106 cytochrome P450 sequences VER 1 of Nasonia vitripennis (jewel wasp)

from Reed Johnson Sept. 3, 2007

modified by D. Nelson Sept. 6, 2007

 

CYP2 clan (6 sequences)

 

>CYP15A1 Nv15 502aa 7 exons SCAFFOLD47 plus (1035002-

1035329,1035392-1035680,1036247-1036494,1036763-

1036995,1037055-1037141,1037220-1037361,1037431-

1037609) similar to  Am15A1,  head to head with

Nv305"      "x

59% to CYP15A1 bee cyan ARITLSI = intron at EXXR use

GC boundary instead. Remove EC at intron 3

MLVFVVLAFLLICCFSCLKPKNFPPGPKWLPLIGCVPVFYTLRKKSGFTHLAL

NELAQQYGPVVGLKLGKQRFIVVSSYDLVKKVLMRDEFNGRPSSFFFRVRSFG

KEKG(1)VLFTQGSVWQQQRRFTMRHFKVFGLGGEVMNQRLVSEAQSLVDFLE

ASGKEGPVPMHTAFDIAVLNSLWTMLAGHRFEYDDHKLKEILAVVHKVFK(2)

LTDTVGGIMSHMPFLRFVVPELSGFNELMSNLQKLWGFIGSEIDEHETSLSKD

QPRDLIDAFLMEIRAKGAGSQEDSIFD(1)RENLMILCLDLFLAGSKTTTDSL

AALFSFLALNPHWVKELQQHMDAVIGRDRPPTLADMPLLPKIEAFIAE

(0)AQRFLHLAPLGIPHNTLKDTSLEGYLIPK(0)DTTVLLNFYSANSDKSQW

ENPEEFQPQRFLDEQGKFRQSTGAMAFSLG(1)KRRCLGEGLARNSLFLFFTY

VLQHFDMKLAPGYEPPNLNGIDGFLISPTPYYLVLKPRH*

>CYP18A1 Nv18 527aa 5 exons SCAFFOLD932 minus (53926-

53551,52516-52395,52318-51889,51793-51529,49606-

49219) similar to  Am18A1, head to head withNv306"

"x 77% to 18A1 bee

MFVEHGIQWLYAAIGGTRADAFHTLLVFFGVLVAVRLVQWYRQLRSLPPGPWG

LPLFGYLPFMNGVDMHLRFGELAKKYGSMFSARLGTQLVVVLSDYRIIRETFR

REEFTGRPHTEFINILGGYG(1)IINSEGALWKDQRRFIHEKLRNFGMTYRGT

GKKVMESTIM(0)KEVDLFIRGLEVKEGAPTSVSFSLGMSITNVICSIIMGVR

FKHGDSRFKRFMSLIEEGFKLFGRLSFVNYIPMFRYLPWLQSVKTKLSANREE

MADFFQETVDQHKATFDENNIRDLVDTYLLEIEKAKAEGREDKLFQGKNHD(1

)RQLQQILGDLFSAGMETVKTTLEWAVILMLHHPEAARAVQEELDQVVGRQRM

PSLEDLPFLPITEATILEVLRRTSIVPLGTTHATTR(2)EVNLNGFTIPSGSQ

VVPLLHAVHMDEELWEEPAKFQPSRFLTAEGKVHKPEYFMPFGVGRRMCLGDV

LARMELFLFFSTLLHTFDFRLPEGACLPSLKGNAGVTVTPDPFRVCLIRRDRD

VPLRSAGSK*

>CYP303A1 Nv303 495aa 10 exons SCAFFOLD39 plus

(406277-406373,406464-406715,407137-407303,407574-

407635,407723-407903,407986-408094,408179-

408359,408551-408668,408761-408899,409153-409331)

similar to  Am303A1,  Can't find M on N-term, 1st

exon may be wrong"   "x 56% to 303A1 bee

FFHSALPTATLILFVLILLYYWGTRKPKGYPPG(1)PKWYPVLGSALEVARLR

KETGYFSEACNILSKKYGSIIGLKIGIDSIIILNDYESMKAMIMNENCDGRPI

GPVYDSRTFGKRRG(1)LLVVDGHLWVEQRRFILRHLRDFGFGRTNMAVQIEF

EATQLVNYYDQLIRDKASD(0)MEDFFGVPVLNTLWCMMAGKR(2)YNIDDKE

LIYLQKIFTTLLRDVDMVGCLFNHFPFLKYVAPEMSGYNKFMETHQQLWKFLK

(0)DELENHKKTFDPATPRDLMDVYLQALQSENHDDTFSE(1)AQLLAICVDL

FMAGSETSSKALCFGFLFLVLNPQVQKKAQQEIDSVIGRERLPSLNDRPR(2)

LTYINAVVLESLRMFMGRTMNIPHRALKDTYIMGHKIPK(0)DSMLVVNFNRI

LMGEFWVDPEEFRPERFIDESGKLVMPDQYLPFSFG(1)KHRCMGEVLAKSNM

FMITAALLQNFTFSPVPGEEPPRNEYTDGVTASPKPFRVLMTRRT*

>CYP305D1 ortholog Nv305 506aa 8 exons SCAFFOLD47

minus (1043510-1043393,1042459-1042205,1042120-

1041886,1041750-1041591,1041467-1041368,1040923-

1040743,1039961-1039705,1038945-1038734) similar to

Am305D1,  head to head with Nv15"  "x

51% to 305D1 bee

MQLNFKILLCNRMVSIIHLYDSSSFFKPSEYSFTVNLFGR(1)PFPWPLVGNM

KELRELSVKLGGQHKALVELSQRYGSPVISLKLGRTTTIVVNGSEGIQTVLGS

EEFDGRPWNFFIKLRNMGKKKG(1)ITMNDGPEWREIRSWFVRSMRSIGFARR

EMSEFIGVELEQILKNIGKGGVRQIKRIIEPAIINVLWTLATGKRFDEDR(2)

LQSFMKLMERRAQAFDMTGGLISAYPWIRHIAPEYSGYNLLVTVNNEFRAVLM

(0)TIEEHKKNFVPGSEADLIDMFLNEMYAGKGPQAE(1)DQLVIILLDILLA

GLNITSTTLQFLFLNVLINQDSQRRLHEEIDSVIGLDKLPEFSDKSK(2)LPY

VEAVILESQRVTPVVPIIGPRRVLRDTKLLDYDIPCESFVIMNLYSMHSDPKL

YPEPRSFKPERFLSNGTRIKDDNLIVFGRG(1)HRQCPGIALAKSALFLLFTG

VMQRYELLPVPGCEPPSLKVKSGITLSPKPYDVLLVPRTTLASDKVGIDS*

>CYP306A1 Nv306 385aa 6 exons SCAFFOLD932 plus

(42940-43088,43160-43365,43583-43880,44149-

44301,44430-44604,44817-44992) similar to  Am306A1,

missing 100aa on N-term, head to head with Nv18,

possible pseudogene?"      "x

60% to CYP306A1 bee, probable ortholog

(1)LIASEGELWRDQRKFVSACLKNFGMVKFPSPKRDQLEKKILVTVDEAVE(

0)KLEARSRGAEGLDSHSILHHCIGNLMNGIVFGKVYDEDDELWKWFQHIQEE

GVKHIGVSGPLNFLPFLR(2)FLPRYGNTIQLIVDGQNKTHQHYRKILEDHRK

FPTEMNSFLATYDEEMKRRMANGEPLASFTETQCFYLLADLYGAGVDTTLTTL

RWFLLFMAAFPDEQ(0)AKIQEEISNVVGEKEPNLEDRPSMPRLEAAIMEVQR

LRSVVPIGIPHGTTE(0)DTHIGDYDVPKGSMIVPFQWAIHLNPLYWSDPRAF

KPQRFIAEDGGLAKPAAFLPFQNG(1)KRMCVGDELARMILILFAARILHRLK

LSAPPGQTVDLEGDCGITLVPKPQTLLFKSRR*

>CYP307A1 Nv307 552aa 2 exons SCAFFOLD52 minus

(278420-277979,273468-272255) similar to  Tc307A1, 

too long?"       "x

41% to CYP307B1 bee, 47% to 307A1 Aedes, probable

spook ortholog

MSTVFWLLFACAAVLAAAFAFLDSWLDRLKALVLAAGLINGKASKLEEDGETL

TTVTTAKKSLRGPRAFPLIGSLHKLGGAGGPFEAFTNMAREYGDIYEIQLGVS

KCVIVSSYKLVKEVLITKGSHFGGRPDFMRFHQLFGGDRNNS(1)LALCDWSD

IQRKRRSIARSFCSPRGGSSQQEELSRVAIDEMAKLLDQLSQPSNTEVLRGEK

AVKPLILGAIGNMFTQYMCSTRFGYSDDQFNRVVRIFDEIFWDINQGYAVDFL

PWLKVFYNRHLDRLNNWATDIRSFILKQIIEPRRASLDLENGVPRDFTDALLL

HLESSESELSWEHIIYELEDFLGGHSAIGNLVMMVLANIVTHPDVQAKIQAEC

DAVLREKYDSSESALVSLKDRFDMPYTEATIWETLRISSSPIVPHVATCDTEI

GGYPVAKDTVIFLNNYDLNLGEAYWGTDSKTFRPERFLKEDEKDDKIVTRVVR

PEHFVPFSTGKRTCIGQRLVQGFAFVVLAGLLSKFDISAPAKVDVKSKLQPSC

VAVPPDCFNLVLTPRTASTHVAAGL*

 

Mitochondrial clan (7 sequences)

 

>CYP12K1 Nv12 527aa 7 exons SCAFFOLD38 plus (926748-

926958,927266-927503,928095-928291,928386-

928587,928691-928847,929016-929264,929891-930217)

similar to  Tc12H1,        "x 40% to 12F Aedes

MARRSILQSLGKLPSAAPKWLRSVAAYPIKESNVEDANSSEWDLARPYEEIPG

PKPVPVFGNLVKFLPRIG(1)EYGDLTSDQLLRRLRAEYGSVVRLEGLLNRRP

CVFLFDVELCEKMYRLEGAWPSRVSIECLHHYCTRNMDRRDLGLSVS(2)QGE

QWHQFRSRVNQPMMQPRTVRHHVAQIDQVAGDFIAKMRQLRDPLTNDLPASFN

NELNKWSLES(1)ICLIALDHRFGCLEANLAADSEPQRMINAVHEMFELLFQL

ELQPSLWKYYNTGKLKRFFRAMDTLTE(2)IGNKHIANALERAKSKPDSDNQE

RSMLERLLAIDERTARTMAQDMLIAGIDT(0)TANSVGKTLYMIATHPRVQEK

LRAEVDAALPRADSPFTYNTMNEIPYLKACIKETLRISPTAPVNLRTMNKDIV

LAGYRIPKG(0)MDVIACHNLLSQDEEQFPRANDFIPERWIRGSKEIQSAKEA

HPFTFMPFGFGPRACIGRRFAELEMETLIAKVIRQFELDWKHGPLVVHDRYIN

TVSTALQFKITDREN*

>CYP301A1 Nv301n1 540aa 9 exons SCAFFOLD28 plus

(1252866-1253308,1253747-1253863,1253950-

1254026,1254276-1254480,1254573-1254747,1254839-

1255008,1255132-1255210,1255303-1255506,1255597-

1255746) similar to  Am301A1,  head to head with

Nv301-2, C-term looks weird"  "x 78% to 301A1 bee

ortholog

MKQKLNAAARLARLCRREITSESIVAEPASATSATNEIQAKPYEEIPGPKPIP

ILGNTWRLFPVVGQYTISDVARISQLFYEHYGKITRLTGLIGRPDLLFVYDAD

EIERLYRQEGPTPFRASMPCLVKYKSEVRGKFFGELPGVVGV(2)HGEPWREF

RTRVQKPVLQPQTVKKYITPIEVVTNDFMKR(2)IEDIKDENDEVPADFDNEI

HKWALEC(1)IGRVALDVRLGCLGSGELAPDSEPQKIIDAAKYALRNVATLEL

KAPYWRYIPTPLWTRYVRNMDYFVE(2)VCMKYIDAAIDRLQEKKKNGVQMHE

SELSLVERILAKESNPKMAYVLALDLILVGIDT(0)ISMAVCSIMYQLATRPE

EQEKIYEELMRIVPDSSVPLTTKDLDQASYMKAFIKEVFR(2)MYSTVIGNGR

TLQNDTIICGYHVPKG(0)VQVVFPTLVTGCMEQYVDDPHTFKPSRWLKEGAD

QKLHPFASLPYGYGARMCLGRRFADLEMQVLLAK(0)LIREYKIEYNYEPLKY

KVTFMYAPDGELKFNMINRNRVQQQQQQQRKNIN*

>CYP301B1 ortholog Nv301n2 495aa 10 exons SCAFFOLD28

minus (1263224-1263104,1261444-1261198,1260221-

1260105,1259648-1259572,1259469-1259271,1259184-

1259025,1258941-1258775,1258371-1258293,1258006-

1257794,1256105-1256001) similar to  Am301A1,  head

to head with Nv301-1"      "x 70% to 301B1 bee

MQTLASETDVATSRVRPYAEMPGPTPIPFLGNTWRFIPFIG(1)NFKIHEVDK

VSRRLHEEYGDIVKMEGLLNRPDMVFVYDADEIERIFRQEERMPHRPKMPSLD

YYKHTLRKDVFCENPGVIAV(2)HGEGWYNFRSKVQQVMLQPRTARMYIGTID

EASQAFLER(2)IEKIKDEADEVPGNFLSEIHKWSLES(1)IARVALDVRLGC

LDAEHAPRETQELINAVLVFFKNVGVLELKIPFWKFFSTPTWRKYINALDVIL

S(2)TTSKYTREALERAKLCNKEKDELSLLERVLAIEGNERLATTLAFDLFLV

GIDT(0)TSNSVASVLYQLALHPEKQDILYQEIKRVLPADGRFEAGHIDQLKY

LKACVRETQR(2)MYPVVIGNGRCTQSDTVISGYHVPKG(0)VHVVFQHYVIS

NTERYFPKCQQFLPERWIGSGSLEAPAPRHAFASLPFGYGRRMCLGRRFAELE

IIVVLSK(0)IFRRYRVEYHHEKLEYYIDPMYTPKGPLKFKFVKR*

>CYP302A1 ortholog Nv302 493aa 7 exons SCAFFOLD21

plus (642301-642424,642522-642762,642845-

643020,643086-643290,643373-643781,643846-

644058,644135-644245) similar to  Ag302A1,  "x 60% to

302A1 bee

MLQRSLIRRFSSKVEPRAFEEIPGPKALPLIGTLYKYLPLIG(1)EYDMKKLH

KNGAAKYAEYGPLVREEIVLGEPIVWVFRPEDIAEVFKADTGRYPERRSHRAL

FKYRLDRRWIYNSGGLLPT(2)NGPDWWRLRKEFQKALSRPRNVVNYAEDTDE

IVRRFVSVCEDGRFDDALPLLSRLFLEL(1)TCLVAFDLKIDAFSEREMLRDS

MSSRLVDAAFTTNSVILRLDNGPRLWRFFDTPKYRKLCRAQAYMEE(2)VAVK

MVSEKLEKLKDEAPNEKQSLLEIYLQNPELDFKDVVGMACDMLLAGIDTTTYS

SAFALYHLSRNPETLDKLHAEASRLIPDDSCVVTAETLKSAIYTKAVIKETFR

LNPISVGVGRILQTDVVLNGYHVRKG(0)TNVVTQNQISCRLPEYFEKPDSFM

PERWLRETGKNEKPPIHPYLVLPFGHGPRSCIARRLAEQNMQILLLR(0)MCR

QLRFDWAGGELDVDSFLINKPNAPIKLNFSARCD*

>CYP314A1 ortholog Nv314A1 525aa 10 exons SCAFFOLD123

plus (129916-130036,130485-130625,130881-

131079,131774-131961,132114-132312,132401-

132563,132663-132829,133778-133856,133953-

134156,134262-134375) similar to  Am314A1,  "x

63% to 314A1 bee

MLLTVAWVEVLLATAIGAMVLLSNYCSSWLFWKKKSPKDSD(1)SVQLPQKKS

KTVQDVPGPVSFPIIGTSWIFFGFGPYHIDKIHEAYKD(1)MKMRYGPVCKQE

SYWNWPIISVFDRSGIETILKRSSKYPLRPAQEIISHYRQTRTDRYTNLGLVN

E(2)QGVTWQKLRATLTPELTGVKTILGFFPALNGVTDDFVDLIRNRRTGCNV

IGFEELAYRMGLES(1)TCMLMLGRHLGFLKPESVGTLTNRLAEAVRMHFVAS

RDAFYGFPTWKLYATSAYKNLTDSEETIYN(2)IISDLIEATIKEHQESAKDE

SIEAVFLSILREKTLDIRDKRAAIVDFIAAGIHT(0)VGNTLVFLLHTIGRNP

EVRKKLQEEADSLVPPRCDISMGDLKNAKYIRAFITEVFR(2)LLPTAPCIAR

ILEESADLSGYHLKPG(0)TVVLLHTWIAGLDEANFKDADKCIPERWLHPEKY

VPHSPLLVAPFGFGRRICPGKRFVEQALQLMVAK(0)MVREFDVIADEELGLQ

FEYIMAPKGPVTLSFRDRVDVT*

>CYP315A1 ortholog Nv315 476aa 6 exons SCAFFOLD5 plus

(4357098-4357441,4358024-4358214,4358331-

4358671,4358755-4358979,4359102-4359314,4359394-

4359507) similar to  Am315A1,       "x 51% TO 315A1 bee

MQRISKLYLSLANRAVASSLAEMPDCRGLPVIGTISSLVQSDRGKCLHEYIDK

MHRRHGPMFRGRVGPTKAIFVSSTDAIREVFRLEGPTPQHFVPEAWLLYNKLK

DRERGLLFM(2)DGQEWLHYRRILNKMMLAPDSAKSMSKPCQEAAMDLVEKWK

GYRNNERIVPDLENQLYQWSIEV(1)LLATLVGSAWPSYRRSILNELGILSCS

LSRIFEYSVHLSSVPARLAMLLRMPSWTGFVTAADYALDTVGRFVEEMEKLEN

AEDGLLGAMLRNGIDSEMLKRICVDLILAAGDT(0)TAYSMQWLLYLMASNPS

AQEAIRQSLLELDEAEVLRNALLKGAIKESLRLYPTAPFLTRILPQDTLLAGY

PACKG(0)ELVVISLYSCGRDEANFPRADEFLPQRWLRSEKGEFQGVINPNAT

LPFAMGARSCIGRKLAEVQMSLTMAE(0)LLRNFKIDCVNKNKVRMKLRMISA

PSEPLQLQLTPWSR*

>CYP334A1 ortholog Nv334 518aa 11 exons SCAFFOLD32

plus (329064-329143,329892-329995,330334-

330445,330513-330635,330887-331037,331117-

331367,331529-331709,331789-331955,332071-

332149,332236-332433,332531-332638) similar to 

Am334A1,  1st exon is a guess"       "x 58% to 334A1 bee

MYEINKGIDSTYAYICSIRCTLLSTIA(2)NVSELDDSPLPFEEVPGPVILKL

WEKYWKYVPLFG(1)RLQWNRNITPIRYLFDEYGPVVKLKGPFAGDIVLIHR(

2)PEHIQKVFNEENDDATRSAIDILQHYRLNYRKYRFAGPYSA(2)QETQGLE

WLKIKKTLEMPIKKQINNQFAKLEITCDELLQRIRLMKNRQDE(0)VSGNFNQ

ELLRWGMESFWIILLNKKLGYLESTGYSETSEASRLIDALSTAHLYMSRCETG

FQVWRFMETPFSKKLFNSCDVIDE(2)TIGKYIRIIQSSRLHESPSKYNKNEN

ICSSIIENLLVDHSLNPDEVSTLLMDMIILGVQA(0)AVNSQAFLLYFLAKNP

RVQKRLFNEIISKTKDYPILNKETLEKMPYLDACIKECLR(2)IRPPFPYLTR

LLPKDIILHGYKIPKG(0)TYLIMANQITFMREENFEDPEKFKPERWLKNDDS

FSVYSYLPFGKGLRSCMGENIAKLEIMLLTAK(0)IIRNFRVEYEYSEICSRF

LMMNVPNRPLRFRFVERD*

 

