsis thaliana
48% to CYP715B1 rice
yellow is too long
MEPLYQLLIKPLSLAMTILLSFVLWKAFFICWVLPTRAYNKLRKSGFGGPIPCFPLGNIR EMTMTKKKIRSSSPSLEYISHDIYPIIFPYFSQWRELHGKVFVYWLGIEPFLYIADPEFL TQMSSGVIGKKWGKPNVFKQDRKPLFGNGLLMVEGDNWVHHRHTITPVFLPNNLK (0)
AMGSMMVESATKMIDRWTSLIASGEPEIYVEKDIMRTYSEIIARAAFGVDYRIS QEVFTKLRAMHLTLFKSNRLVGVPFNNIVYLKQTIELIKLSKDVDQLLLSMITNRKMSVV DVDHPQHDLLGFLLEEKSAGDGQLGKKFSDQELIDECKTFFFAGHETTALALTWTLFLLA LHPEWQNQLREEIKQVVGDRPLDPTMVAQLKKMGWVMNEVLRLYPAGPNSQRQAREDIRV GNFVIPNGTNMWIDIVGMNHDPVLWGDDVNEFRPERFKGDINGGCKYKMGFVPFGFGGRM CVGRNLAMMEYKIVLTLILTSFSFSLSPTYHHSPTIMLSLRPAHGLPLILEQLV 
 
>CYP715A18 maker-scaffold_157-snap-gene-12.24-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.07 eAED:0.13 QI:0|0.66|0.25|1|0.66|0.75|4|0|517 
60% to CYP715A1 Arabidopsis thaliana
MEIQLLKPLSLAMASLVVLLVVRALYLWWVLPIRAYRKLKRIGFGGPSPSFPLGNIAEMR KKKSKPSSSPSLNITHDIHSTVFPYFFRWRSLHGKVFIYWLGTEPFLYIADPGFLKQMSS GVAGKKWGKPSVFKYDRKPMFGNGLVMVEGDDWVHHRHTITPAFSPNNLKAMGSIMVESA TKMIDQWNFRIANGEKEIDVERDIISTAAEIIANTAFGINCENGQEVFRKLRALQLTLFE SNRMVGVPFSDVLYLKQTMQSRQLGKEIDQLLLSIITSRKMSSRVDAQVNLLGLLIAENE EGDGRRVVKKLTDRELVDECKTFFFGGHETTALALTWTFLLLALHPEWQNQLREEIKQVV GDEPLDPTMLAKLKKMGWVMNEVLRLYSPAPNVQRQAREDICVGDLIVPNGTNMWIDVVG MHHDPDLWGDDVNQFRPERFKKDSTHGGCKHRMGFLPFGFGGRMCVGRNLTMMEYKIVLT LILSEFSFSLSPSYRHSPAILLSLRPTHGLPLLLQPL 
 

CYP716 family (5 genes, 3 pseudogene)

 

>CYP716C7 maker-scaffold_377-snap-gene-1.7-mRNA-1 protein Name:"Similar to CYP716B2 Cytochrome P450 716B2 (Picea sitchensis)" AED:0.05 eAED:0.09 QI:0|0.5|0|1|0.5|0.33|3|0|437

72% to CYP716C1 Poptr
56% top CYP716A maker-scaffold_9-augustus-gene-34.9
56% to maker-scaffold_235-snap-gene-3.24
55% to maker-scaffold_235-snap-gene-5.32
contig07693 matches and fills in the gap

MELFFLSLSVLLIVVSLALSFYAYRSSKVGGATKLPPGSLGWPIIGETLEFVFGKPEKFV GDRMKKYSSDIFKTKIFGEPTAVICGPAGNKFLFSNEQKLVVAWRPHPMQRXFRSYQQQA SAPXAVPPKRGEETKVLRSPGFLKPEALVRYLGKMDSISQHHLQTYWEGRDEVKVFPLAK TFTLTLASRFFLGIEDPERVAKLVSKFDDMTLGMHSIILNFPGTQFYRGSKAAIEVRKEL

QLVIKEKKTAMATGAQMQDILSHMI 166048

VATEPTGRLMPEAEIA

DKIMGLLVAGYSAVATAITFFIKYVGERPDIYEKILS

EQKEIYLSKKAGDALEWDDIQNMKYSWNVVLEAMRLTPPLQGTFREAITDFTYAGYTIPKG

WKVYWTVSSTNKNPEYFPEPEKFDPTRYDEGTGFPIPYTLVPFGGGPRMCPGKEYARLAVL

TFIHNVVKRYKWEVVFPEEKIIGDMMPTPAKGLPIRLHQH*

 

>CYP716E5 maker-scaffold_235-snap-gene-3.24-mRNA-1 protein Name:"Similar to CYP716B2 Cytochrome P450 716B2 (Picea sitchensis)" AED:0.10 eAED:0.10 QI:0|0.66|0.5|1|1|1|4|52|395

NNU_025054

59% to CYP716E1 Poptr, revised seq complete
88% to CYP716E maker-scaffold_9-augustus-gene-34.9-mRNA-1

