Neosartorya fischeri P450s

 

D. Nelson

 

August 8, 2009

 

101 Sequences

 

>CYP51F1  Neosartorya fischeri NRRL 181

         XM_001261294.1, NFIA_024690

         98% to CYP51F1 A. fumigatus = ortholog

         63% to CYP51F2 A. fumigatus

MGLIAFILDGICKHCSTQSTWVLVGVGLLSILAVSVIANVLQQL

LFKNPHEPPVVFHWFPFIGSTISYGIDPYKFFFDCRAKYGDIFTFILLGKKTTVYLGT

KGNDFILNGKLRDVCAEEVYSPLTTPVFGRHVVYDCPNAKLMEQKKFVKYGLTSDALR

SYVPLITDEVESFVKNSPAFQGHKGVFDVCKTIAEITIYTASRSLQGKEVRSKFDSTF

AELYHNLDMGFAPINFMLPWAPLPHNRKRDAAQRKLTETYMEIIKARRQTGSKKDSED

MVWNLMSCVYKNGTPVPDEEIAHMMIALLMAGQHSSSSTASWIVLRLATRPDIMEELY

QEQIRVLGSDLPPLTFDNLQKLDLHAKVIKETLRLHAPIHSIIRAVKNPMAVDGTSYV

IPTSHNVLSSPGVTARSEEHFPNPLEWDPHRWDEDIAASAEDDEKVDYGYGLVNKGTN

SPYLPFGAGRHRCIGEQFAYLQLGTITAVLVRLFKFRNLPGVDGVPDTDYSSLFSKPL

GRSFVEFEKRESATKA

 

>CYP51F2  Neosartorya fischeri NRRL 181

         XM_001267337.1, NFIA_109350

         97% to CYP51F2 Aspergillus fumigatus

MVPMLLLTAYMAVAMLTAILLNVVYQLFFRLWNRTEPPMVFHWV

PFLGSTISYGIDPYKFFFACREKYGDIFTFILLGQKTTVYLGVQGNEFILNGKLKDVN

AEEVYSPLTTPVFGSDVVYDCPNSKLMEQKKFIKYGLTQSALESHVPLIEKEVLDYLR

NSPNFQGSSGQVDISAAMAEITIFTAARALQGQEVRSKLTAEFADLYHDLDKGFTPIN

FMLPWAPLPHNKKRDAAHARMRSIYIDIINQRRLDGEKDSQKSDMIWNLMNSTYKNGQ

QVPDKEIAHMMITLLMAGQHSSSSISAWIMLRLASQPKVLEELYQEQLANLGPVGPDG

SLPPLQYKDLDKLPFHQHVVRETLRLHSSIHSLMRKVKSPLPVPGTPYMIPPGRVLLA

SPGVTALSDEHFPNAGCWDPHRWENQAAKEQENDEVVDYGYGAVSKGTSSPYLPFGAG

RHRCIGEKFAYVNIGVILATIVRHLRLFNVDGKKGVPETDYSSLFSGPMKPSIIGWEK

RSKDTSK

 

>CYP52G2 Neosartorya fischeri

97% to CYP52G2 Aspergillus fumigatus = ortholog

NFIA_085030

MGLPLLTIAAVAVALRLLWTLVTRWQHAQNARRLGCGSIPLYPSDPLGISVLKEALAADKAKKLLPMVERRVALMSDREG

RYVTTFRFRQMGRENYFTTDPKNIQAILATQFKDFELGAPRRQALHPLLGAGIFSSDGEEWSHARGLLRPQFTRDQISDL

DLEERHVQKAMQAMPVVNGKWTDAVDIQSIFFRLTIDSATEFLFGESVESQLSALNGGQTPVDKFPYYFDKSQWYAAQRA

RFEKLYWIVNNKECRHAENEVHAYVDRVVHKALKAAREGKLANPDKSSQYVFLHALVSVTQDPIELRSQLLNILLAGRDT

TASLLSWTVLMLARHPAEFHKLRQTIVDEFGTYDQPRNITFAALKSCQYLQYCLNETLRLFPVVPGNRRSATRDTTLPRG

GGSDGTQPIYIRKGQPVVYNVHILHRRRDVWGPDAEEFKPSRWVDRKVGWDYVPFNGGPRICIGQQFALTEAGYVLVRLL

QRFDAIEDVQPHLEIRHSLNLTSAPADNVTVRLREAA*

 

>CYP52H2 Neosartorya fischeri

95% to CYP52H2 Aspergillus fumigatus = ortholog

NFIA_029600

MLAPAVALFGAVYATFLVLRYFQQLYKHRKQARSLRCQPPAEGEAGIFGISSFLRLRNAVKEKRWIELIAEQYGKYGNTF

TQTIFGQPLVSTIEPENLKALLATQFNDFELGTRHQEFYPLLGDGIFTLDGAGWSHARALLRPQFTRDQVADLDLMDGHV

SRLIDLVPKDGSTFDIQRLFFLLTIDSATHFLFGESVGSLHAGTDTGLLGRSAVGNAEGFAEAFNKAQEYLAARSRAVIF

YWMINPKEFRDANKRVHEVVDHYVELALESRRNSENKQPGGRYIFAEALAAENDNPKVLRDNMLNILLAGRDTTASLLSS

TFFYLARHPNVWTKLRQAIVDAFGGAEHPKEEITQTKLKDIPYLRYVLNEVLRLLPPVPANFRVANKDTTLPVGGGPDQK

SPVYIRKDTVVTYSVYAMHRRTDFYGPDANEFRPERWEENGKRGWEYLPFNGGPRICLGQQYALTEASFTIVKLLQRFDR

IENADPDLIEPVQQTNLTLAHDRGVYIRLYSSKAL*

 

>CYP52J1 Neosartorya fischeri

95% to CYP52J1 Aspergillus fumigatus = ortholog

NFIA_113870

MQSSQQDNALGHQHGCELPPELTKKWPLGLDRIKELWTSNAEGHLLAFLCSVAEKYEPGNSITQYFLFGPRAFHILQPEN

VEAILSTNFKDYGFGARAAIFAPLLGNGIFTQEGPAWRHSRDLLRKQFSRVQNRNLEHFHEHVDNMVARLPLDGVVDLQP

LFFNLTLDIATALLFGRSVYSLKAGIDQDADNRLFAESFNIAQEGLAKRFRIAPWHFLYNPPGFRKACGDVHRFVEQYID

QLDLENSEDLDDKTYGFIKRVAQESASQQHLRDQLLNVLLAGRDTTACCLSWTFRLLVRHEQVMIRLREEIASVMGDSAH

PTKEQIRKMPYLSCVIKESLRLYPPVPLNNREAIRTTILPTGGGPDADRPILVRKGELVVFSQYVNSRKKNIYGPDADCF

RPERWETGELDHIGWAYFPFNGGPRQCLGEDFALMEVSYTVVRLLQTFSSIILPKGEPIEPVGSERQRLTLVLSSADGCR

VQIHSY*

 

>CYP53A12 Neosartorya fischeri

96% to CYP53A12 Aspergillus fumigatus = ortholog

NFIA_090480

MITDLLTPQNTGFILLGLIAAYYIVPYLQKWHLHDIPSPSFAAFSNLWLLLQARRGRRFLKVDEAHKKYGKLVRIAPRQV

SIADDAAIQAIYGHGNGFLKSDFYDAFVSIRRGLFNTRDREEHTRKRKTVSHTFSMKSIGQFEQYIHQNVELFVQQWTKL

AKLNGNPRSGYATIDALNWFNYLAFDIIGDLAFGAPFGMLEKSKDIAEMRKAPDSDPTYVQAVEVLNRRGEVSATLGCLP

RLIPYAKYLPDRFFKDGIQAVENLAGIAVARVNERLKPEVMEKNTRVDLLSRLMEGKDSNGNKLGREELTAEALTQLIAG

SDTTSNTTCAILYWCMSTPGVIPKLQKVLDEAIPDDVDVPTHAMVKDIPYLQWVIWETMRIHSTSAMGLPREIPPGNPPV

TISGHTFYPGDVVSVPSYTIHRSKEIWGPDAEEFVPERWDPARLTARQKAAFIPFSTGPRACVGRNVAEMELLVMTGTIF

RLFEFEMQQDGPMETREGFLRKPLGLIVGMKRRAVHASV*

 

>CYP58E3 Neosartorya fischeri

53% to CYP58E1

NFIA_042080

Note: this seq does not have an ortholog in A. fumigatus

MLFQDLSFPAVIGAAFGVFAISVVAGCIYDLFFHPLRNFPGPKRAAIWSFYEFYYDVIRDGTYLWEIEKMHHKYGPIVRI

NSRSLHIHDPEYFSTIYAGSGRKVNKELSAVSGYTFPHSTISTLDHDLHRKRRAIVNPYFSKRAIADIEPVIHERLDALI

SRLAEAKGSTVDLTCAFSAFTADVVTYHFYGSHANYIGSKDFKYGLKDALTVLLNLYNLTRFLPVPATTLKNLPLPILGL

INPNFPE VVSAREANKKMVLNYLNKPDEEKNAMKDARSKSVIVSALTDPNVPDAEKTLDRLLDEGETIIFAGIDTTARTL

AVALFHLLNNKDVLMKLRKELQAIAKSDGQQWTTTELEAVPYMRGVVQEAIRLAYGLVVRIPRISPHEALQYNGFVIPPG

TPVSQSTYLVNNDASIFPNPQAFDPERWVKAAQDGVSLDKYMVSFSKGSRGCLGINLAYAKLYLGIARVATSLDMELFET

TEKDIAVYHTRGFAFPKEGDGAVKAQVTGLCK*

 

>CYP58M2 Neosartorya fischeri

55% to CYP58M1

NFIA_057570

Note: this seq has no ortholog in A. fumigatus

MMLSSSWLLPALAYIFLCFLVQSIYRLFFHPLSRYPGPKLTAATFLYEFYYDVIKGGQFLFQIERMHERYGPVVRINPRE

LHIKDPSFYDTVYAGGTHQRDKDPGWVHISGAPLSTFSTVSHDHHRFRRSILSDFFSKKSVTALSPIIEERVLKLMQRFQ

EAYDSRSAIRVDAAFAGLTADVITHYAYGKSWGFLEDPQFRSNIRAAVNETTNAVHWFRFFPFLVTIFRTIPAQIMCFVQ

PSKTALFEFQKSIFDHAAQPKSKRNDSARTIFHRLTDPSIPAEERSLARIQDEAFIILAAGTETTARTLTIATFYMANEP

RIWKKLRDELQSSVLPTLSSTATWAELEKLPYLNAVINEALRLSYGAVIRLPRITPTETLKYKDYVIPPGTPVSMSTYFV

HQDPSIFPDPQTFRPERWIKASDQPEHLTKYIVSFTRGSRICLGMNLAYIELFMTIAYMVRRFDMVLHETTFEDIRIVRD

YVLGLSKHGDLRVFTKVTNMLQE*

 

>CYP61A1 Neosartorya fischeri

99% to CYP61A1 Aspergillus fumigatus = ortholog

NFIA_020740

MANVNGSFVSPSADATISPQLFYNVDSLSAVLNGFTFWKALATLFFAAVIYDQLRYFYLKGSLVGPTFKLPFMGPFLQSV

NPKFHEYKAKWDSGELSCVSVFHKFVVIASTRDMSRKIFNSPAYVKPCVVDIAHKLLGPDNWVFLDGKEHVEFRKGLNGL

FTRSALSSYLPVMEECYNKYYKHFLEKSKANDYKPEPWMPEFRELMCAVSCRTFVGHYMTDAAIKKIADDYYMITAALEL

VNFPFILPFTKAWYGKKASDMVLEEFSNCAAKSKAHMAAGGEVTCIMDAWVKAQQDSAKYNEKIAKGLPVEDSEKPSHLL

REFTDYEIAQTVFTLLFASQDATSAACTWLFQLVADRPDVLEKIREENLRVRNGNINAPLTMDLVDEMKYTRAVVRETLR

YRPPVIMVPYLVKKDFPITDSITVSKGSMIIPSVWPATHDPEAYPNPDSFDPDRWITGDAEKQAKNFLVFGTGPHYCLGQ

TYAQLNLIAMIGKASLEMDWEHAPTPQSEDIKVFATIFPEDDCHLTFRPRA*

 

>CYP65T2  Neosartorya fischeri NRRL 181

         AAKE02000011.1 NFIA_002780

         DS027697.1  complement(627606..628748)

         57% to 65T1

MMFVILAAASLLYISYILLLAIKTIYFHPLSHIPGPKWRIGIPLLHHLS

628603  AIRGRLDLDISSWHEKYGDVVRSGPDEVTFITAQAWKDIYGHGHRQLPKVQISAINGKDI  628424

628423  FSANDVDHARFRKALSHAFSAKGLQAQERIVTQYIDKLIQRLKWFAESGTAADMGKW  628253

YNLATFDLIGDLAFGEPFGGLDSA

EYHHWVATMFGFVKSIPFLRALHRYPVVFKVILAFHPGSLMEMRSKQVEHAKATVQKRL

SNSAAGRGDFMDSMLRHQGDKGGLSLDELEENANVLILAGSETTAALLSG

VTYWLLRTPDALDKVMREVRAAFALERDITFNQVTAKLPYMLACLNEAFRLYPPVPGGLQ

RWTEVPTWISGYRVPAN (0)

TKVSVHQLSAYSSLKNFHQADRFIPERWLPEAIEDPASPFFSDNRAVFQPFSIGPRNCLG

RNLAYTEMRVILARVLWTFDLTLCEESRDWKDQKIFVIWERGPLMCKLAMRDDRGDCQGGR*

 

>CYP65Y1 Neosartorya fischeri

88% to CYP65Y1 Aspergillus fumigatus = ortholog

NFIA_112820 revised

MGVSSDKGQVVCYVITHAVYNVFFHPLSRFPGPLLHRASRLPYFYGLIKGTLTIDALE

MHQRYGDIVRVAPDELFFAHPDAWSDIHKKTGKAMDKARWFYRPLEVTPRSIVDESHERHSRLRRQMAAGFSEKSMRDQE

PIIRGYVDLLLQRLREKSNDGQPVVISDWFNYTTFDIIGDLAFGEPFECLKSSKYHGWIRSVFESSRPLAVVQALSFFPW

LKRIVLDMVPKDLQETFKRQQRHTEAKMRRRMAVTGNRVDLMEGLLKKKDEFNLSIDELITNAQVLILAGSETTASLLSG

VIYLLLQNSVAYQQLVDEVRSTFSSEKEINFVSASQLSYMLACLNEALRMYPPVANGLPRVVPKGGAQILGQYIPEQTYV

AIPQWALYHRKEYFAEPMDFHPERFLGDSRFANDRRDALQPFSVGPRNCLGRNLAYAEMRLILALIIFNFDMKIDPDCRD

WIQQKNFTLWQKPPLKVYLKPVARKSEP*

 

>CYP65Z1 Neosartorya fischeri NRRL 181 XM_001267015

94% to CYP65Z1

name revised from CYP65Z3

NFIA_106070

MLTRQQGSIYLIGHSIYAIYFHPLSRYPGPKIAAISPIALLVWE              IRGRVHSKVKDLHDRYGDVVRIGPNALVYRTPQAWKEIYGHRTKKGQRTFRKDPSLYV

PTPNGVNAIITAAESDHIRMRRLLAHAFSDRALREQEPLLHFYADLLVQKLRENLDHS

HSEVVDIARWYNYTTFDLIGDLAFGEPFHCLKDSKYHWWVSIMLDAVKLSVYLKVLWF

FPILSPLTKLLVPSYLHQRREASFQLTVEKVSRRLHRQTNRPDFISYILRHKDDENRM

SRQEIDANAATLVLAGSETTAALLSGCTFHLLKNPHIYRRLVTEIRSRFQHPSEIRLS

SIATLSYLNAVLEESLRIYPPIPAMLPRLVPEEGAMINGEYVPAGTSVSMSLWSTFHS

SANFHNPDSFVPERWLASPEEETNRCFTMDKKEAFQPFSYGPRNCLGQHLANAEMRLI

LAKVFWHLDMELCPESENWTDQESYNLWSRPPLKVMISRADGRYEEDSMV

 

>CYP65Z2 Neosartorya fischeri NRRL 181

XP_001260852.1, NFIA_089120

56% to CYP65Z1 Aspergillus fumigatus Af293

76% to CYP65Z5 Aspergillus clavatus

MSPISIVLSILVAVLLGQAIYNIYLHPLRKFPGPKLAACSNICY

IWWTISGEIHAKLKELHDQYGDVVRISPSTLVYRSASAWKDIYGHRKHGASSFIKDPE

YYIPSPNGGHILTAGDADHARQRRLLSHAFSEKAMREQESLVQHYVDLLVEKLRAECA

ASRSTVDMMKWYNYTTFDIIGDLAFGEPFDCLRDNRYHPWVKMVFQSVKMSVYLRLIH

LYPLLESLVKRLLPKKAAKMRNEHWRMSKDKVSRRLDLQTSRPDFMSCILRHNDERGM

TRQEIEANAGVLILAGSETTATLLSGCTFYLLKHPEKYNKLVQEIRGAFQKQDDITFL

SVARLPYLHAVLEESLRLYPPVPGYLPRKVPMGGASIDGQYVPGGVSVSVVPFSASRA

KSNFAEPESFIPERWLENRDRRFETDNREASQPFSFGPRNCLGKNLAYAEMRLIVAKL

LWNFDMTLHEDYRDWDDQTSYIIWQKPSLMVELKAVR

 

>CYP65AA1P Neosartorya fischeri

NFIA_074000

C-term is missing

92% to CYP65AA1 Aspergillus fumigatus

downstream gene is a polyketide synthase

both genes are broken and fused at YNSE/PVEP

PVEP is about aa 410 in the A. terreus PKS gene XP_001215858

The high conservation (92%) suggests an assembly error rather than a deletion creating a pseudogene. CYP65AA1 in A fumigatus is upstream of a short PKS gene on AAHF01000007

MSFLMESSAVGQLSTLNFSNILQALLGS (0)

LVLYAALNSLSNIYLHPLSRFPGPKLWQTSY

IFRHIASIRGTLDVSIKAFHAKYGPVVRYSPDELSFISAEAWKDIYGFRENALPKDPSFYGLIQLSRDKSPSIFTADQDH

HPRIRKALSYAFSEKALRDQEPFVKHYVDLLIQRLRGIADAEDNRIDLVEWYNFTTFDIIGDLAIGRSFNCLQDSAYHSW

VDAFWKSIKISPYARAMASYTDVQRLLRLFAPRALKEARLRHLQYVGVHTEERLARGILRDKPDFISYILRSKGTADELT

DGEVEANVNFLLLAGTETTATALSGTTYYLLKNPEVLRKATAEVRSAYNSE/ begin PKS gene

 