CYP3 clan (59 sequences)

 

CYP6 sequences (37)

 

>CYP6AQ4 Nv6n22 508aa 5 exons SCAFFOLD11a plus

(2819931-2820450,2822126-2822491,2822585-

2822769,2822846-2823134,2823337-2823500) similar to

Tc345A2,  combines Nv6n22i and Nv6nFrag4, upstream

from Nv6-23"    "x

MALITSDWSLDAWIFISAVLLGLYLYFRRNLDYWKKRGVKYVEPTLFFGNTVP

CLLARKTPDVLIREIYEKGAGEQFIGFHVFNKPYLVVRDPELIKNVFIKDFNN

FTNKVLCGNHTDVMSSTNLFVASNPPWKSIRTKLSPIFTSGKLRKMYELMEEI

CDDLQVYLDKLDIDV(1)GKPIEIKEICAKFTTDLIGTTAFGMRLNSLTDPNA

EFRKNGRRVFRSSFKRYLQLLALFFIPPLRPYTNAKFFDEKATDFLRTEFWNV

INERIKSGFKRDDLLDMLIEIKNNQDNGTDNTFR(1)LEGDALVAQAAIFFTG

GFETSSTTMSFALYELARNPESQTKLRNEILNALETTGGKVTYEM(0)MTTLP

YLHMVTLEALRLYPVIAWLDRIPETDYTFPGTNVTVEKGVPVVLPLRALQLSP

QYFPNPNQWDPERFSEENKKNIVPFTYFPFGEGPRSCIG(1)IRLGYIQTKLG

ILNFISKYELTVSKESANLQPEPLNIITQAKGGIYLNLRKLTA*

>CYP6AQ5 Nv6n23 507aa 5 exons SCAFFOLD11b plus

(2824453-2824972,2825547-2825912,2826149-

2826333,2826440-2826728,2827039-2827199) similar to 

Am6AQ1,  downstream from Nv6-22"    "x

MAVITSNWSLDAWIFISAVLLGLYLYFARKFSYWKKRGVKYVEPTFLFGNAAP

CLIAAKKPDDLIREFYEEGAGEKVIGFYVFDKPYLVVRDPELIRHVFVKDFSN

FSNKLLCGKNTDVMGSTNLFQVMNPPWKSIRNKLSPFFTSGKLKKMYELMEEI

CTDLQVYLDKLEIDV(1)GKPIEIKEICAKFTTDLIGTTAYGMRLNSLTDPNA

EFRKSGREMFRSSFMRYLQMLAIFFIPPLRPYINAKFFDVRPTEFLRKAFWHV

INERIATGIKRPDLLDMLIEIKNNQDNGTDDTFK(1)LEGDALVAQAAIFFTG

GFETSSTTMSFALYELARNPETQTKLRNEILSALETTGGKVTYDM(0)ITTLP

YLNMVTLEALRLYPVISWLDRLPEADYTFPGTNITVEKDVPVILPMRTLHLDP

QYFPNPDQWDPERFSEENKKNIVPFTYFPFGEGPRSCIG(1)TRLGYIQTKLG

ILNFISKYEVTTLKETNVKIDKLNIFTQAEDGIYLNLRKLSA*

>CYP6AQ6P Nv6nP2 435aa 4 exons SCAFFOLD5126 plus

(12804-13327,13672-13973,14141-14325,14391-14679)

similar to  Am6AQ1,  pseudogene? 2 frame shift

deletions in 1st exon at Xs, 63nt deleted in 3rd exon

at X, missing last exon on C-term"

78% to Nv6n23  

MAVITSNWGLDLAISIFALMLSLLYLCIAKNSNYWKNRGVRDVKPNFIFGNVA

PCIFAKKTLDELIREVCDKGAGEKLIGFYVFDKPYLLIRDPELIRNVFIKDFS

NFSNKIMGGKHTDVMSQYYNLFLANNPPWKYISLKLAPIFTSGKLKKMYELMI

AICDDLQVHLDKLDIDV(1)GKPVEIKEICAKFTTHLIGTTAFGMQFNSLKNP

EAEFRKYGREIYRSSFKRYLQMASEFLRKTFWRVIDRRIESGTKRADLLDLLI

EIKNNQEREANNQYK(1)LEGDALLAQAAVFFTGGFETSSNTTSFALYELARN

PETQTKLRNEILDALETSGGKVTYEI(0)LTTLPYLNMVTQETLRMYRILPWL

DRISEADYTFPGTNVTVEKGVPVILPMKTLHLDPQYFPDPDNIIPERFSEENK

KNIIPFTYFPFGEGPRSCIG(1)

>CYP6AQ7 Nv6n13 509aa 5 exons SCAFFOLD164 plus

(81916-82435,82569-82940,83194-83378,83459-

83747,84136-84296) similar to  Dm6g2,  upstream from

Nv6n1"      "x

MAVLTSDWCLEAAICASALLLGLCLHARRKHDYWRKRGVKYAEPRFLFGNVAA

CLLGKKSPHDLIRETYEKGAGEKVIGLYVFDKPYLILRDPELIKYVFIKDFGN

FSNKVLCGKHTDVMSAANLFLVNNPPWKYIRTKISPIFTSGKLKKMYELMMEI

CVDLQDHLDKFDIDE(1)KVGKPLEIKEICSRFTTDLIGATAYGLQLNSLKDP

DAIFRKNGRQVFRSSFKRYLQLLALFFIPSLRPYTNAKFFDEKATEFLRNTFG

DVINRRMESGDKRADLVDMLIEIKKKQDRDPNAHYK(1)LEGDALIAQAAVFF

TGGFETSSTTMSFALYALARHPEIQAKLRTEILNALETPGGQMSYEK(0)LMS

LPYLNMVVNEALRLYPVLPWIDRIPETDYTFPGTNITVEKGVPLILPMRTLHL

DPDYFPDPDKFIPERFSEENKKNIVPCTFFPFGEGPRNCIG(1)LRLGIIQSK

LGIVNFLSRYELSICKETDFKIDHMHVLTQAKGGICLNFRKLPA*

>CYP6AQ8 Nv6n30 512aa 5 exons SCAFFOLD24 plus

(575970-576489,576574-576945,577025-577209,577289-

577580,577650-577816) similar to  Am6AQ1,    "x

MALLTHHWGLDGLILLSSLLVGIYLYFTRNFKYWQKRGIKQVPPTALFGNIGA

PLLGQKPFIKLLSDMYKAGEDEPYIGYYVLDKPFLLLRDPELIKYVLIKDFNN

FPNRVAASRKTDVVGSMNLFVVNNPEWKYIRQKLSPIFTSGRLKKMFDLILEV

DKDLDVHMNSLKLEG(1)SGRDIEVKDICSKFTTDIIGLTAYGMKFNSLTDPD

AMIRKVGKDIFGRSYRRYLEFFAVLQVPTLVNVFGFEVFGKAATKFLRYIFWN

AINERIQSGAKRADLIDLLVGLKKEQESDSNQNSFK(1)LEGDTLVAQAAVFF

TGGFETSSSTMSFGLYELAKNPTIQDKLRKEIRDTLDANNKKVTYDM(0)IMS

SLPYLDMVISEVLRMYPILPYLDRNTEADYQLPGTKLVLKAGTPVVIPMQAMH

MDSRYFPKPEIFDPERFSPENKKNILPNTYFPFGDGPRICIG(1)MRLGLMQT

KLGLIHLISKYEFSPCKDTLIPMEFDKYSVFTTSRNDIILNVRKLRD*

>CYP6AQ9 Nv6n35 506aa 5 exons SCAFFOLD149 minus

(106055-105536,103807-103454,103374-103190,103112-

102824,102748-102579) similar to  Am6AQ1,  Combines

Nv6Frag3 and NvFrag6, upstream from Nv6n8"   "x 45% to

6AQ1, 50% to Nv6n30

MAFITHCWTLDILITLVCALMVAYVYLTKSHSYWKKRGVKSVPEPNIFGNFSD

CLFARKPLRDFLSNVYFVGEGEKFIGFYVFDKPFLILRDPEAIKNVLVRDFKN

FSNRCVAPNHSDYIGNVNIFSLRNPAWKVLRQKLSPVFTSSKLKNMLDLIVET

GVDLDTHLQNIISNE(1)VKELCEKFTTDVIGSTMFGLKLNALNNPKAEFHNE

GKKHFQNSYGRYFSLLSMFFMPQLAKLFGITFFDPDVPNFFKRVIPEAMNERQ

KDGIKRNDLLDVFMEMKESFEDEKNDLHYY(1)FQVNGLVATAIVFFTGGFEP

SASMMYLVLYELSKQSEIQDKLRKEILDALEETEGKITYDM(0)MMNLPYLDM

VVSEGLRKYPLLHFLDREAEHDYTFPDTDVTIDKGTPIIIPMSAVHMDPKHFP

DPHVFDPQRFSPENKRKIAPFTYFPFGEGPRNCIG(1)MRIGLAQSKIGLMQI

LSKYEVAPCKETPIPLEFDSYTLFTKSRHNMKLNVRRVRSI*

 

>CYP6AS27 Nv6n3 503aa 4 exons SCAFFOLD10a plus

(1803990-1804854,1804948-1805169,1805259-

1805510,1805604-1805773) similar to  Am6AS5,       "x

MTLGFFEVAAGLVVLGLAVYYYFTSNMDFWSSRGVKGPKPVLLFGTTRDLVFG

RMSIAQHTTLTYEAFQGQPLVGLFTNQKPILMVRDPELIKDVLIKDFSVFSYR

GLPIASKAEPLSQHLFLLEPKRWRPLRQKLSPTFTSGKLKDMFYLLRECAEHL

GSFLEDFVEKNPVIECRELAGKFTTDVIGVCAFGLNMNAIAEDDSKFRKIARK

PFDSSTLSLMKNYLRFAAPWLMDLLSPIFYDRELNDFFIGTITQTMEYRKKSN

VKRNDFIDLLMAIKDDPSKLNDIE(1)LTDTLLAAQAFVFFIAGFETSSSTIS

HTLYELAQNQPIQDKLREEIVEGLKSHNGELTYESVKSMKYLHKIFCE(1)TL

RKYPPLSVLQRCSLEPYTFAGTKVTIPENTLLWIPAHAIQHDPENYPEPEKFD

PDRFEEENVKHRHPSLYLPFGDGPRNCIG(1)ARFGIYQTKVGLIQILKSYKV

EVCAETCIPYVVDPKKFLLTPLDGIKLKFRKVVDK*

>CYP6AS28P Nv6nP1 330aa 4 exons SCAFFOLD10b plus

(1933713-1934071,1934139-1934360,1934440-

1934691,1934768-1934928) similar to  Am6AS3, 

pseudogene?, missing M on N-term, missing 200aa 1st

exon to 2nd exon, CIC in heme binding sequence"

78% to Nv6n3   

IKATRLYTTALLGLFEVAAGLVALGLAVYYYLTSNMDFWSSRGVKGPKPRPLF

GSTLDFAIGRMSLLSPVFHDRELNDFFIGTISQTMDYRKKNNVERNDFIDLLM

AIKDDPSKVGDIDT(9)MTDTVIASQAFIFFLAGFETSSSTISHTLYELAQNQ

AIQDKLREEIVEELKIHNGEITYESVKGMKYLHKIFCE(1)TLRKYTPLSVIQ

RNSLEPYTFSGTKVTIPKDTELWIPIYAIQHDPDIYP*PEKYDPERFDDENMK

QRHPSFYLPFGDGPRNCIC(1)ARFGNYQTKLGIIQVLKNYKVEVCDQTRIPY

TIDPKQFLLAPIDGIELKFRKI*

>CYP6AS29 Nv6n27 501aa 4 exons SCAFFOLD87 plus

(366072-366933,367012-367233,367337-367588,367677-

367843) similar to  Am6AS5,  "x

MSGLFEVAAGLIALGLAVYYYLSSNLDFWSKLDVKGPKPVPLFGTTSDVLLGR

LSLFQYAAREYGRFRDEPLVGIFSYRKPILLLRDPDLIRNVLVKDFSVFSCRG

MKAATKAEPLAQHLVFLEPERWRPLRYKLSPAFTSGKLKEMFYLLKECAQHLD

RLLEDCVARDPVIECRELAGKFTTDAIGVCAFGLDMHAIDGEDNEFRKTSRKM

FSTSILNRIRIHLKITAPWLLDLLSPIFYDREMNDFFIDTVAQTMDYRKKNGV

KRHDFIDLLMDIRDNPSKVNDIE(1)ITETLIASQAFVFFLAGFETSSTTISN

ALYEMALNPSIQDKLREEILEELKKHNGEMTYESIKGMKYLHKIFCE(1)TLR

LYPPAGLLSRRSLEPYTFAGTKVTIPKNTSVVVPIFGIHHDPEIYPQPDKFDP

ERFDEEAVNHRHPSFYLPFGDGPRNCIG(1)SRFGTYQAKVALVQILKSYKVE

VCDQTVIPYVIDPKTVILLAPRGGIKLKFKKIK*

>CYP6AS30 Nv6n28 500aa 4 exons SCAFFOLD7 minus

(1560081-1559217,1558589-1558368,1558278-

1558027,1557965-1557805) similar to  Am6AS7,       "x

MEFSAFELLTALALLFLAIYYYFTSTYDFWSSRHVEHPKPELFFGNFKKMMLG

KSSLGDYLYEQYQYYKNEPMFGLYARRTPVLVVTDPEYIKDVLIKDFSSFSDR

GMTIHEKVEPLSQHLFSLEPARWRPLRIKLSPTFTSGKLKEMFYLLAECGNSF

ETLIDNMVKKNPVIECRELTAKFTTEVIGICVFGLKAEAMADGDSEFRKIGRK

VFENSWMKFIKFRIRDAMPWLFNLLGPFFYDHELNGFFINLMKQTMEYRKKNN

VRRNDFVDLLMDIKDDPSKVGDIE(1)MTDALITAQAFVFFIAGFETSSTTIS

NALYELALNPSVQEKLREEIIEELANDNGSLKYETIKGMKYLHKVFCE(1)TL

RKYPPVTVMMRKSMQPYTFSGTKVTIPKGMRVWIPAYAIQRDPAIYPDPDTFD

PERFSEESIKQRHPSFYLPFGDGPRNCIG(1)ARFANYQSKIGIIQVLRNYKV

QVCDKTCIPYVNDPRAFLLAPIGGINLKFTRL*

>CYP6AS31 Nv6n9 501aa 4 exons SCAFFOLD83 plus

(188126-188990,189072-189293,189371-189622,189698-

189861) similar to  Am6AS5,  "x

MGVGILEILAGIGLLFLACYYYFTSTFNYWQSRGIPGPKPAPIYGNLKDIMFG

KMSVGDFVKQEYDKFKDKRMFGIYAIRTPVLIVNDPELIKDILIRNFSSFANR

GVRLFEKVEPLSANLVNLEAKRWRPLRAKQITMFTFSKLKEMFYIVSECADNL

EKILAGMIEKNDVVECCEVSARYTTDVIGACVFGIDMKALDDENSQFRRVGRK

FIHADKWRAFKLRFKQIFPSLYNLLCPIMYDHEINDFFINTMIATMKHRKENN

VRRGDFVDLLNDLKDNPGKLDGIE(1)LTDTLLTAQAFAFFFAGFDTSATTMS

HALYELALNKSIQNKLREEIKEDLAENNGKLLLESLKNMKYLDKVFNE(1)TL

RKYPVTTILTRQAMESYTFDGTDLTIPKDTKVWIPVYGIHRDPKIYPNPDTFD

PERFDEEKVQERHPSYYLPFGAGPRNCLG(1)ARFGNYQTKVGLITILKNYSV

DICDQTPIPYVSNRRRFLLGPAAGIRLKFTNLS*

>CYP6AS32 Nv6n34 499aa 4 exons SCAFFOLD163a plus

(374817-375675,377867-378088,378183-378434,378505-

378668) similar to  Am6AS5,  completes Nv6Frag1,

upstream from Nv6n8"       "x 60% to Nv6n8

MEVGTLEIIIGLSVLSFIFHYYLTYHFDFWKKQNVVGPKPIPFFGNVKEILFG

EIHAGLLMKRYYDQYKSEPMIGIYGNRTPSLILKDPSLIKDVMIRDFNVFPDR

GFYVNAKADPVNQNLANLEHARWRPLRTKLTPIFTSGKLKEMFYLLVECANSF

EKYVEKLIEKDEPVEVRELTSKFTIQAIGVCVLGLDTKALEENSQFRTYGRAL

FVPTIVNVGRILLQQLAPWIYESLGPFKTSEPVRFFAKSTKEIVEYRRKNKIR

RNDFVGLLMDLQDQPNTLSNID(1)FSDEFLAGQILAFFAAGFETSSTTVSNA

LYELAFNQNIQDKLRNEIREEIERNNGQLTYDSIKRMKYLDKIYKE(1)TLRK

YPPGSIIQRRSNAQYTFTGTKVTIPANTTLIIPVWAIHRDPDLYPDPDIFDPE

RFNEDNESSRHPMNYLPFGDGPHNCIG(1)VRYSNYQTKVGLIAAINKFKVNV

CDKTCISYQVEPRAIFTAPVGGIYLKISKVL*

>CYP6AS33 Nv6n8 499aa 4 exons SCAFFOLD163b plus

(380194-381055,381141-381362,381465-381716,381800-

381960) similar to  Am6AS5,  downstream from Nv6n34"

        "x

MELGVVEILIGMALLFLGFYYYLTSNFDFWKKRQVLGPKPIPIFGNFKDVILG

NINPALLVQKFYDEFKNEQFIGLFSRSSPSLMIKDPDLIRDVLIKDFNVFADR

AVASIPKNDPFSENLLNLEHERWRPLRNRLSPIFTSGKLKDMFYLMVDCAQNL

EEYVNELVKKDQPVECRELSAKFTTDSIGACAFGLNTNALHDENSEFRRFGRD

LFASTLKNKFRRLLRELFPKLYAISGQWLQNDATLFFIRSIKETTEYRKKNKV

RRNDFVDLLMDLQNQPEKLSTFE(1)FTDSLLTAQALVFFIAGFETSSTTISN

ALYELAFHQDEQDKLREEIISELKKNENKLTYESIKSMKYLDKVVKE(1)SLR

KYPPGSILRRTSLAPYTFYGSKVTIPKHTPVLIPVWAIHRDPEIYPNPGEFDP

ERFSEENEKSRHPMHYLPFGDGPHNCIG(1)ARFAKYQTKIGIVAIINKFKVD

VCDKTCRTYFIENRSIIPTPVGGIHLKITKL*

>CYP6AS34 Nv6-5 492aa 5 exons Contig5176 plus (1304-

1782,2562-2923,3023-3244,3330-3581,3675-3835) similar

to  Am6AS5,  1st exon seems short at C-term, deletion

in 2nd exon at X, upstream from Nv6-6 not in ver 1

set

MAFTLVNILLGVGSILVLLYYYVISGFDFWKKRHIPGPKPSLLFGNFKDVILA

KVHQANYLKHIYKSYSNEPVVGVFIWSMPVLVVKDLDLIKDILIKSFDNFADR

GIQIHEDIDPLSMNLVFLEPKKWRPLRQMLTPAFTSKKLKVMFYLINDCADHF

K(2)DLDEPVECRELTAKFTTDVIGVCAFGLNINALSNEESEFRRMGRKMFDV

TWHNRLRHALRLLPHWLARFLKPIARDDKIIDFFVTTFMETMARKKNNIRKND

FVDLLMNVKDSLKQIDDEE(1)MTDLFLTAQAFVFFAAGFETSSTTMSHAMYE

LALNQDIQDKLREEVNATFAENDAKLSYDSVRSMIYLDKVFKE(1)SLRKYPA

ALTLFRKSMNDHSFPGTDISIPRGTCMLIPTYVIHHDPTYYPDPDKFDPERFD

KETANGRSRMTFLPFGDGPRNCIG(1)ERFAQNQSKVGLAMIIRNFKLEVCER

TCKTYIKHEGSPLLAPLDGLYLKLRNI*

>CYP6AS35 Nv6n6 501aa 5 exons SCAFFOLD348 plus

(167900-168401,169103-169468,169716-169937,170030-

170281,170352-170512) similar to  Tc6BK3,  downstream

from Nv6P4,(not in this set) upstream from Nv6n29"

