Neurospora discreta P450s

 

D. Nelson

 

August 16, 2009

 

43 sequences

 

>CYP51F1 Neurospora discreta

estExt_fgenesh3_kg.C_20410

98% to CYP51F1 N. crassa

MGILQVVAGPLSQQFSQLGTVSQIGVAIASFLFVAVTLNVLQQFLFKKPNEPPLVFHWFPIIGSTITYGM

DPPRFFKENRAKYGDCFTFILLGKKTTVYVGPKGNDFILNGKIRDVNAEEIYTVLTTPVFGKDVVYDCPN

SKLMEQKKFMKIALTTEAFRQYVPIISDEVTNYLKRTADFKGQSGIVDIPPKMAQITIFTASHALQGKEI

RDKFDETLADLYHDLDMGFSPINFMLHWAPLPWNNRRDYAQRTVAKIYMDTIKERRARGETGAQDIMWHL

MNSTYRGDIPVPDHEIAHMMIALLMAGQHSSSSTSSWIMLRLASRPDIMEDLYNEQVKNLGADLPPLTYE

DLAKLPLHAAIVKETLRLHAPIHSIMRAVKTPMPVPGTKYVIPTDHVLLAAPGVSATDESYFPQPDLWEP

HRWEKDSPLAPTIVRNVQSEEDDEKIDYGYGLVSKGANSPYLPFGAGRHRCIGEQFANVQLQTILAVIVR

NFKFRNVDGSDKVIGTDYASLFSRPLEPAKIYWERREGCQL*

 

>CYP53A4 Neurospora discreta

estExt_Genewise1Plus.C_10226

97% to CYP53A4 N. crassa

MAIISLLMSSWAPVVLLAGVAFYYLVPYFVTYSALRKIPSPFPAQFTDLWLLSVCRRGNRYQRVDELHKK

LGPVVRIQPNHVSICDDAAIPTIYGHGNGFLKSDFYDAFVSIRRGLFNTRDRAEHTRKRKIVSHTFSAKS

VQQFEPYMHSNLELFVKQWDSMIKNTKNPDKAAHLDCLEWFNYLAFDVIGDLSFGQPFGMLSSGADMAEI

RSSPDAAPIYAPAIEILNRRGEVSATLGIHPALKPFAKYLPDPFFTKGLAAVENLAGIAIACVKSRLENP

PPVTRKDLLQRLMEGRDEKGEPLSREELTAEALTQLIAGSDTTSNSSCALLFHAVRTPGVMQKLQAELDA

NIPSEVDVPTYDMVKDLPYLEAIINEVLRFHSTSGIGLPRQIPCDAAQGVHIQGYYFPPGTVLSVPTYSI

HHSKEIWGPDADEFKPERWERLTPRQKNAFIPFSHGPRSCVGRNVAEMEMKLNVATWARRYEVKLLQDYM

DTSEGFLRKPLGLKVGLKLRK*

 

>CYP54A1 Neurospora discreta

scaffold_13-snap.17.1

93% to CYP54A N. crassa

MDLTQVAHSPSALLPLVLPSIAAILAFAVFQRFFAPNPLSKLPIVGEEYHGYEKKRQAYLTKAKDLYLEGYTKFKQGLFR

IVTPNAGNVIVVSPSFLGELKKLPDDVVSFDAAVDDSMHTKYTLLPTHETILPHTVRSSLTPSLPRLNPQISEEVQTAFS

QEIAPLMSNSPSDWAPININSKLLRIVAKVSGRVFIGPELCQDERYIEAAVGYTVSVMEAQRAVEKMNPWLRPIAAWRLK

EVQKLAQMERDATAFLRPVVEARREKQRKGEEKDSDMLQWLMDSADQGQGKQHGKWGEDTTTTRKLARLQLAISFAAIHT

TTLVTTHAVYSLAADPELQATLREEVQSVLQEHKGVFTTSALQAMKKTDSFLKETMRFHPLGQTSFNRKVLKTFVLSNGQ

VIPKGSTIEVPNYAVSRDPEVYPNPDVFDPLRFYNLRNEAREKGEAEQAASSQFVSVNKEFLTFGYGRHACPGRFFAANE

IKMILANLVMTYEMGLVEGETERYKDWDIAAGTIPDPTKDVLFRKL

 

>CYP55A6 Neurospora discreta

estExt_fgenesh3_pm.C_80311

95% to CYP55A6 N. crassa

MGALTENLEFPFRRATGLDPPPEYAWLRKTDPVTQVRLFDGSLAWLVTKYPDVCQVATDERLSKERTRPGFPELAAGGKE

AAKNRATFVDMDPPKHMQYRGMVEPVFDVEHVKELEPYIQKTVEDLLERMKNMGCEGGPVDLVQNFALPVPSYIIYTILG

VPVEDLGFLTQQNSIRTNGSSTAREASTANLELLNYLHRLAEQRLQEPKDDLISKLMTEQVKTDKLDTADAVQMAFLLLV

AGNATMVNMIALGIVTLFLNPSQLEELKRDPSVVPAFVEELSRFHTASAMAIRRVAKEDLEIRGKTIKKGEGVIASNLSA

NRDEEVFKNADKFDMHREWPAKELGFGWGEHRCIAEFLAKAEMRAVFETIFKKLPQLKIAVPFDEIEYTPLDRDVGVVKL

PVTW

 

>CYP61A1 Neurospora discreta

estExt_fgenesh3_kg.C_120065

98% to CYP61A5 N. crassa ortholog of CYP61A1

MASNATSFTSPLASAKLGTVGVPPQLEYVIDTISQASGWTIIATLLAVLVAWDQIKYVLNKGTIAGPSWKIPFIGPFLES

LDPKFEEYYAKWLSGPLSCVSVFHKFVVIASTRDMARKVFNSPSYVKPCVVDAAHKLLGADNWVFLDGPAHVEFRKGLNG

LFTRRALEIYLPGQEEVYNRYFKSFLEITKNAGGKPVPWMPHFREVITAVSCRSFVGHYISDEAVKKIADDYYLITAALE

LVNFPIIIPYTKTWYGKKAADMVLAEFAKCAAKSKVRMAAGGEATCIMDAWIKQMIDSKKWREAVASGNTEGIEKPTHLL

RDFTDYEISQTIFTFLFASQDATSSAATWLFQIMAQRPDVLDRVREENLKVRNGDIHAPINMEQLESMTYTRAVVRELLR

YRPPVLMVPYLVKKAFPITEDYTIPKGSMVVPTTYMALRDPEVYPNPDYFDPDRYYSGDAEAKGAKNYLVFGVGPHYCLG

QHYAQLNLALFVGKASLLLDWKHHPTPLSEEIKVFATIFPKDDCPLTFEERKW

 

>CYP65B1 Neurospora discreta

scaffold_9-snap.228.1

85% to CYP65B1 N. crassa

gene model does not appear to be assembled correctly. One low complexity sequence

removed. mRNA may be needed to decide this assembly.

MNQEQIMKTVRLGLETPYYGVKKIKGIVLIGISLLLSSFLLSAIYNLTLHPLARHPGPFLHRASILPYLYRQVTGTLPCS

ILDFHARYGPVVRISPDALSFADPQAWKDIYGHRPHGEEEFAKLGLFYRVKGSPPSLLNESREAHGTLRKLMAHGFSDRS

MRAQEGIIGGYVNALVRGLRGHC (1)

LKQNGGGIVSEEKEEKKETTDVHAESNVNIKNTKQNKVPLD

MVSWYNWTTFDIIGDLAFGEPFGCLEKAKYDPWVDEVGKGVRLGCVMFAFRLLGLGDLLSPLIRKLSDKAKGFHRKRTMA

KLQRRVQLTKERPDFLEGLLQKREEWGMNMDGLAANAGLLIVAGSETTSTLLAGATYLLLKDPETMKKLTEEVRSAFNSE

EEITLLSVGNLEYMLACLNEAMRLYPPVPIGMPRVVPKGGAKVAGTFVPEGTVVAVWQWATSHNEQHFVEPFEFHPERWM

RDPRFANDRLDAVQPFSVGPRNCLGRSLAIAEMRLILAKVVYNFDMQLANPDKNWLDQNIFTLWDKHPLPVYLTPFDRND

V

 