>CYP65L5P Neosartorya fischeri

62% to CYP68L3

Supercontig 569: 1883929-1885384 (+) strand

MAASRIATCMKDKMLTDISTQLFRLDP

ISLAGVLAISGLFFLLTLPSKA &

SIPMVNVKKLFQIRSSHIQKRYLDACKLSKTGSRK ()

APSFRVHSDNGIKTMLAPEYANEFHAHPALRFGRAITLEFHSD &

FLGD KICRNPDWLLITVDYTVDTFFAAEDLRLWPRLIRPIVANFLPSCRKIRRELKEA

PVLEERR DLEAARKANQPQKRYHDAIQLMEECAKGQHYPPAEAQMAFSIVAIHTTSDMLT

QVLLDLCANPEVIQPLREEIVAVNQEE*WKKTALYKLKLLDS

VLKESQRMKPVNI

ASMRRLALEDIKLSDGTLIPKGSSILVSSRKMWDPDAYPNPELFNPYRFLRLRETPGHET

SAQLVWPSPDLGFGYGKHACPGRFFTANEVKIALCHIILKYNFNLPDGYTPTVRKRGIS

LSADPSAKLVIRRRQEEIAL*

 

>CYP68X1 Neosartorya fischeri

47% to CYP68V1 Histoplasma capsulatum

NFIA_098910 revised

Note: this seq does not have an ortholog in A. fumigatus

MAVQEIITILLKHIHSAGL

MAWLLLVLFVGSVMLTIRKSLSTNGA

SHIPLIDPRKSYDIGGIYAKIDFILHARRLLALGVSSGRPFRLLTDLGEMIVLPACFAAEIRSDHRLSFAE (0)

NFHSRFPGFEGFRMGTTDALLSRDIANNQLTHTL (1)

AKVTQALSDECAAALNDHFPAKE (1)

ENRMPEWSDICLREHVLQLVARLSSRVFLGDEGANNRAWLR

ITTEYTKTAYIAAYMLRLWPPFLRPFAHWFLPHCQKLRGQVAEARRIITGVIERRRESIAAAELAGQQIPQYNDAIEWFE

QDVAKQDGRYDPVVAQLILAQAAIETTTDLLTQVILDLAQHPELADPLREEVTKIIREGGWRKSSLYEMKLLDSVLKESQ

RLKPLAMTSMHRLVLEDITLSDGTRLPKGSVIGVSVDRMWDPSVHENPTQFDGFRFQRMRDHPGGTANQAHLVSTSVNHL

AFGHGKHACAGRFFVAHETKIALTHLLLKYDWRIASSSIDARPMEFGLVLQANPKAKISIRARQPDSEGPIRA*

 

>CYP503B4 Neosartorya fischeri

92% to CYP503B1 A. nidulans

NFIA_009830

Note: this seq does not have an ortholog in A. fumigatus

MDNYTLLSLHTGNLKPPDSSSSIDRSQLYLGVIGVLSVIYLLQTLVACTKSFKAPFVGFRSSFEPKWLVGLRFSQGALAQ

VNEGYEKYKNAMFKIARNDSDILVIPNKYVEELRSLPDEKISAIRAHIKNLLGKYSTTLILLESDLHTRMLQTKLTPNLG

SFIEVIESELHFAMEKEIPADLHDWQNVNVFHIVLRIVARISARVFLGVPACRNEEWLQTSIHYTENVFATVMLLRRFPK

WMHPIVGHLLPSYWAIHSNLRTAKRIISPMVRQRRAEEAKGDPTYEKPNDLLQWMMDGANENDGQPDKLAHRQLLLSLAS

IHTTTMAAAHCFYDLCQHPEYFEPLREEINDVIAQDGGWKKTTLNKMRKLDSFLKESQRINPPSLLAFNRIVSEDLTLSD

GTLLPKGTHFSMPSAAILQDNAVEPDADQFDAFRYYKKRLNPEEANKHQFAMTDNNNLHFGHGKYSCPGRFFASNEIKII

MAHLLTDYEFKYPPGASRPRNLTADENLYPDPSARLLMRRRMVAEGQAQITPEIVLV*

 

>CYP504A7  Neosartorya fischeri

           XM_001266358.1, XP_001266359.1

           77% to 504A3, 97% to CYP504A7 Aspergillus fumigatus

           NFIA_040380

           Name revised from CYP504A10

MAQTIVIAVLAAVYFLIRYLNRTDIPKIKGLPEIPGVPVFGNLL

QLGDRHATVAAKWAKKYGPVFQVRMGNKRIVFANSFESVKQLWIKDQSALISRPTFHT

FHSVVSSSQGFTIGTSPWDESCKRRRKAAATALNRPAVQSYMPIIDLEATASIKELLK

DCRNGAVDINPTAYFQRFALNTSLTLNYGFRIEGNVDDALLREIVDVERGVSNFRSTS

NNWQDYIPLLRIFPKTNREAEEFRVRRDKYLTFLLDMLKERIAKGTDKPCITGNILKD

PEAKLNEAEVKSICLTMVSAGLDTVPGNLIMGIAYLASEDGQRIQQKAYEEIMKVYPN

GDAWEKCLVEEKVPYVTALVKETLRYWTVIPICLPRESTKDIVYNGATIPAGTTFFMN

AYAADYDDDHFKMPDKFIPERYLDVSEGSGTPHYGYGAGSRMCAGSHLANRELYTAYI

RLITAFTMHPARDPADQPILDAIECNAIPTALTTEPKPFKVGFKPRDTSKLQQWIAES

DERTKEL

 

>CYP504B5 Neosartorya fischeri

98% to CYP504B5 Aspergillus fumigatus = ortholog

NFIA_016920

MAIAAAVSSLQQNVLRHPLQSLAVTALVVPIIYIVINEFIRASARVPGFKGPRGLPLIGNLAQIRKNAAEQYRIWSKTYG

PVYQIQLGNIPVIVVNSAAAAKILFGQNAQAVSSRPEFYTFHRIVSNTAGTTIGTSPYSESLKRRRKGAASALNRPSVES

YVSHLDVETKAFVAELLKYGNGGKTPVDPMAMIQRLSLSLSLTLNWGVRVASQEEDLFDEITHVEEEISKFRSTTGNLQD

YIPLLRLNPFSTNSRKAKEMRDRRDRYLNALNRDLDDRMEKGIHKPCIQANVILDKEAKLNKEELISISLTMLSGGLDTI

TTLVAWSFCLLSRRPDIQKKAAQAIQDMFSQDEPLCDAQDDQKCAYVAALVRECLRYYTVLRLALPRTSIKDITYDGKVI

PKGTVFFLNSWACNMDPEVWSDPEEFRPERWFEQPDAPMLTYGIGYRMCAGSLLANRELYLVFMRTLNSFYIEPHDDVDW

HPINGNSDPTSLVAIPKKYKVRFVPKNEQALTQALA*

 

>CYP505A13 Neosartorya fischeri

97% TO CYP505A13  Aspergillus fumigatus = ortholog

NFIA_067930

MSESKTVPIPGPRGVPLLGNIYDIEQEVPLRSINLMADQYGPIYRLTTFGWSRVFVSTHELVDEVCNEERFTKVVTAGLN

QIRNGVHDGLFTANFPGEENWAIAHRVLVPAFGPLSIRGMFDEMYDIATQLVMKWARQGPTVPIMVTDDFTRLTLDTIAL

CAMGTRFNSFYHEEMHPFVEAMVGLLQGSGDRARRPALLNNLPTSENAKYWNDITFLRNLAQELVEARRKNPEDKKDLLN

ALILGRDPKTGKGLTDESIIDNMITFLIAGHETTSGLLSFLFYYLLKTPHAYKKAQEEVDSVIGRRKITVEDMSKLPYLN

AVMRETLRLRSTAPLIAVHAHPEKNKEDPVTLGGGKYILNKDEPIVIILDKLHRDPQVYGPDAEEFKPERMLDENFEKLP

KNAWKPFGNGMRACIGRPFAWQEALLVVAILLQNFNFQMDDPSYDLHIKQTLTVKPKDFHMRATLRHGLDATKLGIALSG

TADSAPPESSGAASRVRKQAAPPPGQLKPMHIFFGSNTGTCETFARRLADDAVGYGFAADVQSLDSAMQNVPKDEPVVFI

TASYEGQPPDNAAHFFEWLSALKENELEGVNYAVFGCGHHDWQATFHRIPKAVNQLVAEHGGNRLCDIGLADAANSDMFT

DFDSWGESAFWPAITSKFGGGKSDEPKSSSSLQVEVSTGMRASTLGLQLQEGFVVDNQLLSAPDVPAKRMIRFKLPSDMS

YRCGDYLAVLPVNPSSVVRRAIRRFDLPWDAMLTIRKPSHAPKGSTSIPLDTPISAFELLSTYVELSQPASKRDLTALAD

AAVTDADVQAELRYLASSPTRFTEEIVKKRMSPLDLLIRYPSIKLPVGDFLAMLPPMRVRQYSISSSPLADPSECSITFS

VLNAPSLAAASLPPAERAEAEQYMGVASTYLSELKPGERAHIAVRPSHSGFKPPMDLKAPMIMACAGSGLAPFRGFIMDR

AEKIRGRRSSVGADGQLPEVEQPAKAILYVGCRTKGKDDIHAAELAEWAQLGAVDVRWAYSRPEDGSKGRHVQDLMLEDR

EELVSLFDQGARIYVCGSTGVGNGVRQACKDIYLERRRQLRQEARERGEEVPAEDDEDAAAEQFLDNLKTKERYATDVFT*

 

>CYP505E2 Neosartorya fischeri

~77% to CYP505E1

NFIA_004540

Note: this seq does not have an ortholog in A. fumigatus

one stop codon

MKDTERIPGPK (1)

PLPVVGNLFDIDFEHGLESIIEMANNF (1)

GPLFQITINGEKQIFATSQALVDELCDESRFHKAVVAGVQNLRMLVNDGLFTAYHGERGWGIAHRILVPAFGPLR

IRNMFEDMSDIAQQLCFKW ARQGGSTSINITDDFTRLTLDTIALCSMGFRLNSFYNSETMHPFVQYMVDVLREADVQAML

PGIANSLRVTAQRRMSKNIEAMRSIAREIIQGRRDKGESVDDLLNTLLSGRDPVTGEGMTDDSIIDNVITFLIAGHETTS

GLLSFTFYYLLQNPHILEQARNEVDDVVGVD*ITVQHLAK

LPYIDAILKETLRLMPTAPAFAVFPKKPEVLGGKWTINARQAVIVLLPACLRDQAVF

GPDAGEFRPERMLEENFSQLPPNSWKPFGNGERSCIGRAFAWQEAQLVVAMILQTFDLVGNDPSYKLRIKETLTIKPDGF

RLRATLRRGQSATGLSRRSMSVSADGTSAASSTHLAGKCKGLEPAGGQPVSFFYGSNSGTCKALAHRLASNMMARGFTNQ

KLAPLDSAVDNLPRDQPVIIVTTTYDGQPTDDAKKFIAWLESGKVPALQGVSYAVFGCGHQDWTKTFYRVPILIDDMMHK

AGATRLAARGAANAAVSDLFSDLEKCEETSLLPALRETFLPSSSSDVELLNPQQLQISLSKPRRVGMHQGLVEVKVTAVR

ILTSPGTLEKQHVEFRIQGETTLRPGDHLNILPANPPSTVSRVLAHFDLAPDYSITINSFNTLGLPHATPVLAAELFSSY

VELSQPATRNNLKALAATALSNADKQELIRFHDSNDPLVRDKRVSVSDLLEQFPSISLPLAAFISMLPALRVRTYSLSMA

PSFKPSHGSLTFSVVNEPAWSGNGQYLGVGSNYLASLTLGSILYISPRPAKDAFHLPMDQSSEPIIMICAGTGLAPVLSF

IQERMVWLQQGKPLAKALLFFGCRGPHLDDLYHEELSEFESAGVVEVRRAYSKAPDHDLAKGSRYVQHRLVTEAEAIQDL

WAQNAKVYVCGSGNLAKGVQTALENMLGALPQE*

 

>CYP530A5 Neosartorya fischeri

95% to CYP530A5 Aspergillus fumigatus = ortholog

NFIA_094190

MLPLAVLGAVGALIFLVFRLLSIGQRPKNYPPGPPTLPLIGNIHQMPTRDAHLQFQKWAQEYGPVYSLILGTKTMVVLSS

DQAVKDLLDKRSALYSHRQEMYIGQTLCSGGLRMLMMGYTPVWRGFRKMVHGLLNVTAAKSYVPYQMLENKQMMYEFLTQ

PERFLYSIRRYSNALTTTMVFGWRTPTYEDEKMKQLFDGFSEFAGINQTGTAALIDSFPWLRRLPDFLLPTQKRAKELHE

REKALYVGHYLRAKQDIRDGNIKPCFCVGLAEAQKSDGFSDAQAAYISGTLLEAGSDTTSSTLYAFVQAMLLFPDVQRKL

QEEIDRVVGPRMPTMDDEQDLQYVRACMKETLRWMPTTILGAVPHAVTQDDEYMGYLIPKGAGVVNNVWAINMDEKRHPN

PRVFNPDRYKDDRQTLAEAAANPDATKRDQFTFGAGRRICPGIHIAERSLFLGISRMMWAFNVEPALDEKGQPILPDADR

LTQGFVCMPEEFPARITPRSQAKADMVIKEWKEAEQQCLDPETKQWLLSPVQ*

 

>CYP531C4 Neosartorya fischeri

72% to CYP531C3

NFIA_055060

94% to CYP531C4 Aspergillus fumigatus

MDAFQSVAFDYGRRGLVNPFFGALWAALIVWYLGTYLISPLRRFPGPILAGWTNLWRIYHVRKGKVHIVTTELHKKYGPV

VRIAPNVVDLDMPELIRTIYSTRGDYRKTEFYHGSSAKNNGKIIYNLFSECDPQVHAQQKRPIAKHYSMSGVLPLEPHVD

ETIGFLCRRLEEEFIDGPKAGRLCDIGQWLLYYTWDVVGKVTFSEPIGYLEKGYDFDHTIAISDKAMDYFALVSQLPILD

HLLDKNPVYRIGPPSFGTITNISIQHLVDRLQGKDTAYHDPSKPDFLDKFIEAKATFPNVVDDAQIISYLMINMIAGADT

TAITLNAALYFALKNPAVWKRLQEETSSLHSEGSTIVPFKTAQDLPYLNAVIREAMRMHPGVAMCLERYVPDEGLTLPDG

QFIPGGCIVGMNPYVLARNQSVWGEDADFFRPERWLRDPTRETEEAYQERLRRMNAADLTFGAGSRVCIGRNLGMMEVYK

VVATLVSRYEVELADSKGEWKTHNSFFVRQEGIEVRLRRRSI*

 

>CYP537B2 Neosartorya fischeri

100% to CYP537B2  Aspergillus flavus

seq runs off the contig end

LADRYAMSNIVRDKHVSAIKERAQAFVSRCAAIEGSVNVY (0)

SLLHCYALDGVTNFMFSPGGLKSLDNTKDYQMMEELTYHQSLQ (1)

KNLLYYYLPRLAPYFPSCLHPRPAPRANAYVLQMAGQQHPEEHSLVARLTRKGSPLSHMQVAAECKDHMAAGIDTTGDA

LCFLMWELSQPQNLQFQDRLHKELLSTSDDTPLDKMPYLDAVIKEALRCAPPIPMSFPRYVPSGGRTIDGYFIPENTIVS

CQPYTVHRFNEEVFPEPDRFNPERWLEEKGFNDRNRLFFAFGTGGRGCTGK (2)

NLAMVEMKILLRELYSRFRSSVAPDMTASMDLDDQIISARPKDQICKLNFAVRGEDVDTA

 

>CYP539D8 Neosartorya fischeri

95% to CYP539D8 Aspergillus fumigatus = ortholog, 79% to CYP539D7

NFIA_054110

MIEELLARIHPGRAALYVLGALFFACLIRTAQVSMEISKLGYRAPRIRFCLPWAIDFLYGASKANDDGTDHVFLHQAILN

AKGATQLDCVKTAELNGGIARRVILTKDPENIKAILTGQFADYGKGEEFHEQWKDFLGDSIFATDGELWSRSRHLIRPMF

VRDRIVDTEIFEKHVQNLIPLLEGSNLPSGSKVVDVGSLFFRFTLDAATDYLLGQGTNSLHNPETRFAEAFGYVKHRQSEIFRLG (2)

MFSFIVTKRKFRRELKVMDDFIQPYIKRALSLTPSELDQKISKRETFLDALARFTRDPRVLRDQIVAVLLA

GRDTTAAVLSFCIFELARNPDVVAKLRKEIGARLGLGPSAQKPSYNDLKEMKYLNAVLNETMRLYPPVPFNVRYSLRDTT

LPRGGGPDGLSPVGVRANTRVIYSTMIMQRSAENYESPGSPNYFDPEKWLPDRWLSGWQPKPWQYIPFNGGPRICLGQQF

AAIEMGYTVVRILQAFERIQAMPANGKERVDDPVLKFEVTLSPGSELNCVFVRKGEGTLPLRED*

 

>CYP540B7 Neosartorya fischeri

96% to CYP540B7  Aspergillus fumigatus = ortholog

NFIA_077230

MASQQFYLLGESISSARTISLDGMNDLEGLRNLIASHFAIVEPSGIEFSGQDISLTDLNEITSSTTPVAITIDGHAIRDA

PSPNGLPFFGNFFQIFPDHLGNHQRLFEQYGPLIKTNTLGRTVYQTNDPVLSAIVLNESDFFTKKINEAHPLYSLKTPSA

GVFLGDTDTPEWRVAHKFLPPALGPKAVRHYAPTMQKTVEDACTIFDQLDAQGEAWNVYQYMLKLGSQAVGKLTLGLDFE

HFSSADAPIHEMVHLIAEVLSLNKKVTSKGDWYASLPFGDPKRLKDTKARIEQLVEESVQKAQRGGVEDLPLQDAALQAA

NMVDYAIRATDNKGEKLPKSSLVWALVVATGAGFTTTSSLLSWLIYGLVTYPGMQDRLLQELVDHGFDDNTEITADFTDK

LTFLDKYIKETQRRHNPSFQPGRTAKLDLILPGGYKIPQDAVVIPALHHIHNNPAIWDNPARFNPDRWDTDEVKQRHKAA

YIPFAMGPRMCIGFNFALQEIKVFLPKLIYRYKFTREGDGPIEYDPMFQLIRPNNLYVRAERRVKWPYKSEA*

 