MELFLLSLLLLVALLISLSLRYLVYKRKSNPSGGKLPPGKMGLPFVGESIQFLSLGRKGT PEKFMYDRMAKFSKEVFRTSLFGENTAVFCGPSGNKFLFSNENKLVTAWWPRSVEKIFPS

STQTSSKEEAKKMRKLLPQFLKPEALQRYIGIMDSIAQRHFKAGWDDRDEVTVFP

LAKRYTFWLACRLFLSIEDPDHVAKFADPFNALASGIFSIPID

LPGTSFNKGIKASDEIRKELLAIIKQRKIDLAENRASPTQDILSHM LLYTDEDGHFMNERDIADKILGLLIGGHDTASAAITFVMKYLAELPDIYNQVLQEQMEIA KCKAPGERLNWDDMQKMRYSWNVASEVMRLAPPLQGAFREALMDFTFAGFCIPKGWKLYW AANSTHRNPEYFPEPEKFDPSRFDGTGPVPYTYVPFGGGPRMCPGKEYARLEILVFMHNV VKRFRWEKILSDEKIIVNPMPMPAKGFPVRLHAHK

 

>CYP716E6 maker-scaffold_235-snap-gene-5.32-mRNA-1 protein Name:"Similar to CYP716B2 Cytochrome P450 716B2 (Picea sitchensis)" AED:0.04 eAED:0.04 QI:0|0.66|0.5|1|0.66|0.5|4|45|468

NNU_025062

59% to CYP716A1 Arabidopsis thaliana complete, 56% to CYP716E1 Poptr
93% to maker-scaffold_235-snap-gene-3.24 tandem duplication
85% to maker-scaffold_9-augustus-gene-34.9
71% to maker-scaffold_9-augustus-gene-36.14

MELFLLSLLLLVPLIVSLSLYKHKSNPSGGKLPPGKMGLPFVGESIQFLSLGRKDTPEKF MYDRMAKFSTGLQKTAVFCGPSGNKFLFSNENKLVTACWPRSVDKIFPSSTQTSSKEETK KMRKLLPQFLKPEALQRYIGIMDSIAQRHFKAGWDDRDEVTVFPLAKRYTFWLACRLFLS IEDPDHVAKFADPFNALASGIFSIPIDLPGTSFNKGIKASDEIRKELLAIIKQRKIDLAE NRASPTQDILSHMLLYTDEDGHFMNERDIADKILGLLIGGHDTASVAITFVMKYLAELPD IYNQVLQEQMEIAKCKAPGERLNWDDLQKMRYSWNVASEVMRLAPPLQGAFREALMDFTF AGFCIPKGWKLYWAANSAHRNPEYFPEPEKFDPSRFDGTGPAPYTYVPFGGGPRMCPGKE YARLEILVFMHNVVKRFNWEKTLSDEKIIVNPIRMPAKGFPVRLHAHK

 

>CYP716E7 maker-scaffold_9-augustus-gene-34.9-mRNA-1 protein Name:"Similar to CYP716B2 Cytochrome P450 716B2 (Picea sitchensis)" AED:0.04 eAED:0.04 QI:33|1|1|1|1|1|3|162|485

NNU_004859

58% to CYP716A1 Arabidopsis thaliana complete, 57% to CYP716E1 Poptr
75% to maker-scaffold_9-augustus-gene-36.14

MSSNDMELLFLSLLLLVVLFLSLSLRYLVYKHTSHAPGKKLPPGRMGLPFVGESIEFFSL GRKGIPEKFFFDRMAKFSKEIFKTSLLGENTAVVCGPNGNKFLFSNENKLVTAWWPRSVD KIFPSSTQTSSKEEAKKMRKLLPQFLKPEALHRYIGIMDTIAQRHFKASWDDRDEVTVFP LAKRFTFWLACRLFLSIEDPDHVAKFADPFNALASGIISIPINLPGTPFNKGIKASNEIR KELLAIIKQRKIDLAENRASPTQDILSHMLLYTDEDGQFMNERDIADKILGLLIGGHDTA SAAITFVMKYLAELPEIYNEVYKEQMEISKSKPPGERLNWDDLQKMRYSWNVASEVMRLA PPLQGAFREALMDFTFQGFSVPKGWKLYWAANSTHRNPEYFPEPEKFDPSRFDGSGPAPY TYVPFGGGPRMCPGKEYARLEILVFMHNVVKRFKWDKILPNEKIIVDPMPMPAQGLPIRL

HAHKA

 

>CYP716E8 maker-scaffold_9-augustus-gene-36.14-mRNA-1 protein Name:"Similar to CYP716B2 Cytochrome P450 716B2 (Picea sitchensis)" AED:0.01 eAED:0.01 QI:323|1|1|1|1|1|3|327|488

NNU_004866

57% to CYP716E1 Poptr
75% to maker-scaffold_235-snap-gene-3.24
71% to maker-scaffold_235-snap-gene-5.32