>CYP65C1 Neurospora discreta

estExt_Genewise1.C_41538, gene model incorrect. Added I-helix

87% to CYP65C1 N. crassa

MPIMDKLADATGLSGPHLLLGVVGVTILLYITGSAIYNIFFHPLASYPGPLLQRVSSIPFGIRHALGIQAFHTQTLHDKY

GPVVRIAPNHLSFTDVRAWRDIFGHIVGNRQGQEEMSKFQPFVRPLDDQPVHIISAGREKHGQLRRAMANSFSDASLRGQ

GPLIGKYIDLLIHKLHEQGQEGKVPLNATTWYNSVTFDIAGDLIFGMSFEVLDQNGNHPWLQYMLGCLKSLSPLGALSYV

GLHWVVQLLWKAKGAEVFRKSMVSVDLMLKERLKMPVDRNDLFEGLVQRQEKL (0)

GLSFEELSANAWLLVL (2)

AGADTTATTLTGTTYFLTQHPEVLKRVTQEVRSSFKSVEEIDISSV

NKLTYMLAVLNEAMRLYPPVPSMTTRVVPRGGARVLGEYFPEGTIVDVQQWSMNHSKDNWVDPWAFNPARFLDDKETAKE

KGNLLDALQTFSAGPRNCIGRNLAYAEMRWILARILYDFDLRGVPTNQNWIERQRSYGLWDRPPLDVYFEPAREGK

 

>CYP68D1 Neurospora discreta

estExt_fgenesh2_pg.C_110241

92% to CYP68D1 N. crassa

MAHPSATPSSIPSWMERFDIKSITDPSAKPFSYLVTAFLLAVIVYSLQGPRYPKDIKLLNPKGSLEFSDT

RPKKEFVYGSRQMLAKWFKANPDKPCRVITDFGEAIVLPPHFANEIKNDDRLSFTRWTFKAFHGHLPGFE

GFGEASRESHIVQEVIMRDLTKYLNKVTEPLAQETCMAIEAILPKAANGEWSTINIRSKILPLVARISSR

VFLGEELCRNEEWLKVTQQYTINGFGAAEELRLWPAALRPIVQWFLPSCQRARTDVRVARSILDPVLQKR

RQEKAANGGKAEHDDAIEWFERTAKGKYYDPAVAQLVLSLVAIHTTSDLTCQVMTNLMQNPEIIAPLREE

MIQVLSEGGWKKTSLYNMKLLDSVIKESQRLKPVGIASMRRYVEKDVTLSDGTFIPKGGFLAVSAHNMWN

SEVYEQPDKWDGRRFLRMRETPGAGKENVAQLVSTGPDHLGFGHGQHACPGRFFAANEIKIALVYLLLNY

EWRLPEGSDPQICVYIGSSETASSGKLGLDWGRRYHGQWCDSLSRTKSSLTGLDLVCDLDWHGPISGVRH

VVTEF*

 

>CYP505A2 Neurospora discreta

estExt_fgenesh3_pm.C_120016

95% to CYP505A2 N. crassa

MSSDETTPQTVPIPGPTGLPLVGNSFDIDTEFPLGSMLNFADQYGEIFRLSFPGRNTVFVTSQALVHELCDEKRFQKTVN

SALHEIRHGIHDGLFTARNDEPNWGIAHRILMPAFGPMAIQNMFPEMHEIASQLALKWARHGPNQSIKVTDDFTRLTLDT

IALCSMDYRFNSYYHDDMHPFIDAMASFLVESGNRSRRPPLPAFMYSKADSKFHDDIRVLRETAEGVLKSRKEHPSERKD

LLTAMLDGVDPKTGAKLSDDSIIDNLITFLIAGHETTSGLLSFAFVQLLKNPETYRKAQKEVDDVCGKGPIKLEHMNKLH

YIAAVLRETLRLCPTIPVIGVESKEDTIIGGKYQVSKGQPFALLFAKSHVDPAVYGDSANEFVPERMLDENFERLNKEFP

DCWKPFGNGMRACIGRPFAWQEALLVMAVCLQNFNFMPEDPNYTLQYKQTLTTKPKGFYMRAMLRDGMSALDLERRLKGE

LVAPKPPTTPSSGQPKRSGEGKPISIYYGSNTGTCETFAQRLASDAAAHGFTATVIDSLDAANQNLPKDRPVVFITASYE

GQPPDNAALFVGWLESLTGNELEGVQYAVFGCGHHDWAQTFHRIPRLVDSTVSERGGDRICSLGLADAGKGEMFTDFEQW

EDEVFWPAMEDKYEVSKKEDDTEALLQTGLSVEFSKPRSSTLRQDVQEAVVVDAKTITAPGAPPKRHIEIQLSSDSGAYR

SGDYLAVLPINPKETVHRVMRRFQLAWDTNITIEASRQTTILPTGVPVPVHDVLGAYVELSQPATKKNILALAEAADKAD

IKATLRQLAGPDYTEKITSRRVSILDLLEQFPSIPLPFASFLSLLPPMRVRQYSISSSPLWNPSHVTLTYSILETPSLSN

PDKKHVGVATSYLASLEAGDKLNVSVRPSHKAFHLPVDADKTPLIMVAAGSGLAPFRGFVQERAAQIAAGRSLAPAMLFY

GCRHPEQDDLYRDEFDKWESIGAVSVRRAYSRCPESEETKGCKYVGDRIWADREEVTGLWDRGAKVYVCGSREVGESVKK

VVVRIAVERQRMIVEAREKGELDNLPEGIVEGLKLKGLTVEDVEVSEERALKWFEGIRNERYATDVFD

 

>CYP507A1 Neurospora discreta

estExt_fgenesh2_pg.C_170074

89% to CYP507A1 N. crassa

MALTELLGSFPLVSSGMPKFQVAAIYLAIGLVSWYILSSISAWYRLKAFPGPPTTGFSNLWAARAIWTGKAHQIFPATQE

RYGPLTRIGHNALMVCDAATVVHINGVRGGYARSKDFYDCIRMDPWDHTVLSESDSAMHNERKTKVYAGYHGKGEMDMEK

DVDMVVAQAVELIRAKYMNSAATSGHGSKPPLDYTRIARHIAVDSVTQTGFGKAWGDVREEKDHFGWLGFADMIVGYLHS

LAYVPAISKIVVSKPLMVLLGPKPTDKTGMGAFLGLIEREVAKRFKDGEAKGTPLKADTGRSSMLDEWVKNGISQRTAVL

EVSAQLPAGSDTTASALQGTMLYLLSTPSAYVRLKSEITTAIRDGRISSFPVTDQEARKLPYLQAVLHEGIRMMPPLMNG

FPRQVPPEGDTICGHFVPGGTAIIVNYVGMLRDKQVFGEDADVFRPERYLDGTDEEKRHRMLKVTDLAFSHGRWRCLGQR

LAWLQLQKVVVEFIRNFDMQIVDPMHPCRLRGYCTPEMDDLMVRVAEAKLD

 

>CYP526B1 Neurospora discreta

estExt_Genewise1Plus.C_150007

94% to CYP526B1 N. crassa

MSSLVQRSIPFFDNISNFTNPLLIVITVTVSLYSLYRWLLPKPIPGIPYNPQAAKSLLGDAPAMIKEVSATGEFRVWCAK

QMKQMNSPICQIFIRPFSKPWVLLADFREAKDILMRRKEFDKSSFLSDGMACMGSFHGIYMTGEKFKANRQLIQDLMTTS

FLNNHVGPAIFGKGLELMKLFETKMLLSRGRPFSVKKDFEYTSLDVMLEFAFGKNWVHTSLGPQMELVGKMQAQDVDAMM

EGKDPIEPVVFPMVPLVDFLNSVYEAPEIVERTINALMPKLQTWWWSKQSWYKHIFDAKERAMKEQVEIAISNFQSGCIQ

TGIEHMLMREASRAEKEGRAPDFRSKVLRDELFGNIVGGHHTTSGAMMWLTKYLTDHPVVQSNLRSVLYTSLNAAKQENR

LFTFEEIRHAKLPYLDAIIEEMLRINAVPVTREALTDTTILGCPIKKGTQVFFMSNGPGFLSPSFPIDESKRSESSRTSK

INARWDETQDLAAFVPERWLVRKREGNGLLADDVEFDGAAGPQLVFGLGPRTCWGRRLAYMEMRIVIAMLVWSFELLKTP

PALSSYAGLEGIARVPQQCYVRLRKL

 