>CYP540B8  Neosartorya fischeri NRRL 181

           DS027697 join(1677302..1677440,1677496..1678332,1678385..1679094)

           73% to CYP540B4, 96% to CYP540B8 Aspergillus fumigatus = ortholog

           name revised from CYP540B11

           NFIA_006270

MSTTTKLFHLLGEPISTAKEIQFESMTTYEDLRHLIAAHFAIVE

PNGIGFLSQDSILHDVPEIAASDDIISITIDGKAVREIPGPKGLPFIGNFFEVYPDHL

GNHQRLFEQYGPIFKTTNMGRTVYHTNDPQLSSIIFAETDFFTKKINAAHPLHPIKNQ

EAGVFLGDTDTPEWRTAHKFLPPALGPKAVRHYAPMMQETVEDAFNVFDALDEKEEAW

NVYQYMLKLGSQAVGKLVLGIDFKHFSSIDAPPHELVYRIAESLELNKKVTAWGDWYA

KLPFGDPQRLRNARGRIIDMVNESIQNAARGGIEDLPLQDAALKASNMVDYALRATDN

KGEKLPKTSLMQALVVATGAGFTTTSSLLSWLIYGLVTYPGVQERLLQELIDNGIDAD

TQLTADLTDRLTFMDKFIKETQRRHNPSYQPGRTAKVDMILPGGYKLPQDSVVIGALH

HLHNNPDVWSNPARFDPDRWDTEEVKNRHKTAYIPFATGPRMCIGFNFALQEVKVFLP

KLVYRYKFTRENDGHIEYDPMFQLIRPTNLYVRAERRVKWPPRSDKAAPSPSL

 

>CYP541B2 AAKE02000015.1 Neosartorya fischeri NRRL 181

67% to 541B1, 97% to CYP541B2 Aspergillus fumigatus = ortholog

NFIA_039470

347217  MPTPIPHPSGLPILGNLFSISPGNTWGSFNKLAVNNKNF (1)  347101

347032  YPIFKITILGHDIVFITSAKLLEEICDEKRFRKCVTGPIVEIREAVHDSLFTAYHDEESWGI  346847

346846  AHRIMAPLVTPEAVIDAFAGMRETATDLVKKWTAGPRQRINVSNDMDRLNHAANMLCFF  346670

346669  DQRIHCLEGPEPPVLQAMEAATFEALRRPTRPKVLKWLIYQRRFDSYIKTMRDYAAEIVA  346490

346489  KRRAAPTEKKDMLHAIMHGTDPQTGKALTESQHLDEIINIFIGSATSANLVSFALYYLMK  346310

346309  NPHEIARAREEIDAVVGGPTAQLEHEHLARLPYCEAILRESLRLSATAPGFNIEPIPDL  346133

346132  EQPVLLAGGEYQVPNKQPLIALLAAVNRDPEVFEDPDAFKPERMVGEKYDRLPAGVK  345962

345961  KGFGNGKRECFGKRYAWEWSFMILVTIMKDVDFVLADKNYKTEVGGVNYNGAFSTKPLGL  345782

345781  FALTGPRQSV*  345749

 

>CYP547C2 Neosartorya fischeri

97% to CYP547C2 Aspergillus fumigatus = ortholog

NFIA_096320

MADTLLAIASVSLAEGYFLQRSVLNEHSFHSVCLGAVGVNLALKIFWDFVIYPFFITANRHLPTVKGTFVNGKIIFDNPR

GRLPLQWMKTIPNEGLIHFRDVFNRSHLLPTNHQALLDIMSTNTYDFEKPWRAREFLARIIGFGLILSEGAAHKKQRKAL

TPAFNIKNIRSLYSLMWEKTGLFLDELEKEIRQNPMEGTSPEDGVGKVEMSVWASRLTLDIIGPAAMGRDFRSLHNPENK

VADSFLAILEPTKEKMAFLAINFILPQWFARRLPWRLNKVIDTETGFLRDLCKDIVREKRKTIVSSNMTAKELEADILGT

MMVGGDFTDDELVDQMLTFLAAGHETTASALTWACYLLTLHPDVQERLRTEIREHIPSGNHPITWSDLESMPLLNGVCQE

VLRLYPTVPITIREAVRDTTIAGKHVPKGTRILICPYAINRSPEFWGDNGEEFLPERWIDPDKNGQKVVNHNGGASTNYA

QITFLHGQRSCIGKDFARAELRCAVAGVVGRFRFEMQDPKQEIHIAGAVTTKPVEGMHLKMSRVDEW*

 

>CYP548D2 Neosartorya fischeri

96% to CYP548D2 Aspergillus fumigatus = ortholog

NFIA_048430

MLVQPLLENLSVWGAVQGILSLFGVLTVAYVTYNRFFHPLRSIPGPFLASITPWVQLYHGLKGDRHLWLHRLHEKYGSHV

RAAPNFVSINTDRGLHDIYGHGKRLRKANFYNAFPAIKGVYNTHNAIDKAMHGRKRRVLSQAFSDQALKSMEDVMLLHVR

QLCGVLTGGLEGKGEKSATAVFNMGDWFSYLTYDVMGELCFGKSFDMLISTGRRKLIELVDRAANRHYV (0)

CGLWMPLDTWHLDQIFIHKLTNDRWNFIMNSRVEANERAKERTQAGHDAKKDFFYYLLNAKDPETGKGLTTPEL

WGEANVLMIAGSDTTSTTMSATIFYLVRNPRAMELLRKEIRENFSSVEEIVTGPKLNELVYLKACIDEAMRLAPAVPGAP

PREVMEGGAMVDGVFLPEGTDCGTPTYSIHRQPEYYREPEAYIPERWIEGAMCQAGSESWTTSKEAVELARRAFCPFSIG

PRGCIGKSMAFMEMRLTIARLMFLFDFELADHKGEDEKGQLALVDHFTSSKYGPNVIVRKRV*

 

>CYP548T1 Neosartorya fischeri

43% to 548E1

NFIA_095340

Note: this seq does not have an ortholog in A. fumigatus

MFVAAGLGMMVAHWPAVIIGFAICYLLGSAIYNLYFSPLAKYPGPLFAKVSALPDFYWSLTGDRHMWIARNHEIYGDVVR

FRPDGLLFRTPQAHRDIFNHKANVKRAKFYDMLTRNKHDTSTITGTDPTLHAQKRRVLNTVFSEKSLRSMEPFLVKHVTR

WCELLIDGDGTDWSTPRKMSEACDYLVLDVLCDLCFGQSVDTKEPGENEYHKIPHAIGSFLDILYPLGHSPWLDLIVWLK

PRGLDWVFGALTPPHIQFLYEFVKQSLAQRLKTEKETPSTGQEGRGDMLHYLIHAKDPATGRVGYTPEALEAEALMLTIA

GSDTTSVIMAGFFFYIVRTPRAYRKLVNEIRSTFTNIDEIRAGPKLTSCQYLRACVDEAMRIMPPGPSEMPRIVLPGGII

VDGDHIPEGTTVGVASWSSYRNEEYFPDPNVYRPERWIVDEEAGVTAEDVARARSSCFPFAAGTTGCAGKNFALLELYMT

IASTLWQYDARLLPGDMTGAGSKAQGWGKRNPKIFHVKDKYISVRDGPMVQFKKRVA*

 

>CYP566C2 Neosartorya fischeri NRRL 181 revised 7/18/07

NZ_AAKE03000024.1, XM_001258096, 89% to 566C2 = ortholog, 79% to 566C1

NFIA_055490 revised, removed two intronic seqs

Name revised from CYP566C3

189543  MDAQHLMTMSGISLEQVAIMGCSL (0)  189469

        GTGLLVSMIIYNYFFHPLARVPGPCTGAIFP (0)

        FWSMSSLYRRRLNPDLAELHKKY (1) 189182

189121  GPIVRVGPNQLSFATVEAQKMIYNAKP

        THTGSDELFGRDGTLQDVLLSMILGAANIGSLSNRAEHKKMRKRLQPGFTSKALFEQESL

        LRMHMDRLLQGLAQDTGVIDLTEYFSRFLWDLIGDLSFGEPLVPEKH (1) 188720

188664  GRRTDTLRSLVGVYQGCFPILEAINYAVPQIEGVLKLALQLVPPATLRAVLPSATFRD (2) 188491

        CINRQDGRSDFLTHIMGDK  188299

188298  SSNPTELELSYDELHSNATVLM (2)

        IAGYKTTETSLSALFY  188119

188118  RLLSTPGVLEKLQTELFSNFQSIDEITGKKLLSLPYLNGCVNESLRLTPAVAGKFASRRS  187939

187938  PGAIIEGFYVPSGTEVYTETYTMQRSPQYWHAPDEYRPERWFERGEGSPYAQDVHEAFKP  187759

187758  FSSGPRACLGREMALQTLRLTAALLVYRFHLKIVNEDRFVWEQDTDSRMIYSKYHIKAIV  187579

187578  QERLT*  187561

 

>CYP573A6 Neosartorya fischeri

95% to CYP573A6 Aspergillus fumigatus = ortholog

NFIA_027910

MGLGEEFLARITLTNVVLGLVAYVLLKFAYQIVYYHFFHPLSVFPGPFWGGVTRLWIAWHNLRETELPTVYALTKKY

GPVVRITPTLLLVSDPMKLPDIYHRNADKTGHYITGSFGETESLFNMRSHKTHAAFRKHLAGP

YSFTNVKRMEPLIDIRIQHW

IDKLNEKFAQTGEIFDFSWWAVYMAYDIISEIGFGAPFGFVEQGQDVGGLIQGFHDGLPAFGFLARLHPFTSWMKTTFMK

KYLVATPQDDSGIGVLMRFRDRLIDQRFRELEEKKDIGRIDLLQTFIEARTEDGSPLDIEYLKAEVLLVLLAGADTTGTV

FQALVHFLLTNPDAYRRMMEEIDAATAKGLISDPVPQYDEIVEHLPYYVACVRETLRLNPPAPNIFPRYVSEPGMDLYGK

FAPAGTEISGNPWIMQRDKKLYGEDAEEFKPERWLDAEKAKLYNKYSFTFGYGARVCLGRDIAMMELYKGPLQFFRRYNV

QTVNDKPKARFVIKGGVGFYRDVWLTIDRRLLEKA*

 

>CYP578B2  Neosartorya fischeri NRRL 181

          DS027697, NFIA_006220

          join(1665966..1667316,1667397..1667539)

          94% to CYP578B2 Aspergillus fumigatus = ortholog, 66% to 578B1

          name revised from CYP578B4

MFLLTIVAVSSFLVLLLYKFLICPYFLSPLSKIPNAHFTAPISD

YWIERKRRSGEEVLTIYDLHREHGPVVRLGPNELSVNSLGGLHVIYTGAFEKHSFYRD

AFVNFLTDNLVGMLPNGSHARQKRMLSKIYSKSYLHESVDLRNISSIILSQRLLPILK

RVAEKGEAINVLPLFQAVGMDFTSAFLFGTANSTTFLFDLPGWERWLVEYERFKYLSV

KERYLGFIESWCLSLCSRMQSNEHPNDVPVATNPVVYSQLRQSLEKHPDQRPLDLALA

SELLDHLVAGHETSGITFVYMMWELSKRPQLQAKLRQELLTLSPSLRYPFVELSNDSL

PLLPSPAAIDSLPLLDAIVRETLRVHSPAPAPLPRVTPSSPEGIAIEGYDRIPGGVKV

SSSSYTLHRISGVYPQPFEWLPERWLDPGPGKIHDMRRLFWPFGSGGRMCLGSNFALQ

EIKLVMAAVYTNYTTSIVDDEGIEQDYAFISLPKGRKLMLRFTPVKL

 

>CYP578C3 Neosartorya fischeri

96% to CYP578C3 Aspergillus fumigatus = ortholog

NFIA_020380 revised

MVVSIYTSLSIAVLLLFVAYKAIVYPVFLSPLSKIPNAHWSAPISPAWILWKRFRSQNNR

TIQAAHERLGPIVRLGPSEISINCVEGGIKTVYSGGFEKHEWYPRVFGSFG (2)

TVSMFTMTGSKDHSVRKRMLSNIYSKSFLQSSPHMRLISRTIVYDRLLPILYEAATSNRPVDVHDLNQGLTMDFVSAYLYGVR

NGTNFLQDAPYRQRMLHLYQSRKPFEFYHQEVPNLLSWTKSLGIRLIPRYCDQANEILDSWGLGLCDKAEESLKSNRLED

EPAVYKHLKQMISKHLPENQNDVEYARILEQQRLDIACEMYDHLTAGHETSAVALTYLLWELSKRPELQDALREELSTLE

PMIIFPRPSESAELPPAKSVDSLPLLEAIVTETLRLHAPIPGIQPRVTPYPSCTLVGYNNIPPKTRVNAQAYSLHRNPEV

FPDPEIWEPKRWLKDVNTPSELEERRRWFWAFGSGGRMCVGSNLALQEIKLVVAAVYTNFKTSIVSDDNMEAIDAYTVKP

TGEELILRFELVE*

 

>CYP584E2 Neosartorya fischeri

95% to CYP584E2 Aspergillus fumigatus = ortholog

NFIA_022940

MTSNYSISLIAGAIAVLVYALSILRRKWTQYRFAREHNCQAPPRIPSKDPFFGLDTIYATIQNVKEHKFLERAQARFDAV

GHTIKARRLLQTIIFTRDPQNIKTILSLRFKDYALGHRYKTFGPLLGHGIFTTDGEHWAQSRAMIRPNFVREQVADLAIF

EAQMADLLELIPKDGSTVDLQDLFFSYTIDSATEFLFGQSVQSLKKRRSGGRDAHVENDFASAFNYAQHAIATRIRLGPL

AAFYRDRKVERCNRVCHALVEQFVDKALEVRAQGLDGKTLEDGDGEKKQRYVFLHGLAQQTGDRRRIRDEVMNVLLAGRD

TTASLLSNLFFMLAKHPRIWAKLRDEVASLNGRPPTYEQLRNLTYVKYCLNESLRLHPVVPGNARFAITDTVLPVGGGPD

GQSPVFVPKDAIVTYSVWSMHRREDIYGPDANEFRPERWADLRPGWEYLPFNGGPRICVGQQYALTEAGYVTVRLAQQFA

VLESRDPGPWEENLTLTLCSRNGTKVSLRN*

 

>CYP584E3 Neosartorya fischeri

87% to CYP584E3  Aspergillus fumigatus = ortholog

NFIA_049440

MYPSLHPKLVLVLVAALATIACICIKRYLVRRQFARKHGCQPVARSFSKDPFLGLDTIPKTIGALRQHKILERSCNLFRN

YGNTFTVKELQKSAILTIEPENIKTVLSLKFNDYGLSHRLQPFKPLLGEGIFDTDGAHWASSRALIRPSFTRDQVADLTA

LEELIQDLFALLPRDEKTVVDLQELFFRYTIDSATEFLFGQSVGTLKKTHSELGVAQAFHYAQKAIITRGMLGPLAVFYR

DQKADECNRVCREFVQRFVDDAFHAVEGKREKKQDETGRQKRIFSHELAARTSDKRRVLDELMNVLLAGRDTTASLLGNL

FFMLAKKPVVWDKLRAEVACLQGRTPTYEELRSLRYVQCCVNESLRLHPVVPRNERQAVRDTVLPLGGGSDGLSPVFVPK

GTIVSYNLYAMHRRPDFYGPDAEEFRPERWEDGRLQPRWGYLPFNGGPRICIGQRYALTEVSYVLIRMVQEFRVLESRDP

GPWEESLALTLCSRNGTRVCLIPS*

 

>CYP584G2 Neosartorya fischeri

56% to CYP584G1

NFIA_063580

Note: this seq has no ortholog in A. fumigatus

MVQNSHQTGKRRKQSRTDDEIERKYAHKHGCRPPKHSVSLGPFGLGMIMTMLAATREHRFLEQVRSWHRAYGTTFKATMI

VRKAIFTVEPKNVQTVLALKFKDFELGEYRNRAVRPLLGYGIFSTDGSVWEHSRALLRPNFTRNQIADISVYETHVAHLI

KQIPRDGSTVDLQDLFFRMTLDSATEFLFGESVHSLGDAASAPASSFAADFNASQRGLALRSRLGSLMMFYRDKQFSNAV

ADARSYVDRFVQKAIDYRIALDNGQYVSEEARKVNEQQYVFLHELSKRTLNKTELTDQLLNILLAGRDTTASLLSITFFT

MARRPDIWNKLRQEVLALGGRKPSFEDLKSMTYLTWVLNETLRLYPVVPINVRMANKDTVLPVGGGHRGKDPVFVPKGYE

VIYSVYTMHRLPEIFGDDADEYRPERWEKLKPGWAYIPFNGGPRICLGQQFALTEAGYTTVRLMQQFEAIESRDPKPLTE

GLTLTLASLNGTKVAMKPAKGS*

 

>CYP586C1   Neosartorya fischeri NRRL 181

           DS027697

           join(701574..701711,701768..701954,702008..702981,

           703037..703117)

           92% to 586C1 = ORTHOLOG 51% to 586B1, 48% to 586A1

           NAME REVISED FROM CYP586C2

           NFIA_003100

MFLILSVIAALPLLAFWLLNKLDYYRTKQFAAWPQPKPSRVWGHMKDLNTFISRGEPKRHIGK (2)

EDHVFAEIKAHLGNPPLYLLDARPIQHP

MGIVCSHEVAEQVARSSKQFPYGMPKTPTLQAYKYLLGPHSILTSE

GEEWKSLRKRFNPGFAPQHLLTLLPCILDKTVPFFETLDRYAQSGEefslaetctn

LtfDII

GAVTMDEDLGAQLPLDKQSEMVRLYHELAASYYRKSSVRAKALNPLLIWQQY

TLARTLNAIIKNHIKRKFAELKEASTDEKKSRSVLALSLQGIEHLDAHVLDQTCDQLK

TFLFAGHDTTSILLQWAFYELSRTPRVLESIRRELDDVFGPDPSPAVVRDKLLAPNGG

ELLSKLQYTTAVIKEILRVYPSSGTGRLVPEGSDAYIQLPDGRSLCIDGILMYNCETL

IHRDETVYGESKDDFFPERWLGDAGADRIPSSAWRPFERGPRSCIGQGLVTIEAQVIL

ACAVRRYEFVKIGLGEVARDSAGEPILDPQGQYEVKSKLFNTMQVTAKPVDGMIMKVK

LSSGGRKEL

 