        "x

MAVGIVEVLLGMGTILLLLYYFMIMGFDFWEKRGIPGPRPIPLFGNFKDVILA

KMHQADYLKSIYENYPKEPAVGVFMWNRPVLVVKDLDMIKDVLIKSFSDFSDR

GIFVIHEDIDPLSKHLVFLEPKRWKPLRKKLTPAFSSGKLREMFYLINECATH

YDQYMQTIV(1)DKKEPVDCRDLAAKFTTDVIGVCAFGLNMNALLNEESEFRK

MGRLIFADSWHNRARRLTRLLPHWSARFLKPIARDEKIIDFFVTTLRETMEYR

KKNNVRKHDIVDVLMDIKENPEQFNDEE(1)ITELFLTAQAFVFFIAGFDTTS

NAMSHAMYELALNPDIQEKLRQEVNATYSENNGKFSYDSVRNMKYLDKVFKE(

1)TLRKYPPAFTLSRKSMNNHSFSGTKITIPKGTSLMIPTYAIHHDPSYYPDP

DKFDPERFDEGNANNRIHMTFLPFGDGPRNCIG(1)ERFANNQFKVGIAMTVR

KFKLAVCERTCKNYVKHARLSTLSPTDGLYLKFKSI*

>CYP6AS36P Nv6nP3 451aa 4 exons SCAFFOLD44 plus

(803922-804688,804752-804945,805063-805314,805383-

805518) similar to  Am6AS6,  pseudogene?, 3

frameshifts in 1st exon, major deletion of 54nt at

1st X, 1 insertion (at 2nd X) and 3nt insertion (at

3rd X) in 1st  exon, 1 deletion in last exon at X"       

MEVGAPEILALFGVLLSILHYYLTYNFDFWKKQNVLGAKPFFGKLREVLFGEI

HVGLLMKRYYDEYKTVPMIGFYGIRTPSLIMRDPELIKDVLIRDFNVFPDHGF

YVNPKADPVNQNVFTSGKLREMFYLLVDCADAFEKYVETLTERDEPVEVRELT

SKLLRYQAIGVCVLGLDTNALAEKSDFLQMVSRILLQSLAPRIYEMLGPLKTS

EPVKFFAKSTKKIVDFRRNNKIRRNDFVDLLMDLQDQPDKISNIE(1)FSDDF

LAGQCLAFFAAGFEKSNALYEMAFDQSIQDKLRNEIREEMKKITGSLTYDSIK

RMKYLDK(9)TLRKYPPGSIVQRRSNASYTFTGTEVTTTADTTLIIPVWAIHH

DPDLYPNPEIFEPERFNEDNEGSRHPMNCLPFGNGPHNCIG(1)ARYSNYQTK

VGIIALINKFKVNVCDKTXMRMEYRVEAPIGGIYLKI*

>CYP6AS37P Nv6-P6 436aa 3 exons Contig2783 plus

(1031-1895,1982-2173,2237-2488) similar to  Am6AS7, 

in-frame stop codon in 2nd exon, but it looks like a

15nt deletion at X,missing last exon on C-term

missing from ver 1, 57% to Nv6n8

MEFGVVELLAGIGILFLACHYYLMYGFDFWKKRNVKGPKPVPIFGNIKDVVFG

KINLALLIKLYYDDYKGEPFVGIYRKSSAILILRNPDLIKDVLIKDFNVFPNR

DRIVPPKNDPFSQNIFELEYERWKSLRHKLTPVFTSGKLKDMFYLISECADHL

EKYVEKLADRGGPVECRELTAKYTTDVIGVCVFVLNTNSVSDTDSQFRKAGRD

LMASSFSNTLRGIWKEWLPRLYELLRPYVYNRAIDYFIGSLKETMEYGKKNNI

STRNDFLDLLMDLKDQPDSLSDFE(1)FTNELLTSQAFIFFLAGFETSSATMS

NALYELALNQR*DIKLEIQIIHVYKLKYFILTAWNLIK(1)TIRKYPPGSILQ

PCSVAPHTFAKLSVSIPKGTLVIIPVWAIHHDPEIFPNPELFDPERYTVENEK

NWHPMNYFPFGDGPHNCIG(1)

 

>CYP6BC2 Nv6n4 510aa 7 exons SCAFFOLD36 plus (195468-

195858,196309-196438,196472-196694,196901-

197045,197353-197574,197947-198198,198260-198426)

similar to  Am6BC1,  GC-donor on 2nd intron, strange

splices in N-term half"  "x 72% to CYP6BC1

MLSLIKDCLWEPLPIVLIMLGYALYAFLTSTFDYWLVRGVPYRKPTPLLGNFG

DLLLFRKSQPEGISEMYNWFGNERFFGVFRVRSPILIVRDPELIKCVCVKDFH

VFCNRGIPVNSTKDPLSGHLFNLEG(1)KHWKSLRSKLTPAFSSGKLKNMFYL

LVECSDDLTRLVERRLEI(2)FPDASIVEVRELAANFTIDVIGSCAFGIQINA

LSDEDSEFRKAARRLSKPSYKATLWRMLRTSMPKLYKLLGVQ(0)VIDPSVTK

FFMDVVSQMVKERENKALKRHDFMDLLIELKNRGTLELDNG(1)LDENTIAAQ

AFVFFVAGYETSSNTIAFCLYELAVNPEIQEKARRDIIDALDKRDSKLTYDAV

QDMKYLDMVILE(1)TLRKYPPAPLLSRRCEYPYKLPGSDVELSKGMRVVIPI

YAIHHDPKHYPEPDKFRPERFGDEEKRARHPYTFLPFGEGPRNCIG(1)TRFA

LLQTKVGVITFLRKYQVEVCEKTDIPIKFSRRSLVTASETGVSLNISRLSE*

 

>CYP6BD2 Nv6n15 505aa 5 exons SCAFFOLD7a plus

(3132751-3133402,3134144-3134374,3134444-

3134721,3134902-3135091,3135167-3135330) similar to 

Am6BD1,  downstream from Nv6n16, upstream from

Nv6Frag2" "x

MLDPSFLVNLVTVLAMLLTTFYLWARYKQSYWSRRGIPTAPNSHWLFGHFRDA

IFMRSAPPTLLGELHKSCPSDEPILGVYIMQKPFLLLRNAELIKQLLVKDSQY

FPNRYFASKRKSDVIGSQNLFSVDNPMWKYLRVKLSPAFTTGKQKRLFELMLE

SSQNMSKYLEANLPKDGTEIDMEMRRVSSKYTTDVISSLAFGIKTDSFTEPEA

EFYLRS(1)RKLFEQSIINTLKLFYNFFFPKLNDIVGSSFLGAEEDYFRKIFW

ESMNQREKSGVSRGDAMDLLLELKNLKQSKEFR(1)FEGDRLVAQSVILFAAG

LETSATTMSFTLLEIAKQPEIQRKVREEIRDKLNGKPLTYERISEMNYLHQVV

SETLRLYPPAPLLDRVAIDDYK(0)IPGTDIVLEKGSVVYVALNGVHRDPDYH

SDPLTYDPDRFSEMRKKDMKPCTYMPFGDGPRICIG(1)MRTGMLQTMVGLIT

LLSQYEVKLNPMYKNEISKRAIFLAPANGIHLYIKRSPIM*

>CYP6BD2-de4b Nv6nFrag2 62aa 1 exon SCAFFOLD7b plus

(3135937-3136126) similar to  Am6BD1,  incomplete on

both ends, only 4th exon, downstream from Nv6n15,

upstream from Nv336P1"    50% to Nv6n15  -de4b

IPGIDITDERETVIYVALNRLYNGPDYYADPMTYDPDRLSKS*RRI*KFLATW

PFGSGQRVCIS(1)

>CYP6BD3 Nv6n1 508aa 5 exons SCAFFOLD164 plus

(107007-107658,107724-107954,108026-108306,108446-

108638,108714-108880) similar to  Am6BD1,  downstream

from Nv6n13"    "x

MNFDLLSVLSYIVLLALSAFTLFYMYAKQKQTYWSKRGVYSPPCHWFYGHFRD

AFLMKKSFPQAFGEMHNLVDSSIPVVGVYVMQKPFLLLRNPEVIKQVLIKDFN

VFCNRYFAAQRKTDVIGSENLFSIKYAQWKYIRSKLSPAFSSGKLKRYFQLML

ESAANTRNYLKSQIPDGEKVTIECRKLSNKYTTDVISSFSFGIKTNSYVEPEP

EFYLRS(1)RKIFQLGLVRTLQILTTFFFPKISDYLMGSMLGDSNDFFRNAFW

ESMNERKESGIKRGDIIDFLVELSNEKQSQEFK(1)FEGDHLVAQSAILLVAG

VETSAVTIGFTLLELAKHPEIQRRVREEIREKLCKDGQLAYEDVAVMTYLSQV

ISETLRLYPPAPLIDRLASEDYK(0)LPGTDIVIEKGTAVYAALKAGLHEDPH

YHPNPTKFDPDRFSEERKNEIQPCTYMPFGEGPRVCVG(1)MRIGQLETMVGL

ITILSEYEVSLNPQHITELNVRALFLAPADGIKLYFQRIKTCQ*

>CYP6BD4 Nv6n14 501aa 5 exons SCAFFOLD7 plus

(2365830-2366484,2366622-2366846,2366928-

2367205,2367275-2367458,2367884-2368044) similar to 

Am6BD1,  upstream from Nv6n24"       "x

MTFECLNCITNAALLFVFIITILYLYCKYRLSYWNRHGVKSLPTHLFFGNFKD

TFTFKKPPGQVIQEIYEKAAFNEPYIGFYIFHEPKLLLRDLYLMKQLMVKDFD

VFPNRCFGGESQKDSVGLVNLLGIHQPRWKYLRQKLTPSVTGFKLRAMIPLIK

ECGAPLLKFVENAKSQSDGWKELELKDISSRYTTDVIASLAFGISTNSFDDND

VSFWEAG(1)QKILSGAKRGIILIILFFLPGLIKFIENFMVGPAKYFRLIFWD

SMNTREKTGIKRGDMIDHFINLKNGEQISEYK(1)FEGDNLLSQAVSFYVAGF

EASSTAIAFSLYELSLHREYEERLYKEIKDHLTGKELTIDLINEMTFLDQVVN

EALRMYPPLPIVDRVAVRDYK(0)LPGSNVTIQKGTPIYISVTGTNRDPKYFE

KPNEFIPTRPRLETADLPSSSLAFGMGPRSCVG(1)QRLGLIMTKMALITILS

EYTLANDKKNDKALLKPITVFTAAADGIHVKLKKRN*

>CYP6BD5 Nv6n19 496aa 5 exons SCAFFOLD31 minus

(1748844-1748199,1747981-1747757,1747632-

1747358,1746980-1746800,1746716-1746556) similar to 

Am6AQ1,  "x

MPGLLVSLALLGLVLLAFRFYARYKLDYWKRRGVEQLPQSNVVFGNFKDAVLF

QTAPGWHLGVLHKSAVNQDAPFLGFYIFHKPCLLLRDPEIIKQIMIRDFDNFS

DRHFAGSQQKDSIGMKNLFGLKNPAWKYLRSKISPTLARGKLKQMLPLMMQTG

KPMMEYLEAQGIDANNEKMIDAQELNYKYATDLIANVALGTPMDSFHRPNEEF

SKAV(1)YQFFHGFKRMIALVTVFFVPELVELIGPSLLFNSKFVRKVFWNAVN

SREKNGEKRGDFIDSLIQLKNGEQNPVYK(1)FEGENLLYQSGTFFSGFESSS

TTTAFTLMELAAHPEIQERARQDIERAIEEHGMTYEAFNDMKYLDQCLAEGVR

LHPPVSTIDRYTRQDYT(0)IPGTDIVIEKGTAIYISLYGLQEDPRFFTRPSV

FDPERFADDRKVSDAFIPFGIGPRMCVG(1)MKAGQLHAKVVLAMILREYTVT

QRPENKLVLDPRSTFTAAADGINLHFRKNIK*

 

>CYP6CK2P  Nv6nP4 499aa 6 exons SCAFFOLD7 plus

(2625962-2626142,2627299-2627668,2627734-

2628099,2628215-2628378,2628458-2628709,2628792-

2628958) similar to  Am6BE1,  pseudogene?, stop codon

in 2nd exon, 2nd intron splices unresolved, insertion

frame shift in 3rd exon at X, between Nv6n24 and

Nv6n16"

63% to CYP6CK1

MFETVGSVLNSKLFWISAIIFVFYSYFKLIIYSYWKRHATPHDKPTVPFGNVG

MDLITKKC(1)AKMKSSYDKYKKHPFHGLYMFHNPTLMVNDPEVTKYVLVKEF

AHFHDRGMYFNDKIDPISGHLFFMTGDR*RALRIKLSPSLTSGKLKNMYPFVQ

EIADEMVNIANENLEKTDVLEIKELVAR(9)YTTDTIFSLAFGFNANHLRNPD

SEFRHYGDLSIKNVPVINAMAAFTPYILEFFKILFTNAKATAFFIKLFKDMVV

QRKMEKKDFLNLLIELMDHGQIRDQEGENGTDEPGITQPFPTYYILKS(9)ET

SSSIVTHTL*ELALNPDEQEKLHQEIDELLQRDGGFNYENLMHLEYLEMAFYE

(1)TIRKHPSVPFLNRICAKDCKLPNSDFVVPEGMPILISISGLHRDSNIYPD

PDKFDPTRFSKENIAARHPYAYLAFGKAPKICIG(1)KRLGIMMSMVALATLL

SKFKFSVCDRTPIPNRYSLNSILQMPRDGIHLGMEKRKK*

>CYP6CK3 Nv6n20 502aa 6 exons SCAFFOLD6a minus

(3804038-3803876,3803739-3803370,3803287-

3802998,3802908-3802675,3802588-3802337,3802256-

3802060) similar to  Ag6Y1,  upstream from Nv6-21"

        "x

MELLLLFALLLFVLYFYLKYVVYDVWRRAGIPHDRPSIPLGTLPLDYIRRKAT

LG(1)SILTNSYKRYKRFPLHGVYVIYKPVLVITDPKIIQLVLVKDCNIFLDR

GFYADPEKDLISLSLARVNGERWRILRRQLSSSFAPKKIKFMFLMVKEFCERL

IEIYEDELRESDVVRIDELTSR(2)FTIDCAFATLFGFNCNLLKNPDNDFYKY

GKQSNEQGVIYSIISFFLPELAALCRIPKVRRDTNSFFERFFENMIDCQKKKN

MAENNLLGAMMQLMKV(1)DENTKLTTQEAAAQLVTFFAPSQGMPAFVIIHCL

YELSLNPEVQERLYKEIYETACRSEELTYRTLSELSYLNLVLQE(1)TLRKHT

PLPVLNRIAIEDFSIPDSDIVIRKNTRIAISTHGLHHDPDIYPDPEKFDPTRF

TPENKAKRHSSTYLPFGTGPRFCIG(1)KQQGILIPKLALFYLLLNYKFSVCD

NTPANLEYLPEHLILILKNEIYLRIEKRKELDHVHQPDFR*

>CYP6CK4 Nv6n21 533aa 6 exons SCAFFOLD6b minus

(3801156-3800970,3800909-3800540,3800475-

3800129,3800064-3799831,3799753-3799502,3799423-

3799215) similar to  Ag6Y1,  downstream from Nv6-20"

        "x

MEPLSAILYTKTFWITSLFLTIYLYLKYVVYNVWANRGVPHDPPSIPLGNIPV

KYFQGKTTHG(1)AIVKESYDRYKTNPFYGMYMLYMPILVVKDPELIQLILVK

HFNSFYNRGTLYNESKDPLSTGLVRLYDEKWKRLRVKLSPTFTSGKLKLMYPL

VKEICDELLRVYEDVLDKSDVVEIKDITNR(2)FTIDCISSIAFGFNCDSLHQ

PDNEFLKYGKISNDLGRVFLIFSFFVPRLVSLFPIPEKRKKVSEFFYDLFEKM

VSHRRKDKTVRNDFLNMLMQLMDHGKVEEDDDAPSKSNSLTKI(1)TDADKIT

MVEAVGQSMFFFAAGQETTASAITYCLYELSFNQDIQEELYNEISQVAHSPEG

LTYEKLFSMPYLDMVFRE(1)TLRKHPGAPMLNRQASEDFVVPGSHFVIKKGT

RIVIPIKALHADPDIYPDPDKFDPTRFTSENKAKRHAFTYIPFGEGPRHCIG(

1)KRLGILKPKIALFYLLLNYKFSVCDKTPIPLRYMTDYFVQVPAGQVYLKVE

KRNGTLSDKASRPWNSAN*

>CYP6CK5 Nv6n16 522aa 6 exons SCAFFOLD7 plus

(2903402-2903588,2903659-2904028,2904099-

2904433,2904509-2904742,2904830-2905081,2905149-

2905336) similar to  Am6BE1,  downstream from Nv6nP4,

upstream from Nv6n15"      "x

MDFYEDLVYSKLFWATTVLFGVYLYLKYIMYNCWSRNGVPHDSPSIPLGNVPF

SYFTENVPHG(1)EIIKSSYEKYKNHRYHGLYILNEPILVVNDPELIRLILVK

NFTNFCNRGTYYNESTDPLSCALPRLVDDKWKRLRAKLSPTFTSGSLKKMYPM

FKEICDKLVKTFDTALDESDVLEMKDIASR(2)FTMDCISSIVLGFNVNSLQN

PEHEFRKYGKIVNDFGKVFVLLSFYVPDMIDFYSFIPKKRKKVHAFFVYLFQK

TVAYRRAKKIVRNDFLNMLMQLMDRGYVENEFEASSTNV(1)SDDDRLSMTEA

VAQSVIFFAAGQETTSSALCCCLYELALHQDVQKKLQWEIDQAFASPEGLTYE

KIFEMPYLDMVLCE(1)TLRKHPGAPVLNRISLADLNVPDSKFRIPKGMRLVI

PVNGIHSDPNVYPDPDRFDPSRFTPENRAKRHPLVYLPFGEGPRHCIG(1)KR

LGVLKPKIALCYLLKNYSFFSCDKTQPRLSYMSNSFVQVPAGGVYLRVERRRQ

ERTEASP*

>CYP6CK6 Nv6n11 512aa 6 exons SCAFFOLD58 plus

(295312-295489,295581-295950,296021-296364,296448-

296678,296778-297029,297126-297286) similar to 

Am6BE1,  "x

MLEFTYSQLFWITAVFAAVYAYLKYYLYNYWNRYNVPNETPSIPLGNVPLDFL

RGKIHYG(1)GFIDSIYKKFKHYRFCGIYVFHKPILCINDPELIKLILVKDFD

LFPDRGWFYDGKIDPMSSHLFLLPGEKWKRLRVKFAPIFTSGKLRQMYPFLVE

ISKHMIKTCDAELKTTDTVDVNDILAR(2)FTTDVISSIVYGLDSKSLDDPKS

EFRTKGVKALSFGSFNLLVALFAPEMMSWATVPLYQENVSEFFLNIFKEAVNY

RRKEKIQKKDFLDLIMQLIDSGKVDDENKILQTNGKNSE(1)HFDKLTIEEAA

ANAFVFFLGGYETSSSTTSFCLYELAQNPEVQEKLQAEIDEVVRSLTGLTYES

IAEMEYLDMVLSE(1)TLRKYPSGATLNRIAKEDYPLPNTDFVIKKGMRIIIP

LSGIQNNPEYYPDPEKFDPLRFTKEKVAARNKYVNIPFGDGGRICIG(1)KRF

AVMQVKIVLTAMLYNYQFSISQKTQVPPKYETRNFTQIARNGVHLRVERR*

>CYP6CK7 Nv6n17 522aa 6 exons SCAFFOLD60 minus

(108535-108358,108268-107899,107822-107479,107380-

107150,107090-106839,106743-106553) similar to 

Am6BE1,  "x

MLEFTYSKLFWITVVLAAVYAYLKYYLYNYWNRYNVPNETPSIPLGNVSIDYL

RGKIHFA(1)GFIDSIYNKFKHHRFYGVYVFQRPILCINDPELIKLILVKDFD

LFADRGWFYDGKVDPMSSHLFLLPSEKWKRLRIKFSPIFTSGKLRRMYPYLVE

ISKHMIKTCDAELKTTDIVDVNDMLAR(2)YTTDIISSIVYGLDSKSLDNPKS

EFQTKGEKALNFGRFNLLMAMFAPEMMSWATVPLFQENVSKFFLNIFIEAVTY

RRKEKIQKKDFLDLIMQLIDYGKVEDDDQIMQTNGKNSE(1)HFNKLTIEEAA

ANAFVFFLGGYETSSSTTSFCLYELAQNPEIQEKLQAEIDEVVKSPTGLTYES

IAEMEYLDMVLSE(1)TLRKHPSLPILNRIAKEDYPLPTTDFVIKKDMRIMIS

LSGIQNNPEYYPDPEKFDPLRFTKEKAVARNKYINIPFGDGERMCIG(1)KRF

AVMQVKIALAAMLHNYQFSISEKTQVPPQYETMNFTQTVRNGVKLRVKRRDLE

KILRKRS*

>CYP6CK8 Nv6n25 516aa 6 exons SCAFFOLD18a minus

(2559691-2559502,2559437-2559068,2559000-

2558660,2558583-2558350,2558277-2558026,2557948-

2557788) similar to  Am6BE1,  upstream from Nv6-26"