>CYP527A1 Neurospora discreta

estExt_Genewise1Plus.C_90116

92% to CYP527A1 N. crassa

MLQELLSLVQGPYALPFLAASLVTYLLVSTIITYRRLSHFPGPFLASFSPLFMLKVWSSGHHADGYSRLNQQYQSSLVRI

GRTDLITDDPAIIRHMNGARSAWGRSNWYRAMTLDPRGGSLFDEPDTKTHDMFKARLSFGYSGRENPGLESDIDEVVGTL

IQYIKSRYISDDERGVLERMDLAKVTQFFTLDVITRIAYGKEFGWLETDTDQFEWTSTVKKAVPANSLVAELPLLQKIFL

SNWFLQWFGPKHSDPSGMGRVMGMAREMVARRFGEKAEDRKDMLGSFVRHGIKQQACEVEVLFQILAGSDTTAVAVRSTF

FHLATSKKAYVRLQEEIDRAVKEGKISSPIRAEEGKHLEYLQACVYEGLRMQAPFSGLCMKSPPKGGDFINGVFIPEGTR

VGHNFGGLIRRRDIFGGDADVFRPERWLNADPAKRLEMQQATEMVFGYGRWACLGKPVALMELSKVFVEFFRRFDLQLVE

PKNPWHEFNVNMCFQSDLWVKITERFPEGKNQGLV

 

>CYP527B1 Neurospora discreta

estExt_Genewise1Plus.C_20111

96% to CYP527B1 N. crassa

MTLPTKASLASFLDPSHVTNASPKAILLTTFSLLIVYYITSSIIAWYRLRHFDGPWLGKFSYLWIFKIIHSGQMGEAAHA

AQDKYGGVEPGYPSTVRIGPSDLITTELDLIRRMSGARSRYVRSDWYKLNRLDPYDDNMFSTTSTTYHDKLKSKMAPGYA

GRDNTGVEKDIAYVCGKLVDKIRAKYAAPKGSTSPAGREMLEFGQMAQYFTLDVICKTAFQIEFDHITKEEDVFGYIYMV

HNLVYGNAMAATIPIIGKILSNPLFLKIFGPTTKDPRGMGLIMKVAREIVAKRFAPDAKDQQDMLGSFIRRGLTQRQCET

ESIFQILAGSDTTATGIRSGLLYLCSNPRAYTRLQREIDDRIASGLIPSPCITNAESLSFPYLQAVIYESLRMRPPFDGL

PFKIVPPEGDYTRDGRFIPGGTKITATFGAMQRNKEVFGVDSDIWRPERWLEEEGCDAERRREMKSVVEMVFGYGRWQCA

GKMVAMLELNKIFCQLMRNFDFQLANPTQPWKSRNYHIFFHDDFYLTVTDRHSKTEDEKSG

 

>CYP528A1 Neurospora discreta

scaffold_9-snap.53.1

81% to CYP528A1 N. crassa

gene model does not appear to be assembled correctly. Two sequences removed.

mRNA may be needed to decide this assembly.

MSLATLQDVFTTAFSFLKTSTSLLHKSTRSLLLLVFVIVLAISVYRLYFHPLAGVPGPRLAAVSNIWHAYHARNGRMYLL

GKSLHKRYGPVVRVGPDELWFDSREAFKTIY

ISTLLTKPTLSFHFSPFKSPLPSLHVQLHHPETLDLLSERHLPRYRLQR

RLIGPLYQLSSLKKFEPQIDAVLDHAIAQLRTLQGQEVDLKEWMHIIAVECLGAVVLGWSPGYIRDKTDGGTSTQGYRSW

KRKSVFGLFPSVTILSFIEGGPLKIGEKIGKGISRWFSNAWGVTFATPKGFKPFFTPVYQRVSKRVSMMRVMEDPK (0)

MEEKGKNDLLEDLIKLHLAKPDQFTETYLRRMATTNFGAGHETLCSALTACMAMIGTHPAVQERVAEE

VGPHLRAGADGTVPFDTTARQ

LPYTLAAIKEAQRLHPVIAMSLSRTVPRDQRTGRILL

HGHWIPKGTTVGCNPVALHRNRDIFGEDADVYRPSRWLs (1)

qgaekkrLREMLHLNLTYGGGAR

TCPGRHLAELIVWKVVPRLVGEFQVQVTHMPGEEDMERYFMSMLTGVKVRFLER

AHRGRGGLKRSAEGMVEN

 

>CYP528A1 N. crassa AABX01000356.1 cont3.332 NCU05849.1 revised

appears to have a 14 aa insertion in the beginning of exon 3

8219 MSLPTLQDVLATSISLLKTTTPLLKRITSLLLKTTTSLLFIIVVTILAIA

     VYRLFFHPLAGIPGPRLAALSNIWHAYHARNGRM YLLGKSLHKRYGPVVR

     VGPNELWFDSKEAFKTIY (1) 7866

7779 SAGSGFEKSDFY (1) 7744 remove

7659 LSTLLTKPTLSLKFSPFKFP

     FPNLQLPLQIHHPDTLDLLSERHLPRYRLQRRLIGPLYQLSSLKKFEPQI

     DAVLDRAIAQLRTLQGQEVDLKEWMHIIAVECLGAVVLSWSPGYIRDKSD

     GGTSVQGYLGWKRKSVFGLFPGITILSFLEGGPFGLGERMGK add

7173 GVARWWSNTWGVTFATPKGFKPFFTAVYQKVSRRVSMAALLWMSDE (0) 7066

6953 MEEDKGKKDLLEDLIKLYQSKPEQFTETYLRRMAMTNFGAGHET

     LCSALTACMAMIGTHAAVQARVAEEVGSHLRGGGTVPFDTAAKQLPYTLA

     AIKEAQRLHPVIAMSLSRTVPRDLDGGGVMLHGHWVPEGTT

     VGCNPVALHRNQEIFGEDADVYNPSRWLP (1) 6490

6154 LERKRLREMLHLNLTYGGGARTCPGRHLAELIVWKVIPRLVAE

     FRVEVTHMPRDEEKNMERYFMSMLTGVKVRFLERREDSGDMA* 5897

 

>CYP529A1 Neurospora discreta

estExt_fgenesh2_pg.C_90006

96% to CYP529A1 N. crassa

METSNLTLLILYLAIPSLLISAVQQILSWRKKTGLVGSSGSKAKFPGPRQFPIVGRIHDLPRFSLWLKFKEWADEFGPIY

TTSVPDATFVIISDEKIAEELLVKRGHIYSGRPQIRSLIGHKEGVVYSALMDRHDTWKSQRKWAHAAMAAAYKHHFYGHV

ESEMRRFLVVLLFDPDRFLDHTREYCGRVMSRLAWDDATQGRLNGASADKTLHCMSVSGPITNTMTPLWSLPASINPWYK

YEVKREAELRQWWLGLFRKAKERMRKGELPSDTWAYRYFEQMLQDTAPSMPATARAPGPDVKNAEKSPSAAAEEAYEKED

ALDQPEKDETFASCMIGFLNLVGVVTISGPLKFFQMAMALHPEWQRKAQAEIDEVCGDRMPTMKDFEKLPILRACLKETV

RWRSGVPLGVPHQAERDDEFRGVKIKKGTIVLACEWTLNRNPEKYPDPETYNPARYLDPSYPTFQAPLTRYPNFREGSSM

HSFGWGRRTCLGQNIVDDEMFVFGAALLWAFDVSPKTCPVTGKEVPIDTQKTNSHVILEPVDFQLGYKVRKGKKELVLEG

GKEFFGTV

 