>CYP586C4 Neosartorya fischeri

56% TO CYP586C2 Neosartorya fischeri

NFIA_106770 revised

Note: this seq does not have an ortholog in A. fumigatus

MCVVCSHEVAEQISRQSRMFPYSVPKSPTTKAFVDLIGPKSIITAE (0)

GCEWRDLRARLNPGFSAGNLMTLLPCMVEKTLLFVDILDQYAASGEHFMLNELCTNLTFDII (1)

GAVTMGVNLCAQLGEDRQSEIVKIFKEIGSTYSSQRGIWTAPLVRLRRRKLVSKLNALLTGFISETFEEVKRTPQTKESTRLGS

RSILTLMLQDANELTPAIMDRTCDQLKSFLFAGHDTTSILLQWALYELSRTPRAMDAVRRELDSIFGPDTSPRSVSNILL

SEDGTALLSKLRYTSAVIKETLRLYPPSGSARYAERGSRLTLRLPTGRVYCVDGLVLYNCATIIQRDETVYGESKDEFVP

ERWLQDNELNMHLSQYRDHDCYREARFAGPASAWRPFERGPRNCIGQELAMIEARLILASVVRRYDFSKVGLGEIAIDEN

GQPALNSHGQYETKSKLYNVITSLPPRPAFAFCWLTSSVKDVTGDSKTHRWDENEREAKRNSV

 

>CYP613B1  Neosartorya fischeri NRRL 181

          GenEMBL AAKE02000024.1, NFIA_055360

          95% to 613B1 Aspergillus fumigatus, name changed from CYP613B2

MAYALTILVPCLVLALVAARPVLYWVLSVVVD (0)

AFLRWKYPLPHHAGSKPMPRARYT

WPNGQGTEKFFNGRSAAKQWRQQWGPIYQIWSGWSPEI (2)

VLTTPTHAVQFFRNSHRHTKAVNNDSGWLFGEVLGVCVGL

LSGSDWKRVRQQVEDGFSRPTAARYTADLVTLAREYLQSTLLTSSEQSVEKKGIIHVEPA

KTLQFYPFLSVAQILFGRLSPMQRTQLTTLAPLREELFKEVIRGGINRLSIAPWFGSRGV

RLLNEFQTQWERFVEDAYHTAVKRNQSPRPLVIGLWEAYQAGTISKRE (0)

CLQTLDESLYANLDVTTHA

LSWNVLLLAENGEAQTELRQEVLSALQSEASESYERYIDRDDTFLAACVLESARLRPIL (1)

PFSNPESAPEDLYVDGYLIPAN (0)

160249  TNVIVDAQAINIDNPFWVNGTQYNPRRFFSLNKSD (0)

VRHNMWRF  160428

GFGPRQCLG  160455

KHIGERMLKAIVAEIIRQYVVSISADSALEKNVLQEDSWVGLPATRIQCVPVGRE

VEKN*

 

>CYP613F1 Neosartorya fischeri

42% to CYP613C2

NFIA_074290

Note: this seq does not have an ortholog in A. fumigatus

MIKYMPGGMPLLLQLAVLSIVAFVGYAFRPNSWSNRVVSYVINKILLWWYPIYSIDGRSSIPTCPYRFPDGGGKIKFLEG

ETISRKWAKQYGPIYRIWVGLTPEIIVTRPEDIKTAFKDSGNHRKAPNLNGGWVMGELVGDGVGLISQADWKRVHAVVSP

PFAQRPITYVPLVQSRIDRHFAELSQRHSQDRRTMRLRPAEDLKLLPFWVISDLLYGELPQPMVEELLRITELRTDVFQY

AFKGGLSLFSISRWFSPALRNKLHFFHTRWAEFNRQAYHRAKASDAAAACAIVPLSTAVEEGRISRTELLHTLDEALFAN

IDVTIGSFSWIPPFLAAHADVQRELRDEIKQARSQATATPTQDAWVKYLASNTTLLASCINESARLKPVTNYTYAQSLPT

GREVGGYLIPVGTYVVVDTNALNLRDPGWGSDRGEFRPRRFLEKPRGEFRYRLWRFGFGPRQCIAQALADTVLKVLVAYM

VENYQVKVPEKPTGGESEERKRGDAWFKVAEQQILLEPL*

 

>CYP617D2 Neosartorya fischeri

95% to CYP617D2  Aspergillus fumigatus = ortholog

NFIA_081070

MTIKIPWPVVYLAIAASVYMRPQYTILDSPTATFVVLSLAVTSFRIIYALVLYPKFFTPIKHIPTPPKWSWLTGNTSSYL

IESPFEEMIEWAYKVPNNGLIRYYIVGNLERVLLTNPKALSELLVTQVYGFPKPQMVRQSLARVTGKHGVLLVEGDEHK (0)

KQRKNLMPAFSYRHIKN

LYPTFWSKSIEMVKLIEKDLHNRADAKDNIVRVSEWASRATLDIIGVAGMDHDFGSLHDSNNELTKHYRRLLAEPPLAMR

IIFVFGVLFGSVGVVQSLPLKRNREIRESSLYIRDVARQMIRKKEAKMKSQASAETGTDIISVALESGAFTEEELVDQMM

TFLAAGHETTSTALQWSVYALCKHPDVQTRLREEVRAHLPPISPEHPEPLSAATLDSLPYLNAFCNEVFRFHPSVPGTVR

DAAKDTTLLGYPIPKGTRILVSPEVINHSKALWGPDADQFNVERWLGPGRANTGGASSNYSFLTFLHGPRSCIGQGFAKA

ELACLVAAIVGRFQMELKDPDAKLEVRLSATVAPKDGVLARFTPLEGW*

 

>CYP617D3 Neosartorya fischeri NRRL 181

NZ_AAKE03000007, NFIA_062490

93% to 617D3 Aspergillus fumigatus = ortholog

54% to 617D1, 46% to 617A1

19kb from PKS 51% to chr 6 Nectria PKS

name changed from CYP617D5, revised seq 3/11/2009

MGPIRNYSGVLCLGIAAGVYFSPECAIYGSRIATIAVLITGITISK

87863 LLYQLFIYPQFVTPLKHFPAPP (0) 87798

87742 KRHWLTGNTGSLLVDTPHALMKEWAKTIPNDGILRYYIVGNMERLTITSPAVLSEILVSKAY 87557

87556 DFAKPLVIQQTLRRVLGNGILIAEGEEHK (0) 87470

87411 FQRKNLKPAFAYRHVKDLYPVFWSKGTEMARLIRKDLQSRKAPDDNTIQVRTWASRSSLDI 87229

87228 IGLAGMGRDFGSLQDPENSLSQSYEMIFATPGLGTKILFILGMLLGNTTWLAKLPTKQNK 87049

87048 LIDTGCRNIRDATRRMIREQKVKMEDPNAEAEVDIISVAMRSGNFDDDNLVDQLMTFLGA 86869

86868 GHETTAGALQWAIYALCKHPDVQARLRDEVRANLPPINVENPGLIDAATIDSLQYLNAVC 86689

86688 NEVIRFHPSVPNTVRVALKDTTLMGHPIPKGTQVVISPELVNHMPALWGLDAEQFNPDRW 86509

86508 MGPGKANTGGAASNYAFLSFLHGPRSCIGQVFAKAELACLLAAVVGSFEFE 86356

86355 LKYPDAPLEVREGATIAPKDGVLAKFTALEGW* 86257

 

>CYP623E1 Neosartorya fischeri

51% to CYP623B2, 46% to 623B4

NFIA_042090 revised

Note: this seq does not have an ortholog in A. fumigatus

MGASTFSQSFAGGYEAWASLMLPALVGCALLIYRAFFAIKYPANLPLAGEPEGKRTFSWRTRWRYYTDCEALYRETYEN (0)

YTKSGKTVLLPGLGFRNDIVLPQSA

MRDIMARPETELSHADAVLELVQLKYALGHEKYKADPWPCMLVKSDINSKLEAVCDGMNEELKYVFDKYIGCDTESWKEV

DLLETIRTVIMAAASRFTVGFPLCRNEAYLRACWKVNDGIVMNGGLTGATPRLLRPIVGPLITMKLRRSIEQVKKQVEPI

YHQRVQALSQQNSAEKPASEEPQDLFQQMLCYAQRERPGELHDLPSMSRRLCFANFAAVHQTTLLVTNMILNIVSSDSQY

NTISVLRDEVNDVIGPDSDTKWTKYKVAQMIKSDSVARETMRLYSNTNRGVFRKVLVEGVKTEDGIELPKGAYVSFLGRP

LQCDPEAFEDPFEYDPFRFSRIREQAPRDTKGRSSASHLSFVSTSPEHLPFGHGGHSCPGRFLVDFEVKMIVAYLLMNYD

IEFPAEYKGQRPANRWMAEALVPPSGARIRIKRRS*

 

>CYP630B9 Neosartorya fischeri

97% to CYP630B9  Aspergillus fumigatus = ortholog

NFIA_083610

MWSLFTIAPYACILGLLLFVYFIAYPFAEYIRDPKGLRRYPNFHPFSGMSAIPFMVLASRGFRSMELMKLHRKHPVLRTG

PNSLSYGDVRAIKDIYGHNTKCIKDPSYIVTAGTHYHLADVVDKPDHARKRKVLSSAYALKNLETWEYKVSDKLERLIAH

FDRVCTKPPSPAVAEGKAAPDPADLTVDFRAWTNYFTLDAIADIGLSEKLGFLDSGSDVCTAERKDGTTYEVHLREALYP

TARKQSLILWNYEWYPVLNKLVNIIPFFGRMQRSSDNWDNIVWRRASQRLRRYEAGEKLDDFFQALMEDKNGHPNNLEWG

EIVAEVNIMMNAGSVTTAIAIANVMYQLLKNPCCLVKLREEVDAVLDDDEIIAPYDKVKHLPYLRACLDESLRIFPPTSH

GLPRQTPPEGMEILGQWVPGNTSVSISALVAHRDESVFPQADRYIPERWLGEEGKALQPYFVAFSAGARSCIGRNISYLE

QTKAIASLVHRYEFALPHPGWELKRLETMNLILGDMPVKVWRRQRDMI*

 

>CYP630D4 Neosartorya fischeri

57% to CYP630D1

NFIA_005950

Note: this seq does not have an ortholog in A. fumigatus

MAFTLILMVALAYLCARPFIVYFYDAKGLRKYPNLNPLSGITSLAYVWEHSNNFRTRRLYLKHRKHPVIRVGPNVLSFAD

VRAIKDIYGHGTPCRKDDVYSLTVGSHAHILNTVDREDHNRKRRMLSHAFATRNLERWEFKIVDKIGKLITQLDRRCTAP

LSDRHHVNSEDLTLDFTLWSNLFTIDAIADLALSEQLNLLDSGTDVVKVDNIPSLKFIDSLHGGNYITSLFVGAANWFAV

LKALSRIVSPLFRAQWDHGRNYGRIVSALTGKRLEKHQRGGQLGDLFACLMEDNKGNARGLERGELEAEVNVLLDAGSDT

TAIALTHALYYLIKTPHALATLRKEVAGAFSEEPIARYASVKNLPYLKACLEESLRLSPPVSRGLERRTPPEGMRIMGEE

IPGDVGVSVPVYVAHRDPAIFPEPALYRPERWLESEENVKQMREAFVPFSTGARGCIGRNITMIEQQLVIATLVHRYDFA

LPSDHWSLQHNEAFLLWPGPMPLKIWRRDLGSATSMRNDL*

 

>CYP643D1 Neosartorya fischeri

43% to CYP643C1

NFIA_045690

Note: this seq has no ortholog in A. fumigatus

MLDRFVNDVNHAEAPMWLRVLLDKSLLLIFISCVGVYAITRVLVTFYRLYLHPLAAFKGPRAAAISRNWVYKVLTGPSLP

ETVFENLHTEYGVKAIRIGPNELHLTDVSLYKTIYNQTTPYLKEHGFYDGFLTPHTIFAETDPQLHKERRKMLNHMFSKM

GVRKLEPVIQKKILTLGKKIKAIASSGPINVYDAYRCMAIDIMMRFAFGNESDAINETPGTFKATFLTAFDAASHTLADT

QENPVKRFVAGKIPLSLVAKVDKNIRVIYKLQDTAYQGIRRYKKLTESPSHPVIFDNLKSLTDKAQAAQSIEILLIGSDT

SAFTLSMGSFHILSSPECKEKLVATLNEHIPNPDAMPSLVELEKIDYLWAVVKEVLRMAISVHGRLPRVVPKEAPPLLVD

GKVIPPGTVIGMSAYTMHTSIELWVRTSAHSVLNAGYPQMELGILTGSRSICVPSARAVAYAEVTMALAYFFRTFDMTLR

TTKPELRGHFTLGFANGMMIDFKKSLRLYARNGLLLDLSLREFWGEVLSCQMMMFTTI*

 

>CYP643E1 Neosartorya fischeri

52% TO CYP643C1

NFIA_058010 REVISED

NOTE: THIS SEQ DOES NOT HAVE AN ORTHOLOG IN A. FUMIGATUS

MALSGLVSAKLVIWNLT

KKQSLIILSALVAVVFIFRSLRKLYLAHLHPLAKFPGPAEAASSTAWMYGVLKSGSPENHYEKLHELY (1)

QTKALRIAPNELHITDVHQYKVIYGTSRPFPKLPSFYNSFHTPHTVFVEIDPTLHKERRR

MLSPLFSRTGVFRLEPIIHSKVKELLHRIDQMTGKKVVNLYDAFR HVTADIIMEFGFGRSPSIPDQKGLGAKSWLIHALE

GFGRNIWTMQERPIINRISGMIPLCIMQYFDNGFGPMARLMKYGETCLQEYEKGEYAKSHPIVFDSLPTLSYKLKVMEAV

ELLIAGSGTTASTLTSAMIHILKNKDIHARLVSALQKVQPNEEGNLALSDLERVDYLVACAKESLRFGLAVPGRLPRVVP

DGLEQPFVVDGKVVPPGTIVSISAYTMHYSEELWGADARTFNPDRWLDSRSKNLEQYLCTFSKGARMCLGHN (2)

LASAEVIIILAYLFKYYNMSLQPEFESPKTKDNFVLEYCSPGLPVTFETCFQDGCCKGKQGAIPQ*

 

>CYP646A2 Neosartorya fischeri NRRL 181

92% to CYP646A2 = ortholog

XM_001261718

NFIA_094420

MLLDINASTLSATGVLCMLLCLIVKLFETSPVPKNIPWVLSKKG

FFGRAAERFLGVNPIGFIQQGYEQYSKNQEPFVMPSVNEGDEVILPKEHTNAVLFAKE

SEYSFKAHISDFFQLKYTSWPLAFAERYEFFVKLVSKDLTDTLKSKAVAESLAEEARS

CLSDIWGEDTDNWVEVPLYSFMEKAAARMVNVLAIGPGRSHDTSLLNAMTNCSNAIVF

GANVIKAFPSFLHPIIGPIVGLANRWQERVFHARMKPIIEAKIKEQKEAYNSHSLQER

LRTNGSLLDLLIQAGLRSKWPVERETMWLAYRIFMINFPGVHTSGISATSALLDILSY

PTEEGFMDMLQAEIEQIAANSDGSWSAADLERASLLESAIKESLRFNGVNAVSPTRKV

VAPEGAILPNGVYLPYGTKIGIPQYAVHRDSDLYPNPDEYNPYRFYKENATPEERRQN

LMTNTSDTYLVFGHGRRQCPGRWLFAHIFKLLIAEMFLKYEIKPFATRPKIHRAGWGR

FQLPPLSVKLTVRRKKNTVAVYN*

 

>CY653A2 Neosartorya fischeri

95% to CYP653A2  Aspergillus fumigatus = ortholog

NFIA_039010

MADQVLELPCWPFALLLSSSLYFYHYPPGEASAEIPTVRFSRFLPDFINRLMFIFVAPYLIKYGYEKYRDQPYRVLKADG

DLLVLPPKYLPEIRHLPPSKLSGVDAQF ENILGKYTNVLIDSHLPVKTVHKGLTPA IGRVLPRLLDELQFAFQVEVPDCD

DRWVPVNLYDMILGLVTRATSRVIVGENICRNPQWLETVTSYTVNLGVTVILLRPFPYFMRPLVAKVLPSVKKLRTQLRF

VQKELFIPMILARREAEMKDPAYQKPDDFLQWMMDLAEDDFDKDPANISQMLLIVMALAVVHTSSMLMTHAIYDLVIRPE

YIEPLREEIRETLTDGWDKVTQASFASQRRLDSFMRESQRFNPTGELSTHRMVMEKMVLSDGLVLEKGTHICFPSKPMGM

DDSIIEDALSFRGFRWCEDPEARSTSLVSISPSNMHFGYGRQACPGRFFAANTNKAVLGRLIADYEFKFEDDNNNKRPRN

LTLGEQIMPNMHTKILLKKRDLV*

 

>CYP655A3  Neosartorya fischeri NRRL 181

          DS027697

          join(287915..288538,288596..289115,289183..289287,

          289332..289600)

          88% to CYP655A1

          adjacent to a PKS similar to FUSS polyketide synthase FusA

          FusA is used in Fusarin C biosynthesis

          NFIA_001540

          Note: this seq does not have an ortholog in A. fumigatus

MMSLATTLSKESLQTLLQHATFLDGIKFVFSAFVIYSCCIIAVD

WIVYEWKRKAHGCGKIPRYPHRDPFFGFDVVLGMAKALRNDYFLVWLNKVHENLPKTF

LVNFVGTRFIYTIEPENMKSMSAINWQDFAVGPMRRNNKATAPFADKGVNTVDGHEWE

FSRFLIKPFFKRETFTDTTRLAIHVDRIFGLLPADGETVNIQPLIQRWFLDVTTESLF

GESIESLVYPERAPICWAMVDVLRGLRLRLQWYKYIWLFRHQAWLDAVDVVHKYLNAH

IDRTYKELDEYKRQGKDPETADRKDLLWYIASNLQDKDALRSQLCLIFVPNNDTTSIF

ISHILWNLARHPEIYEKCRQEVLAVGDAELTFSVLRNMKYLIAILNETHRLFPNGVTQ

VRKCIRDTTLPVGGGPDGKQPIFVHRDIWGPDAEEFRPERWENLRPYWNFVPFGGGPR

RCPAQMLVTAEASYFLARLMRVYKRIEARDSNPYVGVMRVGPSNKTGVQIALFKD

 