        "x

MLLNIWQILCIKTLWISIAIAGVYLYLKFVLFNYWSRKKVPHVPPNIVLGNIN

KNFLLDKITIG(1)ELVRQHYDKFRKEKYFGIYIFHNPILVINDLELIRLILV

KDFPYFYDRGIHSNVDVDPMSFNLFRLPGERWKNLRTKLTPIFTSGKLKQLYP

LLYEVSHEFVDICDKILEVTDVIDMKDLVER(2)FITDCISNVAFGFNCNSLK

DPNNEFRNNGKSGTDLGKYSATLSIFGSNILNFLRLRVFSSNVNKFFIRIFED

VVNHRVKSKIVRNDFINLLMDLTDHKQGSDKAPIVNKSDPAE(1)MKNRKLNM

LEAAAQVFVFFIAGFETTSTTVTYCLHELAKYPEVQEKLQEEIDEVANSPEGF

NYDNIMNMKYLDMTFNE(1)TLRKHPPVPFVNRLCTKDYQIPGTDLRIPKGMR

LAISVSGLQRDPDIYPEPEKFEPLRFSKENLAQRSAYCFLPFGEGPRICIG(1

)KRIALMQGKLALATLLSKYTFSICDETPVPLEYSNRTFLTVAEKDLYLKLTK

R*

>CYP6CK9P Nv6nP7 505aa 6 exons SCAFFOLD18b minus

(2557375-2557198,2557115-2556746,2556652-

2556321,2556249-2556022,2555952-2555714,2555644-

2555478) similar to  Am6BE1,  pseudogene? deletion in

4th exon at X, downstream from Nv6n25"  "x

MLEYLSSKLFLLAAVLTAVYFYLKLCVYNYWKKCNVPHEAPSIPLGNIPVPLF

TGKKALG(1)NLFWDWYNKFSQHPFYGVYLFNRPVLMVNDPELINLVLVKEFQ

RFIDRGWFTNEKVDKLTCNLFLMPGKPWKRLRSKLSPTFTPGKLRQIFPLMSD

VSEQMIKTCETELKLTDELNIIEIVGR(2)YATDVISSQGFISSSLKNPDNDF

RRLGMRGLAFGRFKMLLVVFFPGLLSNVSIPINPKEVREFFTRIFAETVDYRR

REKVTRKDFMNLLMQLVDKGMLLDDEQKPEGDKEA(1)DSDRISMVEATAQAY

LLFIAGFETTTSVVSYCLLEMALNPDIQEKLQQEIDEVAERNGFTHNALMEME

YLNMVFLE(1)TERKYPGVVFLNRLCGSDLSDYVIPKGMPVVISTLGVHYDPK

HFPNPHKFDPTRFSKENSVDRSPYVNLAFGEGPRNCIG(1)KRFGTLQSKLAI

ARLLHNYKFYISQNTVLPVKFTSESFFVSPDHKLTLRFEHRRK*

>CYP6CK10 Nv6n31 527aa 6 exons SCAFFOLD89a plus

(778425-778608,778669-779038,779121-779470,779569-

779799,779865-780116,780199-780392) similar to 

Tc6BQ13,  upstream from Nv6-32"     "x

MDSIAPILHTKLFLVTALITVIYMYFKFVIYGYWKRRGIPHAPPIIPVGNAFP

LISGKVSIG(1)NLMRQKYNEGKKYPVYGIYMFHKPILLINDPNVIQLILIKE

FNKFCNRGLYFNDKVDTLSLNLFFLPGERWRQLRTKLTPTFTSGKLKQMYPLL

LEIGDNLIRVCDQIIKKDNIVEFKDLIGR(2)YTTDSISSIAFGVDCQSLDNG

SSEFQKHGIMVFDLPPSKIASAVFAPIILDIFRIPVFNNTITQFFVKTFNDVL

EERRRNKITRKDFLNSLMQLLDKGSLDEDKDLKQKDNNNSANA(1)LGKISLS

EAIGQAFIFYLAGFETTSSTITYCLYELALNPEIQEKVQAEIDEFSKRDGGIT

YEIMSNDMKYLHMVFLE(1)TLRKHPSIPFLNRECIEDCDIPNTNFRIEKGTK

LLICMNAMHRDPDIFPDPEKFDPFRFTKENIASRQPYTYLPFGDGPRACIG(1

)IRFGMLQTKIALIGLLSNYNFSVCEKTSIPVMYARRSFTQTPEYGIYLKTEK

RNKSTFLYKNRQ*

>CYP6CK11 Nv6n32 527aa 6 exons SCAFFOLD89b plus

(783711-783888,783949-784318,784398-784741,784835-

785071,785137-785388,785471-785670) similar to 

Tc6BQ13,  downstream from Nv6-31, upstream from

Nv6Frag6" "x

MDSITPILHKKLFWAFTLIIVIYAYFKFVIYDYWKRRGIPHDTPIIPVGNAFP

LISGSIG(1)NFIKQKYNKSKKYPVYGIYIFHMPLLLINDPNVIQLILIKEFN

KFRDRGLYFNEKVNPLSVHLFLLPGERWRQLRAKLTPTFTSSKLKHMYPLLLK

IGDNLIRVCDQIIKKDNIVEFKDLIGR(2)YTTDSISSIAFGVDCQSLDNGSS

EFQKHGSMAFDLPPIKNTLGTFVPKLLDIFRVPLYNKAMTQFFTKTFKDVLEE

RRRNKIARKDFLDLLMQLLDKGSLDEDKDLKQGDNSANG(1)SALGKISLSEA

IGQAFIFYLAGFETTSSTITYCLYELALNSEIQEKVQAEIDEFSKRDGGITYE

IMSNDMKYLHMVFLE(1)TLRKHPSIPFLNRECIEDCDIPNTNFRIEKGTKLL

ICMNAMHRDPDIFPDPEKFDPLRFTKENIASRQPYTYLPFGDGPRACIG(1)I

RFGMLQTKIALIGLLSNYNFSVCEKTSIPVMYARRSFTQTPEYGIYLKTEKRN

KSTFLYKNNKGQ*

>CYP6CK11-de3b6b Nv6Frag6 147aa 1 exon SCAFFOLD89c

plus (788964-789410) similar to  Am6,  pseudogene

fragment fusion of exons 2 and 5 with in frame stop

codon, 3.3 kb downstream from Nv6n32"    -de3b6b

GYTNDSTSSIAFGVDCQSLEMALAGFKSTLWFLIYLLLKMLVFAPIILDILRI

PIFSKAVTQLFTKTLTDVLEERQRNKITRKDFLLMQFIALIGLLSNYTVPVCE

KISIPVSYAKNFFVQTPVNGIYLRVEKRNKTIFLHKNNNGQ*

>CYP6CK12 Nv6n24 520aa 6 exons SCAFFOLD44 plus

(41754-41937,41998-42367,42444-42790,42929-

43168,43231-43482,43558-43724) similar to  Tc6BQ8, 

downstream from Nv4n14, upstream from Nv6nP4"      "x

MESLAPMLHTKLFWLAAVVTLIWVHFKFVIYTYWKRKGIPHDEPVVPFGSTLP

IFLGKSSMG(1)NLVKQKYQKSKKYPLYGIYMFHQPMLLINDPDLVRIILIKE

FNKFRDRGLYLNEKVDPLSGHLFLLPGERWRKLRAKLTPTFTSGKLKQMFPLL

VEIGDELIKVCEKIIQTDSVIEFKDLNAR(2)YTVDSISSIAFGFNCKSLDNP

NNEFKRYGSMVFDQSPIRNALGVFAPVVLDTLRIPLIRRVIIDFFSQTFKDMV

DHRHSNKIVRKDFINLLMQLMDKGVLEEDEKSQKSNDHTKAG(1)LIDNEKIS

MVEAQAQAFVFFLGGFETTSSTITYCLYELALNPHIQEKLQAEIDEHLAKPGG

MTYDRIVNELEYLHMVFSE(1)TLRKHPSVPILNRLCIEDCDLPNTNFRIKKG

TGVMISVSGMQRDPNIYPDPDKFDPLRFTKENIASRSPYVYLPFGDGPRVCIG

(1)TRFGILQSKIALIALLAKYKFSVCDKTSIPINYSKRSFTQSPEGGVYLRM

EKRIK*

>CYP6CK13 Nv6nP5 505aa 6 exons SCAFFOLD18 plus

(1536416-1536609,1536679-1537047,1537108-

1537443,1537533-1537736,1537802-1538053,1538118-

1538275) similar to  Dm6a14,  pseudogene?, deletion

in 3rd exon at X, unresolved 3rd intron, deletion in

5th exon at X"

MFDLAQWIFCLKLFWFTLVTYILYLAYLKFIAFNYWKRKGIPHEEPVLIFGNL

LKSSRGLISIGK(2)EDVRRNYEIFCEYPIHGIYMFSNPILMVNDPELIRVVL

VKEFARFRDRGLYFDDKVDPLTSNLFFLSGEKWRKLISKLTPTFTSGKLKQIY

PLLQEIGDELAKVVEKSMTRSDIIEVKDLSAR(2)YTTDSIASIAFGVNCDSL

NHPDSEFRKYGDMIVKKRSNIQLTFGMFSPSVPSLTKAVFNFFIKAFSDMVEY

RKREKIVRNDFLHLLIQLIEKGQVDDTEGEKFENIVRISTF(9)YAQAFVFFL

AGFETSFGTTIAYALYELAINPDIQEKVDEEIDELLNSVDGCSYNNCINKMKY

LDMVVYE(1)TLRKHPTSPFLNRVCVEECDFPEVNYRVPKGMRIIIPASGIMK

NPRYFPNPEKFDPERFSSKNGVSRSPYVYLPFGQGPRSCIG(1)VRLGMIQTK

IALISLLSKFKLSPCEKTSIPLKYSPRSIVQVPADGIYLNSTE*

 

>CYP6CL1 Nv6n29 493aa 4 exons SCAFFOLD348 plus

(172879-173746,173872-174075,175038-175283,175352-

175512) similar to  Am6AS5,  downstream from Nv6n6"

        "x

42% to 6AS5

MIIESFFCVVCILTISLAISFYYFLTWNFDFWKKRNVKGPEPVPFFGNYKDNI

FGKIHSTELTKRFYDEFANEKMVGIYVYGSPVLILRDLDLIRDVLIKDFAAFS

DRGIRVHDRVEPLSQHFFNLPVSTWRPLRKSLTPAFSCTRMKGMFELMAQVAE

LFVSFLEQNTEREESLECCALVAKFATEVIGECGFGSKMGEFEDKVSEFREVS

KTRIKSNLWNFVRRNLRQFWPSIYKYCSMFCNKKLLRYYVNMINSVNLTRSKE

GIKRKDYVEILLHLKNNPEQIQNLE(1)LSDSILAAQSYVFFTAGSDTTALII

SNLFYELAVNESIQDRLREEIQDQKLSYHGLKSMEYLDKVWKE(1)TLRKYPL

RNIQRASNQIYTFSKTNVTIPANTQIIIPNYAIHYDSQYYHEPEVFNPERFDG

RGNFSHPMIYLPFGKGPRDCIG(1)SQFAVHISKILIVKVLENFKVEISSESL

TREENDPRQVLLSPKGGIRLKFKRL*

 

CYP9 sequences (19)

 

>CYP9P3 Nv9n17 505aa 1 exon SCAFFOLD10 minus

(2621856-2620342) similar to  Am9P2,    "x 54% to

CYP9P1 bee

MFILLIAAYGLAVGLLYLLYMVVNQFTYWNQRKILHLKVTPLLGNFAPIFFRR

NSFPEHAKFLYNYLPDAKYYGTFDFNTPVIVLKDLDLIRDICVKNFDNFPDHR

SFVTEEMDPIVGRNVFSLKGQRWKDVRGTLSPSFTANKMKIMFQLITECSREF

VQYFVDHPELAANFEAKDAFTRYTNDVIATAAFGIQVNSMRDRENEFYVHGKD

ATSFSSPLRLIKFILFRSFPKLVRMTGERFLSRSTDKFFNQLVINTVRTREEQ

KIVRPDMIQLLMQARDKEDGIDVTIEDIIGQAFIFFLAGFDTSSTLMCFAAYE

LAAHPDIQEKVFREIEEQENGEELTYESLAKMKYLDMVISETLRMYPPSPMTD

RVCAKEFVMPPAKAGEPELRVEIGTNMVMPIYGMHHDPQHFPEPDKFMPERFS

DENKDKINPYIYMPFGHGPRKCIGNRFALMETKTLLVHILRKFRIKFTDRSKY

PIEFCKKTFNMTQKDGFWLKFEERKKTD*

>CYP9P4 Nv9n18 503aa 2 exons SCAFFOLD10a plus

(2416042-2416536,2416736-2417749) similar to  Am9P2, 

Downstream from Nv6n33i, upstream fromNv9-12"      "x

MLLAAYGLAALLFYASLLVLHQFTYWKRRKVLHLELVPIIGNMAPIMFRTSSF

PIHSQNMYKKFPGARYYGFFDLQKPSVIIKDPDLIREIFVKSFDHFTDHDAFV

TEKMDPIVGRNIFSLRGQRWKEVRNTLTPSYTAARIKMLFALVAECSKDFVQY

FVDHPE(0)LAENFEAKDAITRYTNDVVASAAFGVKVDSMKDQDNEFYLHGKE

VTNFSALAALKFTILKNFPNIMKFFGTTFLPNATDKFFKKLITNTVTTRIEKG

ITRQDMMQLLIQAMKKDDGIKVTMDDIIGQAFFFFLAGFESTSSAMCFALQEL

AANPDIQDRLRQEIDDEIEQHGGELTYESLVNLKYLDMVMSETLRKYPPVAIT

NRLCNKEYTFPPLMEGYPEYQMEVGTSILISMFGLHRDPKYFPDPEKFDPERF

NDENKHKINPYTYMPFGIGPRQCIANRFALMEAKIVIIDILRKFVVKFTEKSH

HPVTLSKKTFILSAEEGYWFKFEGRKKVD*

>CYP9P5 Nv9n12 508aa 2 exons SCAFFOLD10b plus (2418648-2419154,2419228-2420244) similar to  Am9P2,  downstream from Nv9-18"  "x

Nv9n19i same as Nv9n12 235aa 1 exon SCAFFOLD10 plus

(2414482-2415186) similar to  Am9P2,  C-term only,

missing 275aa on N-term, upstream from Nv9n18"    

MIPVAAILGYGLAAIFVFALYTIVYQYTYWKRRKMLHLESVPIIGNNYPMLFG

IDSFPMHAQKMYKKFSGARYYGCFDFRKPVVIIKDPDLIKEICVKNFDDFTDH

LTFVTEEMDPIAGRNIFSLKGKRWKDLRSTLTPSYTAARMKLLFELIDECARN

FGQYILENPE(0)FAKSFEAKEVFTRYTNDVIATAAFGVKVDSMKDQENEFFM

HGKASTTFTSKLLMLKIVLLRNFPRLMRLFGATFLPRSSDKFFKKLINEAVTL

RREKDVTRPDTIQLLMQAMDKEGGVNVTMDDILGNAFIFFLAGFDTSSSLMAF

MALELAANPDIQEKLQQEVDLQLEKNDGKLTYEALSDMKYLDMVVSETLRKYP

PAPITNRVCTRDHVFSPPMQDYPEYRMEKDTVIMIPIYALHRDPQYFPEPEKF

DPERFNEENKSKIEAYTYMPFGHGPRQCIGNRFALMETKILMVHVLRKFTIKF

IEKTVFPVEFIKLSFNLGAVGKFWLQFEERKKVN*

 