>CYP530A1 Neurospora discreta

e_gw1.4.267.1

89% to CYP530A1 N. crassa

MAVITTYLPIVVGLALLIRLLMTGRRPKNYPPGPPTIPILGNLHMLPTRDVHLQFEKWAREYGPVYSLILGTKVMVVLSG

DRAVKDLLDRRSYMYSHRQEMYIGQTLCSGDMRVLMLGYTPKWRMSRKLVHALLNISSAKSYVPYQMLENKQMLYDMIIK

PDEFLYNIRRYSNALTTTMVYGWRTPTYNDEKMQQLFDGFSEFVEMNQTGMAGLADFFPILRYLPDFLLPTCKKAKELHK

KELGLYKGHWLKAKEDTLKGTITHCFCADAVSVQKTEKFSEEEAAYIAGSLLEAGSDTTSSTLYAFVQAMLLYPDVQRKA

QEEIDRVVGPDRLPTLDDEPNLQYSRAIVKESLRWMPTTIMGGVPHAVTQDDYYNGYLIPAHAAVVNNVWAINNDPVRAP

EPRKFKPERYLNDKLSLADSAANPDLSKRDQFTFGAGRRLCPGIHVAERSLFLGVARMLWGFNIAPKVGEDGREIIPDQE

KLTQGFACMPEEYPATITPRDERRKAMMEEEWVVAERECLDAETKQWKQGLNWVPKLSFAKA

 

>CYP531A1 Neurospora discreta

estExt_Genewise1Plus.C_30974

96% to CYP531A1 N. crassa

MDSHAGLDGILRPQVLKLTLRILPSPFVSLVVIPVLSVLGWYIISWATNPLRKYPGPFLAGFTNWWRLYQ

TRTGRYHEIIYDLHKKYGPIVRIGPNTLDLDYPELIKTIYSTDGKWLKTEFYHNNSAIVNGKITYHIFST

TSPTEHAKMKRPVAKYYSTSYVQALEPHVDVVLNDFCKYVEERFINVPGGPKELDFGEWLGYHAWDLISS

VTFSRRFGYMEHGSDFDGTIEKAEAALAYFQTVGQIPILDYFLDKNPIKRVGPPNLVHPARIAVQSFVAR

LQGKDENYDPKYPDYLQHFIDSKESHPDLVDDNQIISDVLVNLLAGADTTAIALRAVFYYMLKNRSIYNK

VSAEIQAAGFDRSKPVPYTGARQLPYLEACVREALRIHPAAAMLLERYVPAGGITLPDGSFVPAGTVVGL

NPWVVSRNKSIFGEDSDTFRPERWLQQPGEDDEAFHIRMQKWNAADLTFGNGSRICTGRNFAMFELYKVC

ATLLHRFDIELADPTKEWKVWGSWFTIQKDVIAKMKVRA*

 

>CYP532A1 Neurospora discreta

estExt_Genewise1Plus.C_60876

95% to CYP532A1 N. crassa

MITDAILKVLAQHWPAILFLILVGWLVKNKYHNGLNKYPGPFLASLTDWWRFIDVYKRRPEVTHIALHKKHGPIVRLGPN

TLSFSDPEAIKTIYGLNKGFVKSDFYVVQQSTVKGHNLPSLFSTTDNEFHMQFRRCVNSAFSMSALVQYEPFVDNTTKLF

LKQTEKLYVEGGAKACDFTRWLQFYAFDVIGEITYSKRHGFIEHNKDIDGIVSYLTKLFNYVAPIGQIPLLDRLFLKNPL

YLKLSQWGLIDGTMPVAAFARARMAERLPELQTEKTAILPTSEKQAQLKVQTPDLLSKFLAARPARPNFMTDTLVQTMAV

SMAFAGSETTAISLSAVFYYLLRTPRALARLQEEIDEAARQGKFSDYETGLVTWAEAQTLPYLDACVKEAFRLHPAAGLP

MERVVPPQGMEIVPGQFVKGGTIVGVSAWVLHRDESIFGQGVEEFRPERWFVDETASKEGKREEEEKRIKTMNGHMLQFG

MGSRTCIGKNISLLEIYKLVPTMLRRFEIDFDDPNREWEIVNAWFVKQNNFITRFKLRDIVMPENKE

 

>CYP533A1 Neurospora discreta

fgenesh3_pm.C_scaffold_14000109

90% to CYP533A1 N. crassa

MINLFMGDFGIGPSSDVVTSDSSAISAISAPATGFQFIQQSVDTVAGIAIGLFIGYSAYKNLSEAYRRGDPHRKAPLPPS

PPGDFLLGHYRHVPENESFRKYSEWSKEYNSDVLYFETFGTKWVVLNSYEAAHELLDNRGRKYSDRPRFVMFEEMGWAPT

LTWLRWGPQWGLHRKVLSPPFTKTSCVSFQPLQRKQAMIMCKNLIENPKEWMSAVTHFSVSIMMQISYGIDVDTPTHKWV

KLAAEASEAVGKAGAPASSIMDRIPWTRHLPDWLPFMERLKYAHENKQAIQNITERPFNESMSDYHERYRDPTRKLKECF

VHRMYHLRGEDARRNRQNVYYEEDIKGGAATMLIAGNDTTASTVNLIILYLTKHPRVQRRAQAEVDYILLTTGLPTEPVE

DYRPTTPAPWASSSSNRAGTIRLPTWKDIPKFKYVNLILQEVYRINPLSPLGIPHASVKDSSDIDADGDDTYNGMRIPCG

TIVYPNVWAMNRDVKRYREPERFFPERYLPKEEGGWGEPLPVGNFGFGRRACVGQHLAENSLLIAMAMMLATIEFDLPIG

PDGNLEDFEPQFSHKGQSIVLPFNVSIRPRSPMVEELLNRHILVAKMAEKAAEDVRGKKGGPTPSA

 

>CYP534A1 Neurospora discreta

fgenesh3_pm.C_scaffold_1000944

90% to CYP534A1 N. crassa

MRLNLLGTLLGLFLAWAIYKIYAGFRTNIAKARKAGYPVLITPIYPLSPLWLTTRHFLLPILTRLLPSRLYASYVFVMTP

DWEYHPSPCSHFARLGSDTFVVASWNGLACYTSDAAVIHQVMSRREAFPKDTQHYGILEIFGSNVVTTEGQVWRMHRKVT

SASFNERNAGHTFREAVRQTVGMLGGWFSSSASSSSAGSQEERRREGDVEMTGTITTLEHDTKRWALNIIGYVGFGLKLF

WPHESMPADMDPKLAKYGSLQPPSGYSMTFADSLATVLERILILLLVPSAVLKRIPPRWGSWASKLHEAWEAKVNYTKYM

NAFLAEKVQDIRAGVQEREGMNIMGQLVRSKYDPSSSEKKDGATTKLEDSDIMGNAFIMTLAGHETTANVIHFTIVELAM

HPEVQRRVQRDIDAIFGRDSDPETWDYEKNINALLASYIGAVINETLRLIPPVVVTPKRVADTDQWIQDDGQRHQMPAMM

PVMPVISAVQRSRRYWPALQDKATTKQGDADDLDDWHPDRWYLPSVSRGQSPTDDENGEGNQQQEEHYGGYQGLDTSPTL

FRPVRGSFIPFSEGARSCLGRRIAMVEMVAAVAVLFQKYSVELAVDASDEEVQMMETEQRRSVYSKAQKKAKETVQQAQS

VVTLKLTMGRHVPGLF

 

>CYP535A1 Neurospora discreta

e_gw1.4.292.1, fgenesh3_pm.C_scaffold_4000422

86% to CYP535A1 N. crassa, missing C-term, added below

MGTAHLIYEARWLLTYVLLAIWVVLKIKQYYRLRHFRGPIGTGWFEFWHGLAYLSGNSHIKFKEATDRYGPIARIGPNEL

MTTSIDLLAHINGARNKYMRTRWFYIAARFQPNRDNILSEPNDNIHTKRRAQMAGGYSGKENRELESSVDTHVAELVRLI

RTKYCSTEIKTNPFDLAKKTQYLALDIISHIGFGEPFGCLLSDQDVNGYMKDAEQGLDALIYLWGFGLTELVLGTPLMHL

LGRSDKAKTGFGAMTANTRRIISKRLEDDPGMTKGSDMLASWFRHGLDKEQLVNESIVQLLAGSETVATAIRCIMLYLVT

HPRVYVKLQTEVDAAVQDGKAPPYPSVVSNATQRQLPYLWACCKEGMRMHPPATNSSQKKVPPEGDTVIVEGKTVYLPGG

TNVGYCTWGLNRDQKIFGADANCYRPERWLNEEDPKKLAQMNLVHEMLFSYGKYQCLGKPIALSEIGKTIFE (0)