>CYP655B3P Neosartorya fischeri

51% to CYP655B2

NFIA_045730, NFIA_045740 join

Note: this seq does not have an ortholog in A. fumigatus

MFTAPLSIAILSITLLYWVVRVYLNYLRYERTAAQFGCPPLKHYPGWDRILGLDYVYAMFKALKEDRFLEFQTETYSARG

SKVWTANFMGNRMVYSSEPENMKAMSTLQRDCFAVEPIRVANGAITPFTGRGVSSSD GAKWQSSRDLVKPYFKHEGFSNLERLSQHVDRLLSKIPTDGSTVDMQPLFQQ* (0)

FLDTSTDFLF*ETVNSLDNPERDWPHRDMVTVMRGLRLRLQLSSFLFLHRDKEWFATCKR

IHGFLDGYIDKAYKHLEYEKSGKPATYANGEP*DDFLWTIARQVPDKLELRTQLTSIW

IPSNETTSILMSNTLFALARHPEVVEKLRKEILDYGDKPLTFEGLRFMVYLRWTINE (1)

SHRLYPVSLQTVRSCVKNTTLPTGGGDDGKAPIFCAKGDIVHCNWYLMHRDPDLW &

GADAEQFRPDRWEKVRPMWNFVPFGGGPRICPAHIMVDTECSYTIFRILHHFKAIEARDSEPYTAIMRV &

SPSNKNGCRVAFIPA*

 

>CYP657B1 Neosartorya fischeri

94% to CYP657B1  Aspergillus fumigatus = ortholog

NFIA_017390 revised

MDDVREWIWPTLLAILLSSCLATRIITGLKSWPDKRTDAQLPRSVRVVPYWLPWLGHSIPFGWDHIDFVRRAR (2)

DYMNEAVFGIILGGSKHDVVVSPSLTKAILASRSTSSTALINYALEKVGGDQGAIRNLSATDHHIIHHNIPNLLMREPFLTE

ASKVAKDITERETPNLVTFCRSMVDQAPWERRSEAEVIDEQEKPMAEVNLFALVRNFVGHISTSVSMGQAFLEAFPDLLD

DMWTFDNRFPALSLGAPRWLPLPGLSAAYAARDRILDALAAYHQAFVSWDEGNDPGVKFRDLDDVSEPMKQRIRKFKELG

LSPRSSAPGHLSLFWALNANSPNAVFWNILRIYSDPALLEEIRKEIAPFAKVHRPSREETGLPFQEPAKVSLDPDELFRS

CPLLKASFYETMRLDSAGLSFREVTSDLTVTESPEDAAAASLAEPRTYRIKKGGNIIMAHGVVQRDPQLFSNPEQFDPLR

FVVTDPDTGAQKADMHTIYPFGGGVSGCKGRALAERMILLFSAAIISTWDIEPASGKAFIIPGHRPSSGAYLPKNDIRVR

LRMRV*

 

>CYP660B1 Neosartorya fischeri

94% to CYP660B1 Aspergillus fumigatus = ortholog

NFIA_048000

MDNLSLAVVTLILIAGSALILRIRHDPREPPVVHNGIPFIGHMIGFIRHGIDYYALQSAKHGLEAFTMDVLFTKIYVITT

PNLVIAARRHHRTMSFEPAITGAARRVTGLKGRGFELLSEKRSGGENLHGEVVNAMRPALEGAGLDGMNEKVIGYLLRSV

DDLPTAAPFDFHAWCRSALTVSSTDAVYGPLNPYRSKELQDAFWDFEENLALLLMDVVQKVTARKAWKARQRLVAAFLDY

YRAGGHLDSSQLTYARWETQQKGGATLEDIARLETAAALGTLSNTVPAMFWFMFDIFSRPELLEEVRDEVAQRAVQVDAQ

GVHTVDLAEIKEKCPLLMSAFQETLRLRSNTVPIRIIFEDTILDDRYLLKKGGILQMPAHAVNRDRKIWGSDADEYDPRR

FVKINQSDSRKKANGFLSFGTSPHVCPGRHFATGEILALIAMLVLRYDIVPLGGVWKEPRTNKSAVTSSTRPPAEEFKVI

ATARKEYEGVEWAFRVTEGKGKYGLIIG*

 

>CYP661B1 Neosartorya fischeri

98% to CYP661B1 Aspergillus fumigatus = ortholog

NFIA_039460

MILYYLASIPLTIILYLAWYLHVPWDLPSLPRIPFYVSILGLWSSMGQDEIYERWLRKPLEAHGAVLIWFAGRWSILVTR

PDLLTDMFRNEDLYAKAGSQKKIPWSVIATLVGDNIINSHGDTWKLYTGIMKPGLQKKNFDTAPLLLKSRRFVDEILAEQ

DSAGRGTGILVNTYVQQWAVDVMGTSFLDLDLQSLEKPHGAVRLEAIQSVIKLMLFRPLFFNFPDLDQFAWLIKSRQRAY

EIMHEFGDTLMATVLGRIDSDREKGIKPAEEMVVHMLVDAYRDGRLTEKQFKDNLKIVFLTAHENAQQLVNSVFWEIGKN

TEVQTRLRAEILSTNTTTPTSEVVNALPYLTAVVYELLRLYPPVSQLINRVTVRPAMLGNEIPIPAGTFVGWNAYGVHVN

PAIWGPDANEFKPERWGRTVGEMHARFRRETVRGTYIPFNAHSRKCLGQGFVLLQMKILLFEVLRRIEWTVDPGYQLKMT

PGGILAPLGCRVILSEVKEADKAEQRG*

 

>CYP662A2 Neosartorya fischeri NRRL 181

89% to CYP662A1 Aspergillus nidulans

NZ_AAKE03000038.1, NFIA_044230

Note: this seq does not have an ortholog in A. fumigatus

MLALLLVLVALASYFLVRLRQQRSMFK

NLPGPPHHAIWGHFLVMREIASTLPPDATPQLFAHLMRQRYGLGDFFYLDLWPLAPPQLV

IAHPELATQIVHKMNLPKESAVMQKWTGPILGEKSMVSANGHDWFIARKSFTPGFQPRKL

LQHVPNIVDEALAFADVLREHALKDDIFKMEDLGARMIFNISAWVIL (2)

GIKCNAQRGDDEFLELFRKQAALAPQDFWSRYLYDVSPRRHYQKWSNGR

ALDRYVGRLVDKRVVSGPTAVPSEKARYYAIDDAIATSRTLNKSIPPTTALDKYTRD

116369  MLIASVKTLIFAGHDTSASTLC (0)

116479  YTYAALSKHPQVLHTLREEHTTLFGTDPSAAANLLRNDPSLVNNLPYTLAVIKEALRLWP  116658

116659  PTGVSLRRGQPDQTLLADGKEWPTYPFAVLVNNCATMRREDLFKDAERFYPERHLVTDPS  116838

116839  DPYFVPAKAWRPFEKGPRMCLGQTLALMQLKIALVMTVRTFDFEIVYKDGTFMYQVLDVT  117018

117019  AKPSLGLPTRVRLTE*  117066

 

>CYP666B1 Neosartorya fischeri

93% to CYP666B1 Aspergillus fumigatus = ortholog

NFIA_114140

MIWSSVLLGLAGLYAFDYFRRLFKNIRLAQRTGLPYTVLPFAGNSLQVKILLSIRWLPYIINHWLPDWLADIINDDTYDY

RWTVKDRRVKKLGKMYMVVTAENIVCHIADAHLVTQICNARQSFPKPIWQYGFLNLYGPNLLTCEDQGWAHHRRHTAPTF

NEKNSALVWEESIRQMTEMLHHWQIAGTSEKLHGFVVASTRGDLLKFSLNVLSGAGFGVKLPFKQLPQESSNDPNDVFKD

TAKPPEGFSFSFRSAVAYMNLRIMTVVLATMVIPKWIPRALIPWLKSDFEAHRDLEAYLRKLISIGKAEKTADSSQNLIQ

GLLLSRNKVAANGSSKGTGLTDLEIIGNMHIFTIAGHETTATSLRFTLLLLALHPDVQDWLYEGILEAAHGEPEDVAQWD

YHRMLPKLITPLCVMLEVLRLYPPVVTVPKSTSKTPSPLNYQGKQYLLPPRVNVNLNANCLHYSEQYWGPDVATFYPQRW

DARNQNSFLAKNAGAFIPFSDGFRACLGKKFAQVEFIAALSALSRDYKVELADDSPEGRKDAERVLRESTSVLTLSMRED

VPLRFRRRKD*

 

>CYP672A2 Neosartorya fischeri

94% to CYP672A2 Aspergillus fumigatus = ortholog

NFIA_102170

MVLVAMSLPSGPFPELAYPVVPFPILAVLLVPCLVLLAIRLAPKGPVIKGVPGSFVDLYLCG (0)

IGTKLAFISGRSAYHFHS

LHLSYGNTVRFAPGQATTNTVKALRQIYSTGTGKGAAFLKTGFYRNISRRNVFTAADPVYHASVRKLFGPSFTPGSMHVH

AGVIRECILRLHEVIRGKLETQNTISLNELLYCHSVDTVSEVLLGKPLGCLKRGKPYFWTEQLPRIFYWATIRDQFEGSG

IPTAIKWLLRRFLRKGIRLRAEQARMRLINEQLRASHTRRDIMVEVMERSGGSDLPEDEVAENFSAIMLAGFHTTQNALC

AVIYLVLTHPEAHVKLVQELQAAFASADDISGDVAAQLPYLNAVITEALRLYPPVPLGGPRVSPGAYVDGVYIPAGTEIC

TSLFALHHNPEYFSCPYEFIPERWTEPGSTDRKEAVQPFLVGSRACIAKYFAKQMLQLTLAGFFLEFEAEYVGKVKDWQR

QSRCYAFWEVPDLKVKLRKRLVN*

 

>CYP678A3 Neosartorya fischeri

58% to CYP678A2 Aspergillus clavatus

NFIA_045580

Note: this seq has no ortholog in A. fumigatus

MATMNFAPSSPLQLDAGVILQSLPIVAALIILFCILKLGHNFFRSPLKHIPGSRLSAFCGWDEFYSNIVLNGQWCKTYPE

LHRKYDSPIVRVGPNHVHVNDIDIYEKIFRMGTDFCKDHTFYTCANNDGSIFSITDRAKHRERRKVLSPRFSKQAAEAGA

PGVLRRLQQLVDYMTDQTRMGNTCDATDLFRALMINVVGEILFGDCGDLVEYGPSKPALLDSVDNLSSLIPWLRFFPYLG

TVASMFSTSISERLEPAGVYNFKQKCKEHTLPRMDQPISDAMDRSHASLIELLIAHSHQVQGKAPTLQYLTEETFTFIDA

GVDTSGRTIAAAYYIVRNPGVQQKLRAELDESSVTDQAGKHVDVKLLGTLPYLNAVIKEAHRMWPALPGPLPRIVPAEGL

TVGKHYVPAGSVISASHYMLHFNETIFPQPHEFRPERWLEGHSSEQDRYLNPYSRGSRACIGINLAQLQLQVTLGHLFSH

YQIQLCEPIPQSLDWHDHFVATPRSNVIIKILPRDQGY*

 

>CYP682C2 Neosartorya fischeri

97% to CYP682C2  Aspergillus fumigatus = ortholog

NFIA_040740

MELLRLLLSHPVSSAVALGAVYLLWVVLDRLYLSPIARFPGPKLAALTHLYEFYWDTICCGQFTFQIGRLHEKYGPIVRI

SPTELHINDPDYYEVLYSRDSPRNKYEYYQKTLNAPLALLNTIDHQLHRQLRAQLNPFFSSARIRRQEPAIKALVNKLCR

RLEELKNTGQPLNIEHALTCYTTDVITDYSMGDGYHYLDAPDFIPQWHGTLNGTAKTMVFIRPVAWALPLLLSLPEGVTA

WLNPGMELFFDFQRRCRKMIKRIVAAHYEKGDQGVQNGGFVNIFDDILRSDLPAKNKSETRLAQEMQVLVSAGAETTAKA

ITYILFYLLNDPETMAKLKAELETVGEDPALIQLEQLPYLTGVMLEGIRLSYGVSARLPRIAPYNALKFRDWTIPPGTPV

SMSCLLMHHNETVFPDSHRFKPERWLDPAERKRLEKYMVAFSKGSRQCIGMHLAKAEILLSVSTLLRRMDLELYETTVED

VAIKHEIFIPFPRMDSKGVRVLIKG*

 

>CYP685A2 Neosartorya fischeri

85% to CYP685A1 Aspergillus nidulans

NFIA_001570

By comparison to 685A1 with no intron at PSSK/LRYG a gc boundary is predicted

Note: this seq does not have an ortholog in A. fumigatus

MGFVDTLTQASDLDKQRLRTSPQVLKLFALILFAVLVLKIRARHRADRITNQHGRKICELPGDARVSKFAFSQQLSDQGK

ALAGGKPFIIRNGRARELVVTKPEHIYDFYKGDTK (1)

RPADHPKPPYLNMGKYFSG (2)

ILGHAVGAIAGERWSMIRRYFDPEFSFQS

ARQAIPQLTASINRWLDDLPLQGAGTEKEFALEIKKPCRFSPLRLAAEFVYGEVFDDERFSALLELNVLHEVILHDVIAN

KRLATRLGCWLDHKAAKRMEEFRAKWREFNLRIIQSAREASQVCPAERIYRGVEEGDLKLEEFLHTLDEILFANVDVSSA

VLNTLFEHLAANAAFQQKLRGEVEAHIQSRTHTPDTDTETDTNTHTGKYLSKQDTLLNYAVMEAMRLSPAF (1)

AFSLPECTAVPKEIGGYRVPARCPVVIDAKRLNADPATWGKDGDTYRPERFRDIPSSK (1)

LRYGFMRFGVGAASGRCLGKHLADTVFKLTLMAVLERYSLHSGQDGPEIELRYMNQKE*

 

>CYP5042A5P Neosartorya fischeri

59% to CYP5042A3

NFIA_005930

Note: this seq does not have an ortholog in A. fumigatus

LTKYGEMTTVHLGSKTWI &

NSQRAVSEIFAKRGSITNGRSPVPVASGIVSRHGRSFIL ()

AMAALLFCYPEVFQKARAEVDRLCGTDKKKLRLPV

LDDMDQMPYTCAIIKELLRWRPIFPSTPDHVLTSNLEFEGYHIPAGVWFVVNEIPGCYESE &

NPDVFKPEWWLDGHEADNVHGP*QFGGGRRICVGYRWAQRGPFGSLALRVFYYDYAA ()

SGPIDSRRLNHHFTQ &

EPFPVKVTPRSKQHAQLIIEEASREGILEES

 

>CYP5047A2 Neosartorya fischeri

AAKE02000009.1 NFIA_047320

Note: this seq does not have an ortholog in A. fumigatus

49868  MSLLSTLLQVPGGAPAVSPILLLTGVL

49948  LVAGIWRLLQIGKRDPRMPKGPPTVPILGNFHQIPSTGLFAR  (2)50073

50146  FGEWAKEYGPVFSLKFGPTNIIVLCDRKAVHELLDKRGAIYSDRPPSYVGRLLTQGDHIALE  50329

50330  QMDPVWREKRKVISHNFSPKNLDEKHFLVQEAE  (2) 50428

50485  GLILLNDLLRDTEGFYNHVRRYTASVASALAFGHRGPTFESFWGH (0)  50613

50687  AVYDVMDRWTEAMEAGANPPVDEYPILRLIPKRFAYWKRRAVAAGTVFDTTWGKARQIVDE  50869

50870  RRARGDKRDCIIDRLLDEYNQKGWPMSQHAFNNLVGEVVEGAADTTAAQILTLILAFA  51043

51044  MHPHVQEAARREIDAICPPDKPPKWSDFQQLPYINMIVKEGMRWRPV  (2)51184

51261  AVTALPHRVRQ (1)  51293

51364  DDWYEGMLIPKDSTVFIATWAIHHNEQIYKDHDVFDPDRYKDHPKLANDYAGSPDW SNRD   51543

51544  KYNPSPLCLKTSSPV

       SLHHYGYGAGRRLCPGVHFAERNMWRIAAKLLWAYEFAEPIDPRT  51723

51724  GKTIPLDPNSYNDGILHAPLPYKVRITPRSKQHEETIKKGLQEALDFLSKWN*  51882

 

>CYP5059A3 Neosartorya fischeri NRRL 181

AAKE02006477.1 55% to fgenesh1_pg.scaffold_6000721

AAKE02001791.1 Neosartorya fischeri NRRL 181 65% to fgenesh1_pg.scaffold_6000721

about 60% to CYP5059A1 Middle region not in database

627   MFPLIILMLGAVAWRMYTSIKHLSTIPKEVPWVGRTGTFSTYLSSQIQAIRNTPSAINEAYNK (0) 815

862   YNKNGAICAIPLPFSRPEILVPRSFVRWMLSQGDAILSPLPVQNEIVGPKYVFLNPSVHG  1041

1042  DYAVYNVLRAKLNRQLPMLIPAIMEELAARVDQFWGMDTDWREVQSHPLVRNVVGRVSGR  1221

1222  IILGSPL (1)

 

2     ALKETLRLRTSIKALAMQVTAPSGITLDGGKLRLPQGSRLSVSSWGIHHDEEIYPSASTF  181

182   DAFRFSRPREGGETADANAATNGNDNKHLMVSASETYLPFGMGRHSCPGRYFAAIELKLL  361

362   LAYLAVNYDIKLAGERPAFVSIGHFPIPPLNGKLMIRRKRGTAVGMDDPTGV* 520

 

>CYP5061B2 Neosartorya fischeri NRRL 181

AAKE02000017.1, NFIA_053810

70% to CYP5061B1

Supercontig 582: 2020434-2022262 (-) strand

530186  MALISELLQSPYFLQGIAVSLLLVVVSNFYRKLVDGFPYRNIPLVGRSRWEITNSKAKER  530007

530006  FVASAKALFAQGFSQ (0)

        GKTVFQMMFSHSPMIVLHPRYMDEIKSHPHLTFDEANRK  (0?) 529794

529750  AFFGAKLPGFEPFGLDKEGIALDVINKKLTHTL (1)

        GSLTISLSRESAAVLKETLPPKSD (1)

        EWQSLVFAQEIPYIVARLSSLVFMGEK  529394

529393  VCRDKEWLHVSVNYTIDAFGAARDLRLWPSITQSLVHWFLPSTRRVRKHISVAKKIVQKE  529214

529213  IEKRELIRQGKLLEYSPLKPDDALDWFREVAAGRPYDMTKSQISLSLAAIHTTSNLLTN  529037

529036  VMYDLIAYQEYIQPLRDEIVAVVKEEGCLKKTSLTKLKLMDSFMKETQRLNPVSI (1) 528872

528819  ASLQRYALADITLSDGTFIPKGAMLVISAHTMNDESIYPHADTFDGYRFYNKRKVPGNEH  528640

528639  RYQFVTTSNEHFAFGHGLHACPGRFFAANEVKILLIHLLMKYDWKFAEDRGRPQSLMH  528466

528465  GTEIICDPNVKLLYKARTPEIDLSKLGELPTDSPSV* 528355

 

>CYP5063A2 Neosartorya fischeri

93% to CYP5063A2 Aspergillus fumigatus = ortholog

NFIA_014190

MAATSVVVVIVIGLLTVLYISRKNGKKADKLLKLPLIGDLHSSPIEKPLANWASWAKQNG

PIAVPKLFGIIPIVVLNSYEAATELFSRRSQWYSNRPPSVSMEMITGAPPGQSRFTLMHD

YDDHLKLHHRILSPSLGALAAPKYQPLMELEAKQLLHDLVNALQHCPDGTTISTDAIYPL

LERTQSSVILALHYGLRIPHPDEHILHEVIDIQVQVTHLAANPALPDLIPPLRHLPAILS

PWKRAADRLYAAQVDLYMRLFHHGRDAAGWNATKQALSTAAKYAPASSPSSQVPVPVPVP

DLDLAFTLATSIQGGMETSPRQLLWLFIAALHQPSFVARAHALLDEVVGRDRLPRFSDRA

RLAFIDAVAHELFRWRPIAPGSIPRRADRDDEFQGVKINKGVTIMANAWGIGRDEQVFDP

ALGDLQEFVPQRWLREGEAGEERLRSDLPLPVFGQGRRICQGRRVAIDGTFMQVASLLWA

FDVEMVDGAGPVDPWEMVVVGFMTMPRERRFKLKPRGDWVLDVIKREWETAEKSLDKVMGTNDVE*

 

>CYP5066A1 Neosartorya fischeri NRRL 181

AAKE02000012.1 ctg_1099437635460, whole genome

89% to CYP5066A1 = ortholog, no introns in CYP64 clan

Note: CYP5066A1 and CYP5067A1 are close in Aspergillus fumigatus

and Neosartorya fischeri, separated by a phytanoyl-CoA dioxygenase

they are probably working in a pathway.