MSDNDMELFFLSLLLLLALFLSLSLRFSLRYFVCKYKRTGGAYLPPGSLGWPVVGESLEF LSTGRNGTPEKFFEDRMKKYSPEVFKTSLLGEPAAVFCGAGGNKFLFSNENKLVTSWWPR SVEKIFPTSLQTSTKEEAVKMRKLLPSFLKPEALQKYVGIMDIVARRHLDASWDGKEQVT VFPLVKRYTFSLACRLFMSIEDPDHVAKFADPFHVLAAGVMSLPINLPGTPFNRAIKAAQ LIRKELLAIIRKRKTDLAEKTVSSTQDILSHMLTTTDESGKFMNELDIADKILGLLIGGH DTASAAITFIMKYLAELPEIYNEVLKEQTEIAKSKASGELLTWEDIQKMKYSWNVACEVM RLAPPLQGTFREALTDFTFAGFSIPKGWKLYWTSNSTHRNPKYFPEPLKFDPSRFEGNGP APYTFVPFGGGPRMCPGKEYARLEILVFIYHLVRRFKWENALPDEKIIVDPMPQPAKGLP VRLQPHKP

 

>CYP716R1P pseudogene maker-scaffold_29-augustus-gene-1.17-mRNA-1

protein Name:"Similar to CYP716B2 Cytochrome P450 716B2 (Picea sitchensis)" AED:0.20 eAED:0.24 QI:0|0|0|1|1|1|3|0|346

42% to CYP716D1 Poptr, missing C-term
43% to CYP716B1 Picea sitchensis
44% to CYP716E maker-scaffold_9-augustus-gene-36.14-mRNA-1
sequence gap at WELM
78% to maker-scaffold_0-snap-gene-49.14
79% to maker-scaffold_67-augustus-gene-4.23
142097

MEFLLEHLLYLFLAVAAHAYLVVLRCIRHRYPQPPLPPGSFGWPILGETLVIQRLNRSGDP

FAFVRQRRQRYNRDIFKTSLLGEKTVVLCGSEGNKLMFTGEKRLLLTWWPPSLKKLFGDA

FFTAPYEKAIHTRKLITSFLNQEVMY*LMERFDRTCRECFRDDWIGKKEVKAFPLIKKYA

FAIA*DVFASMDDP &

IPEEFNVLLKGMFQLPIYFLGTRHYKAVKSAASLRRELIKVIESKRRSGTMNESLSED

LISHLMKGRDENGKMLSDEEIADNVILVMDAGHNTSSSTMMMLIKYLARM

VSILGLTLNCCLGEQREIELQRRPREPLNKDDIQKMTYSWN

VVDEVLRLTPPIQGNFRKAIVDFPYAGFSIPKDWK

WSATSTHKEAEYFPNPEKFDPLRLERDIPIP &

YTFIPFGGGP &

PRM*PGREFAR &

IEILVFLYNLVREFRWELM 140614

 

>CYP716R2P maker-scaffold_0-snap-gene-49.14-mRNA-1 protein Name:"Similar to CYP716B1 Cytochrome P450 716B1 (Picea sitchensis)" AED:0.32 eAED:0.32 QI:0|0|0|0.4|0.25|0.4|5|0|265

43% to CYP716B1   Picea sitchensis aa 121-467
44% to CYP716E maker-scaffold_9-augustus-gene-36.14-mRNA-1

1208 VTWWPPSLKKLFVDAFFTSPYEKAIHTRKLITSFMNQEMMYQLVERFDRMCRECFRDDWI 1387

1388 GKKEVKAFSLIKKYAFAIACDVASMGDPSRQSHLLEEFNVLLRGVFQLPIYFFR 1549 &

1552 TRHYKAVKSMANLRRGLIKVIESKQRSETMSESSSKDLISHLMKGRDENGKILNDEEI 1725

1726 ADSVILMSG 1752 &

1752 HDTSSSTVMMLIKYLAEMPYCYR*V 1826

1915 LAEQREIELQRRPGEPLNKDDIQKMTYSLNVVNEVRKLTPPIQGDFRKTIVDFTYDGFSI 2094

2095 PKDWK 2109

2196 VCWSATSTHREAEYFPNPKKFNPLRFERDILVPYTFIPYGGGPKMCPSREFARVEI 2363

2364 LVFLYNLVRESRWELI 2411

 

>CYP716R3P pseudogene maker-scaffold_67-augustus-gene-4.23-mRNA-1

protein Name:"Similar to CYP716B1 Cytochrome P450 716B1 (Picea sitchensis)" AED:0.37 eAED:0.37 QI:0|0|0|0.5|1|1|2|0|127

41% to CYP716D1   Poptr, EXXR to PKG
80% to CYP716 maker-scaffold_0-snap-gene-49.14

383032 VTWWPPSLKKLFDNVFFTAPYEKVIHT*KLITSFVNQEVMYQLVERFDRTCRECFRDDWIGK

KEVKAFPLIKYTFTIACDVFVSMDDPSWQSHLLEEFNVLPRGVFQFPIYFPSTRHYKAM

KFVANLH*ELIKVIESKRRSGT

MSESSSKDLISHLMKERGENGKTLSNKEIADNVILV 383568

MDAGHDTNSSTMMMLIKYLAEMPDCY**VL &

SAEQREIELKRRPREPLNKDDIQKMTYSWNVVNEELRLTPSIQGNFRKAIVDFTYAGFSIPKDWKVSS &

TSTHKEV &

(54 aa deletion)