>CYP9AG1 Nv9n13 504aa 1 exon SCAFFOLD2a plus

(7526748-7528259) similar to  Am9R1,  upstream from

Nv9n14"    "x

MEFFTWSLILGACGLIYYFFKKRLSYFEDLGIPYVPGWPFFGNMSGPFLFRKH

FTEALVDLYKANPREAKYIGIFDFNARPVILLRDLEIIKTIAIKNSDKFPDHL

AFATEDMDPMFGANLFNMTGDRWREMRSILSPAFTSSKLKAMFHLMVECAENF

VKYVDGLPANLRKSIATKDLFTKHTNDVIATCAFGISVDTLKDPNNDFYVLGR

QATNLEGVLAFKMFLFRSFPAIVKLFNLRFVTPEVVNFFTKIVSTTVKTRDEK

GITRPDMLQMMMDARSKGSKGLEMDLNMMTAQAFSFFFGGFDTTSSQMCLMAH

ELAINPDVQKKLQDEIDQVLCNTNGKPTYEAINAMQYLDAIFNETLRKHTQGL

MLDRLCRDDLEIPPALPGGKPLTLKPGMNVWIPAYAIHHDPQYYEDPEKFDPE

RYVNKKVSINDVINLGFGTGPRSCIGNRFATMEVKILFFHLLAKFSFKPNENT

CSPLTYDRKKFILVPEKGFSLAIKPRN*

>CYP9AG2 Nv9n14 503aa 1 exon SCAFFOLD2b plus

(7530152-7531660) similar to  Am9R1,  downstream from

Nv9-13, upstream from Nv9-15" "x

MEFCTWCLILGACGLIYYFFKKRLSYFEDLGVPYVPGWPFFGNMSGPFLFRKH

VTEALVDLYKTNPETKYIGIFVFNARPVILLRDLEIIKTIAIKNSDKFPDHLA

FATEDMDPMFGANLFNMTGDRWREMRSILRPAFTSSKLKAMFHLMVECAENFV

KYVDGLPANLRKFIATKDLFAKYTNDVIAICAFGISVDTLKDPNNDFYVLGRQ

ATNLEGVLAFKMFLFRSFPAIVKLFNLRFVTPKVVNFFTNIVKTTVKTRDEKG

ITRPDMLQLMMDARSKGSKGLEMDLNMMTAQVFSFFFGGFDTTSSQMCLMAHE

LAINPDVQKKLQDEVDQVLRDTNGKPTYDAINAMQYLDAIFNETLRKHTQGFM

LDRLCRADLEIPPALPGGKPLTLKPGMNVWIPSYALHHDPHYYEDPEKFDPER

YVHKKVSINDAINLGFGTGPRSCIGYRFATMEVKILFFHLLAKFSFKPNENTC

SPLTYDRKKFILVPEKGFSLAIESRN*

>CYP9AG3 Nv9n7 502aa 1 exon SCAFFOLD2a minus (776111-

774606) similar to  Am9R1,  upstream from Nv9n8"  "x

MDLWIWTVLVTVCVWLYYHFKKTLNYFKDRDVPYVPGWPIVGNMANPILRRKH

VSDAVLDMYNFHPEAKYVGVFDFVRPVVMLRDIDLIKSVTIKNFDNFPDHKSF

IDASLDPLFGGNLFNMAGEQWREARNLLSPAFTSSKMKAMYELMVKCGENFVN

HISERSAKENRMIATKDLFTKYTNDVIATCAFGISIDSLKDPNNEFYHLGKTA

TNPEILTRKFFIARSFPKIMRIFNIKFVSESTGNFFKNIISSTVRMRDEKGMS

RPDMIQLMMDARGKESTKHLKLDITEMTAQAFIFFFGGFDTTSTQMCIIAHEL

AINPDIQKRLQNEIDDVMRVSNGKPTYEAINGMPYLDAVFNESMRRHTQVAFI

DRLCTKSFELPPAYPGGKPFVLEPGMNIWVPATAIHLDPKYYDNPRKFDPERY

YQKKVSINDATNLGFGIGPRGCIGNRFAILEIKILFFFLLSKFSLKPNEKTSR

PLVYSMKSFVVSAEGGFWLTIEKRK*

>CYP9AG4 Nv9n8 502aa 1 exon SCAFFOLD2b minus (773569-

772064) similar to  Am9R1,  downstream from Nv9n7,

possible alt. 1st exon 740nt upstream from start" "x

MDLLTFALIVVACYTIYYYFKNNLDYFKNRDIPYYPAWPLLGNMATPFFRRKH

ISDLVRDMYNYNPDAKYIGGFDFVRPVIVLRDLELIKSVAIKNFDSFPDHKSF

VDDSLDPLFGGNLFNIAGDRWKEARNLLSPAFTSSKMKGMFELIAQCAENFVK

YLEERPASENKMIATKDLFTRYTNDAIATCAFGIAVDSMKDPKNQFYVLGREA

TNLEGLMTVKFFIARAFPQILKFFRITFVRDEIVKFFKDIVGATVAMRDEQGI

SRPDMIQLMMDARGKESKHLKLDLTEMTAQAFIFFFGGFDTTSTQMCIIAHLL

AIHPNVQRKLQEEIDEVMRKHQGKPTYEDINGMAYLDAVFNESMRRHTQVGFI

DRLCTKKFELPPALPGGKGFTVLPGMNIWIPAIGIHMDPKYYDDPETFDPERY

YEKKVSINDVTNLGFGIGPRACIGNRFAIMETKLMLFFLLSKFNLVANEKTAK

PFVYSKHTFSIVAKGGYWLGIEKRN*

>CYP9AG5 Nv9n9 503aa 3 exons SCAFFOLD16 plus (588025-

588309,588377-588929,589000-589670) similar to 

Am9R1,     "x

MEYTTLALLAVLAYAVYRYLRKRCDYFEDLGLPYVPALPLFGNMGNLVFGRKH

IVHVIQDIYNYMPEAKYLGAFDFTRPVIVVRDPELIKDITIK(0)HFNNFTDH

QGFVDVSVDPMFGGNLFSMAGDQWKEARTLLSPAFTSSKMKAMYGLMVKSVEN

LVAHVEKLHKEDPKRKFATKDLMTKYTNDVIATCAFGIEVNSLEDPTNQFYVL

GRKATDFEGLLSLKFSLNRAFPKLMKLLRVKIVTDKVARFFKDVVRRTVEMRD

AENISRPDMIQLMMDARG(1)KTSENLKLDITQMTAQAFVFFFGGFDTTSTQM

CIISHELIINPDIQSRLQAEIDEVLERTRGKPTYDDINSMPYLDAVYNESMRC

HPQANVIDRVCIKAFELPPALPGAKPFVIRPGMNIWVPVAGIHYDEQFHRDPW

NFDPDRYLNKKVTISEVENVGFGIGPRSCIGNRFAILETKILFFHLLAKFSLR

PNEKTCKNFEYSKNNISIMPKGGYWCSFESRA*

>CYP9AG6 Nv9n10 503aa 1 exon SCAFFOLD9 plus (1812432-

1813940) similar to  Am9R1,  "x

MDPFFWTSILVISSLVYYYFKKKLDYFEELNIPYVPGWPLVGNFLGVFTQRQH

LIELLKELYNSHPEAKYVGAFDFGTRPVIVLRDIELIKSVTIKHSDKFPDHMP

LADRRTDPTLGDNLFNITGDEWKELRNVLTPSFTSSKLKMMFHLMADCADKFL

KHVEYLPPEARKYVDTKDLFTRITTDIIASCGFGISVDSLRDRNNELYVLGKK

STHIEGIQGLKFLILKSFPWIVKLFKLKHVTEDVSKFFANLVSTTIRTRDAMG

ISRPDMLQMMMDARKKKTEHLELDMSMMTAQCFGAFFAGYESLSTFMCLVAHE

LAIHPDVQKKLQNEIDEVMKESNGKLNYKAINKMQYLDAVFNEIARKHPQNPF

IDRRCVAHFEFPPAFPDGKPITLEPGTSIWIPVAGIHMDPKYYENPEKFDPDR

YYQKKVAKNDALNLSFGIGSRSCIADRFSKMLVNILFVLLLSRFNFVRNEKTC

SPLKYSRKNIIITPKGGFSLDIEARS*

>CYP9AG7 Nv9n1 503aa 1 exon SCAFFOLD112 minus (2410-

902) similar to  Am9P2,         "x

MDTWTWSLLVASLGLLYYYFKKKLNYFEELGIPYVPGWPLFGNMASVFFRKSH

LNDTVKHIYNAHPEAKYVGFFDFGSRPVIMLRDLDLIKSVAITNADKFPDHLP

FVHGSIDPLFGTDLFNTLGDQWRELRSLLTPALTPSKLKGMFPSMIECAQNLV

SYIEDLPPNSRKLINTKELFTKSTNDIITTCAYGISVDSLKDPNNAFYVFGNK

AANLDGHVGLKIFIMRSLSTASRLLRLKFVSDENCKRFTDLIRTAVKTRDDNG

ISRPDMLQLMMDARKDTKTVDLDPSLMAAQAFSFFLSNFDSSATHMCLMAHEL

AINPDIQDKLQNEIDDVLKETQGNLTYEVINGMQYFDAVFNETLRKHAQGTGA

IDRVCKASFEFPPALSGGKPVTLKPGANVWIPSVAIHADPQYYEEPDRFDPDR

YYKKKVNAKNAPNLGFGIGPRGCLGVRFAVIEVKILFFYLLSKFTLKRTEKTC

SPLVYDKRNLFLVAEGGYFLDIEPRN*

>CYP9AG8P Nv9nP3 341aa 1 exon SCAFFOLD33 plus (312468-313492) similar to  Am9Q2,  major deletion of

470nt at X" ~60% to Nv9n7      

MVFVTFTLAVVAFCTIYYYFKNTRDYFKKKNIPYYPAWPLLGNMAEPLLRRKH

VSQLVKDMYNHNPDAKYIGGFDFTKPVIMLRDLELIKSITIKNFDSFSDHKAI

FDETMDPLFGGNLFNLTGERWKEVRNLVSPDFTSTKMKAMFELIVQCAKDFVG

YLEERPVEDNKMIXDEIIVKYKGMPTYEAIHGMDYLDAVYNESKRIHVQVTFI

DRLCIKTFELPPALPGEKLIVMQPGMNVITVTGIHTDPRYYDDPETFNPERYY

KKKVSIDDVTNLGFGIGPRSCIGSRFAIMETKVLFFFLLSKFNLVANEKTAKP

FVYSKHSISVVAEGGYWLEIEKRN*

 

>CYP9AH1 Nv9nP2 496aa 1 exon SCAFFOLD24a plus (2116732-2118249) similar to  Am9R1,  pseudogene, no

M at N-term, many stop codons, upstream from Nv9n6"

52% to Nv9n4 41% to 9R1 bee

AAZX01006492.1 6481-7968 (-) strand

MNSWIWIFLLSVVTFIVIKAYRIRHH

FEKWGIPQYPDLPFLGFMASNFFPRLHLHNVVRDMYNWNREAKYIGCHMFTSPQLMLRDL

DLIKAVTVKNFDHFSDHKTFVDESMDPLFAGSLAMLNGDKWCEVRNVLNPAFTLSKMRVM

FGLMSNCAENFVDKFLVLYSNCDEVEIMEPINRYTNDVIASCAFGFDIDSLGNPDNEFYI

RGRSLMSSLKYLKVFKILFIRACPRISQILKLKIISEQDNDFFVNVIRSGIETRREQGIT

RPDMLQLMMDVEPSLNLLEMTAQAFVFFLAGIESTAVQMCVIAHELAANPDVQKKLHDEI

DTVLRECDNKPTYEAMNNMVYLDAIFTESLRMHSASFMNRMCTKEFELPPAVPDAKLYIV

QPGEERLISMPGIHYDPDYYENSERFDPDRHTGKRAAQGDATNLGFRLGPRMCIGNRFAV

LETKVMFAHLLSKCRLQPCKKTCIPLKYDPGSLAVVPKGGFWLKVLPRN*

>CYP9AH2 Nv9n6 502aa 1 exon SCAFFOLD24b plus

(2120168-2121673) similar to  Am9R1,  upstream from

Nv9n5, downstream from Nv9nP2"       "x

MYQWIWSILLLLLAVAVFYAVTMNIRFRSYGIPQPLELPFIGFFGLGFMTRTH

MSVVFRKAYDMSVKAKYMGAHIFTTPIILIHDLDLIKSVLVKNFENFAYHKTF

VDESADPLFAKNLVFANGERWRNIRTMLSPSFTSSKMRSMFVLMSRCAQDFVD

QFIELYQSKPEINMKDALTRYANDVIATCAFGLEVNSLREPNNQFYLTGRRAT

NFASLSLLLKFMLMRLCPSLASALKIRIVSKKDTDFLVNVIQSTIKDRDAKGI

SRPDMLQLMMDARGKTSECLDMNILEMTAQAFVFFLGGFETTSTNMCLLAHEL

AVNPEIQKKVQDEIDQVMERCKGELTYEVVNNMEYLDAVISETLRMHPALTAL

SRICNKEFELPPALPGSKPYLVKPGMEIMVPGSTIQRNPEYYENPDRFNPDRF

LGKKAANSDVTTLSFGLGPRMCIGNRFAILETKILFVYLLSRCSIEPSEKSSV

PLVYDPTVFGASAKGGFWLRIKVRK*

>CYP9AH3 Nv9n5 498aa 1 exon SCAFFOLD24c plus

(2125867-2127360) similar to  Am9R1,  upstream from

Nv9nP1, downstream from Nv9n6"       "x

MDFWIWSLVLVVVTYIVHKALEIKNHFRQYGVPQPAEIPFLGFFGKNMMLRRY

FGLVLEDLLKNHREAKYIGVHSFATPVIIVQDLELIKGVLVKNFDNFSHRRTF

TEDVNDPLFTKNLAALNGDRWREIRNILSPAFTASKLRAMHVLMAGCADNFVK

QVIVKYGDKEDMDTKDAITKYTNDVIASCAFGIEVDSLKDPNNEFYLNGKKST

DFTRTSAMFKFIILSVFPWLATKLGIKLIEKEESDFFIKVIETTLKTRKDKGI

YRPDMLQLLIESAEKNVSLDFLDITAQAFIFFLAGFETVSNLLCMIVHELSIN

QVCQDKLKEEVNETMQKCNGQPSFEAINNMIYLDAVFNETLRLHPVPLLSRMC

SKDFELPPAVPGARPYVIKAGIEVVIPASAIHKNPDYYQDPEKFNPERYVNKK

LTTSDPTALGFGLGPRMCIGNRFAIHECKVLMVYLLSKCNLLPAKKTCNPFVY

GKNSFAPVPEGGFWVKIRPRN*

>CYP9AH4-de1b Nv9nP1 133aa 1 exon SCAFFOLD24d plus

(2127771-2128167) similar to  Am9S1,  pseudogene

fragment, N-term only, upstream from Nv9n4,

downstream from Nv9n5"

63% to Nv9n6   

MYHWLWSIFLLLFTVLIFFTLHMNNRYRSYGVPHPLELPFLGFLGIGFFKREH

LTVTFKKAYNMAYNAKYMGCHMFTSPVIVIRDLELIKSVLVKNFDNVAYHRTF

FDERKNFIISSTVAMNELPLIITDFLR

>CYP9AH4 Nv9n4 501aa 1 exon SCAFFOLD24e plus

(2128982-2130484) similar to  Am9R1,  upstream from

Nv9n3, downstream from Nv9nP1"       "x

MYYWICAALIAVLSYVILKAYQIRHYFEKYGIPQSPDIPFLGMLGMSILTGHH

VNYIIKDVYNINKEAKYVGVHPFLKSAILVRDLDLIKSVLVKNFDNFADRTVF

SSEESDPIFAKSLSLLNGQRWREVRNLLSPAFTSSKMRTMFTLMSHCAKNFAD

QFVKKYRDEENIDMKDAFTRYTSDVIATCAFGIEVDSLKDPNNEFYLHGRRST

DFSGLKVMLTFFVNIVCPSLGRKLGLRFISKKETDYFVKLVEGTIKAREEQGI

RRPDMLQLLMESEEKGKHLDSMDLVAQAFIFFAAGFDTVSGQACSIAHELAVN

PDVQQKLQVEIDEVMKNCNGQPTYEAVNSMQYLDAVFYETMRVHPIGFLSRIC

TNEFELPPTLPGAKPYVLKPGMEILVSPVGVHSDPDYYDNPEKFDPDRYLDKK

ISSDVLNLGFGLGPRMCIGNRFAVLETKILLLHLLSKCNLMPSKKTCIPWVYA

KRNFNPLPEGGFWLRIKQKKQITG*

>CYP9AH5 Nv9n3 497aa 1 exon SCAFFOLD24f plus

(2130821-2132311) similar to  Am9R1,  downstream from

Nv9n4"      "x

MDFWLCVTLIAVLTYLVFTAHKKRHYFAKYGIPQPPEIPFIGAAGASILTGYH

VNYAMKDVYNTNRDAKYVGIHAFIYPIIVLRDLDLIKSVIVKNFDHFSDHKTL

VSEKSDPLFGKNLANLKGERWREVRNLLSPAFSSSKMRTMHELMSLCAENFAN

RFLESNSSKEAVDMKDAFTRYTNDVIASCAFGIEVDSLKESKNEFYLHGKTST

DFTKPSVLVCFLLNMVCPSLANKLGLRIVSQEETDYFVKLIKETIKTREERGI

KRPDMLQLLLDSQEKTKKLDFLDLTAQAFIFFAAGFDTVSTHACCMAHELAVN

PDVQRKLRVEIDEVMRNCKGRPTYEAVNNMRYLDAIFHETMRIHPIAFITRIC

TKEFELPPTLPGAEPYVLKPGMEVQVPTVGIHHDPDYYDDPEKFDPERFMDKK

ASSDILNLGFGLGPRMCIGNRFAILETKVLFVHLLAKCDLVPCEKTCNPMVYA

DRSFIPAAKGGFWLKAVPRH*

>CYP9AH6 Nv9n2 504aa 2 exons SCAFFOLD127 plus

(674200-674841,674909-675778) similar to  Am9Q2, 

        "x

MDYWIWSLLVVTLTYAITSIYRQLSYFSRWGIPHPREMPIVGAIYALFFPRRH

INDFIKYIYDFNPDAKYVGAHIFTKPTIFIRDLDLVKTVLVKHFDHFADRKTF

VDEKADPLFGRNLNFLNGDRWKEIRTILSPAFTSSKMKTMYVLMSKCAENFTD

EFLKKYGDAEAVDMKGAIGKYTNDTIASCAFGIEVDSMKDPNNEFYLQAKEIN

FK(0)GVTLLKIQLEMIFPTLTRKFGMRIVSKKVTDFFVNAIATTMSVREEQG

IFRPDMLQLMMEARSKMDKEAAERFDLLEMTAQAFLFFLAGFDASSNQFCIIA

HELAANPDIQSRLQAEVDDLMQKCDNKPTYDALNHMPYMDAVISESLRRHPIA

FLNRLCSKEFELPPAVPDSKPYTMKPGDGLMIPVAGIHMDPNLYPNPERFDPD

RFIDKKIAISDVTNLGFGLGPRMCIGNRFAILSMKSLLVQLLSRCNLVPCSKT

CIPLEYCKNIFAPTPKNGFWLRIEPRTESR*

>CYP9AH7 Nv9n15P 520aa 1 exon SCAFFOLD2c plus

(7539842-7541405) similar to  Am9R1,  pseudogene? 2

stop codons, downstream from Nv9-14"    

51% to Nv9n3, 42% to 9R1 bee

AAZX01003178.1 2245- 3756

MDSTTWLLVVSAIVLCLSVYYKKKRHSFKDWGIPQPFEVPYLGSVPRNLWKK

YHLSDLMKDMYNFNKEAKYVGMHTFMIPVVIITDIDLVKTVLIKEFDHFADHRELGDAVG

DPLLTKNLIAINGDKWRELRQLLSPAFTSSKMKLMFELMSDCADRFTKSFSEQFLKEDDT

DMKKAFTKYTNDVIATCAFGIEIDSMKNPNNEFYRYGREVTNTDGLAQLRAIYKMLFMIM

FPRFAKFIGMELMREKISKFFIGVIDEAIKQRDEKGATRPDMLQLMMDARDKNSKLDLVD

MTAQAFLFFVAGFETASSNMSLMAHEIAANPDVQEKLHAEINEVSEKSGDKVTYEAIANM

PYLDAVFQETLRLHPQLAFLSRVCSKTFELPPALPGAKPYVMKAGEEIMIPVTGIHQDPA

FFEEPTKFNPERFLEKKITTTGDPKSLGFGMGPRMCIGNRFAILETKVLFFYLLRKHTLQ

PCSKTCLPLKYHKFKVGPIPKEGFWLRVRER*

 

CYP336 sequences (3)

 