LMRNSDWNITNAAEPWKETNASSVFMTHDFLVEATERSAF*

 

>CYP536A1 Neurospora discreta

estExt_fgenesh3_pm.C_30692 [Neudi1:154377]

94% to CYP536A1 N. crassa

MGVVLMVKDGKVSPTRVVVVTTATVLASYWLYILLFAIVIRAAYKRYASPLRKYPGPFLASCSRLWKVLS

TARGRTHIDHIELHRKYGPVVRIAPNEVSLASPEAARTLLSAGKRFFKTPFYSVFPPAENPDVFTEIRED

VHAQKKRVVNVPYSMAAMQQLSPFIDDTIELLVRKMDEHIAQHKGVFDLGDYLHYFAFDVLGEVAFSRSF

GFLAQGRDVDNAIKTIDKSQTYNGIVGQVPELDHLLRKNPLWRFIPWLSTKNAPITRMALEEMGRRQPFN

KDTAVLQTGDTRQDLMASSILGHLKSPEKFGVGDVFAVAHGAIFAGSDSTASTMQSFFYHVLSSPFTYQS

ILYEIQWAVATGVIPATGNLNWNQAQSLPYLQACLKEAMRLRPAVGLNITRFVPPEGAELDGYFFPGGTS

IAVNGWVLHRDKVTFGQDADEWRPERWLESEEEARRMERYMFQFGGGSHLCIGRNLALLEINKVVPRLLR

DYRFELTHPGQELKATASFFVVQSGLEVFVRRA*

 

>CYP537A1 Neurospora discreta

estExt_Genewise1Plus.C_50619, possible gc boundary after NRLH

91% to CYP537A1 N. crassa

MTLLLLLPIIIFLLHNLFYKPLTSPLSSLPGPFYTKFTSLVLKYHELRAKRTRWIHALHLRYGPVVRIAPNEVSFASREG

VKEIYGSGGSGFDKSGWYDLFKIYGRRTMFTFLKKDD (0)

HAKRKRILVNRYANSNVMRQPSLSGIVERADRVVKRCAESLGGSLDLY (0)

HTGLHSYAYDCVTHHLFHPYGADSLRNEQDEKIMREITFDDSLQ (1)

RQLSYYSPTLHKAISKILYICGVKPRETPLADKFILDTAAKTDAAPFTLLNRLH (1)

NSKIAQIDQLDIAAEILDHMVAGIDTTGDALC

FLMWELSQPRSHHIQTKLREELLSQASSDINFDKLPYLDAVVMEGLRCFPAIPMSLPRIVPRGGKTIDGYFLPEGTTASC

QAYSMHRIDLEAWGPDPDTFRPERWFEQKGDAERRRLFFAFANGARGCVGKHLALAEMKLLLREVYSKFETVPDETMTEE

DMKMDDQLISTRPAGLKCLLKFEPIGGQ

 

>CYP538A1 Neurospora discreta

estExt_Genewise1Plus.C_20706

93% to CYP538A1 N. crassa

MLTPTTLLLFSPLLYLLSLVIRTALYRLRVRSLGCSPVAIYPHKDPILGLDLFRDTLRAINTHTLLPLWD

ARFKRYGNTHYTLTLGKWVLMTNEPENVKVILGTKMAEWPIDGPRLHASVQVLGRKSVFTTNGAQWREAR

GMIRPSFVRDQVADLHCFAKHVANFLNAIPKDGSTFDMQELLLSMTMDSSTDFLLGYSTNSLLEPSPEAE

QFLEDFEYTSREAAKKSRLGTLLHLLPNGEFRAAVTRVREYVRAYIRKSQAEKTDKKERDYVFLHEILKS

GADEEHAIDQVLSVIIAGRDTTAAAMTACFYYLARNPEVVQKLRKEILDVEDEMPTWEQLKNMRYLNMVI

KEALRLFPPASTNSRAPVKDTVLPRGGGPDGKQPILVPKGQVVRWSLYSLHRRKDIWGEDAYEFRPERWD

ENLRVGWEYIPFSGGPRICLGQQFALTQIEYALFKFFRAFKSIEPRDDDGPLLLRTNLTVTFAKGCLISA

TPDSN*

 

>CYP539A1P Neurospora discreta

fgenesh2_pg.C_scaffold_7000212

91% to CYP539A1 N. crassa, added back EXXR region

MCLVEDVAGSLSLKNTPIILGGLLLGLIVFRHLQVVWQNFRINSTGLRPPRIRDTGLYGTKFIRTTIKMA

AEHKHLQFWQQMFRSIGGYTAEVRLVGRRIIFTSEPENIKAILATQFGDYGKGEGFHREWKNFLGDSIFT

TDGDIWHASRQLIRPQFIKNRVSDLECFENHMQMLFRTIASGGALNGEDQMVDMEAGNGKPVDISDLFFR

YTLDATTAFLLGKDIKSLSTPVQPFADAFQEVQRVQSVIARAGPLNRLVPRKTFWEGMKVIDETINFYIE

RALRLDEEELANKSKGDEGYTFLHALAAFTKNRQVLHDQLMAVLLAGRDTTACTLSWTIYELARHPEAVT

KLRAEILSVVGPDRAPTYDDLKSM

KYL*NVMNETLRLYPVVPFN (2)

VRMALRDTTLPRGGGPDGSQPIVILKDTPIGYSTLAMQRRPDLYP

PVSEKFPDSEIFSPDRWFHWQPKPWQYIPFNGGPRICIGQQFALTEMGYVLTRLFQRYDRVVSYMDEIDG

GKPRMKTDIVLMPADGVKVAFFEAKRE*

 

>CYP540A1 Neurospora discreta

estExt_fgenesh3_pm.C_20016

96% to CYP540A1 N. crassa

MSSQTFFLVGDEPSTARGIVVDPKWKLEELKRAVGLAHHIAVPTGLTFHFDADDEQELKTVEDVLKASGPVACRIDGNPV

RDPQGPEGLPIVGSYYEIFPDHLGNHYRLFRKYGHVIKTTNMGRTNYLTDDPAVALVALAESAYFTKKITEEHPLFGIKD

NSAIFIGDTETENWRLAHKFLPPAMGPKAVRHYTPLMQECVRGSFRIFDELDSRGESWNVYQYMVKLASQTVGKFAMGFD

YHHFDAVDTPLHSLVTNIVKMLSLNKKVTARGSWYQQLPFGDPARLREIRKITYGQLAEAIESAPKSGIEKLPLNEAATK

ASCVADYLLNAVDEKGEHFPKGLILSNMLVVTGAGYTTTSSLLSWCIYCIVTYPKMQDRLLQELIDHGINGETEWDPDLA

HSLPFLDAFLKETQRLHNASFQPGRTTKTDVVLPGGFRLPENVIMIPALYAIHTNPEHWHDPFRFDPDRWETEEVKNRHR

GAYMPFATGPRSCIGFNFALLEIKVLLSELVYRYKFAREGFEAIEYDPEFQLIRPLNLYVTAKRRTEWPAKSSA

 

>CYP541A1 Neurospora discreta

estExt_Genewise1.C_130023

93% to CYP541A1 N. crassa

MSTPIPQPPGIPVLGNVFDITPSNTWWSLKALAEKYGEIFQIKILGKTIVFVASAALAEELCDEKRFQKYVGGPIVEIRA

TVHDSLFTAFHHEQSWGVHHRIMAPVLTPQAVSGYTDDISLCATEVIQKWASLGDSNILEPLVDLNLLTLEATALTLFGQ

KLDCIQAGYHPVIQAIEDAVSEAIMRPTRPGLVNWLLYSSKFKKATKTLRTWAADTVKYRQENPTDKQDMLWALMNAKDP

ETGKGLSHSEILDEIVTMPIGSATAPCAVTATIYYLLQNPEVVTKARKELDRVIGTGPLKDEHLSQLHYIEGITRETLRL

SCAAPGFNIEPIPRQNKADKSPLLLQGGKYQVAHDQKLIIVLAGVNRDPAVFEDPLAFRPERMMGDEFDRLPQGVKKWFG

NGKRRCIGKEWAKNFLKIVTARLIHEVDFEVADEGYEFRQDGWFQIRPVDFRVRVKPRVRA

 