RMCPGREFA*VEILVFLYNLVREFRWELII 384143

 

>CYP716R4P scaffold 60 697678-698217 (+)

82% to CYP716 pseudogene maker-scaffold_67-augustus-gene-4.23, 
38% to CYP716D1 Poptr
LITSFLNQEVMYQLVERFSRTCRECFRDDWIGKKEVKAFPLIKKYSFAIACNVFASIDDPIRQSHLLEEFNMLLIGMF*LPIYFPGTRHYKVVKFVANLCQELIKVIESKRRSGTMSESSSEDLISHLMKGRDENRKILSNEEIIDNVILVMDVVHDTNSSTMMMLIKYLVEMPDCYQRV

 

CYP718 family (1 gene, 0 pseudogenes)

 

>CYP718A10

contig_24794 98705-101655 (-) strand

          Length = 109442

60% to CYP718A1 Arabidopsis thaliana

101655 MALEMDSVPSLVLSVLAILVTLIFLMSTSKKKNSINRSSNKKLPPGEMGLPWIGETL 101485

101484 EFHKAQRSNRLLEDFIQPRMTKHGNIFKTRLMGSPTVLVSGAEANKFFLSNEFKLVVSSW 101305

101304 PSSSVQLMGTDCIMQKQGERHRCIRGAIASSLSCTGLEALVPKICSSIDKHLSKDWHG 101131

101130 RDTVSLYPSVKKLSFSIVLECLLGIDVEPGMLEMFEGVVEGAFAAPVNLPGCRFWRAK 100957

100956 KARLEIEKKLVGVVRRKREEMEQKVRREEERRLLSGLVLGLMKGEMSEKEVVDNVV 100789

100788 LLVFAAHDTTSFAIAMICRMLALHPNCHSRLVE () 100690

 99319 EHVEIAGSKRPGENLTLEDTKKMKYTWQVARESMRMFPPIFGSFRKAIVDIEYEGFTIPK 99140

 99139 GWK (0)

       VLWTAYGTHYDSQCFP 98960

 98959 EPLHFNPSRFEEPIPPYAFVPFGGGPRLCAGYQLAKLNILLFLHFMVTHYDWSLLHKDET 98780

 98779 ITADPLPFPSQGMPIKIAPKQPCK* 98705

 

>CYP718A10

maker-scaffold_80-snap-gene-8.20-mRNA-1 
protein Name:"Similar to Taxadiene 5-alpha hydroxylase (Taxus cuspidata)" AED:0.03 eAED:0.03 QI:205|1|1|1|0.5|0.66|3|93|485 MALEMDSVPSLVLSVLAILVTLIFLMSTSKKKNSINRSSNKKLPPGEMGLPWIGETLEFH KAQRSNRLLEDFIQPRMTKHGNIFKTRLMGSPTVLVSGAEANKFFLSNEFKLVVSSWPSS SVQLMGTDCIMQKQGERHRCIRGAIASSLSCTGLEALVPKICSSIDKHLSKDWHGRDTVS LYPSVKKLSFSIVLECLLGIDVEPGMLEMFEGVVEGAFAAPVNLPGCRFWRAKKARLEIE KKLVGVVRRKREEMEQKVRREEERRLLSGLVLGLMKGEMSEKEVVDNVVLLVFAAHDTTS FAIAMICRMLALHPNCHSRLVEEHVEIAGSKRPGENLTLEDTKKMKYTWQVARESMRMFP PIFGSFRKAIVDIEYEGFTIPKGWKVLWTAYGTHYDSQCFPEPLHFNPSRFEEPIPPYAF VPFGGGPRLCAGYQLAKLNILLFLHFMVTHYDWSLLHKDETITADPLPFPSQGMPIKIAP 
KQPCK

 

>CYP719A22 family no introns

55% to CYP719A1 Coptis japonica

probably catalyzes the formation of the methylenedioxy bridge

Known alkaloids in lotus that contain a methylenedioxy bridge: anonaine and roemerine

scaffold 2  1660526-1659039 (-)

MQGNQGLILASVIFVVAIVQMMIRKRR

TSPTAMKWPAGPRKLPIIGNMHQLSRADGLFHVALTKLAKVHGSVMTIWLGSWRPTIVVSDDEVAWEVLVNKSSD

YAARDHPYIDKIMWAGARTIHTSDASPHWHSLRKGLQSGGLGPLSISGQTHLQEKDIAQMLRDMREEASLNGGLV

KPFHHIRRTSVRLLCRLCFGPNFEDAKFSEAIDKAIEDIIRISGVGYLADAFFFGRHFPGLKHTFQEACDLKRRV

EDLIRPFLRAVPPPNCYLHFLLSNNIPEDVTIFTILEVFTLGIDSTSSTATWALALLTNEQRVQQKLYQDIKKNI

DSTQQIVRVEDVSKLQYLQAAVKETLRLKPVAPLVPHMTATETTLMGTKVAQGTRVVVNLHAIHYNPNVWPEPE

KYMPERFMPRQEEVDEIRPGTTKLSYFLPFGGGMRACAGMEVGKLHVGFVIANIVNAFQWSSAVEGQP

PDLTEDFKFVLLMKNPLTVRITARHP*

 