NFIA_093730

28112  MERLPLSPAVLFLTITLPILYFWILHTSPARHHGKQLPLPPGPPRLPKIGNLHQVPRQIP  27933

27932  WKKYKEWSDTYGPIMSVQLANTIAVVFSSWDLIKTHVERRNTIYSSRPSVPFFLHATGGL  27753

27752  NASILPYGPEWKLQRAIRSSVLKPSMTIKYRDVQSMETTQLLHELLSTNDFSVCLRRCIA  27573

27572  SVFLTVAYGERCADHAGLEAIDRLEELNRAIALHAEALFSGAAGILAQLVLPQALVDRLP  27393

27392  VRWKKDADILHNRLTADLVARTRAALARPGWNWVKAFAIKEGTGSGEGDGEQGREVGLKR  27213

27212  LAYMVGSLYEASMAASQALRVIILAGILYPDATRRMHDELDAVVGKDRLPDFNDAAQLPY  27033

27032  TQAFIKEAMRWRSLTPMGSPRATSDEDECRGYHIPRGATVLVNVWAINHDEGVFLDPFTF  26853

26852  KPERWIENPDLPQLLYGMGQRACPGRHMGQDSLFLGTARLFWAFDMALPDGAEAIDQERF  26673

26672  LDSGTTLAAFLPDFEVRFTPRSEKHREVIENSVVVSSDVSSVTVAT*  26532

 

>CYP5067A1 Neosartorya fischeri NRRL 181

AAKE02000012.1 ctg_1099437635460, whole genome

92% to CYP5067A1 = ortholog

Note: CYP5066A2 and CYP5067A2 are close in Aspergillus fumigatus

and Neosartorya fischeri, separated by a phytanoyl-CoA dioxygenase

they are probably working in a pathway.

NFIA_093750 revised

33060  METFDAIQLPYPGVVGASLLVILGIILLFPLDTGHFISINQHPWDFFQTKAKQEFEYNAA  32881

32880  ALLNEGLQT (0)

32788  GRSAFRLVTNMVTYLILKDQYAEEIKNDSRFGAHEAVDP (0)

       VLLVDLPGLETMFQGSLHNQVPPMAVRALNKEL  (1) 32512

       VHLTPFLSEEAMNCLQTRWTDSAGTC (0)

       TEWHDVSIPETVLALIAQMTTRALLGPALCRNPEWLDIAKSFTTNRAIAV  32193

32192  AAVQSWPSFLQPVIHWFLSPCRALRRQIQCARNILLPVLERERRSYRSDQPTKREFSNLA  32013

32012  FIDQYAKGARYDATMAQLRIIAVAFQTTSDLVEKVIARLCKHPELIQPLREEVVSVVGKN  31833

31832  GLHSHSLRKLTLMESVMKETQRLEPAVI (1)

       IGMFRLAKE  31653

31652  KVTLKDGTVIPKGTNIAFANDLRFDPEMYPEPETFDGYRFQRMREDPEKIDLTPFTKTRM  31473

31472  SHLAFGHGKHACPGRFLACDEAKLILCHILLKYEIRAVEGSPPEL  (1) 31338

31314  AGSWGNDVGEKAAGE*  31267

 

>CYP5068A1 Neosartorya fischeri

92% to CYP5068A1 Aspergillus fumigatus = ortholog

NFIA_094170

MESVAPTLLAIVLVCCCFHLLRPRTSRLPLPPGPTLLSGPFPEKDIATTFQKWNQRYGPVISFKIGTRTFVVLGTRQAAQ

DLLEKRGSIYSSRPPSVWMEKYLNKGLAAAFMPYGPEWRLNRRLHGSLLSAHHTDAYRHLQDIQSKQLLHEFLSTNDFSH

CFHQYTSNVMFTLVYGKGRGRDDNDHRRLEQINEMAGFVLQGASFWTFLMDLFPILDYVPRIFWKWRTEAARLHDKTMIV

YRECCEEALTAECWNWSKEVTQKPDIMQLPWDNACYSLGELYVAGIHTTKMVLELSVMVSILYPDVVRKAQQELDSVVGV

DRLPSFDDMERLPYIDAIISELLRWRPISPIAVPHAVIQDDEYMGYFIPKGATVIANQFGMNMDDAFFYDPSRFHPERYV

ENPDLPVSAFGFGRRACPGHRLARSSLFIVISRLLWSFDITSADKEPLTEESSPAAVKATFRVRSPHRQRIIEKDWTLAE

KDERVVLSQIESRIHGK*

 

>CYP5069A1 Neosartorya fischeri

98% to CYP5069A1 Aspergillus fumigatus = ortholog

NFIA_030840

MDYFKAVDLPLYFKAADLPLPPHFVSALGRPTVLVGFACVFLFSQLLVWTVKYSRKKSKGLADIPGPSGWPIIGIGLDLP

ARPRKLLNSWATQFGDTFKVRVGWYNWVFFNHPDAVKEVFDRQAAVTSGKPPLPIAQEYCLRGDGVLPMTYNAKWKRLHA

FLKQLLNAKASAAFIPSQEFEIKQLLWDLSHEAGKNSTDFYMHIRRMTFSIVMTSAYGLRIPQWDCQEVRDVYGNMRMLS

IILSPGVFWID VFPPLNWLPRFLFPSWPKAKFMAQKMHANK MRHWNNLKERIALGNAPDCFAKDLMESNYRDHGLEEETV

SWLASAVPEAGAETTASALNGMIRYLAMFPEAQARAHEEVTRILGDGRMATLADEPQMPYIKAVIKETLRLCPVATTGLR

RMADGDVKYRDHVIPKGTILLANLNALHWDPERFPDPFSFKPERYLNHPHRSAVYAAGGDIMARDHFTFGAGRRICPGIH

LAENGLFLAVSNLIWAYEFKLPLDEKGNEITLDISDEGFMEGAIRVPKQYTVRILERNPARSHLIQESWEQAQKDGYVLR

GAHVDADGGVRGSAKVKA*

 

>CYP5074A1 Neosartorya fischeri

93% to CYP5074A1 Aspergillus fumigatus = ortholog

NFIA_100510

MPLGSNWARGLAIILFLGPLTLLLVSSYLFPSTLTVINSGRAWDVFRTTAKKRFRSDAARLLQNGFEKSPDAFRILTDNG

PLLVLSPRYAREVRSDDRLSLDHFIASEFHPDIPGFEPFKLILDPRNPLNTILKTSLTQALAYMTEDLSVEVADALSTTL

TDDSEWHEISPCQTALKLVAQMASKAFIGQEKCRDPKWHNIIITYTHNVYLAAQALHFWPKFLRPIVARFLPACQTLQAQ

IAEAREILEPLVAQRRADRASRAAQDKPVPSRADVIDWLENSYGDQPYDAVAAQLLLSFAAIHGTSNLLAQALMDLCTDP

DLIRDIRAEIISVLGDEGLTRVALYRLKLMDSALKESQRLAPNRLLSMGRIAQSDMHLSDGLRIPRGTTLMVSAHTMWEP

EIYPDPRRYDGYRFYKLRQASGQEGQHQLVSATEKHMGFGYGKHACPGRFFAAAEIKAALCHILLKYDLEHRDGQPPRVW

SQGIHLFPDPTARIHVRRRKEEISL*

 

>CYP5076C2 Neosartorya fischeri

92% to 5076C2 Aspergillus fumigatus = ortholog

NFIA_093700

MPSVMKCGYLATAGLIGICIHLWYFRYGEHHLYPWRYVRFHLCLTMGVSALLYAKKPPQYTLSPGDLVKDTCLLMVTYLI

GLFTSLLLYRTLFHPLRQIRGPWAAKVSSFWLSFRLRRGPSFRILHELHEEYGPVVRVGPSEVSIIHPEAIGIIYGPNSR

CSKNAFYDNGHPMMSLHSYRDRTAHDQRRRVWSAGFGDRALRGYEQRMRVYRQKLFQRLEERADAESTINISQWFNFYSY

DTMGDLAFARSFDMLDASRNHWAVDMLMHGMIGYRYLFPSWFFRLLATMPSLSNDWHKFIGFATDTMLRRLREQVGVPDI

FASLLAPLNGRDPTDDERNMLMGDAMLIITAGSDTTATSLTSIVYELARRPDEVDKLRAEIEPIEADSDGEYQHDTLAKL

PHLNGFINEAFRLHSPIPGVIPRKTPPEGIHVKDIFIPGNMTVFSPQWSMGRSEAAYVDPAIFNPERWYKHIDLVKEKSV

FAPFSIGPYSCIGKPLAMMNIRTTVARLIMRFDVRFPEGEDGIRWMDAADEHFAMGIHQMPVVLTRRH*

 

>CYP5076D1 Neosartorya fischeri

93% to CYP5076D1  Aspergillus fumigatus = ortholog

NFIA_106550 MDPYVLIAIAGVLSHVVYFRRGEHQLYSHIYLVLFVISTAVVTVLFHYSYILVYLASLYTSILVYRLLLHPLRSFPGPLA

ARVSGLWYINPKHNAYLTLQALHSQYGPIVRTGPSDLSIIYPSAAPAIYGSQSPCTKGPWYDLSYPSRPLQHCRNAKEHH

ARRRTWTPAFSDKMVRGYEQRIKTYQQQLIAQLTTLQTVDIRKWIYLYTFDVMGDLSFGRSFDCLTTGHEHPGITLLNAA

LSNIGLFIPPWLHLILLKIPWLTRDWWAFLSFCSERLQARMRMHLQIPDISASLLAPLKGREPTPEEKLMLDGDARLIVV

GGSDTTAVSLCGVLYELARHPEQLRKLREEVEPFVDDAGDVRGADIALLEHLNGVINEALRMYPAVSSGLQRKTPPEGIQ

VEGVHIPGEMTVYCPQYAMGRSELCYARPDEFIPERWYKYPDLIKDRSAFAPFSLGPYSCVGRPLALLNMRTTIAKLITT

FDMGFAPGEDGKAFKQQAQDNFVLYMGPLHLTFTRRK*

 

>CYP5078A4  Neosartorya fischeri NRRL 181

           DS027697, NFIA_005630

           complement(join(1475691..1476929,1476977..1477279))

           93% to CYP5078A4 = ortholog, 75% to 5078A1

           note name changed from CYP5078A6

MEVSILSSFKAYAAYVVIAVVVLRLITNRFRRSLAGIPGPAIAK

WTRLWKLHSVWKGDHHTTAIDLHRKYGPLVRIGPKHVSVGDPSAIPIIYGLNKGFTKT

GFYPIQCISWNKKPQMNLFSTRDEMFHREQKRPVANAYSMTSLLELESAVDSCTEIFI

NQLARFANSKKSVDLGMWLQYYAFDVVGEFTFAKKLGFLQEGKDVDGMIEAIQGMLVY

ASVCGQIPEAHPLLLGNPLFPIFMPSMETWNQVLNFTLKAINSRASLQRDGELDAEKP

EAGKDMLSRWMAIHVSDPEKLTTRDVIVHLSTNVFAGSDTTAIALRAVFYLLLRNPSV

LAKLNAEIDNADREGKLSHPISYRESMNHLPYLQAVLKEAMRLHPSVGLILEREVPKG

GVTICDRHFPDGTIVGINAWVLHRDARVFPDPDKFIPERWIDSDPQHLKKMEQSFFAF

GAGSRTCIGKNISLIEMHKIIPQLLREFEIRLHSPEKEWKTKNVWFVQQEGLVCDLVR

RRDVK

 

>CYP5080B3 Neosartorya fischeri

95% to CYP5080B3  Aspergillus fumigatus = ortholog

NFIA_079750

MYLIIIPIVILLYPFLCTLSTTLHTLSLRRIPGPFLTRLTKLWYFHRVRAGHFETDNIALHRRYGPVVRIAPDHYSISGR

AAIKTVSGTGSKFTKSAWYEGWKHPDPNQWTLFPDRNIKRHAETRKRFSSLYS MTSLVHYEAFVDRCADLFCMRLREFAA

RGEEFNLGHWFQCYAFDVIGDITYGQRFGFLDRGEDIEGTIAALQRLMMYSTLVGIYPEWHPRLFGPLSRFSWSGAAGRA

YIVRFVKEKIRGLSVKVDLGQAERGPLETQNFVEKMMLARDKDPEKVTDYHVFMMGLSNVIAGSDTTAISLSAIMYNLLR

YPAVMEKLRREIDEFTAEGKCSDRVTFRESQEMPYFQAVIKEALRMHSATGLPLWRVVPDGGAEINGYFFPAGTVVGINT

WVAHYDEEVFPDATTFRPERWIEAESNPEKLKAMNEMYMP FGLGTRTCLGKHISILEMSKLIPRIVRDFDFSARSENWDT

ENRWFVKPTNFTVRVKQRPVAR*

 

>CYP5081A1 Neosartorya fischeri

97% to CYP5081A1  Aspergillus fumigatus = ortholog

NFIA_101370

MIRVAELQPFLNAISVLQVLAAIFIGALTYRLIDAYFLSPLCSIPGPLLARLTTKRANVDTFSGKVTQTVDKDVARYGDV

YVYKPRAVCINHPDDIRAVLGSQEFRKAAFFDIFNDGNTPNIVSLREPELANRRRRQLGPFFNYAYLGRAEPLILQHGYQ

AIRTKWDALIGANSGRPTEVNYRTDTQLVTFDIMSALAFGRNFNAISRGSSSIMKWAGLIMEMLESPVVLALLSLLPFSL

IMRPWKIMYRELAAFSSDAVDMRKQLLADDSTEKPLDMLQAFIDAEDPESKVKMSPHEVQAESIMMMLAGSETTSSAIMW

TFHLLLLYPETLRRAVHEVRSTFSLSHLVTHKDVRSSLPYVEACVYEALRHSPTTAGLTPRISHSTGITLQGHYIPPGTE

IYVNLRSPSMHPSLWDDPARFNPDRFLDSENNKRLLFTFSYGPRNCLGRNLAWVEMLTIVANVLKDYDIALTEDSRFGPH

CTDENGLPVLMPAKCFIASFPAKPERDCRMVITRRIE*

 

>CYP5081B1 Neosartorya fischeri

95% to CYP5081B1 Aspergillus fumigatus = ortholog

NFIA_101380

MALPIILCLVVILWTSWRLLDALFLSPLHRVPGPVLARFTPLRAIYARLPSRVIPAALADFHTYGDIYLSKPRTITISHP

RDVRAILASSEFQKIDVYHGLNDPVMANIVTFSDPKLASRRRRQIGPYFNPSYLAKMEELILRSGCRAVADKWDRLIAQQ

GHGPEKAVKVNYRHDLQLATFDIMSALAFGRRLDSLKEEGESVAIVEWIMATAVYIGVRINFRLLMVFPFSRLVRRWTRA

YSEFVQFGKHAVASRKELLAQGCQKPVDLLQAFIDAEDPDSKVKMTAVEVQAESVGMQLAGSETTAASLTWVVHLFTLYP

EYYRMAVDEVRGQFGPDHLITYADCNRLVFLEAFVYEMLRYTPITSSFMPRVSFSNGTTLQGHYIPPGTEIAFNLIAMNN

REDVWEEPERFLPDRFLKDPDLKRSIFAFSYGTRSCIGRHLAWMEMMTVLANLLKDYDWSLPEGSLYGPHHVDEQGNPIR

MPSKCHIVFAPTHPDRDCQLVISRPKT*

 