>CYP542A1P Neurospora discreta

fgenesh3_pm.C_scaffold_2000176, stop codon in PERF motif, add green regions

88% to CYP542A N. crassa

MASTTAFFSHLTTITSPSLTITLLITLLLPCLTFYTIYIAIYRLYLCPLADIPGPRLAALTQWYEFYYEVILHGQYTFKI

IELHKQYGPIIRINPWEVHIADPDFHRVLLPTNTNQRRHRTPFFTKQFGADESIVSTNDHDLHKLRRSAVGPFFSMQNIR

ALQPVIEERVDALLARLRDHGKTKKEISLSMMYPYSAMSYDIISEYCFAKSEHAVEDPDFRAEITNGILTGSNYGKIFQH

FPFLVPFLASIPPRMLAAISPFYRTFLHLRACITAQIGEIEKSLRSEEGKNAHLDIPHPTIFRSFVNTEALPPIEKSVPR

IAQEGQVIVQAGTVTTSWALTISTFHLLDQHTTAPTKLRKELMEAIPDRDEPVELARLEQLPYLRAVIKESMRLSVGASG

RITRVAPGETLRFKPSKLCLRCFPDHVKTTAAADKEKEWLLLPGTEISMTSYQITTNPEIFPDPHAFVP

*RWLGRENEMRLER

YMTVFGHGARV

CLGMQLAYAEMYLLLSKMWRVWEGGPQVGGDEED (1)

GRENAKEKGRK

DGQTVGRMRLAEGVTVRDAEMAEDWFIPVPYRGSKGVRVYFEIY

 

>CYP543A1 Neurospora discreta

estExt_fgenesh2_pg.C_50051, there is a C-term extension on this seq

90% to CYP543A1 N. crassa P450 part, 84% to the whole seq.

MPCVFAISVLTLLVVWLVVQRWRERKRVLGGSRPLPGPINLPFIGRVHDIPEKGSWLKFHEWSKVYGPIYQTKMFGVTHV

WISSEKIAHDLLSRRANIYSDRPQIPNLPDNRTSGDYLALLGRNDTWRRQRKLCNHLMHSSALASLHDYPTLERNRFLYL

LSQSPEDYIEYIEQFTSRTIARLSWGSAHPAQILRHTTFGLLETISPSGALPNVISFLRHLPQALSPWQKKEKARHELEE

KQFRSNIGFVKRMMEGGRAEPSFIRTYLEERGFNWTKKGSGASPDEQKQAKEADDEAMRVVGLMAIAGALTIGSPIQSYI

LAMCHYPEWQARLQEEIDRELAGRCPMWEDREKLPLLRAVVKEVIRWRPPVPTGIPHAIEKDDVYNGYFIPAGATIHALE

WAITRDEQTYPQAETFNPSRFLLPSFPTYREPLTLYPNLSGFSQFGFGRRTCQGVPIVEQDLFLTMGGMAWAFTISKKRD

PVTGTEMPVHWNDYTPLLIAKPCRFPFDAVPRDQDKMRKMREMYDQ

AVEGEEVERSESREERERTEGWMVEGGVRQKEEE

IPWQSGVGSMSGDDSRGRGQDQDHAQSSPQDTSPEELDACDSNSAISSHLDLTVSGSASGSDSVIGTPSASWGSEPSLSL

RGSSAESSDCDEHEHEHEREVLACSTRSYKQEDGNGDEGMRMRMGRGRRVRIKAMSNASSTIEALMTPMTPSTPDGEKGL

PFSELGMMGMGM

DGVVDEMEVPGAWRW

 

>XM_954194 CYP543A1 N. crassa with extension

MFGVTHVWISSEKIAHDLLSRRANIYSDRPQIPNLPDNRTSGDY

LALLGRNDTWRRQRKLCNHLMHTSALASLHDYPTLERNRFLYLLSQSPENYIEYIEQF

TSRTIARLSWGSAHPAQILRHTTFGLLETISPSGALPNVISFLRHLPLALSPWQKKEK

ARHDLEDKQFRSNIGFVKRMMDVGRAEPSFIRTYLEEQQGSINSTSTNKKCDEQKGKE

AAADEAMHVVGLMAIAGALTIGSPIQSYILAMCHYPEWQARLQEEIDTELGGRCPMWE

DREKLPLLRAVVKEVIRWRPPVPTGIPHAVEKDDVYNGYFIPAGATIHALEWAITRDE

QTYPQAETFNPSRFLVPSYPTYREPLTIYPNLSGFSQFGFGRRTCQGVPIVEQDLFLT

MGGMAWAFTISKKRDPVTGVEMPVHWNDYTPLLIAKPCRFPFDAVPRDEEKRKKMREM

YEEAVEGEEMERCESREERERTEGWMVEGGVRQKEEEIPWQSGVGLQRQVEGDVGAGV

GAGGGGASSEDRRGQDHAQGPQDTSQEEPDDASDSHSTTSSRLDSTASGSGSVIGTPS

ASWGSEPSLSLRGSSVESSDCDEHEHDELRVVTRTTPYKGEDGDDDGNEGMRMRSMGR

MRGRRVRIKTMSNASSTIGMEALMTPMTPTTPEKEGLPFKEMGIMGIMGM

GTMKLGIATRRVMEVEDMEDLERV

AVDDEMEVPGAWRW

 

>CYP544A1 Neurospora discreta

estExt_Genewise1.C_60834

95% to CYP544A1 N. crassa

MGIIHEKAHYAVAVALVAFLIRAFVLSQWNTIRRNGERLKKPPNTLPLVGNGLQFLQSRWKLFSWFDACQRRFGYETVAI

SVPTLPSGVLIHDPRNLDYVFKNEGIFTKGNFVKVRTWDLFGNGIINAEGDFWKTQRKAGLSFLNTANLRVLTDVALPQY

LSESSSQLRSSTNGTVVDLQHVFHEITTKLMGKMAYNASMAMHADDEFTVSFDYASGGTAERFQNPLWFVTEIFLGAELR

KSIAVVKDFGRYIVAKAVQDRQEKRFGEEEGKLDQISGSLIQSLLDAIQDEQLVADAALTYLSAGRDTTGQALTWTFYLL

MRHPRVVAKIREEATQLLKEKNVVLTPDQFDSSLFNPVTMPYSMAVFYEVLRFYPPIPFEIRQCNEDVTLPDGTFLPKSS

ILVWCLWAMQRSNLTWGDDADEFKPERFLDGNKLITRSPSEFPVFYGGPRTCLGRKMAEAIAAQVIPTMACLFDFVPTSD

EERTSKTSLTLPMEGGLPVTVKTRAGEEREIRTRVPEFLFSEH

 

>CYP545A1 Neurospora discreta

e_gw1.6.180.1

92% to CYP545A1 N. crassa

MQLLTIVIAGLLLLTVAIVHFIKAFREINDPNGIPGPAQIPYLGRVHDLPIQFMWLKFKEWADRYGEQGF

YRTMMLGSEFIVVTDEKVAEDLLVKRAKYNSDRPVIQSLFDSKSTHGSMEYLPLMGHNQYWARQRKLSHS

YLTEATNAHYYGVMYFEVQRWMARLLENPEDFQHSIEDMSSKVMCQLTWDDPSLSEYCTKSAWGLLTQMS

PAGPITNVLTPLWHLPTLINPWKKAERKRHDEQQAWWMERLLTCREKLARGELRPCWTRQFLEKTSQKTS

ISGDYEASCVIGMLALVGIFTVVGPMSYWLVSMVHNPKWQEAVQREVDEVCGHRMPRLEDAPRLPILRAC

IKETMRWKPNVPTGVAHETEADDHYQGYFIPKGTRILPFDWSGRSFLRNPVKYPDPENFRPERWLEPGWP

TYKEPLTQYPTIKGFTSFGWGQRQCLGMSLTQDELIVGCGALAWLFNLKHKRDPVTGRKLPVPLDRSNSL

LIIKPDPFQMEFEPRSEERKKEALRLWKESEAKDRAKRERWLKNVGEGKPNVIKEPKVAQPTVKIPSPSP

AAAVPAALVDEDDVMDELLKTVQVVEEKSGGANGHGGGLGEKAVIDVRKEADIRITVARLDSTACLY*

 