CYP720 family (1 genes, 0 pseudogenes)

 

>CYP720A6 maker-scaffold_280-augustus-gene-4.22-mRNA-1 protein Name:"Similar to CYP720B1 Abietadienol/abietadienal oxidase (Pinus taeda)" AED:0.09 eAED:0.11 QI:316|0.75|0.66|1|0.5|0.33|9|0|449
68% to CYP720A1   Arabidopsis thaliana, revised seq is complete
479107
MEENFPLAWSLTIGTLLLIVFLVKLLKDRRERVDGRTSKLPPGRRGWPLLGDSINWISSV ASSHPPRFVEEQVKRYGRIFSCSLFGKWTIVSADSTFNRFIMQNEGKLFQSSYPKSFRDL VGKNGVITVQGEQQRKLHGIASNMMRLEKLKLHFLTDIQMVMLQTLNNFQNNQVILLQDV CRKAIQVAIHLMVNQLLGTSSESEINEMAKLFSNFVDGCLSVPIRIPGSAFHTAMQ (0)
480409

480562

ARETIINKINKKIEFMKRKQPATESGSNGVLGRLIEEESLPDEAIADFIINLLFAGNETTAKTM LFAVYFLTQSPKALNQLMEEQDKLRSATSDDPVMLTWEDYKSMAFTQCVIDETLRLGGIA IWLMREAKVEVQYEDFIIPKGCFVVPFLSAVHLDETLYKGALNFNPWRWMDPENQ (0)
EKRNWRSSPFYTPFGGGARFCPGSELARLQIALFLHYFVTQYR (2)

WTQIKEDRMSFFPSARLVNGFQIRINKRADEVSVSMH* 484856

 

CYP721 family (1 gene, 0 pseudogenes)

 

>CYP721A29 augustus_masked-scaffold_13-processed-gene-52.1-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.06 eAED:0.06 QI:0|1|0.33|1|1|1|3|0|533 
56% to CYP721A1 Arabidopsis thaliana
MHLLVTGVFFLLLYILLRSIHSLIWVPWKTQLHFRNQGIRGPGYRLIFGNAAEIRGLIAE AQAKPMMPVSHEIIHRVMPHYHTWSTIYGKTFLYWFGPKPRLAIADPDMIKEILLNTNGA FGKIGFNPLSKQLFGDGLVGLEGEKWARHRRITNQAFNMERVKEWVPEIVASTLKMLKKW EEKRGERDEIEIEVNRELHNLTADIISRTAFGSSYEEGKHIFQLQEQQMHLVSQALRSVY IPGFRFVPTKKNRRRWKLEKEIRESLRRLIEINGETSQNSRNLLGLLMSTNRNQSETEKT EGLSVEEIIDECKTFYFAGKETSANLLTWAILLLALHQEWQSKARQEVDCVCGDVGLPTA 
ENLNDLKI (0)
VSMIINEALRLYPPAVMLMRQTNK GVKLGKLNIPANTQLYLAMTAVHHDPEIWGEDADEFNPLRFNNPKKHLASFFPFGLGPRI CVGQNLAVVEAKVLLTIIIRRFSFVPSPSYVHAPMQFLTIQPQYGAQVVFRKV 
 
CYP722 family (1 gene, 0 pseudogenes)
 
>CYP722A6 maker-scaffold_33-snap-gene-30.12-mRNA-1 protein Name:"Similar to CYP707A4 Abscisic acid 8'-hydroxylase 4 (Arabidopsis thaliana)" AED:0.04 eAED:0.04 QI:51|1|1|1|0.33|0.4|10|346|481 
64% to CYP722A1   Vitis vinifera. complete
MTFIHAFLPLGLHLCSVLVIAFWLFRTTQKILLCRNKSTDNIPPGTGGLPLIGESLQFLS ANSSAKGLYHFVHIRRLRYGNCFKTNIFGKTHVFVSSVESAKAILSNDFVNFTKRYVKSI SELVGDQSILCATQEYHRLIRGRLSNLFTMDSTSSFIKHFDHLIVTTLRSWEHKQTVVVL DDALKVTFQAICKMAISLENPNELEMLQKDVGQVCEAMLAFPLNLPYTRFRAGMKARKRI MEMLKKIIDERRQGCGECHEDFIQSLVSEDEKLGCKLTDSQVQDNILTMIIAGQITTASA MTWMVKYLDENQEIQHTLRAEQQLMLADKNPCGSPLTIEDLNAMPYASKVVRESLRMASV VPWFPRVALKDCEIEGFKIKKGWIVNIDARYIHLDPTVYHDPSEFYPSRFDDESKPYSFL AFGTGGRTCLGMNLAKAMMLVFLNRLVTTYRWKVMDPDSSLEKWVLFARPRTGCPIRVTR V 
 

CYP724 family (2 genes, 0 pseudogenes)

 