>CYP5081C1 Neosartorya fischeri

95% to CYP5081C1 Aspergillus fumigatus = ortholog

NFIA_101420

MIEILRFIPLVLLLSLTWRITYELFFSPLRHIPGSRLARLSSKYSILKRVLSDGPRSVQADYQRYGNIYVHRPNGVSISH

PDDIRTVLLSPEFRKTKVYEMLDIEGHASIFTTRDPAQASRRRRQIGPYLNHGYLGRMEGLIMKYSVLAIKSKWDRLLEE

SGRQQVTVNYRDHTQYATFDTIGALAFGREFNALKNDDQTVIRWIEATGLYLGIRKNFPLLKVWPFSRVLRQYRERYERF

IAYSKESVTRRKNLLSSAGEGPMDLLQAFIDAEDPENPRVKMTADEVMTESIAMQLAGSESTSFVTSWVIHLLTLYPQHL

AKVTEEVRSQFSPSHLITFAECRDNLPYLEACVYETLRYSPITSGFLPRVSYTKGLTIQGHYIPPGVEVAINLHGAHINK

DVWTNPHLYDPTRFLGDEQAKRNVFAFSYGHRNCIGRNLAMMEIMIIIANLLKEYDIALPEDSVHGPWNVDALGRPRIMP

TRSALFTTPKYPERDCRLVVSHRQ*

 

>CYP5081D1 Neosartorya fischeri

95% to CYP5081D1  Aspergillus fumigatus = ortholog

NFIA_101400

MAAASLISILFAVLALRLCYLLIHALFLSPLRHIPAPFMARVTSKRPLWHLLTGKAETAARQDYSTFGDIYLCKPNTVYL

CDPHDACTVLSSHAFRKTDMYRVFEYEGIPNVSTFTDPAEAQRRRRQLHPFFNNAYLTQMEPVMLQYGVQALKARWDAQL

AKHKKVEVNYRYDTQLAMFDITGALVFGREFHALQTSNLVYTKWVNNTLSYMLVSHYFPWVKRVPLSWLVRGLKQSYDDL

VAFSQESIAIRQADLRAGRPKPADLLQALLDAEDPDSKAPMTAREVQAESIAMLVGGSESTSSVISWVIHFLLLYPEHLQ

AVVAETRANFPANHTITFNESKAKLPYLEACIYETLRCIPTASTSFPRVSDQPITLKGYYIPAGTEIATNKCAAHLHRPS

WEDPDRFYPPRFLKQETYHETRRNMLSFAYGTRFCIGRNLAWAVMMVTLANLFKNYEVELPEDSRFGPTIVDAAGRPKVM

PTKMGVATMPADPERDCRMILSARITE*

 

>CYP5082A1  Neosartorya fischeri NRRL 181

           GenEMBL AAKE02000007.1 NFIA_064360

           94% to CYP5082A1 Aspergillus fumigatus = ortholog

           name revised from CYP5082A2

MDSAQPTKLDFLAVPVTPFSIGVLASIVVLVAVLIGPKVVIDTILN (0)

GYLSLVHRIPAANGKKYMSGPAYTFPNGQMVDKFLAARTRSWEWEEKYGKTYRIWAASIPEV (2)

602792  VITDPKDVEVLYQQSTDHNKAPQANAGWLLTQLLGSGLGLINGTRWTTLRKTLDPMFSHR  602971

602972  TALRYFRDSLDAGAQDYVAGIHRFAKADGQMQNADGKGIIINATQALQRYPFFEVASMFY  603151

603152  GKMSEGEQERLWDLGRRYSEVFAAVVSGGIHRSKLTRY  603265

LNTKAWNNARDYQKA

WLDFNREIYTARKMTAPDTPIVVLTEAAERGELTPNE (0)

VTDTIAESTFANLDIVTHVISSCIILLADSPEVQNDLIQEMEKNKADREDYITRKDTLLHYCL

LESLRLRPVL (1)

TFTFPENPPREKILGNFVIPKDTTIIVDAFAINIRNPFWGPDNRAYRPSRFAGIKQSQ (0)

LRYNLATFGYGPRKCLGQHIADKIIKAVVYHMFSKYRVSLMP

MQAVEGDFKVDKTSWVALYDVDLKLEPRES*

 

>CYP5083A1 Neosartorya fischeri NRRL 181

NZ_AAKE03000007, NFIA_062670 revised

95% to CYP5083A1  Aspergillus fumigatus = ortholog

~30 kb from PKS, 96% to 5083A1 probable ortholog

NAME REVISIED FOM CYP5083A2

MEAVIV (0)

ASGLCVAYAVYYVYSDALAEVPGPGFAKLCP (0)

SWLIRVLWSNKLNQGIREQHQKHGKPS

MPFSSNSFDRSDKLTGDKGDVVRLGPSELSFCSLSAHDTIYNTNSTSFITYGSFQSAVEGLCPPGVTFVSHHSPAEQKEL

RRVFQPAIRLAVAGGMEAHHERRFNELVAGLNIKPGVPICVNLTGLLEKLEWDLIGDLGLGYSVPDRLK

137863 DNWTSQKAHQNLIGVAFALGSFLLSRRGLKVLVDSFGPFWIPKYLDPAHLFDV 138021

138022 ALKQ

RAEGKSTFVSQAIPYKNEKYPYLTKQMSSNVTGLI

138244 YAAFETSESSTRAILCALMRDPVRYRTLQQEIRSNFSA 138357

138358 SKPITDSQLVGLPYLTACINEGLRLWPGLNGQFTSRVSTGAVVDGVYVPPG (0) 138510

138606 CLVSADLYTLQRHPRYWHDPDIFKPERWLDPKNPDEMRAFRPFSAGPRSCPGRQ 138767

138768 IALQKLRLTLAKFMFLFD 138821

MHFVNPHFEWDRDVPSGLLWSSVEVMVRMTLLEPPVEAVEAAEAVEA

 

>CYP5085A1 Neosartorya fischeri

96% to CYP5085A1  Aspergillus fumigatus = ortholog

NFIA_055420

MDQVYLPQSLRTAVAVSFGVGLLYWVYRLLLQKTKSLKALDLPVLQSVGDQDIVKTLEDGHAKYPDTPFALGVPGQQVVV

LPVSEIDTVKALPENQLSIKKHHYNQFLGEYSYMGTKADEFDDAMRYLLVRNTPAVLASFTAEIDYAMSTVLQVPPNTWT

RVKPRSIMPKVATILSGRAFVGLPLSREPDWIESNVNYTQDVSRAWMVLRFYPHWIRPLVAPFLREVKTLEQNKALIGRK

IAKLLADQEAQKLSPAKEKVPGGDMIDWFKSRYQTQGKTATAQQLTRDQLLATFASIYNLSNALTYVIFDLAAYPAVVDE

LREELDQVLGPNVGAESIDKTALPRLIKLDSFVRESQRLSPTSLVNIPRVVTDPNGLRLKTGHVIPPGYLVMVRAQPINQ

NSTLYPNPERFDAFRFARLRQQGGANENRWQHTSTGADNINFGHGIWACPGRFFASAEIKVVVAYVIRHYDLRLVEGRPH

PKPKYGGLAIFPDAEAEVEFRPRV*

 

>CYP5089A1P Neosartorya fischeri

91% to CYP5089A1  Aspergillus fumigatus = ortholog

NFIA_012290 REVISED

VLRQLGLRYMVTLNCRMTDERQ &

GQRDAINVSQS &

SRCTDLVGFQSA (?)

PRHLFSSRWHLGSYLSVES

TSIPRDTMSLAMILVALTLAAFIARVVYRCYFHPLARYPGPWFAHISNAW (2)

RLVTFFSGQHHLIEQRLHARYGRVVRVAPNWLSFSSLDDF

EAIYGFNKAIEKDEFYDFGRDRGSRPESIFAAKTETSHRVKKKKVVSPALTSTRIASYKPVIDKHVGILLARLQSQSKGP

LLDAKNDGTTAVNMAPIVHQFTLDTMLELVFGPRLSAHPYTDTPAGEGVCSNLRIMTKMAWSFSLWPAFGWLMNTRPVDA

ILRRPTYSKQGELTGMAGLMGVAMPRLLRNPKQVIASSQPSIVKGWLEVPTDDANRMTSAEVASEASNLIIAGPGSTAAA

LTAVIFYLGTKDGQAWQERIREQIRASQSHDLGPSSPELQAVIKETLRLSAPFPTAFPRVIRPGAEMAIPSLRAPLPVGT

TVSANTFVLGRSRELWGNDSDEWEPRRWLGSEQHRREMETKFVAFSKGSRSCIGRELALLVLAQAVIGIVQQWKFRSRGE

LRGNSFLEMQYDECWIEFERLDLSLSE*

 

>CYP5090A1 Neosartorya fischeri NRRL 181

XM_001260900, NFIA_089610

96% to CYP5090A1 Aspergillus fumigatus = ORTHOLOG

MLSDAVSAAIDWTGQGISWVNQEYPALTVAVTSACVLVLWRIWRFTILPSYHPNDPKELPYWIP (1)

WHGAAFFSNSNALLSRAR (2)

NYYNNIQDPFALTIANSL

IYVITKPQDVAEAYRNTDTLSFNDFVQAMMRACGNTESCVKTMYKPLSKDKPGFPNPH

GKPLATLARQMHIHQLYPGDNLDFLEKQFLDWVEPRLTLDALKRECPYAIQSDLPAGK

KDDGIVLPLMQWCSDYFTRAGQRAYFGPALHGIDPKLPQTFIVFDELSWQVLYQYPEF

LAGEMKSARNAIQRALKKYIQLPQETRQGDAWFTKAMENEMRALGISEDDIATMLVTI

YWGINTNTRKAAFWLLTYILHYGPQHYIDIIRQETLPAFSSDKSIPDLDYLHDNCPHL

DAMWNETIRLSAYSASVRFVTSDTIIGGKILRKGNRLMIPYRQLHFDESIFGVDYPVE

EFRHERFMQKGRNLTRSDNWRPFGGGTTQCPGRYVAKRFVLLFVAMLLRRFDVELVTK

RIPAAEEGKPVLGIMSIKDGEDVLVRVRPR

 

>CYP5091A1   Neosartorya fischeri NRRL 181

             GenEMBL NW_001509762.1

             Also called CYP5126A1

             ortholog, 92% to A. fumigatus XP_755777 revised

MLEILVTFLIFCFRRIRGLWYLARGPEIIDKAYIA (0)

AEGKPFKISTPSNDHLLVTSNEHIAELVNAPLQNLSLHAVAKE (0)

ILQPKYTMFGFEWQDQRGVEGTGFVRALRSRLTAHLPILMPELQRIVETAIADELVAPGSDGKWGPP  530

531  QSCLIPSDCSRIRALQIVLYDQANGHQGQQLCLLRGGTWYDYPWHVRHRQAYCVAAQNPE  710

711  FTAAALEFPQRVILAAEILRITPGFLR  794

5164664  RTLFRYLEPVVEKRLATRANSTRSMQEDAP (0)

MDCMQWLIDTSPRK  5164843

5164844  IQWTTTRMVGEIIAVWFGSVHQLAM  (0)

TTTYAIEDLCLHSDYVEPLRAEVQQYLAGSCRRRVAEMPLLDSFVRESIRCTNSDA (1)

ITVRRKALTPFVFSNGLEVAEGNWVCIPQRAMMRDRIRYRNPQAFDGFRFARANK QLRA  5165393

1626 GDVSLDVPENSPLTMTDVSVDWPIWGLGNTAS (2)

PG 1806  RFYAATILKLIMVCILEKWECRLEDPKSQRWRTWRSSIVPREGTVVLFKRKEEALTG  1976

 

>CYP5101A1  Neosartorya fischeri NRRL 181

           GenEMBL AAKE02005071.1

           98% to CYP5101A1 Aspergillus oryzae

           runs off the end

           this seq does not show up in the Broad comparative blast server

  17 QQMTAAHTGIHLLHKQLTQPDAMHEFMTNSLVHVNNTLQWDSFYNTSVLAATADVKVVSL  196

 197 ECLCRDVIIDAQLTSFFGPRILEIEPNIRSFLKAWDSISWKVSYRLPSFLAKHATQLRDH  376

 377 LIEVLVKYYAFPAEERPGSVSFVNDVYDDYKQAGIPDRDIAGIVFTILWG  526

 594 LNSNVNAISYWMIAHLMNNPTVVNEIREEIAPMMRALDSSPTIDGTILADVSKDPLLNSC  773

 774 PIMNSTFNETLRFTATGSSFRETTRDTTLDGRRIPKGTKIIIPQRTQMMHSAAFGPDPET  953

 954 FDCYRFYRNKSLLRKVEFRGFGGGTTLCSGRVVGRHQVLAYLALLFWRYDLEVIGPDQEV  1133

1134 LGVRGKGFPRLDEAKPSLGPGKPIDGDDQILRLTRRNV  1247

 

>CYP5121A1  Neosartorya fischeri NRRL 181

           GenEMBL AAKE02000008.1 NFIA_060240 revised

           42% to AAKD02000042.1 Aspergillus clavatus

           this p450 belongs to a group of sequences without

           Cys at heme region CYP5102, CYP5120, CYP5121 families

1210404  MAVFAALLLLLCVFGGILWNYTRLNTIPGPLLAGLSDIWSQCLKSSPRYAYRLQRLHRKY  1210583

1210584  GEVVRIGPKTVSVTDPSNIFWLDAACPQRSK (0) 1210676

1210852  DLVLDFLKAIRKQRTMKLTVFRDFATDIVGRMFVGDLEDDRAAPMRTGSNQMDRCRFTTS  1211031

1211032  LDHIMFKNPVAKLKRKRNKSLRWVSCAVTHSRWDDASIFEVLPETGRKTFLQ  1211187

1211188  AETREYGGPYASLIVKGADCMVAAFVSVFRHLLKCPTAMSQLQHEVDNAFRNLTLSD  1211358

1211359  ILQQETELHALSFLDAVIKESMRLALRFDYLRDVPAGGLAVLGHYLPEGTVVQFHSEA  1211532

1211533  LRNNRTIFGEDVSDFRPQRWLQADLDQWQRKQMEALLFLRPNMPNSAKARAAWLELKRA  1211709

1211710  AALIILKFD (0) 1211736

1211784  LRPLNYEEVFIQDAVSREQEYEILVNFTPRMH*  1211882

 

>CYP5134B1P Neosartorya fischeri

43% to CYP5134A1 Fusarium oxysporum, 40% to CYP526G1

one stop codon and a small deletion, probable pseudogene

NFIA_045710, NFIA_045720 join

Note: this seq does not have an ortholog in A. fumigatus

MLHHTFCTYLSAHLHPSPNHNVPVPSHFSFDSMAIQISPSILGVAACVLFAVAACVVYRAL

LPKPIPGIPYNKASANRILGDAPD (0)

LLKWRAETKEICSYIRKLA

VELDSPVIQMFMRPFGKPWVIVTDFCEAQDIQINRQHEFDRSTYIGEVFGPLLPGNHVW (0)

MPSNDEFRAHRHLIRDTMSPSFLHDVVGPAIHSSTQDLLALWRERARLAQGRPFEADQDIIRNLVD

VILVATFGFEVGAIASQTKLISGINKIDLPWNVDVPAIFPTAKDPQAFTSVRTLVDSL

QIALRSPVPRQRLTFALKFYPSLVSARRWNKRMMGDRLQAAWKKFSDNAD*DEQVKSAVDLLVQREAQ MAKRQNRDVMYDTRVIRDELFGFFSAGHETTSTTICWAVKYLTDHQEVQQTLRSSLKLVHKRAAESGELPTAQEIVKADI

PYLDAFIEENHRLGNSIPTVIRITTRDTVVLGHRIPKGTDVFMLTNGPSFQTPAFAVNESARSKTSQESKDKYGVWDASD

IERFRPERWLVKDHEGNLRFNPRAGPVLPYGLGPRGCFGIKLAVLELKVIITLIVWSFELQKTPPSLSGFGGDDMNTYRA

QQVYLRLVEAK

 

>CYP5235A4 Neosartorya fischeri

59% to CYP5235A2

NFIA_023520

Note: this seq has no ortholog in A. fumigatus

MLAPHVWLIGTLWFLVYFLGRRVYQWNRLRHIEGPPGTGWTKLWLLRQAWSGRLCDSLYNACREYGPLVRIGPKWVLCGD

PAEIRRIWGINSGYHRSDWYKAVRLNSEVDNVLSVIDNKEHHRLRSHLMPGYGGKGIANEEQLVDQQITKLVALIEQRYI

STQTDLRPCDLARTMQYLTQDVITAVGFGKPAGYLEANSDIHGILETSEALHRPVHMVTLLPTLRKILESRLLKPFHPKP

HDQSGVGRFLGHIKDLVDERYDDLKTNHTDILQSFINSGLSRPQVESEALVTVFGGTDTTSTALRNIIFYLSTTPRAYRA

LQSEIDDAVKTVARPVIRDAEAKALPYLQACIKEGLRIFPPSMGLMGKVCPRDDTICGIKVPANTQVAWSALAIMRNRTI

FGDDADVYEPQRWIDAPVEKRKEMDASYGLVFATGTRWECLGKRLAYIELGKTIFELFRRFDFAMVDPVEPFRWANHGLT

AHFGMNVRITEREAGGDVGVFRL*

 

>CYP5262A3 Neosartorya fischeri

56% to CYP5262A2 Fusarium verticilloides

NFIA_044250

Note: this seq does not have an ortholog in A. fumigatus

MLSAALELVREWVPFLRTWFFVALAIVSLLTLGWVLYHRYRFGRHVPGPWLPKVSGIPLAWYDIWYCRNDHILQWHRQYG

PVVCIAPNEVSVATLESTKDIYGTTLRWPKSNYFDHFKGYGMRSAFATKPYEEHRAKRKLISAFYQPTTIYKLPQIEHYV

QERSRAVLREIQHGQGVDVYSLTDWYALDIITHLVLGPDFGSRAIECPCPERDILALLKHQQFVGSLRMRYPNAYHYISC

IFGKLTPRLRYLQADNEFASWCKQRTLGAMEAPSMSNSPSLLRHLLEIRGSDGEKKKQQLDREYVVAEILDNINAAEATV

SVTATYLIWRLTEAPEWQRKIRKELTALPVQPDGSLAFADLDSHVPSLEACLREVYRLHPASSGRAERVVPQGGHVLCGV

FLPQGTIVSTSVVALHRDERIFPDPDRFNPGRWLDEDPLTLKMREAQLIPFGYGARICLGKALATLEIKMLIANLYLRYE

TVMGSSTTPESMKQCSTHDAVPKALKCVVRFQEVAEEL

 

>CYP5278A1 Neosartorya fischeri, Aspergillus fischeri

33% to CYP636A1, 76% to CYP5278A2

NFIA_098920, AAKE03000027.1

Note: this seq does not have an ortholog in A. fumigatus

MGLISLLVLSIVIYCVLRLLEVKRCKNVATEAPTIYGWIPIFGHALGLLQYGVSYYRMLR (2)

ETTNMPIFTLFLGFQKVYVVNSPALISQINHHQKVIDSNPPFLIIVMGKLFDFHKDDLAELMRNPNETGS

LRRETRTVEHSLLERGAAPLHEIFTAMIQEVALRLNSLASKGPATIKLKCWLRETITTCTAQATFGPHNPFAQNQSLLND

FWHFESGIKGLTMGIFPTLTASGPARARHRLVQAFHRFVQGSFIKREETCELVRQIGEVAHRHNRGTDYLARYYFGVFSA

FLLNTVPVTFWTISHIIKNPDLLARIRTELEDVVQEFVDADGIRTRVLHISTIRERCPLLLSTFHEILRYVGASTSTLVV

HEDVWLDDTYLLTKGSLVQIPATAIHSDPNIWGPDAANFDPERLHAAPNKVHPSANRTFGGGNTLCPGRHLASDEVLEIT

AMFLSTFDMGFEAKPSWPRRDETNMLSVIKPRDDLSLNLTRYPHMEKVLWGFETS*

 

>CYP5279A1P Neosartorya fischeri, Aspergillus fischeri

C-term pseudogene fragment, the sequence immediately upstream has strong similarity to

C-3 hydroxysteroid dehydrogenase. This suggests a sterol biosynthetic gene cluster that has degraded.