>CYP546A1 Neurospora discreta

estExt_fgenesh3_pm.C_60058

91% to CYP546A1 N. crassa

MLSDRLLDLFTHHKAQEVLSNVNLYQLSVVALALALTTVIIDYGYMLWLRSKMPPGPFPWPIIGNTFSLPENKPWIYFEE

LSKKYETPLITFWIGRNPTIWINDAWCAHEILEKKAQIYASRPRMVVFGELGTGQNNLVTMRILNNNDRDHWRIHRKLMH

LGVGVQSVRGYRDIQNNESKVVALDYLREPNEYVKHLERYATSVVSIIAFGRRVA

ILARFPRWLPFFRGIGYRSGG

RGGRQKGGGGHYFFHSLALEALSQYESKSPLAKASMPTPYIKTLMDESR

KYNLPESELSSLTGNLFGAGSDTSSSTLITFMLAC

CAFPDAMLKAQSELDRVIGPGRSPHWDDAPNLPYTNAYVKEVLRWRSVAIIGGQPHSNTSPDYYQGYYIPPHSWVQGNVW

AIHHHEREFPDPDRFYPDRYLPGNDHHRPFPGEKGYMTFGWGRRVCSGQALAEQGTWITVARLLWAFTIRKYRDPETGKE

EEVDIFAYTNGLNMRPQPFRCEIVPRSEEIRETVVREGEQALRDLKVLDGESRYRMSTFYQQKKREVAEMPEFDEKGNIK

MVKVK

 

>CYP547A1 Neurospora discreta

estExt_fgenesh2_pg.C_80114

87% to CYP547A N. crassa

MPLTGNPFNFARITLLALVEVLIVKKTSYRHVLPLSSTSLVLAILAINYAFFLAWKLYLYPVYFHPLSTFPAPKVVDLWR

LLARVRGKAPPGQLLLELAERTPNDGIIILLGGFGTSMLVTKPAPLADILVHHPYDFAKYDTLRSFLRPILGNGLIVAEG

EQHKFLRKNTLPAFKFGHVKELYPTMWTKAMEMNKALTEELRQRRREGNDTSIEINAWAGKVTLDIIGIAAFGRDFHVLE

RPDHPLVKNYADLLEPGPAKFVYFFLALTFSRKLVDLFPWEVSRRFNRTTTNIRKICAQLVRDKKAAMEKLGDDQFDILS

LLIRSNNFSEEELVDQLLTFLTAGHETTSSAFTWATYKLAQDGEMQSTLRSELRRALPDFPKFAPGQDIASILEHLPCLN

GVMNETLRLYPTVPMTVRTATCDTTVLGHPIKKDTQIIISPWVTNRYSENWPSRSTDFVPERWIDQEGTHIAEDGTEQPI

QKPNNTGGVTSNYAQTTFLHGPRSCIGHGFAKAELRCLLAAFVLAFEWELGMDERDIMPDGVITIKPNNGMYLNLRSLDG

HQKG

 

>CYP548A1 Neurospora discreta

estExt_Genewise1Plus.C_80575

97% to CYP548A1 N. crassa

MAFGAAHLQLWLGALFVLGAVYTSCLIFYRLFLHPLAKYPGPFLAKLTDGYMAYHAFKGDRHLEFWRMHE

KYGKFVRFGPNSLSVNSNTALKDIYGFKANVRKAEFYNAFVHPAPNTHNARDRDLHARKRRVLAHAFSDS

AIKEVERYILSNIRTFCDAIGDLGRPSFAPLADKKGWSSPKNMSDWCSWLAMDILGDLCFGKAFHMLEHP

DNRYAVDLVSVAAHRHLICGTMPMLDKLSLDRIFLRKIASGRAQYMAYSRQQLAERTALGDETDRRDFFY

YLLKARDPETGQGFTTPELWGESNLLIIAGSDTTSTAMAATLFYLVRNPTALARVTAEIRSAFASVEDIH

QGPGLQSCTYLRACIDEAMRLSPSVGGLLPREVLPGGITIDGEHVPQGTIIGVPHYTIHHNAAYYPDPWS

YTPERWLPTQSPSEKAPGATAQTEEQIQLAQSAFCPFSIGPRGCIGKGLAYIEMSVTLARVLFLYDLRRA

VGVEDPAEGGKEGAEYGRHRVGEMQLVDTFTSTKDGVMVEFRPREDLAA*

 

>CYP549A1 Neurospora discreta

estExt_Genewise1.C_100543

84% to CYP549A1 N. crassa

MLIALLAFFSIFMAYGLYYVLSHQNLLLERIFAQTIFNTLQLARLIGPLNPYDPLVFPDPITDTNSASQISEAQALATQR

IDYARSIIDFSYAGPKVELEDRLRLRALANARLVAAFGINTSLTSSSVSVHKKFRKLASASINKSRADWQKLYGVAMDFL

QHEMAWYGRTGVCLAECVRCLCFVVVLVSQFGADDKKLDKNLVKRITDEINAQWLKSKEYGGVVKTSESLNHDLGILFSN

LNTPVAEENGTGKNTSIDLSEALGLIMPQYETLWRVVLLTYVTAYYRQFDRPSLKKRVKDVPSCLGNAATEKEALKLAME

GLRLYPSNNSIYRAATSGSEPPKSANVQACHRDFVIWGRDALEFRPERFDSLTPLQEKAYFPFSLGSHRCPAFGGFGNRM

VTMLVVSMGRTLSPETGQLKFGHALLDNYIEISLPTGRDEMEEWSWDRIRV

 

>CYP550A1 Neurospora discreta

estExt_Genewise1Plus.C_130219

92% to CYP550A1 N. crassa

MTSENGIVQHTLTVYHDLSMATKATLAISIALILYRLLFRHESTRRKELPAWGPIEMGLVMYLLDRARNGIVYRIYSAIR

RYGGSFYGISSANQTLIGYEDVDRLFSSRMNHALSIEWHGYGLFLRFFGFPDTPTLKKKVESTFKPWHAPIERVFNNDTG

ATAAFERGNLPKMVSEFVSFSQEKEKMKRWELRAGIKVLKQGEAVEANLCALIMDFGACFTIPPIFGHDLLDRNPHLIED

IWKFDHVVPLLFINMPTWVPFKVMKEGIQARKRLLDGVEAFSRRVTQFQRGEAIDDGADMSDVSDVVLERNTALERNEWS

YQERAASELLVLFASNTNTQPVLFWLILYIYSTPGLANTLRHESAPFITLSDSHNRKSITAIDTSGLSRECQLLKSIILE

TLRLAFGAVSTRFVKRPITVQDGNHTHKLYPGTFLSVPHSFSQRDPSLYTDPGKFVPDRFLETDPSSGRLVAKYGKLRPW

GAGASMCRGRLFAEKELMAIGAALVMLWDISPAGGGEWKVPAMVGGPGPVKPKEEVRVVIQRRVFDGVSSSE

 

>CYP551A1 Neurospora discreta

estExt_fgenesh3_pm.C_100040

91% to CYP551A1 N. crassa, frameshift = &, modified green region

possible pseudogene

MAVLNWASSRAATLSPRTAALVVITTWLLYVIGLAVYRLYFHPLARFPGRKLAAITTWYEFYHDFRYGGK

YLFEIEKMHMEFGPIVRINPYELSIHDPEYYNELYVGSSKRRTNFWPLFQGCTDDTNVNHFMTIDHDLHR

QRRKPFDPFFSRMAINTRYWPMLARK &

AAFLESRIREHKGQGKAVRLDRAFSAFSADCIERICTDDLEPGDGFLDQPDFGPE

WYDGMLGLIRNAPILTKFPKVLSSLGYVPQRLLLWAFPQGRIANKYDERTRTQIRKAVTKQHLSKNASSE

HTTLFRALAQSNLSPADKTEQRLVREAKLIFLGGTISTGRTLGFVSYYILSHPDIKARLEDELGDIMAAW

PDVLPTWAELERLPYLQAVIKEALRLSYGFMRRLPRVSPDVAIQYKEYMIPPGTPVGMSAYLMHSNPEVY

QDPDRFVPERWLAEDTKAMQRSYVPFTKGSRSCLGQNLSMAEISLVLAVLFRPNGPRMELFETDESDVKH

VHDFVVPLPKLDSLGVRVMVR*

 