>CYP724B18 maker-scaffold_5-snap-gene-26.28-mRNA-1 protein Name:"Similar to CYP724B1 Cytochrome P450 724B1 (Oryza sativa subsp. japonica)" AED:0.15 eAED:0.15 QI:202|0.75|0.77|1|0.5|0.55|9|259|480

63% to CYP724B1 Oryza sativa, short at KERKE needs about 16 aa

MVGIGVLLLLPLLLATSLGLVLAFVFLQSLFLKQEPINNLPHGSMGWPFQLGETLAFLRP HQSNTRGSFLDDHCSRYGKIFKSHLFGCPTIVSCDHELNMFILQNEEKLFQCSYPKPIHG

2591560 ILGKHSLLVVVGDVHKKLRSFALSLASTCKSKPEYLHDIEKLAISLMESW

KERKE (0)

FTFNLIVKEILSMEPEDPVASKILKDFLTFMKGLVSLPIYIPGTPYAKAVK 2591125

ARARISSTVSSIIKEREKVDVGLKKGDFLDVLLSNASLNDEGKVSIVLDLLLGGYETTSILMALTVYFLAHSPH ALEHLKEEHEAIRKYKPEKESLNWEDYKQMEFTQNVVINEALRCGNVVKFVHRKAIKDVN FKGYFIPSGWKVLPIFTAVHLDPSLHENASEFNPWRWVGQAPGKNFSPFGGGLRLCPGAE LAKVETAFFLHHLVLNYRWRTKGEDYPLAYPYVEFKRGLLLEMEPLETRLPEGNPSSDRR

 

>CYP724B19 maker-scaffold_74-augustus-gene-15.14-mRNA-1 protein Name:"Similar to CYP724B1 Cytochrome P450 724B1 (Oryza sativa subsp. japonica)" AED:0.09 eAED:0.09 QI:339|1|1|1|1|1|9|306|478

71% to CYP724B1 Oryza sativa
65% to CYP724B maker-scaffold_5-snap-gene-26.28-mRNA-1

MVEGVCFVVLVGLLGAALGLVFNHFLPLLLKLGVAPRGTFGWPLFGETLSFLKPHASNAL GTFLLDHCSRYGKVFKSHLFFSPTVVSCDQELNYFILQNEDKLFQCSYPKPIHGVLGKSS

1576336

LLVVVGDTHKRLRNVALTLVSTTKSNPEYLNDIERTAIHILDSWKGKQV (0)

1576732 FTFNVIVKQVLGLTPDEPRTAEILGDFLAFMRGLISFPLYIPGTPYARAVQARTRISSTIKA IVEERRRNGGNSNKNGDFLEILLSVNNLSEDEKVSFVLDSLLGGYETTSLLMAMAVQFLA HSPAALEQLKLEQQNIRSIKKHGDEYLNWEDYKKMEFTQNVINEALRCGNIVKFVHRKAL KDVRFKDYVIPSGWKVLPIFSAVHLDPSLHGSALQFDPWRWENAGQTCKKFMPFGGGPRF CPGSELAKVETAFFLHHLVLTYRWRTEGDDQPMAYPYVEFQSGLQLRVDPILSNRQVN

 

CYP727 family (1 gene, 0 pseudogenes)

 

>CYP727B6 maker-scaffold_200-snap-gene-3.33-mRNA-1 protein Name:"Similar to CYP97B2 Cytochrome P450 97B2, chloroplastic (Glycine max)" AED:0.09 eAED:0.09 QI:226|1|1|1|0.66|0.85|7|378|588

58% to CYP727B1 Populus trichocarpa

MLQMTTCEAPGSMLGFIWKRDQLGSGTCRAEGDSPLFSDFVAREINALSWLFLILITSLL LGKVIRLVRLWANGSKIPGPPCPSLYGHLKLISGANSGGNLIDFLSKSHEKYGSIVRLWL GPTQLLVSLNDPELIKEMLVKAEDKLPLTGRTFRLAFGRLSLFVPSFEKAQKRRQSLAMQ LNGKLLDRANMITLKVVDSVMERIHSLMPKEVLDCRSVSQHMAFSILGSMLFGDAFFAWS DAIVYEDLLMMIAKDAYLWASYSVPPFWKTGFWRYQCLCRRLKNLTQDIVQLCRETCKFF GQMDQNHHDERAHIGKEVAKGAISYSGGLLADDLFLEELNGHFITRDEPCGNIMGMMFHG CLTMAGLIANILTRLVMHPDIQDKIYSEIIMMRRESSNPELQNVDKMHFLLATVYESARL LPAGPLLQRCSLKHDLKLKTGITVPAGTILVVPVQLVQIDDSCWGSDASQFNPYRFLSKV VKTGDSMPKMPCTGAAKDLAGAGDGSFVVNDPNANEAFLPFGSGARVCVGQKLAIRGIST LFTSLLEQYEVRLQPGTENDPKPTMNNCVLQLLPSPKIIFVRRTKVRK

 