>CYP336B1 Nv336n1 502aa 1 exon SCAFFOLD15 plus

(588295-589800) similar to  Am336A1,    "x 37% to

CYP336A1 bee

MDLSCLLLVAILALSILYWFCTKTFDHWKQQNVPSVPNPRPFFGHFLPVLFIK

ESLISFVHKIYQQTDASMIGLFLLRKPILLVRDPELVKSIFQTSFNKFHVNGF

DLSEKNDPILVKNPFFTADLHLWKTRRARIVNHLSGSKLRQLFVIAEEVCSKM

CQFNDRKIKENGDYFECELKEFFVKYTGEIVANAAFAIQGQSYEDNPDRLAFA

VIARKLLKPSLMNALKQAMLFYFPEVGSALGIGIMEKSTDNYFRENIKLVLKE

RKRSNVAPKDFLQSAIEANGID  DIDSIIADAIIFYGDVYETSSTTLAIVIYYLSEYKDIQNKLRTDISSKLQASG

GAVNYDFLKSMNYLDQVIQESMRLLTPAGTLMKVCTEEITLKGFDGITCNLKP

GTRVFISLTGLHLDSNYWPEPDVFDPERFAPENQANRHKFTFMPFGEGPRMCV

GMRLALMIIKLAIVKLLLRYSIEQSSKTKKPLVLDATSFLTYPKGGWWARFKK

LSD*

>CYP336C1 Nv336n2 499aa 1 exon SCAFFOLD87 plus

(57254-58750) similar to  Am336A1,       "x

35% to CYP336A1 bee, 38% to Nv336n1

MDTSCALLFLVAVLSVVYYYLKWPYTHWKKQKVKCVPGTIPAFGHLLPILFSR

ESSSDLFTKVYRDYEKSSMVGMYFFRTPAVLVREPELVKRVLVSDFQSFQNNL

LLLNPKMDPFMSKNPFFCWDEDWKAMRSQMINNMSQKKLKIFFGIMHRVSDKF

DDYLSKQVGKAADLEVDIKYVILRLTGELVANTAFGIEGGGFESEISPHSFTG

RVENMLKPTFTTIYRQMLVLYLPEFASALGLGFLTNSLDSFLISTVDNIMRHR

KEQGLVVDDLLQMIIEASDDLDPKVVAGKLSGYYFDAYETAATMASFACFELS

HNSQAQDKARSEIKEILDNYEGTLSYEALKDMKYLEQVIHETIRLYPIIGAAY

KVCTRKITLEGSDGQSCCLEPGNIVVVPILGLHTDDEYWENPHSFDPDRFNEE

KKNVTKFSFLPFSEGPRMCAGMRYGIMTVKTILATIIKSYTIETSQKTSRPPK

LETGSVLTLPAEGLYVKLKRIG*

>CYP336-un1 Nv336nP1 504aa 1 exon SCAFFOLD7 plus

(3392146-3393659) similar to  Am336A1,  pseudogene?,

stop codon in 1st exon, GPRM_Y_IG_K_RMG in heme

binding, downstream from Nv6Frag2" 42% to 336n1

MIDITCLLIVLVLISVYLYLTKNYNYWKNQNVPCASYALPGIGHGLSLILIWD

NLAMWVTKLYKMQKHSMYGCYFIQTPALIIRDPELIKCVLLSDFANFPNNMIT

LNDQLDPAMARNPFFAKDDIWKESRMVLGNNSSGKILRSVSKILFQVCKKFTS

FVDEHITENKGYAEFELKDFFARIIGEMVANSAFGIEGQSFSRSPSPQAFTNV

AKEIFDPKKINGIEEAIRFCFPKLADKLGLRMIPKETDTYFRQTTKTIIKAPL

QSNESRSDFLQYIIERMYKEINEDMAISQAISLFFDGYETSSSALSFVIYHLA

ENPGVQEKLRKEVFTVLKRFDNKVTYEAIKMMHYLEQVIYESIRLNPPLGEFV

KVCNKQIQLKGYDGLRCNLKPGDLIIISVFGLHMDHEFWPNPSKFDPERFSTI

NKATRNKFTYLGFGEGPRMYIGKRMGLMIVKAVTAIILQQYFLVPCSKTRVPL

QMNPNTFASVVRGGLWARFKSLNTKNY*

 

CYP4 clan (34 sequences)

 

>CYP4C60 Nv4n29 518aa 11 exons SCAFFOLD20 minus

(1854616-1854409,1851394-1851188,1850411-

1850226,1850117-1850048,1849637-1849512,1849439-

1849379,1849296-1849187,1849092-1849024,1848960-

1848786,1848723-1848544,1848472-1848312) similar to 

Ag4C26,  55% to CYP4C3 47% to CYP4C1, 48% to CYP4V2

MYLANKCLQWILDVKRFNILLMVLFTIFGWLILRWWQMKRRCWKYLAKIPGPF

SLPLIGNLVQLKVDHDE(1)LFSLIVGMRLMWGTQEGINKAWLGRKPYVFLSK

ASTVEQILGSNRHIDKSCDYKFLQPWLGTGLLTGSG(1)HKWYSRRKILTPTF

HFNILEDFVQVFGEQTEVLVRKMSSELGRPSFNIFPYVTLCTLDIICE(1)TA

MGRRISAQSHSDSDYVRAVYD(2)IGSIIQTRQASVFYQSNIFFRLSPLYKKH

QECIRILHQFSNE(0)VIKERRKEISESIREINGNEV(1)PKKRLAFLDLLIK

ASENGAILSNSDIREEVDTFMFE(0)GHDTTSSAVCWTLYLLGCHPEVQ(0)E

EVVNELEMIFSEGDYDRRPSLKDLKRMKYLDKCIKEALRLYPSVPILGREISE

DVEIG(1)GYTVPKGTTALVVLPVLHRDPEIFSNPEKYDPERFAAENMIGRHP

YSYIPFSAGPRNCIG(1)QKFALLEEKAIISGILRKFVVEATEQRDDISVTAE

LVLRTKSGLHLRIQPRMN*

>same as Nv4n29 not Nv6nP6 518aa 11 exons SCAFFOLD20

minus (1854616-1854409,1851394-1851188,1850411-

1850226,1850117-1850048,1849637-1849512,1849439-

1849379,1849296-1849187,1849092-1849024,1848960-

1848786,1848723-1848544,1848472-1848312) similar to 

Am6AS5,  1st exon seems short at C-term, deletion in

2nd exon at X, upstream from Nv6n6" probably

mislabeled since Nv6-P6 was missing from this set

MYLANKCLQWILDVKRFNILLMVLFTIFGWLILRWWQMKRRCWKYLAKIPGPF

SLPLIGNLVQLKVDHDE(1)LFSLIVGMRLMWGTQEGINKAWLGRKPYVFLSK

ASTVEQILGSNRHIDKSCDYKFLQPWLGTGLLTGSG(1)HKWYSRRKILTPTF

HFNILEDFVQVFGEQTEVLVRKMSSELGRPSFNIFPYVTLCTLDIICE(1)TA

MGRRISAQSHSDSDYVRAVYD(2)IGSIIQTRQASVFYQSNIFFRLSPLYKKH

QECIRILHQFSNE(0)VIKERRKEISESIREINGNEV(1)PKKRLAFLDLLIK

ASENGAILSNSDIREEVDTFMFE(0)GHDTTSSAVCWTLYLLGCHPEVQ(0)E

EVVNELEMIFSEGDYDRRPSLKDLKRMKYLDKCIKEALRLYPSVPILGREISE

DVEIG(1)GYTVPKGTTALVVLPVLHRDPEIFSNPEKYDPERFAAENMIGRHP

YSYIPFSAGPRNCIG(1)QKFALLEEKAIISGILRKFVVEATEQRDDISVTAE

LVLRTKSGLHLRIQPRMN*

 

>CYP4G43  Nv4n27 561aa 5 exons SCAFFOLD17 minus

(2104122-2103894,2103823-2103626,2102868-

2102616,2102458-2101821,2101748-2101384) 81% to 

Am4G11,

89% to 4G41 Ceratosolen solmsi martchali

(Hymenoptera) fig wasp

probable ortholog to CYP4G11 Apis 

MSAAGPEVVAGSVAAAAASGFSATSVFFTLLVPAILLYYVYFRISRRHMIELS

DKIPGPKGLPLLGNALELIGSSDT(1)IFRNVYKRSFEFDQVIKLWVGPKLVI

FLIDPRDVEVILSSHVYIDKSPEYRFFQPWLGNGLLISTG(1)QKWRAHRKLI

APTFHLNVLKSFIDLFNANSRAVVQKMRKEDEREFDIHDYMSETTVEILLETA

MGVSKSTQDKSGFEYAMAVMK(2)MCDILHLRHTRVWLRPDWLFNLTKYGKEQ

VHLLDIIHGLTKKVIARKKEDYKSGKRNFVDTSAAAKDNKSTTVVEGLSFGQS

AGLKDDLDVDDNDVGEKKRQAFLDLLVEASQNGVVLTDEEVKEQVDTIMFEGH

DTTAAGSSFFLSMMGCHPDIQEKVIQELDEIFGDSDRPATFQDTLEMKYLERC

LMETLRMYPPVPIIAREVKTDLKLA(1)SGDYTIPAGCTVVVATFKLHRQPHI

YPNPDVFNPDNFLPEKTANRHYYAFVPFSAGPRSCVGRKYAMLKLKILLSTIL

RNFRVRSTVKEEDFRLQADIILKRAEGFKVKLEPRKRAAGLKA*

>CYP4G44 Nv4n3 547aa 9 exons SCAFFOLD36 plus (468118-

468241,468401-468611,468716-469012,469487-

469788,469884-469993,470072-470140,470807-

470975,471054-471228,471310-471493) 58% to  Am4G11, 

       

61% to 4G41 Ceratosolen solmsi martchali

(Hymenoptera) fig wasp  

MSTSYLPATLFWPLVLIAAALAAVHYYIETSRIVRLGNKLPG(1)PKTVPFFG

NALMALGVQPKDVLTEVMKYDIYGNVARAFLGPKLVVFLVDPRDVEIILGSHV

HIDKSPEYR(2)YFAPWLGEGLLISTGEKWRSHRKIIAPTFHLNVLKSFVPLF

YENSIDLVKRLKSEVGKEFDCHDYMSGITVDILLETAMGVRGTQKEKSSYDYA

MAVMK(2)MCNIIHQRQYNFMLRLDTFFQFTSFAKQQTKFLDIIHGLTKRVIK

KRNVEFKDKMDSPMMNSIMKELKKDSTEIVDEKQPEEQKMRYVRDDLDEIDEN

DVG(1)EKRRLAFLDLMLEMRKNGEQLTDEEIKEEVDTIMFE(0)GHDTTAAG

SSFVLCVLGIHQDVQ(0)DRVIEELNEIFKGSDRPCTFQDTLEMKYLERVILE

TLRLFPPVPAIARQLNQDVKLA(1)SGDYILPSGCTVVIPQFKIHRLKEYYPN

PDVFDPDNFLPDKTQDRHYYAYIPFSAGPR(2)SCVGRKYAMLKLKVLLSTIL

RNYKINSDLTEEDFKLQVDIILKRSDGFRIQIEPRNQAVIV*

 

>CYP4AA1 ortholog Nv4n12 500aa 6 exons SCAFFOLD28

plus (26669-26837,26909-27289,27360-27438,27695-

28218,28571-28750,29081-29247) similar to  Am4BA1,

can't find N-term, no M, maybe 1st exon is wrong?"

61% to CYP4AA1 bee  

WDRDAQELWIYVALIVGTLAIYLLKDQIRIYWTIFQLNGPPTVPLLGNVDCLL

RKDI(1)LEVMSHTAYKDYGPVARFWVTLIPYVILLEPDDIQAVLGSAKHTSK

IFVYRLLDNFLGKGLITSDVDTWRTHRRLLQPAFHLHVLQKFVGSFAERADRL

ADRLARYDNQQLDITKFVNDAVYEILNE(1)TVLGVNVASTANEDGVVDLDDL

PFRK(2)GQVLMTHRLIRPWLIFDWIYKLTSTGQQEKKQSQDLSAACHRIIQE

KRRLQRDSSSLTKKTSLLEYMMETSERNPEWFSDEDIINECCTFMLAGQDSVG

TATAMTLFLLANHPDWQDKCREELDEIFAEGETNRPPTMQDLRAMRWLECCIK

EALRLYPSVPIFARKLGEDVKVG(1)KHVIPSGCGVIILPYSTHRLPHHFPDP

HSFRPERFSPENSEKRHPYAYLPFSAGPRNCIG(1)NKFAILEMKAVISAILR

RYRLGGVEGKTEVRPKFRLTVRASGGLWLKISQRVDAR*

 

CYP4AB sequences (23)

 

>CYP4AB4 Nv4n32 515aa 12 exons SCAFFOLD4 minus

(3739653-3739500,3739338-3739229,3739154-

3739064,3738979-3738791,3738407-3738314,3738244-

3738142,3738075-3737970,3737904-3737798,3737715-

3737647,3737580-3737412,3737323-3737144,3737065-

3736893) 51% to  Am4AZ1,  upstream from Nv4n16", 53%

to CYP4AB1

AAZX01001981.1 (-) 8901-6138 

MIVEFLLLLLLAACIFHYYTRCGRVAKLTENIPGVRAWPIVGSLPGLMKSQG(

1)ELWPIFRKMSNDYYPTYKFWTTHEVVINIRHPDDIE(0)ILLSSVQHLEKS

TAYKLLHPWLKTGLLTSAG(1)NKWQARRKILTPAFHFNVLKKYMDIIVENSE

RMVRSLKTKASDGPIIDLLQFSTNYTLNVICE(1)TAMGTSLHGMEEFQEKYR

NAIHKMGDVLIYR(2)IARPWFRKESTFKWTQKGQEQTAALKVLHGFSEK(0)

IISERKEYHDQTKYNYLNQFMTDEVNDEEDNEIYGI(1)RKKRLAMLDLLISL

FRNGQIDDEGIQEEVDTFIFE(0)GHDTAAMGLSFALLLLAEHTDSQ(0)SRA

RDEVKEMFNKSGGKMGYSEIQQLQYLEMCIKESLRLYPSVPFISRQLKKDLQL

K(1)HYLIPSGAIMHVHIYDLHRDANFWPEPEKYDPERFSPDSIRNRHPFSYI

PFSAGPRNCIG(1)QRFAMMELKASIAHLLHHFILEPIDYAHEVPIRSDLVIR

PARPIRIKFVPIKHDALL*

>CYP4AB5 Nv4n16 511aa 12 exons SCAFFOLD4 minus

(3736332-3736179,3735921-3735812,3735734-

3735644,3735508-3735326,3735226-3735133,3735064-

3734962,3734894-3734783,3734700-3734594,3734522-

3734454,3734382-3734214,3734132-3733953,3733878-

3733718) similar to  Si4AB1,  downstream from Nv4n32"

53% to CYP4AB1

AAZX01001981.1 (-) 5580-2963 

MWLQILLTLLVVLFVIHYYIRGGRIGHYVNKMPGPPAYPLVGNLLSFMVPFD(

1)QLWQVVRKMNDDYYPLYRIWSTNVAVINLYHPDDAE(0)VLLSSTNHIEKS

FIYELLHPWFGTGLLTSTG(1)TKWQHRRKILTPAFHFNVLQKYMDIIIENDE

RFIDTLKAKGESVQNLLPLITNYTLNVICE(1)AAMGTSLQGKEELQARYRRA

IHDMGNILVYR(2)LVRPWLRWDRLFNLTPKGHEQKKALQVLHGFSTD(0)II

NERKEYHEKTESKFLNNTLASDESSKDNADTEVFGV(1)RKRRLAMLDLLIAA

YREKQIDDLGIREEVDTFMFE(0)GHDTSAMGVCFVLLLLAEHKDIQ(0)ARA

REEVEEVLGKTGGRIDLSAINQMSHLERCIKEALRLYPSVPFISRNINEDLHL

K(1)DYTVPRGTIAHIHVYDLHRDANFWPEPLKYDPDRFLPERTRNRHPFSYI

PFSAGSRNCIG(1)QKFAMMELKSITAHLLHDFHLEPIDLAHEVPIVCDLVLR

PARPIYMKFVPIEK*

>CYP4AB6 Nv4n8 510aa 12 exons SCAFFOLD127 minus

(399884-399731,399645-399536,399479-399389,399303-

399121,399048-398958,398875-398773,398696-

398588,398512-398403,398333-398265,398191-

398023,397933-397754,397695-397535) similar to 

Am4AZ1, 60% to Nv4n16, 60% to Nv4n32, 49% to CYP4AB2

49% to CYP4AZ1

AAZX01003887.1 (+) 46733-49085 

MLIETIVVICMLLYAFHHYTRNDRIGRYVNKIPGPPTWPIVGNLPALSAPHE(

1)QLWPLGIKWDKQYYPIYKIWTTHKAVIVILHPDDVE(0)TLLTSMEHIEKS

IMYDMVHPWFGTGLLTSTG(1)AKWQKRRKILTPAFHFHVLQKYFDIIVENNE

KVMHSLKSNGSVINNLVELLTYYTLDVICE(1)TAMGTTLLDKEHQQKYRNVL

HDVSNAVIYR(2)LMRPWFQVDWTFRWTSVAEKQKKALEVIHGFSKK(0)IIK

ERKEYHEKTKGHYLNQLESDQSDDKKEDEEYFGC(1)RKKRLAMLDLLIAKQK

DGNQIDDAGIREEVDTFIFE(0)GHDTSAMAMCFAILLIAEHNDVQ(0)DRIR

AEVKEVLEKSEGKMGVPEIQQLNYLELCIKESLRLYPSVPFISRGVTKDLHLK

(1)NYIVPKGTLIQINIFSLHRDPNFWPDPEKFDPDRFLPDRFQGRHPYSYIP

FSAGPRNCIG(1)QKFAMMELKAFIAHLISEFYLEPIDLAHEVLITPDLVLRP

ARPVKVKIVPVNK*

>CYP4AB7 Nv4n18 515aa 12 exons SCAFFOLD28 minus

(891172-891019,890953-890844,890758-890668,890596-

890414,890336-890243,890167-890065,890003-

889883,889799-889690,889601-889533,889364-

889196,889114-888938,888756-888593) similar to 

Tc4Q7,  next to Nv4-19, GC-donor on 7th intron" 49%

to 4AB2

AAZX01001507.1 (-) 26254-23672      

MLVLTTLLLGILILGAIHVHIRGRRGRILAKMPGPSGWPIIGVLPSVLVPIE(

1)KLWMVGRNMDKQYYPLYKFWLANHVIVAILNPDDAE(0)VMLTSMQNIDKS

SVYNFLHAWFGTGLLTSTG(1)EKWQKRRKILTPAFHFNVLERYLTITVENSE

RAVKSLRGKGECVQDLVQFLTQHTLNIICE(1)AAMGASLSRKEESQKKYRKA

VHDMGSALVYR(2)LVRPWLYSSWTFGCTAAGRMQTDALKILHRFTKN(0)II

AERKEFHEKTDGRFLKNIVSKSSGADDDDEAVENEELHD(1)RKKRMAMLDLL

IAAQRDGQQIDELGIREEVDTFMFE(0)GHDTSAMGLCFALLLIAEHKDVQ(0

)ERIRQEVNEVLKNADGKLEMSELNKFNYLERVIKESLRLYPSVPFISRNITE

DMQLK(1)YLIPRGTLVDVRIYLIHRDPKHWPDPLKFDPDRFLPERIQGRHPF

SYIPFSAGPRNCIG(1)QKFAMMELKVFVALIVKNFILEPIDFAHEVPILPDI

VLRPARSVHVKFVPIAEK*

>CYP4AB8 Nv4n19 513aa 11 exons SCAFFOLD28 minus

(887765-887603,887251-887142,887062-886972,886888-

886703,886639-886537,886473-886371,886240-

886049,885967-885899,885834-885666,885580-

885401,885309-885137) similar to  Tc4Q7,  next to

Nv4-18"    48% to 4AZ1, 47% to 4AB2

AAZX01001507.1 (-) 22847-20216      

MAYYYLFTVLLGLVGLLFHFYIQLFSRTGKLVNKIPGPTAIPFFGNLLELHVP

LV(1)EINNALRKWSKIYYPIYRLWFGPKALVFILHPDDLE(0)IMLTSSKHI

NKQFAYEHFHLWLHSGLLTSNG(1)QKWHHRRKILTPAFHFNILKKYMEITNE

EGERAVTNTRKTTKETKVDLLQFCSKYTLNIICE(1)SAMGVPLDGDHKDKEA

SNKYKNAVYRMGNIIFFR(2)IIRPYIWDWMVPFIPKHNREVKEVVANLNNFT

DM(0)IVEERREYHASTNYEHLNFEKSEVNAYIGKSKRLAMLDLLLAAERDGK

IDDEGIKEEVSTFIFE(0)GHDTTAMSMCFIIMLLAENKHCQ(0)DLAREEVE

IILGPKNGQLETADLKHMNYLERCIKESLRLFPSVPSITRYLHEDVQLK(1)N

YKIPAGVNIIMHIIDVHRDPNFWPEPEKFVPDRFLPEEIAKRHNFAYLPFSAG

SRNCIG(1)QKFAMMELKSLISRILYNFHLEPIDYTRDVKLISDVVIRPSKPV

YTKFVRIDRQSNI*

>CYP4AB9 Nv4n24 509aa 12 exons SCAFFOLD29 minus

(792405-792249,792119-792010,791859-791769,791597-

791412,791336-791240,791145-791043,790953-

790863,790788-790682,790600-790532,790459-

790291,790213-790034,789951-789785) similar to 

Am4AZ1,  upstream from Nv4n25" 48% to CYP4AZ1 46% to

4AB2

AAZX01008651.1 (+) 19354-21977      

MIRIFVLLLLLTLIACHIFTRYTRKGRLLNIIPGPAPLPIIGNLLQFAVTSAD

(1)DLWKIARKYSTDYYPITRFWTTGLCVVSVRHPDDLE(0)ILLNSQKTITK

GYIYNYLHSWLKSGLLTSTG(1)DKWRQRRKLLTPAFHFNILKEYLGPMNEEG

LRCVDDLKNDGESTIKDLVEFLSESTLNVICE(1)STMGVSLNRIETGLTTRY

KKAIHEMGYIVSFR(2)LCRPYIFDWIMNLPWKFGNLQRKSLKILHHFTNK(0

)FIQEKKIFNEESKGNYSDVTQHSEDNGEHSG(1)SKKRLAFLDLLLTAKKNN

MIDDEGIQEEVDTFTFE(0)GHDTTAMALTFTLMLLAENKEAQ(0)EKARAEA

KEVLDCSHGKLDVSDVQKLNYLDRCIKESLRLYPPVSTIMRYSADELQLK(1)