NFIA_098930

Note: this seq has no ortholog in A. fumigatus

VRLSNQAMSTRHVMENTFITDSDGREYLLRAGSIVVMPATAHMEGDVWGINKIDFDPERFLDWEDHKASRDRRLIYMPFGGGRHLCP

GRNLAKAEILGFIVMLILSFDMEDGANLEQPIRVPTLEPARLGQGVGKPVYLRTGDKFPVRLRTRKGLESVNWRFLA*

 

>CYP5280A1P Neosartorya fischeri

most like CYP630 (33-39%), 37% to CYP630D4 Neosartorya fischeri

NFIA_099450, one stop codon, possible pseudogene

Note: this seq has no ortholog in A. fumigatus

MLLVLLFFISMAPALFWLFIV*LRDEKGLRK

YPKQNWASGLTALAYGWECGRPRRDIH

SKRLHAALQKYPIVRIAPNWLAFGRSQAARDIYGYNSKCVKAATYDLLSQGGANLNNISDKRFHSSRR

RMVAPKNIQEWEPKVAVSVADLMNQIDARCAEDQGVVVEPSSFDAVHWIFLFSVETVIKIMLSKDVFFLRNGTDHVYFQD

ENGLPQAVQSIHNSHASQRAAATVIWDIQRFALWIRLTKMVSKRYADNWAAGPKFHAAMEALTKERIEQYSNGERFSDLF

QPMLEDKHGEASEITLKDRIAEVEQAVGAGTDGPAVSISMTLYYLIRNPHTFAALRKELDTVLSTEDSVAPWGKVKSLPF

LRACIDEAMRLAPPVATELIRRTPPDRHVIIDGHLIPPDTNVSIAAYTSHRDPQVFPDPETYNPDRWMAKGSDNLRNMLG

MFIPFSAGTRGCIGRNVSILMQSVCVATLVYHYDFALPHENWEMEFEEWFSLWPLRLPLGVRRREPASFPQA*

 

>CYP5281A1 Neosartorya fischeri

39% to CYP68L3, 38% to CYP5067A2, 93% to CYP5281A1 Aspergillus fumigatus = ortholog

NFIA_100500

MIRFEDASIGTVWVTCLLAVGLYFIRSRLLGDQFDGFPSVNSRKPWEVLNVFAHRRFQKNGPEYLKAGFSKSPIFGVVTD

LGPKLVVSGAFIKDFKDERLLDHYRAMIEDFMAEVPGFESMFLGNLHNTVLRDVISVITRELEQFTLPLSDEVSAALGDT

WSVSPDWHEVTLLPSMLGLIARVSSLIFVGEPLCRNPAWLETVVNFTIVRHHAILALHMCPAVLRPVLHWFLPPCQKLRR

EIKAARGLINSALEESRKNPRTDRFSSLTWVDAFASGNKYDAAMVQLRLANASIHSSADLLIKVLINLCDQPGLIQDLRE

EVISVLEKTGWRASTLNQLKLLDSVLKESQRLHPITTGTFSRFTRQNIKLTNGTEIPTGTPVMVTNDVAGDADIYPDPEV

FDGYRYLRLREGADKSRAPFTTTGQNHLGFGYGKYACPGRFFAATEIKIALCHMLLKYEWRLVKDSPHDMLTSGFASFRD

PRARIEVRRRAPAPKEFEVLTQK*

 

>CYP5282A1 Neosartorya fischeri

49% to CYP5282B1 Talaromyces stipitatus

30% to CYP609A1 Magnaporthe grisea

note: this seq. has no ortholog in Aspergillus fumigatus

NFIA_101520

MDFQIISRFTDGADFQWAKFGTAAFLAVVLSALAFLSYTPRVHQKSPAFTSHKLPFIGSLGFTTEQW (2)

NWWKSATAES

KTGNFSFWLGKRHVVGVTGEAARKMFFTHEALDFVSGALIRPINIHFWPPIHDIFRPDVKSSRKNTYFLRRLYELQSTEQ

LNHYLPQLLKDARVGMAGLSRVTKPSVSCWETVFTQDVRLLCTDEIIADPKLLATFGRHVETLLFTFSHYNVCFPWLPSP

SYYKRRYARYALYNLMKDIVNKRLKNGARRPNDPVQILLDYNDKLDHIIEFFITVLFIAPANSRIIGGQMLNIMSIHRDW

QEKVYADIKAAAAAHSPDKNAPLVDQLASIPLHAWENSFPSIDLCLQETIRMWTSFSMARLNVSPNPIPIPGSDEVIPAN

TFVCYNSTEVNFSDTLYPDPKKFDPVRFLDGREEFRNEAYGFLGWGRGRHPCPGMRWAKLQQNIIIAYAVAMYDWSSCDE

TGKPTPQAVHVKELNAARGTVLPSAYCKLVPREKV*

 

>CYP5283A1 Neosartorya fischeri

35% to CYP5074A1

NFIA_004940 revised

MLSVYVTLCGLCCHFIPIHGYLRLMRIQSSGKQQPYTWPLKYSAALSLCGFL

IVAIKSGYEAWRCRPNLPQVNKPELWDILGLQAKRKYLSPDTSSFIEALAK (0)

ATRVYTNLGWVYLLGGRYIPLLKNETRLGQEFQSTIPGYEPYYQ

LTADHHILQHYTRSKMSLQLGKPSFGGKL VKPVSRNTARTLHKMLGDSQEWSRILIRETAGATLSEAAGSLFYGPDIAAD

PEFGESVLRYLTFSIAGMPKLHLWPQCLRPIVHWLLPTCRAARAELAKSRARLTLLLVKQKKERQKADDLDQIDVFSFIE

TLPPDQRGDPACLAIALTIAATHTTATLLTTIIYQICKHPDLIEPLRAEIRSVIQEHGWTKAGITKLRLMNSVMKETNRL

SPLSQAIMRRVATADVPLNRDLTIPKGAITMTSTLDTMWDPQIYPDPQKFDGYRYLNLAKQDPYWNRTSSFVATSPESLG

FGLGKEACPGRFIADLEIKLILCYLLTHYDIKLPGGITAKPRYEGVFLLLDPGDILIRRRPEEEAKFPDWSHDDQV*

 

>CYP6001A1 Neosartorya fischeri NRRL 181

fusion with diooxygenase, P450 (C-term) part may act like a hydroperoxide isomerase

XM_001266940, same seq as DS027685Neosartorya fischeri NRRL 181 XP_001266941.1

96% to CYP6001A1 Aspergillus fumigatus = ortholog

NFIA_105320

Name revised from 6001A4

MSEKQTGSANG GLGKTLAQLEQVVSASLRPLPSQTGDGTYVTEQ

VKTGILKDLPHVDLGDLKTLVDVSKSALTGEALDDRKYIMERVV

QLAAGLPSTSQIGKELTNTFLTTLWNDLEHPPISY

LGRDAMYRRADGSGN

NVLWPHIGAAGTPYARSVRPKT

TQSPNLPDPETLFDCLLARKEYKEHPNKISSVLFYIASIIIHDLFQTDRKDPAISLTS

SYLDLSPLYGNNQEEQNRVRTFKDGKLKPDCFSTKRVLGFPPGVGVVLMMFNRFHNYV

VEKLAMINEGGRFTKPQESDTAAYAKYDNDLFQTGRLVTCGLYVNIILKDYVRTILNI

NRTNSIWSLDPRSEMKDGLLGSAAARATGNQVAAEFNLVYRWHSCISQRDQKWTEDMY

QELFPGQDPSNISLQDFLRGLGRWEAKLPEEPQERPFAGLQRKADGSYDDDDLVKIFE

ESVEDCAGAFGALHVPTVFRSIEALGIQQARSWNLATLNEFRKYFNLAPYKTFEEINP

DPHVADQLKRLYDHPDRVEIYPGIIVEDAKESMAPGSGLCTNFTISRAILSDAVALVR

GDRFHTVDFTPKHLTNWAYSEIQPQDSVDQTHVFYKLVLRAFPNHFRGDSIYAHFPLV

VPSENKKILTELGTADKYSWDRPNYTPPPQFINSHSACMSILSDQETFKVTWGSKIEF

LMRHNNQPYGRDFMLSGDRTPNAMSRQMMGKALYRDKWETEVKKFYENITLKLLHRYS

YKLAGVNQVDIVRDIANLAQVHFCASVFSLPLKTESNPRGIFTESELYQIMAVVFTAI

FYDADVGKSFELNQGARGVTQQLGQLTLANVELIEKTGFIASLVNSLHRHDVLSEYGV

HMIQRLLDSGMPAPEIVWTHVLPTAGGMVANQAQLFSQSLDYYLSEEGSVHLPEINRL

AKEDTPEADDLLLRYFMEGARIRSSVALPRVVAKPTVVEDNGQKITLKQGQHIICNLV

SASMDPVSFPEPDKVKLDRDMNLYAHFGFGPHQCLGLGLCKTALTTMLKVIGRLDNLR

RAPGGQGHLKKLSGPGGIAMYMTADQTGFFPFPTTMKIQWDGDLPELKE

 

>CYP6001C2 Neosartorya fischeri

82% to CYP6001C11 Aspergillus clavatus

NFIA_065200

Supercontig 574: 1021375-1025419 +

MLRRFSSTFKKKGDRESKQNGTAAAVANTNNNDNNKRHSKISAARKSSS

DDDRNEKKGDSVSPFEKYASVLHASRSPIPNQTGDGAYLEHEHTTSLLQDARHLGFKDFKTLKEVIESKLPGGQLIDDK

TMLMERIIQ LVSRLPHNSKHREELTNAFLTELWDSLPHPPLS YMGNDYAYRS

ADGSNNNPTLPWLGAANTPYARTIAPLIIQPGGLPDPGLVFDTLFARQTFKPHPNKVSSVFFDWASLIIH (1)

DIFQTDYKNPNVNKTSGYLDLSILYGDVQEEQNLIRTFKDGKLKPDSFSEPRLQAFPATCCVLMVMLNR (2)

FHNYAVEQLAAINEDGRFTKPADNLSEEEAKKAWAKYDEDLFQTGRL (2)

ITCGLYINITLYDYLRTIVNLNRTNSTWCL (0)

DPRAQMEGSRTTPSGLGNQCSVEFNLAYRWHSAISATDEKWTEDVYERLMGKPASEVSMT

ELLMGLGKYQAELPKDPSKRTFADLERQADGKFKDEDLVNLLVNAVEDVA (1)

GSFGARNVPKVLKNVEILGIIQSRKWNVGSLNEFRKFFGLKPYETFEEINSDPDVAESLR

SLYDHPDFVELYPGIVAEEAKQPMVPGVGIAPTYTISRAVLSDAVALVRGDRHYT (0)

IDYNPRNLTNWGYSEVRYDLSINQGCVFYKLATRAFPNWFKPDSIYAHYPMTIPSENR

KIMKDLGRESHYSWDRPRYTPPRVDLVSYSNAKLVAEQQNQFRAAWDDTVEFVFGKASKE

FKLSQDSAFIQKHADVMSKLLNKEEWHRSVKEFYEDITTKLLEDKTRRFGGLNQVDITKD (2)

VGNLAPVIFASNVFSLPLRSKENSRGIYTEHEMFKVLATLYNCLYFDIDKTKSY

PLYHASQAVGEPLGKALEASVKALGGSSLLSGIFGSFRENNNALKEYGVHMTKQ

LLENGLGAHEIAWAQILPTVIAMVPGQAQA (0)

FTQIVDFYLSKEGSKHLPEIQRLAKQDTKESDEQLLRYCLEAVRL

NDHSGLYRQSETTLAVTDEAGEVTIQPGDKVFVSF (0)

AKANRDASVFPDPEEVRLDRPMNSYISPNLGPHGFLSKETSHIALTAML

RTVGRLNNLRVAPGVQGQLKKIPQPGGYSAYLREDHGSYSVFPT (1)

TFRVQYDA*

 

>CYP6001C4 Neosartorya fischeri

95% to CYP6001C4 Aspergillus fumigatus = ortholog

NFIA_045480

MRPEPQTEGASSKPGNDSHAKFVDTGPKRIHEVQHFNELSREPPKGDVGAEQGGAIGRFKDLSEVVHKATRPLPTETGNG

TYIKDSSKGGSLWEDLLSLGIEDAKTVKDFVKTEALGRPMDDKTMLMERIIQMVAKLPDKSKIREKGTHKFLGILWNSLP

HPPLSYVGDKYAYRSADGSYNNPTLPLLGAANTEYARTTEASKMRPASMPDPGLIFDSIFARETFKPHPNNVSSIFFTWA

SLIIHDVFQTGYPDQSINKTSSYLDLSTLYGDNQDEQNM MRTFEDGKIKPDCFSEPRLHMLPAASGVILIMLNRFHNHVA

EQLASINENGRFTKPKDEIIDPVEARAAWAKYDNDLFQTARLITCGMYINITLYDYLRTIINLNRDNSTWNLDPRTHDDQ

DEIPTAEGNQCSVEFNLAYRWHSTIGRQDEAWTEKTYREIVGKPAQEATLQDLMEGMRKFNARMDKDPSKRTFAGLQRQG

DGTFKDVDLVDILTRAIEEVSGSFGPNNVPKVLRSVEILGIQQARKWNVGSLNEFRKFFDLKPYESFEEINSDPYVADQL

RHLYEHPDYVELYPGIVAEEPKEPMVPGVGIAPGYTVSRAVLSDAVALVRGDRFYTKEFNARNLTNWGFSEANYNLEINQ

GCSFYRLALRAFPKWFKYDSIYAHYPMTIPSENRVIMKALGREEDFSWDRPAYIPQRISVFDYANVRHILQDASNFRVMW

GEATAYVFGPKGWDFMLSGDAPTHANQRNIMSRALYRGQWHDAVKQFYLDITQQLLTEKSCRVGNVNQVDISRDVGNLAH

VHFASSVFSLPLKSREHPHGILTEHEMFEAMAVIFTAIFFDAEPVKSFELRHKAREAAEKLGKLVEINVKAIKSSGLITT

LLGNMHANKNALFEYGVHMVERLLQSGLDPEQVTWSQILPTAIAMVPNQAQVFTQIIDYYLSDNGRKHLPDIKRFAKEDS

PASDEVLLRYCMEAIRLNGIFGSYRKSQTNLTLDDKGGKVHIKAGDKVFVSFVDANRDPNVFPKPKEVDLNRPMDSYIHY

GVGPHTCLGGEASKVALTAMLRVVGRLDNLRRAPGAQGELKKISREHGFYTYMREDQSAFYPFPMSWKLHYDGEIPGKEQ

PVRGDFVCNVPGHWQN*

 

>CYP6002A4 Neosartorya fischeri

71% to CYP6002A3 Aspergillus clavatus

NFIA_045180

Note: this seq does not have an ortholog in A. fumigatus

MAPPTESSSHSAGQNGKQRMFLIDARQDLLSQAGRILPDLRTIHELGQTAFNGGLVDDRKYLIENIIQVTASLPNTSALR

GKITDAFVSTLWDNLQHPPLSYLGDQFKYRTADGSYNNIMYPHLGASGSHYARTVTPQHPRPAVLPDPSLIFDTLLARDG

PAKEHPSKISSTLFYLATVIIHDLFHTDECDGTKVKNSSYLDLGPLYGHNQDQQNKVRTFTDGLLEPDTFAEKRLLTQPP

GVGALLVAFNRFHNWVVGELAYINEAGRFSLPAGVNQDDPRYSSAVAQRDNDLFQTGRLITCGLYVNIILNDYLRTILNL

NENLTQSDWTLDPRKSLEVFDKGGVPRGVGNQVSVEFNMIYRWHAAISNQDEAWANSLCQRIFGPEVDGSTLSVNQFLDG

LRKYFEDNVPGEPPTWTFGGLERQQDGRFADSDLVRLISDGCENVAGAFGARNIPKVMKAIEMLGIEQGRQWQLATLNEL

RAFFKLKPYSSFLEVNSNPAIAEALEALYGHPDNIELYVGIQAEEAKKPFYPGSGLCPGFTISTAILSDAVALVRGDRFY

TVDYSPANLTNFGFNAVSSDFDVAGGGVMYKLLMRAFPGWYRPNSVYALYPFVTPEKSREIMDKYMKFKDLNFDRPSYTP

PPVPVTTWEGATTVLENQKRFHVPWGTHTFQITGHDYMLSGDSAANAEQRRFVNECLYEPKTVLEVVRKLYESITTALLH

EKAFKLRDYYHVDIVGD ()

VGNLAHAHFCSQFFNIPLKDDKDPSPDAYTPRELSDALSLLFGYVFLDLEPTDSLRNRIAAAA

EEQRMGAIMAKSVSSARHSVVRRFMQALGRSEAGPGSYGQQLANRLLREGKSVDEVVWTIIPTAAAACATQAQGWAQMLD

LYLSDKYASHWPAIQKLARSADPAAFEKLKKYALEGFRLSTPAFGVLRTAVEEATIKDGEATTTVHEGDTIFVDFITAGR

DPVKFPDPDEIRLDRPADSYIHHGWGPHACLGRAIVTTAGAALLRVLGRLENIRRAPGPAGEMKSKMVNNAFKLYLRENG

SSWTPFPQNMKVIFDSFK*