>CYP727B7P pseudogene scaffold 200

65% to CYP727B maker-scaffold_200-snap-gene-3.33
19 kb from parent CYP727 gene

323639-323806 (+) aa 439-489

QDLKLKTCITVPAGAVLVVPVQLLQVDDSSL*SDFSQFNPYCFLSKVEKTGKSVSK

325227-325265 (+) aa 506-518

SFVLNDPNVNEAY &

325267-325365 (+) aa 519-551

LPFGSGTHFCIG*KLAIHGISRLFASLLEQYEV

 

CYP734 family (2 genes, 0 pseudogenes)

 

>CYP734A24a maker-scaffold_12-augustus-gene-69.23-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.11 eAED:0.11 QI:203|1|1|1|1|1|5|326|539 
58% to CYP734A2 Oryza sativa complete
MEENWFWQPVLVFLVLVLVLKIMGLLWWRPRRIEEHFSKQGIKGPHYRFFVGNVKELVEL MLKASSQPMPLSHNILPRVLSFYHHWKKIYGATFLVWFGPTPRLTVTDPDLIREIFAQRS EFYEKNDSHPLVRQLEGEGLLTLKGQKWAHHRKIISPTFHMENLKLLIPVMGKSVVEMSE KWSEMSNSGEVEIEVSDWFQTLTEDVITRTAFGISYEDGKAIFQLQAQQMLYAAEAFQKV FIPGYRFLPTKKNRSSWKLDKEIKKSLMKLIERRKENSCNETPDGGSSPKDLLGLMIKAS ENETTRTMSGSSSSSNSPSSTITVGDIVEECKSFFFAGKQTTSNLLTWTTVLLAMHPEWQ ELGRQEVLRVCGPHDIPTKDDVAKLRKLSMILNESLRLYPPAIATIRRAKADVELGGYKI PRGTELLIPIIAVHHDQGLWGNDANEFNPARFSDGVARAAKHPMAFIPFGVGARTCIGQN LAILQAKLAMAIILQRFSFRLAPSYQHAPTVLMLLYPQYGAPIIFRRLSSPTASTDQGS 
 

>CYP734A25P scaffold 157 1143688-1143882 (+)

84% to CYP734A maker-scaffold_12-augustus-gene-69.23 aa 126-190
45% to CYP734A2 Oryza sativa (rice)

TPCLTVIDPDHIREIIALRSEFYKKNDSHQLVKQLEGEGLLTLKGQKWAHHRKIFSPSFHMENLK

 
>CYP734A24b maker-scaffold_6-augustus-gene-61.10-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.09 eAED:0.10 QI:139|0.6|0.66|1|0.8|0.83|6|296|543 
59% to CYP734A2 Oryza sativa, GC boundary at PGYR
revised seq. complete
MEDNFSWFWMPVLWFLVPLFVLKIVGLLWWRPRRIEEHFSKQGIRGPPYHFFIGNIKELV GLMLKASSQPMPLSHNILPRVLSFYHHWKKIYGPTFLVWFGPTPRLTVSDPDLIREIFAL RSEFYEKNESHPLVRQLEGDGLLSLKGQKWAHHRKIITPTFHMENLKLLVPVIGKSVVEM LDKWSEMSNSGEVEIEVSDCFQTLIEEVITRTAFGISYEDGKAVFRLQAQQMVYAAEAFR 
KVFVPGYR (2)
FFPSEKNRSSWRLDKEIKKSLVKLIERRKENSCNEMLDGCPK DLLGLLIRASTNETAQRKPSSPPSTITVHDIVEECKGFFFAGKQTTSNLLTWTTVLLAMH PEWQELAREEVLRVCGARDIPSKDDITKLKMLSMIVNESLRLYPPAIATIRRAKADVELG CYKIPRGTELLIPIIAVHHDQGLWGNDANEFNPARFSDGVARAAKHPMAFIPFGLGARTC IGQNLAILQAKLAIAIILQRFSFRLAPNYRHAPTVLMFLYPQYGAPIIFRHLSGPTTSSD 
HGS*
 

CYP735 family (2 genes, 0 pseudogene)

 

>CYP735A21a maker-scaffold_39-augustus-gene-15.15-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.09 eAED:0.09 QI:158|1|1|1|1|1|5|142|517 
68% to CYP735A2 Arabidopsis thaliana
MASVVLLGLVVVLVVSLIRVGYVTISCYWLTPRRIKKFMEKQGITGPKPRFIVGNLVDVA ALVASATSKDMDSIHHDIVGRLLPHYVLWSKQFGKRFIFWNGSEPRMCLTETEKIKELLS SKCVSISGKSWLQQQGTKHFIGRGLLMANGDDWYHQRHIVAPAFMADKLKNHVGYMVECT KQMLQSLRSKVESGETEVEISECMSQLTGDIISRTEFDSSYEKGKRIFHLLNSLQRLCAQ STRHLCFPGSRFFPSKYNREIKSLKMEVEKLLMEIIQRRKDCVEIGRSSSYGNDLLGMLL AETQKKRAGGFSFTLQMLMDECKTFFFAGHDTTALLLTWTIMLLATNPEWQDKVRAEVLQ VCNGEAPTIDQLSKLSLLNMVINESLRLYPPASLLPRMAFEDIKLGDLHIPKGLSLWIPV LAIHHSEELWGKDVHEFNPERFSGKSFAPGRHFIPFAAGPRNCVGQSFALMESKIILAML LSQFSFTISKNYRHAPIMVLTLKPKHGVQICLKPLNP 
 