NALVPADTHIVVNFFDTHRDPNFWPEPNKFDPDRFLPERSVGRHPYAFVPFSA

GSRNCIG(1)QKFAMMEMKILIARILYDFRLEPTEHLADGYADIPLLADIVIR

PLNKIFTRFIKL*

>CYP4AB10 Nv4n25 509aa 12 exons SCAFFOLD29 minus

(788013-787863,787778-787669,787572-787482,787401-

787216,787138-787042,786965-786863,786588-

786486,786409-786303,786231-786163,786087-

785919,785837-785658,785591-785431) similar to 

Am4AZ1,  downstream from Nv4n24,upstream from Nv4-P1

and upstream from Nv4n26? GC donor on 5th intron" 47%

to CYP4AB2 44% to 4AZ1

AAZX01008651.1 (+) 23740-26331      

MYLLFILFLGPLLFHIITRTNRRARILKKIPGLKPYPFVGNLLTFNVNCLN(1

)KFWELGRQFSNEYYPITRFWLFKTAVISVRHPDDLE(0)IIFTSQKFIDKGY

IYDYLHPWLKTGLLTSTT(1)NKWRQRRKILTPAFHFSILKKYLENMNEEGKK

IVNELKNEGQIIEKSLMPFCSSCTLNIICE(1)SALGVSLDSLDGKIVNKYKN

AVHDIGNVVLYR(2)MPRPFLTNWMMNFVWKMGSVQRNAVRVLHRFTDE(0)I

IKERKTYHKRMNNKYLKEYADNIKQNRSYEKDIN(1)QKKKYAMLDLLLAAEY

NGLIDYNGIKEEVDTFTFE(0)AHDTTGMAMAFALMLLAENHEAQ(0)NKARV

EIIEVLDRHNGEMELTNLQEMNYLDRCIKEALRLFPPVATVMRYTAEEVQLK(

1)NALVPADSHIMIHLYDTHRDPNFWAEPEKFDPDRFLPERSINRHPFAYLPF

SAGPRNCIG(1)QKFAMIELKSLISLILYDFYLEPIDRLDDMKLIADIILRPL

NPIRIKLIRIKK*

>CYP4AB11 Nv4n26 508aa 11 exons SCAFFOLD29 minus

(781473-781320,781218-781109,781020-780744,780672-

780576,780449-780347,780285-780192,780095-

779989,779910-779842,779758-779590,779517-

779338,779270-779107) similar to  Am4AZ1,  downstream

from Nv4n25"    47% to CYP4AB2, 44% to CYP4AZ1

AAZX01008651.1 (+) 30283-32652      

MIFYLSSLLLVLCIFHIITRYNRRGRLLSKIPGPTAYPIVGNLLMFNMSSMH(

1)DFWQLGRLTMKKYYPITRFWGLHSALISVGHPEDLE(0)ILLSSQKVIEKG

YVYWYLQPWLRTGLLTSTDDKWRQRRKILTPAFHFSILQKYFDITSEQGERFI

EDLKAEGDETIKSLMPLCSNYTLNIICE(1)SILGVVLNKMNDQEVKKYKQAI

LDVGSVVLYR(2)TVRPFIANWMLPFVWKIGHMQRNALKILHDFTDK(0)VLK

ERRKYHESTGYRYLNDEYTGEVKYDLGIG(1)RKRRLAMLDLLLAAEKNGLIQ

EDGIKEEVDTFTFE(0)GHDTSSMAMTFTLMLLAENKEAQ(0)DLARVEVIRV

LDKSGGKIGVTEIQELHYLERCLKESFRLYPPVATLMRYVSEELELK(1)NAT

VPADSHVMIHFWDTHRDVNFWPEPDKFDPDRFLPENAKNRHPYAYVPFSAGPR

NCIG(1)QKFAIMELKSLIARILYDFYLEPVDRTTDMRLIADIILRPLDPVHL

KFIKINKC*

>CYP4AB11-de7b8b10b11b Nv4nP1 126aa 4 exons

SCAFFOLD29 minus (784745-784639,784564-784496,784388-

784307,782336-782206) similar to  Am4AZ1,  pseudogene

fragment, 1000nt downstream from C-term of Nv4n25,

upstream from Nv4n26" n26-de7b8b10b11b  more similar

to 4ab11 than 4ab10

AAZX01008651.1 (+) 27016-29558

(1)EKRRLSMLDLLLAAQQN*LIDDDGIKEEVDTFFFE(0)GHDTTGMAMTYL

LILLAENKEAQ(9)GPRNCIGNYAFRIRIITLLEEDTRANR(2)LIAQLLYDF

LDPVDRLADMNIADIVIRTLKPFRIKLTKINKD*

>CYP4AB12 Nv4n7 507aa 12 exons SCAFFOLD22 plus

(1181281-1181428,1181665-1181774,1181852-

1181942,1182027-1182209,1182288-1182384,1182458-

1182560,1182627-1182729,1182798-1182904,1182975-

1183043,1183124-1183292,1183367-1183546,1183617-

1183777) similar to  Am4AZ1,  47% to CYP4AB2, 47% to

CYP4AZ1   

AAZX01005970.1 (-) 23502-21003

MFYLLLVILGVLIFHISTRYSRMGKLVNKIPGPRPIPILGNMLLLNVSSD(1)

KLFGIMRELINSYYPILKVWFCTNAMVGLRHPDDLE(0)VILSSQKAIDKSYV

YGYLEPWLKTGLLTSTG(1)DKWRARRKILTPAFHFQILKKYMDITSEQGEKM

IDALRQKKEMVENIVPMCSTFTLNIICE(1)SAMGVALDKIDAKELKEYKMAI

HDMGDVVVQR(2)SVQPYVLDWMMSPLIKLGRMQKNALTVLHKFTDK(0)VLK

ERRNYHNRTENKYLHELDDNAHDDDSDKVALG(1)RKKRLAMLDLLLLAEKKG

LIDEEGIKEEMDTFTFE(0)GHDTTGIALIFILLMLAENKEAQ(0)DKAREEV

SEMLNSTGGKISQTEIQDFNYLERCIKETLRLYPSVPNVLRHLTEDLQLK(1)

THTLPAGVDVICFLYDVHRDPNFWPDPEKFDPDRFLPESSAGRHPYAYVPFSA

GPRNCIG(1)QKFAMMELKSLVARILYNFQLEPIDRSADVKFTTDLVLRPTNP

IRVKFVRIDK*

>CYP4AB13 Nv4n4 517aa 11 exons SCAFFOLD6 plus

(921490-921649,921723-921832,921913-922003,922080-

922265,922342-922438,922503-922608,922700-

922811,922893-922999,923067-923135,923204-

923372,923443-923786) similar to  Si4AB1, 41% to

CYP4AZ1, 43% to CYP4AB2 

AAZX01002378.1 (-) 6430-4131

MLFYIVLSALVAALVYFHISIRYSRQGRMLSKIPGPFSFPIIGSLHLFTDRTQ

R(1)GLWITIRMITDTWYPICKGWAMGLPLLSVRHPDDLE(0)VILSSQKACY

KEFPYKYLRSWLNDGLLTNKG(1)DTYRARRRMLTPAFHFNMLRRYVDIMNEQ

SGRLMTELRANGKEFVLDVLPIYADVSLNIIIE(1)SAMGIDLDKTDKKVIKD

YKEAIEDMGIVLTYR(2)MLRPYILDWMMTPFTEIGRKQIHALKVLREFTDKV

(0)IIKERRKYHEMLGGIKGYKEFTDSLENQDESESIYAIG(1)HKKKLPMLD

ILLSAEKDGLLDEKGIKEEVDTFLLG(0)GTDTTRMVMAYFTMLMAENKKCQ(

0)DKARAEVCKVLERSGGKRGMTELSQMPYLEQCIKESMRLYPIASTIFRHTV

DDIQLK(1)NYTIPAGVVVICQIIDAHRDPNFWTEPEKFDPDRFLPENCRHRH

PFAYLPFSAGPRNCIGQKFGWMEVKAVCSRLLYNFYLEPIDSTRDMQLIGDFV

LRPADPFHTKFIRIDRE*

>CYP4AB14 Nv4n13 509aa 12 exons SCAFFOLD13 minus

(2836866-2836713,2836636-2836527,2836435-

2836345,2836283-2836098,2836003-2835910,2835831-

2835732,2835649-2835550,2835484-2835378,2835303-

2835235,2835159-2834991,2834912-2834733,2834675-

2834509) similar to  Si4AB1,  70% to Nv4n30, 42% to

CYP4AB2   

AAZX01001453.1 (-) 11601-11771

MLLYFLIVALCSLACFHVYVRHGKYGRAIGKMRGPPALPIFGNMLSLNCGPV(

1)EFWNYLADAIKIYYPCGRIWFFTCAVVITQDPDDLR(0)ILLTDKTNITKG

FVYEYFHLMAKTGLITSTG(1)EKWQYRRKILTPAFHTHIIKKYMKITFEQGE

RFVKSIKAQGDETVQSLIPVCSDLTLSIILE(1)AAMGIQFQTIGNKAEEYRK

AIEHYFSSIAYR(2)ATRPYIKDWMLRYFSEGRRILATVKVLREFTDK(0)II

DERREYHKQTKQESFQKYVDDDMEHECTDGEG(1)RKKRLAMLDLLLMAEKEG

LIDEEGIKEEVDTFTAA(0)GYDTTGMEMVYLLMLMAENKDQQ(0)ELARAEA

NRILDASGGKISMKEINQMEYIERCVKESLRLFPTAPHIVRAVTEDIQLK(1)

NYMVPAGTDIFVPIHILHRDPKYWSDPLKFDPDRFLPGEAEKRYPFTYLPFSH

GPRNCIG(1)QKFAIAELKSLLACVLRNFYLEPVSYTKDLQFTLHVVLLPTVR

PHIKFISIKKND*

>CYP4AB15 Nv4n30 508aa 12 exons SCAFFOLD15 plus

(1658400-1658550,1658626-1658735,1658827-

1658917,1658999-1659184,1659263-1659356,1659435-

1659534,1659626-1659722,1659808-1659914,1659982-

1660050,1660131-1660299,1660385-1660564,1660636-

1660805) similar to  Hz4M6,  43% to CYP4AB2, 42% to

CYP4AZ1

AAZX01012601.1 (+) 2379-4787 

MLLYLLIAVLCVVGFHAYVRYGRYGKLINKLPGPTPLPILGNLLLLNKGPV(1

)DLWNFLHVKMKEYYPFGKIWFCTSAIILTQDPDDLK(0)ILLSDKVNIVKGF

MYKPLHLWAETGLITGTG(1)EKWQHRRKIITPAFHANIIKKYIEITSEQGER

FVEYLKTKGDETVESLIPICSNLTLSIIIE(1)AAMGTKFNTMGDKAEEYKKA

IEDYFHGVAYR(2)ATRPYIQNWMLRYFGRGRRILDCIKSLRGFADK(0)IIE

ERREYHNQTKHQSFQNYVDDVDDTNLLDGG(1)RKKRLAMLDLLLLAEKEGLI

DEQGIKEEVDTFTAA(0)GYDTTGMGMVYMLLLLAENKDVQ(0)KLARAESDR

ILSASGGRITMTEIQQMDYIERCVKESLRLFPTAPNISRTIIKDIQLK(1)NC

MVPAGTDVFVPIYDVHRDPKYWPDPLKFDPDRFLPEEVHKRHPFSYLPFSHGP

RNCIG(1)QKFAIAEMKALVARIVYNFYLEPVTYTKDLQFTAHIVLLSTVPPC

TKFIKRLRSKD*

>CYP4AB16 Nv4n23 511aa 12 exons SCAFFOLD16 minus

(2276870-2276711,2276593-2276487,2276396-

2276306,2276232-2276047,2275944-2275848,2275756-

2275657,2275579-2275474,2275403-2275297,2275222-

2275154,2275093-2274925,2274856-2274677,2274606-

2274446) similar to  Am4AZ1,  downstream from

Nv4frag3, upstream from Nv4nP2"

62% to Nv4P3, 43% to CYP4AZ1, 41% to CYP4AB2

AAZX01000773.1 (-) 15377-12971

MALLYLLLVFIVIGLIAFHVRVRYGRVGSMVAKIPGPYPLPFLGNLLSFAGNR

E(1)ELWNKLRALMKGCSIKRMWFPTRAWIFIQDADDME(0)VLLTSKVNVNK

GQAYNLALKWLHTGLLTSKR(1)EKWTERRKIVNTGFHYNVMKKYVEISIEYT

KQFVEEIKSHGDECVLNILPLLSDLTLQIICE(1)SALGISLDKLDNKVLQEY

KEAIREIDDIFVYR(2)GARPYITDWMMYFLPLGRRQDHAIKILHEFTDR(0)

IIRERKEYHANFQENRSYQHFVDDVEESAEDDSFKG(1)TKKRLVMLDVLLSA

EQDGLIDEKGIREEVDLLVLA(0)GHDTTSISMVIMLMLLAENPEAQ(0)DRA

RAEVIQVFSENGGKLDIKEIQKFEYLDRCIKEAMRLYPAIGNFIRHLNEDVQL

K(1)KYLLPAGVDVAFFVYDLHRDPKHWQEPEKFDPDRFLEENVKKRHPFAYM

PFSAGPRNCIG(1)QKFAMFEMKVILSHVLYNFYLEPVDLTASIRFEVNVILR

LSHPVHVKFIRRDV*

>CYP4AB16–de1b2b Nv4frag3 72aa 2 exons SCAFFOLD16

minus (2278474-2278388,2278324-2278196) similar to 

Nv4n22,  upstream from Nv4n23v2"

pseudogene fragment

AAZX01000773.1 (-) 17041-16722

LVLILACLILFHLCIRYGRVGRIIDEIPGMYPLPIFGNILSLVNAA(?)QVWN

AL

RKIRHKDYPITRL*FPTRAWIIVRDPDDTK (0)

>CYP4AB16-de1c2c11c12c Nv4nP2 178aa 4 exons

SCAFFOLD16 minus (2273814-2273663,2273505-

2273324,2273247-2273199,2273110-2272959) similar to 

Am4AZ1,

pseudogene fragment, 1000nt downstream from C-term of

Nv4n23, upstream from Nv4n14 

AAZX01000773.1 (-) 12342-11484

MHLLLVLILSCLLVFHIWIRYRRIARIVNKIPGRFPLPFLGNLLSLAGSKG(9

)TTFL*CIQQLWTALRQITKEYPIARLWFLTRMWVLVRDPDGIEVQIAFKKSN

MSFHFLKYC(9)YLFAYIPFSAASRNCIG(1)KKFAMLEMKIMLAHILYNFYL

EPVDFPANVKLETNIILHLTHPVHVKFIR*

>CYP4AB17P Nv4P3 506aa 12 exons SCAFFOLD16 minus

(2233954-2233801,2233730-2233624,2233532-

2233445,2233355-2233170,2233079-2232983,2232909-

2232810,2232740-2232635,2232568-2232462,2232372-

2232305,2232203-2232046,2231963-2231784,2231657-

2231493) similar to  Am4AZ1,  possible pseudogene? 

missing phase 1 intron acceptor on final (heme)

intron " 71% to Nv4n21, 62% to Nv4n23, 43% to 4AZ1

AAZX01012297.1 (-) 3310-846  frameshift after LLAEN

seq revised in green

MTSVYLALILFGLVIFHAWIRYRRMGRIIDKMPGMRPLPFLGNMLSLMGDKD(

1)QLWNIMRSLAKEYAITRIWFFTRAWVAVRDPDDIE(0)ILLTNKANLNKRA

VYELALKWLETGLLTSG(1)EKWVHRRKIVNTGFHFNIMKKYVKISGEHAEKF

IEKIKSHGDEYVLDLVPLFSDLTLQIICE(1)SAFGVDLNKLDQKLVQQYKGA

LHVMYDMVIYR(2)STRPYIRDWMMNFLPIGWKQNRAINILHNFTNK(0)VIQ

ERREYYNKHASENRSYQSFVDDVDIESDYVADG(1)RKKRLVMLDVLLSAERE

GLIDAKGVREEVDIFTVA(0)

1728 GHDTTAVTMAFMMMLLAEN

SEIQ(0)

DRARAEVINHFEENGGKLNITEIQKFEYLDRCIKETLRLYPPISQFVRYMDKDIQLK(1)

KYLIPAGVDVLFLTYDTQRDPRHWTEPDKFDPDRFLPENAKKRHPFAYIPFSAGLRSCI(9)

1013 GQKFAMLELKAMLAHILYNFYVKPVDLTANMKLETYIVLQPSHPVHVKFIRRNVN* 846

>CYP4AB18 Nv4n21 508aa 12 exons SCAFFOLD8 plus

(3533729-3533879,3534041-3534147,3534226-

3534316,3534509-3534694,3534774-3534870,3534954-

3535053,3535131-3535233,3535314-3535420,3535495-

3535563,3535632-3535800,3535879-3536058,3536138-

3536301) similar to  Nv4AZ1,  71% to Nv4P3, 59% to

Nv4n23, 42% to 4AZ1, 40% to CYP4AB2

AAZX01003514.1 (-) 9713-7138 

MIVYFQLILLSLFVLHIWIRYRRMGRVVDKIPGLRPLPFLGNMLSFAVDKH(1

)QLWLTMRGLAKIYTITRVWFFTRAWVVTRDPDDFQ(0)ILLTSKVNLNKRAL

YEHCLKFAKTGLLTSNR(1)EKWSQRRKIVSTGFHFNIMKKYVEITGEHAELF

TKKIKSNGKESSLNVVPVCSDLMLRIICE(1)SAFGVNLNKLDPQLVDQYSEA

LHVVYDTVVYR(2)ATRPYIREWMMDFLPIGWKLNRAIKILHSFSDK(0)IIQ

ERRDYYNKQAESRTYQSFVDDVDTDNENTLGE(1)RKKRLVMLDVLLSAEREG

LIDAEGVREEVDIFTVA(0)GHDTTAVTMAFMLMLFAEHSEAQ(0)DRVRKEV

TKVFNECGGKLTITETQKLEYLDRCVKETLRLYPPFSIFARYIDEDVQLK(1)