>CYP735A21b maker-scaffold_1-augustus-gene-124.22-mRNA-1 protein Name:"Similar to CYP72A1 Secologanin synthase (Catharanthus roseus)" AED:0.06 eAED:0.06 QI:65|1|1|1|0.75|0.8|5|221|519 
68% to CYP735A2 Arabidopsis thaliana
MAMVVLVGLLLQVVLLCLFAIVSYVTISCYWLTPRKIKKFMEKQGVRGPKPRFLVGNLID VAALVSSASSMDMDSIHHDIVGRLLPHYVNWSKQYGKRFIFWNGSEPRMCLTETDMIKEL LSSKYVSLSGKSWLQQQGSKHFIGRGLLMANGDDWYHQRHIVAPAFMADKLKNHVGYMAE CTKKMLQSLHTKVESGETEVEIGEYMSQLTGDIISRTEFNSSYEKGKQIFHLLTSLQHLC AQSSRHLCFPGSRFFPSRFNREIKSLKMEVEKLLMEIIQSRKDCVEIGRSTSYGNDLLGM LLAETQKKRASGFNFTLQMLMDECKTFYFTGHETTSLLLTWTTMLLATNPTWQEKVRTEV FQVCGGEAPTAEQLSKLNLLNMVINESLRLYPPASLLPRMAFEDIKLGDLHIPKGLSIWI PVLAIHHSEELWGKDVHEFNPERFAGRPFAPGRHFIPFAAGPRNCVGQSFALMESKTILA MLISRFSFTISKNYRHAPVMVMTLKPKHGVQICLKPLNP 
 

CYP736 family (0 genes, 2 pseudogenes)

 

>CYP736A99P pseudogene join two models

augustus_masked-scaffold_1-processed-gene-119.3-mRNA-1 protein Name:"Similar to CYP71A1 Cytochrome P450 71A1 (Persea americana)" AED:0.35 eAED:0.36 QI:0|-1|0|1|-1|1|1|0|141

55% to CYP736A1 Pyrus communis (pear) mid to EXXR

CYP736A augustus_masked-scaffold_1-processed-gene-119.4-mRNA-1 protein Name:"Similar to CYP750A1 Cytochrome P450 750A1 (Pinus taeda)" AED:0.31 eAED:0.33 QI:0|0|0|1|1|1|2|0|176

CYP736 pseudogene C-term half revised

50% to CYP736A1   Pyrus communis (pear)
scaffold_1 11906915-11907769 (+) strand

GLSRDMKKVSKLLDEFLEKIIDEHVQYTNNHQGHHRDFAHVMLSLMEPQDAAKELSNIIGIDRTNIKA IILDMLVGAMDTSATAIEWGFSEILRHTRVMKRVQEELREVVGMDRLVEDLIRLEDLDMV MKESMRLHPVAPLLDPTT*VHGGRHSERIPYTKEISIVF*SMFGPLDGTLASVWSENADQ EFIPERFMGTDVDLRGRDHFQLLPFGSGRRSCPGMQLGLTVIRLVLAQLMH*LL*LGASK LNGMSSPSDLDMREKFGPSVPRANHLLAIPKYFPHL*

 

>CYP736A100P augustus_masked-scaffold_1-processed-gene-119.5-mRNA-1 protein Name:"Similar to CYP71A28 Putative cytochrome P450 71A28 (Arabidopsis thaliana)" AED:0.14 eAED:0.16 QI:0|0|0|0.66|1|1|3|0|313

CYP736A pseudogene revised
56% to CYP736A1 Pyrus communis (pear)
scaffold_1 11909752-11923493

VVVIVSVLKLWYGQQRLPPGPPGLPVLGNLHMLGQL PHRDLHRLANKYGPIMYMRLGLVPTVVVSSPEAAALFLKTHDLAFASRPTLKAFEYMAYG SKGLAFSKYGPYWRFIRRLCTTELFTDSKVHSFKATRKEEFAHFCTSLKQAAEADMIVDL

KEKI*SLIEDMSFRMIIGSKHSDFSLKPVVREFFRLGGTFNLSDYIPFVVALDLQ (0)

GLARRMKEVRVRFDEIMEKIIDQHEQDAKEEKDHNRDLVDTMLSLMAEASSSS KDEQHEQSSGDYCNMDRTDIKANVLNIIGGAIDSSAATIEWAFTELLRHEQVMKNVQQEL QRVVGMNRAVEEDDLAKLEYLDMVVKE &

SLRLHPPGPFLLPRESIEDTTVNGYHIPKNSRV IINVWSIGRDTNVWSEDAHQFNPERFRGSTVDVFGQDFQLIPFGSGRRGCPAIKLGLTVV RLVLAQLVHCFDWRLPNAMLPAADSLDMTEKFGISMSRSSDLLVIPTFRLKNNFGSF*