KYLVPAGVDVLFLSYDAHRDHRHWPDPDKFDPDRFLPENVKKRHPYAYVPFSA

GPRNCIG(1)QKFAMHEVKSVLAHVLYNFNLEPVDNIADIKLETYIITQPCHP

FHVKFIARNAN*

>CYP4AB19 Nv4n20 501aa 12 exons SCAFFOLD2 minus

(6936045-6935895,6935798-6935689,6935606-

6935516,6935436-6935251,6935180-6935093,6935007-

6934908,6934825-6934741,6934672-6934560,6934487-

6934419,6934336-6934171,6934109-6933930,6933855-

6933692) similar to  Am4AZ1,  41% to CYP4AB2, 41% to

CYP4AZ1   

AAZX01003026.1 (-) 36366-34010

MIAYVLLTCVFLLIVQILLWVTKEGRLWNKIPGPTPLPFVGNLLPLIGSTE(1

)HLWNALHDLAIKYYPIVRIWHTKTVMVLISHPDDLQ(0)VILSSKANINKPP

LYDLIKPWLGDSVILSKD(1)NKWTERRKILIPAFHLNILKKFIKVTNEHNER

FITFIQSFGDESVQNVSTLLPELTLKIFCE(1)SAMGVNQNDDLIKKYKHAME

EMFGVSIYR(2)ATRPFIKDWMMPFVKIGQIQKRAVETLHGFRDQ(0)MILER

RKYHESTGYQIYQPVDNESNSSNE(1)IQYKRTLSMIDLLFTLEKEGLIDEDG

INEEVDTFIVG(0)GHDTTAIASTFFLVLLAENVYAQ(0)DRARAEITEVLAN

NNGDITSQLHKLHYLERCIKESIRLYPSAPCIGRILTEDIQLK(1)NYLLPAG

TEVLCMLRAAHLDPNFWPEPNKFDPDRFLPENVKDRHPFAYSPFSQGPRNCI(

1)

GQKLAFLQIKILASGILSNFYLEPVDRTVDVKFRMNANLHTTKPLHVKFVKIR

KD*

>CYP4AB20 Nv4n15 511aa 12 exons SCAFFOLD110 plus

(336536-336686,336750-336859,336941-337031,337110-

337295,337374-337470,337551-337653,337750-

337852,337934-338040,338107-338175,338250-

338418,338505-338684,338767-338933) similar to 

Si4AB1, 62% to Nv4n1, 56% to Nv4n7, 46% to CYP4AB2

AAZX01000970.1 (-) 50872-48472     

MIIYFLLILLGLWVFKVYFQNKRSKELLDKIPGPPTVPILGNLLMFNVPIE(1

)KTWNVIRDLNKNYYPIAKFWLGPYPYVSIHHPDDLE(0)ILLSSTKHLEKGS

AYTVLHPWLRTGLLTSSG(1)SKWQQRRKILTPAFHFKILRKYMDITNEHGKK

FIEALRTENSETVQSLMPFCSNYTLHIICE(1)TAMGIALDKIDTKISKEYKN

AVADIANLIMYR(2)VMRPYLKEWMMLPVWTFGRLQTQTLRTLHKFTKT(0)V

LTERREYHKRSDNKYLKGFHDDTYDVNKDDVAIG(1)GKKKLAMLDLLLSAAQ

DGLTDDEGIKEEVDTFMFA(0)GHDTTGIALVYAIMLLAEHKEIQ(0)EKARA

EVIEVLTESNGEIGTLEIQKLHYLERCIKESLRIFPPVSALSRTVKEDIQLK(

1)NYVVPAGTEIGCHIFDLHRDPNFWPEPEKYDPDRFLPENIQGRHPYAYIPF

SAGSRNCI(1)

48642 GQKFAMMELKSLTARILYNFELEPVSQTKDMKLTLDLVTRPLEPVYTKFIRID

NNN*  48472

>CYP4AB21 Nv4n17 509aa 12 exons SCAFFOLD18 plus

(159104-159251,159366-159478,159559-159649,159739-

159924,160016-160112,160189-160291,160379-

160481,160560-160666,160750-160818,160892-

161060,161146-161325,161405-161565) similar to 

Si4AB1,  63% to Nv4n1, 49% to CYP4AB2, 49% to

CYP4AZ1

AAZX01004195.1 (-) 19884-17414

MYILLCVLGLIFCYIYNNRDDRKVKLINRIPGPPGLPVIGNLLIGLTPVD(1)

QLWDVVRSYTETYYPTIRIWLGNYYSIVSISDPDDVE(0)TLLTSQKHIEKGY

SYKNLQPWLKMGLLTSTE(1)KWRRRRKILTPAFHFNILKKYVDITNENAERF

VEKMRDDEGDDTVQDLAPLTSKYTLNIICE(1)SAMGVALDEIESKAAEKYKN

AVYTMGNITIYR(2)ITRPYLTDWVMNICWRLKKLQEKTLKTLHEFTDK(0)V

IMERKAQHKNTDYKYIKNLADDIKESEFDYVTSG(1)RKKRLAMLDLLLSAEM

DGLIDDDGIREEVDTFMFE(0)GHDTTGMAMTFTLMLLAENEEIQ(0)EKARA

EVIKVLTESSGKIGMRQLQEFNYLECCIKESLRLYPPVANISRYITEDLQLK(

1)KYLVPANTEVFVQLYPIHRDRKFWREPNKFDPDRFLPENLQGRHPFSYIPF

SAGPRNCIG(1)QKFALMELKSLIARILYNFKLEPIDRSADMKILLDIVIRPA

SPVRTRFVKINH*

>CYP4AB22 Nv4n1 510aa 12 exons SCAFFOLD39 minus

(10042-9892,9793-9681,9612-9522,9442-9257,9170-

9074,8995-8893,8738-8636,8545-8439,8361-8293,8228-

8060,7974-7795,7715-7555) similar to  Am4AZ1, 62% to

Nv4n15, 63% to Nv4n17, 59% to Nv4n7, 47% to 4AZ1 

       

AAZX01007544.1 (-) 10042-7552

MTIYFLLIFLVLLFHRIYARNIKYRSLLKKIPGPPTLPLLGNLLIFNVPVE(1

)KQWDIVRSLTKQYYPICKIWLGPRHAVVSLLHPDDIE(0)VLLTSSKHINKG

DSYTYLHTWLKTGLLTSSG(1)DKWRQRRKILTPAFHFNILKKYMDITNENSI

NFIEALRNEGEETIQNLTPLCSKYTLNIILE(1)SAMGIVLDKVDKKTADDYK

NAVYEIGRIIMYR(2)LARPYIREWMLNPLMNLARVQKRVLKTLHDFTEK(0)

VVKDRREYHERTENKYLDNFTNESHCDDVYAGTGG(1)RKKRMAMLDLLLSAE

RDGLIDDEGIKEEVDTFTFE(0)GHDTTAMAMTFALLLLAENKKAQ(0)DKAR

EEVTEILDRSEGNMGMAQIQEFNYLERCIKESLRLFPPVATMARTITEDLQLK

(1)NYLVPAGTEVMYHLWEIHRDPNFWEEPLKFDPNRFLPERSQGRHPFSYVP

FSAGPRNCIG(1)QKFAMMELKSLIGRILYNFKLEPIDKTADMPMLLDIVIRP

AKPVYTRFVRIDK*

>CYP4AB23

59% TO CYP4AB12 Nv4n7 NEW SEQ NOT IN EARLIER SET

AAZX01002053.1 (-) 16417-13827

16417  MLMHLLLFIVLALTVFHFYIRYRRIGRLASAIPGPSPYPFIGNMLSFDISSP (1)  16286

VSMWLVLRQLSNQYYPITRVWMTTEALYSVRHPDDIE (0)

IALTSRKTIDKGWVYKYLHPWLRTGLLTSS (1)

GEKWRHRRKILTPAFHFNILRKYMDITQEQGEKLIKFLQCDGKESVQSLIPFCSKFTLNIIC (1)

ESAMGVALDSLDTKTIEKYKQAIYKIGEITVYR (2)

MPRPYIHDWMLKLVPFLPINRHRKQALSILHEFTAKVLKERKEYHDRTGNKYLQGLTEE

DKDGDEDVYM (1)

GCKKRLAMLDLLLSAEKDGLIDDEGIKEEVDTFTFE (0)

GHDTTGMAMTFILMLLAENKNAQ (0)

DKARAEVNEMLKKNNGILGIAEVQELHYLERCIKESMRLYPPVPTIFRDVSEDLQF (1)

KHGLIPGGSCVVCHFYDLHRDPNFWDEPDKFDPDRFLLENSSKRHPFAYIPFSAGSRNCI ()

13997  GQKFALLELKSILGRILQNFYLEPVTRLADIKLIADLVLRPSEPVHLKFVKIEKNT*  13827

 

>CYP4AV5 Nv4n9 513aa 5 exons SCAFFOLD4 plus (5121737-

5121935,5122014-5122397,5122473-5122542,5122609-

5123153,5123240-5123580) 55% to  Am4AV1, 

76% to CYP4AV2 Apocrypta bakeri (Hymenoptera) non-

pollinating fig wasp,     

MLVDEYAPPPPSLSSRLTFTLGLIVFLLLSRLAVRRAKFLYSLRNIPYPPALP

LLGNFVQLLCNLED(1)FFAKLTEWAQEFGDIYLLWVGLRPFVFVYRMEAVGT

LLSSRQHIDKSLEYEYLKPWLGSGLITSTGERWLARRKLLTPTFHSELLKGYF

RVTLREADTFVECLRSEIGKLEFDIVPFAKRAALDTICV(1)CAMGHQLNAQV

NRRNEYVQAVQR(2)LTAISQRRFTSILLKPELLFKVSTLGREHDRALRVIED

FVNGVITDTKRDWLGSRLRRARASNNNERKPRPETLLDLLLQMVQNGEKLTDN

DLRDEVNTFMFAGHDTVGMSVSWILYSLGRHPEYQERIIREVEDLLAAEGELG

FESYNRLHWLGACVKEAWRLYPVTPLIARQINSPITLQ(1)NHDIPVGTTVLI

NSYLLHRDPRYFPEPERFKPERFLPGASKPPSFAFIPFSAGSRNCIGYKFATI

EVKVTVLALLRAYRFRAILREDQLHLLSQVVLDNVGGIQLSITPRQPS*

 

>CYP4BW3 Nv4n5 513aa 9 exons SCAFFOLD15 minus

(628012-627838,627592-627483,627409-627319,626515-

626254,625871-625745,625678-625615,625548-

625436,625358-625121,624567-624209) similar to 

Hz4M7,  upstream from Nv4n6"

59% to 4BW1     

MGPITLVIVYLIIVICVAIAYVSLSEYYELRQTLGHIPGPRNYPFIGSLWRMK

RLPRED(1)KFKWFNDLCFTFKNGLVVTWFGMEPVVNIRKPHQIQ(0)ILSSS

CETVAKSRFYKFMSPWLGDGLFSSTE(1)VWFNHRQLIMPALCSNILDEYTAV

MHDKADVLTEIMRAKVELNPDSFINILDLVMRYALDTVCESAMGINMDIQRKP

ENDYVTAFYK(2)CIQISTERYFQSWMRWNFIFHKTKRGKKFLNSVECMHKFT

EK(0)VIRQKQIDKFKRPDSKDGNQCG(1)KRKNKAFLDLLLDINQSGNHSLT

LEEIRQEIDTFIFA(0)GYETTATAIIWTLFAIGNDPGVQARVHVELENMFGN

CHERPTIQQLSQLKYLDRVIKEVLRLYPSLPMISRLLDRNSVID(1)NYFIPE

KTLITIQVYQLHHDPEVWKNPEIFDPDRFLPENSRERHPYAYLPFSNGSRNCI

GQKYAILEIKIIVTKILRMWSVKSALKPTEVKLVSDFTLRPFDDKINLYFTPK

INNTRTN*

>CYP4BW4 Nv4n6 512aa 9 exons SCAFFOLD15 minus

(623406-623238,623125-623016,622933-622843,622106-

621842,621747-621621,621546-621468,621361-

621249,621180-620943,620847-620504) similar to 

Am4G11i,  upstream from Nv4n18, downstream from

Nv4n6, completed"

65% to CYP4BW1 Ceratosolen solmsi martchali (fig

wasp)       

MVPLLLLFTLLAIVGFVISRWIYEYVGLRQKLSTIPGPTLLPFVGIVLERMRI

PKED(1)VWQWFNDLCFKFESGMVLAWVGTQPIVILRRPQQME(0)VILPSNT

LITKAATYDYMKPWLGDGLVTSTG(1)ELWFSHRRLITPAFHFGVLEEYGAVM

REKVEIFKECIESELKTDPKAPINIFGLVVKYTLDTICETAMGVNIDTQRNPE

SAYVKAVHT(2)YARLTVERFYKPWLKWNAIYYRTNKGKEALNAVKIMHSFTE

K(0)VIRQKQAERKEKSFSNKELSDEVDEFG(1)KRKRKAFLDLLLSASENAS

NPLTFEELREEVDTFMFA(0)GHDTTSSAISWGLFALANAPEIQAKVHKELQE

IFGDSGETANSKQLSELKYLDRVIKEVLRLYPSAPMVSRRLTHDTVID(1)NH

HVPKGTFVNIHIYQMHHDPKVWKDPETFDPDRFLPENIRSRHPYSYVPFSAGP

RNCIGQKFALLEVKTALTAILRKWQISSVLKPTEIKMIHTFILRPQNESLELY

FTPIVK*

>CYP4BW5 Nv4n28 515aa 9 exons SCAFFOLD15 minus

(617495-617327,616976-616867,616787-616697,616598-

616368,616290-616115,616021-615949,615866-

615751,615096-614856,610724-610387) similar to 

Ag4C25,  combines Nv4n28i and Nv4Frag2, downstream

from Nv4n6" 59% to 4BW1

MLYVSTTATLVLFGVATFILKPLFDYLYLKYRYRKLPSVGLPFIGVVWDLLRI

PNED(1)HIEWFTKLQEKFKGNVYIMWLGMQPYVNIQKPHHME(0)VLLTSTV

NIKKSSIYNIIIPWLGDGLLTLTG(1)KKWHHHRRLLTPAFHFRVLEQFTETM

HEKADVFNECLKEQVSSNPKEPVDIFSFASRFTLDVICKTAMGIDMDAQRA(1

)INNDLQLYYVRTSISRMSRFVVNRYLRPWYASDFIYSKTEDGKQSQAAISVM

REYSSK(0)VIKERLDERRKLKSSKDEDKEDEFG(1)IKQRNKAFLDLLLEAS

ENDKNPLSNDELRNEVDTFMFA(0)GHDTTATAISFTLLLLGNHLDIQKKVHE

ELQTVFNNDVDKPTRAADLSQLKYLDRVIKETLRLYPSAPSFLRTLVEDTIFD

(1)GHTICKGSVIIINAYDMHRDPKVWENPTVFDPDRFLPENVRSRHPYAYIP

FSAGPRNCIGQKFAMLELKIALTAILRKWRVKSDTLPENLKLLHSIILRCNKP

IKVYFTPID*

 

>CYP4BZ1 Nv4n2 497aa 10 exons SCAFFOLD19 minus

(361359-361158,361074-360968,360902-360812,360735-

360529,360351-360200,360121-359957,359888-

359657,359584-359405,359322-359168) similar to 

Dm4C3,  38% to Nv4n11     

bad ETAm exon added green exon 42% to Nv4n10i

AAZX01008621.1 N-term may be too long remove

MGKDGLILLPAFFLVTTITL

 

MMSFWVFRTLKQWYRDRARTLYLASKLPGPPTLPLIGNAHLFACNPEE(1)TL

DKIKQIVQSVDTPGRFWLGPKLFIILAEPRDYE(0)VILGCHKASYKDKMYEF

IEPFVGKGLVSGSG(1)

PVHRAHRKAIMPMLNSK

23555 ALNEYLKHFDTHSRICSELLEEKAGTGVFDIQPFMVHCTFDMIF

(1)

DTILGMPGSSQKEGHKELVYWTEK  (2)

MYELVHTRMIKVWLHADWIFSWTDLGKKQKEGQHVIHSFIET(0)

AVARKKKEHYAIERDAIAPDRPR

LMLLEQLIDHNAKTNLMNDTELRDETYTI 22839

FTA(0)AQDTTGVISSFALLNLAINQEIQDKVREEIRNVVGNDSVTVEHLPEL

KYTELVIKETLRLYPIAPLMVREATGDIDLE(1)TCTLPKGCSIVMIPYETHR

STKYWTDPEKFIPERFLPENSVGRHPYAYIPFSGGLRGCVG(1)QKFAIMCLK

TMLVHVIRKVRLTSTQNLETLRLKADISVRSRDGYMVSVERI*

>CYP4BZ2  Nv4n10i 439aa 9 exons SCAFFOLD11 plus

(1925756-1925868,1926586-1926676,1926753-

1926938,1927018-1927090,1927190-1927333,1927398-

1927521,1927592-1927823,1927911-1928090,1928160-

1928335) similar to  Dm4g15,  incomplete on N-term"

       

= AAZX01002773.1 35% to 4G11 with a segment deleted

in the middle, 44% to Nv4n2

33% to Carcinus maenas cytochrome P450 CYP4C39

added N-term exon

4207 MIVTTMVGASIVRYIVNKKRIIELAIKLPGPRAYPIIGNALKFACEPD

(1) 4350

5067 QLLERIVDVIAPYADVTPMRLWMGPMLYVIITEPRDIE(0) 5180

VVLNSQQATSKGSAYKFLYPFIGNGLISGSG(1)KSWKAHRKIISHILNQRTL

DSFIETFDRRSKEFVKKLEPLANGEVFDIFHSLEGCTIDLVCE(1)TVMGYTD

INALDNPNKEFVHYTAE(2)

6503 MYKIIHNRMMKIWLYPDWIFRITSNYSNQKRAQTMIHNFTERVGMRKK(2) 6646

6711 QDMLKEKSKTCILHRLLTVNSVTNELTEEELRDEIYTIYIA(0) 6833

SQDTLAVTSSFAVLMLGIHGDVQKKARSEVDEVIGVGDVNIESLSKLKYLEMV

IKETLRLFPIAPLMVRQLNGELKLG(1)NSILPKDCQVVIAPYATHRSSKFWE

NPENFLPERFAIKETVKRHPYTFIPFSGGPMGCIG(1)QKYALTALKMILANI

LQKYVVESDVTLRDIKLKTDISIRSMNGYKISLQARTNITKYL*

 

>CYP4CA Nv4n11 493aa 12 exons SCAFFOLD13 plus

(303708-303882,303998-304104,304414-304504,305034-

305219,305333-305402,305486-305612,305902-

306012,306123-306191,306261-306438,306517-

306696,306782-306966) 39% to  Am4G11 AAZX01001465.1

added green exon, boundary not clear, 36% to revised

Nv4n2

37% to Nv4n10i

MALAISALLAVGLLFTALAFVIGHYLRKIRLYRESAKFPGPPALPFIGNAHFF

MGSTED(1)ILSKCQELLDTYPSPFRVWLADRLFYAVYDPEQLK(0)TIFLSP

KTIEKEELYKFAEPWLGTGLFTAPA(1)SKWRIHRKLIMPTFNPRILESFVEV

FSVQSEVMIKEMEVELNGGEFDIFHYVSLCTLDIICE(1)TAMGVRSRAQTQR

NSPYVESAKR(2)

30652 LFEIVYSRMFKIWLHPDIIFNNTRLGKDQRECIKYVHSLTDD(0) 30780

VIKRKKQAFEGNGTVEGMNGKLRK (?)

VEGKRKAFLDLLMELSHEGTKFTDEELREEVDTMMIA(0) 31180

GNDTTATVNCFVMLMLASHPEIQ(0)DKVYEELCEIYGSEDPSSVLVRHEDLH

RMEYLERVIKETMRIFPVGPVLVRRVTDDLNIG(1)DYTLTKGSSVVLGIIKT

HRSEEYWTDPLTFNPDRFLPEECAKRHPYTYIPFSAGPRNCLG(1)MKYAMMA

MKALLATVIRKYVIKKDNALPVQDIKLKADVMLKPVEPITIRIERRIHGKDRT

N*