>CYP552A1 Neurospora discreta

estExt_Genewise1Plus.C_150001

84% to CYP552A1 N. crassa, missing C-term, added below

yellow regions do not match N. crassa

MPVHSAILEFVYTSARCIFVLASICIAFHLAKAFFNLFFHPLRHIPGPKLAAATYIPEFYWDVLRGGMYQKQILLMHERY

GPVVRISPDEVHCSDWRFIEDIYASGNRKRDKPLHQVRGSGGQVSRAIIVNATFSTASHELHRMRRNALNKFFSRAQVAR

LEPTVRDYAERICGKILTLGKSAPFDVTTAYSHFTTDVISGYCLGDSLGLIEQKGWEPNFREPLYAQLKLMYWLRFVPFF

KHLSVATATIARRMSKEMNTLFNALVGDMPRYVGRAQDNVNKGLDDGSSVFGALLTSDLPPSEKSLERLTDEGFSMFAAG

TETVSWALSVITYHLFANRELLKKVTTEVTQAIDAKSGQLPSWHALEKLPYLGGVIYEGLRLSYGVATRSSRVPVGEDLV

YRGKWAPKGSYVMREVQYVIPRGYAIGMSPLSVHHDETVFPDSYSFIPERWIDENNQHRKELDRALLSFSKGSRSCLGIN (2)

LAYCELYVLLSLLIVRVFPHMKLYETTETDVGHDHDFFNPFPISSSKGVRAIIV*

 

>CYP553A1 Neurospora discreta

estExt_Genewise1Plus.C_80731

93% to CYP553A1 N. crassa

MHSTMVDTVAEIESFLDTSIAAIKGLVPIIWVQSKTSLVQFLVGGIGVLVSYWLLTISPSQDPSEPPLIKPRFPVIGHLF

GLLNHQVNYFSELFMRNYLTIATLPIGNQKLYVIFDAPLQQAALKAKDMDAQSFMVDFVPRIFGVKQGTVDKLLGKDGVH

PNIMGDMEQVFKSALSGDNLQKLANTTLATMADTLNDVGSDKGTKIPNMFLWLQSLLSRSTSKALWGEKHNPFKDHQVID

AQWDFESHLGPLVLGVLPSIIARRAYVARNKVQSALLSYFSARHYETDPSTSYFIRAHTRLLKKYDLPDDELAKNEVAIT

LVATTNVLSTLFWCIAEIWTRPDLLQQIRAEALRAVFGNSQKALSGEDMGARTITIPAIGLDAKCPLLASCFRESIRLAS

QIVTARRVLKDTILTDPVSGNSYLLKADTNVMMPAKVVHRNTAVWGADAEDFNPRRFMWEELGPKVERQRKAAFVPFGGG

KHMCPGRHFAFTENLALMAALAIGFEIEGLDKSKLKMGDSKRGETAKPLPGMEGGEVVLKRRKEWEAVQWEFSC

 

>CYP559A1 Neurospora discreta

estExt_Genewise1Plus.C_130397

93% to CYP559A1 N. crassa

MAITSLSAHLLESLLASLTLGRITALGFLFIIASFAIDSLKKPTYPKSLPRVGYTGGIGATIRNWMNLAN

YHNWVEEGYHKYGKHGRSFVTPSSPSQPDEIVVPQEQIAWMLEQPETVVSTQESHKDVLFGTYNFFNVDD

HFPTKVMHKHLARNLVGLLPEIQQEVAESIDIAFGTDTENWTTLNLWETLLAIIPRVTNRIAVGLPLCRN

QAFLSSQVGFADDVFRNCLILTLFPRVLHPLVGRLVNLSNWYHFHQGYRLLKPVIEQRLRDYERFESGDS

HTPPPEESLITWLIRQAKADNLPHELTPYMIAMRLLPIEFAAIHTTVITLHALFLDLLASDPAKDYLSVL

REETTTVLQSEPNGVWTKNGLARLYRTDSAIRESMRLSTFSTGLTHRKAVAKEGITNPFEGWHAPYGAIL

MANMSVQHDAEVYEDPKTYDALRFSRVREEYEARSEEVEKGKDTEEALRIKRLGMVTTSSEFLPFSHGRH

ACPGRFFVAHEVKMMLAHILQNYDIKPIAERPRPTWVAHTIIPALDVKIEVKRRQRKN*

 

>CYP560A1 Neurospora discreta

estExt_fgenesh3_kg.C_80010

93% to CYP560A1 N. crassa

MNTLHNRSSPPEPPNSYANPFYLTIKDGIEHLNYPKTFALILITSWLLSNTAKWLTNGKRKKLTIPTWGY

RSWFEPTLLLQARFVMGARQLVHEAYTKMPNMPFVLKRYDADFLILPIRYLDELRLIPLSKLSNKGANVA

NLVPEYHGITFLLTNNLHVEVLRKKLTPELWKFIDSASSELSHGWDMSLPHAQLSANGNDWVKIDFERTV

RDLVARMTAKVFLGDPACRDETWLGISVDFSIDLFTASFTMKMFPPWMYPLIAPLIPARRRVLKQLKAAR

KIVGEQMRKHASLKEKRAQANRGEVALTEEEAQDTLLDWMLDHGKGDEVRVEEMSARQCVLTLASIHTTA

SQAANMIFDLCEHPQWWGVLQEEVDGIAKELGPPGLAGRGKDGGGVSVKEWCVRLEKLDSFFQETQRREP

PIMLGPQRLAQQDVTLKDGTYIPRGTRVAFPMLEHQMDPQTYENPNEYDPMRFYRKRHESPDQMHLHMAG

QTHPNVLGFGYGNQACPGRQFAVAEIKLIMARMLYEFEFKFADEKKGRPKTTYINEMAMTDWNARLLMRK

RVR*

 

>CYP5272B1 Neurospora discreta

estExt_Genewise1Plus.C_21110, removed two sequences

41% to CYP5272A1 Aspergillus clavatus

MSLIPFDPILLSLALILPVCYYFLAHRIVYPQPLPGIPYNQTASHRVLGDIPDLVTSVRRTKETSKWCFSQCRRLKSPVI

QLFLRPFSKPFVFVDDARETEDILLRRTREFDRAPSTAAFFRTVLPRASIVKPTDHEFKAQRRLWVDVMSPAFLRSVVAP

NIYRSTLELVELWRLKSRVRGGGRPFEAHHDLETAAFDAIWVAVLGSELGGIRSEIAAVAKDVEQQVFQTEEEHDAKDQP

ANMPVAERSDLYEAIQYLNKSIERIMASPMPVLHHWLIRQTPTYRRYETIKNREIRRILRSAYTRFQALKLSSTFDSQSQ

EEADEQHQHDTCAMDLVLRREMIFSQRKGITLPSPEKNLEMQDELLMLLVAGHETTANTLSWFVKFMAHNPSSQARLRQH

LQAAFPSSSAFNPPSAAEILSSTTQIPYLDATIAETNRLAATVPLIVRVTTVDTHILGYKVPKGTHVMCNSR (0)

VTEPYDDDNDNGMGDLESRR  (2)

AMRELDRFEPERWL (0)

EELFDPGALPVLAFSAGPRGCFGRRLAMQELRMMIVLLVLSFRFLPLPESLSGMEGRQRVLRSPQQCYVKVEVI

 

>CYP6001C7 Neurospora discreta

estExt_Genewise1.C_90088

92% to CYP6001C7 N. crassa

MSSYPNGMNGHSASTSENGKEFKSRTVIGPDPKAERMASMAKPRPTPNKLPFTGASRQGVENAFERHRQTIQSAVQPLPT

QQGAGTFSENSKWGKLSSDLMTLRWADLKTLKHMVVAKIKGERITDDKTMIMEKVIQLVSNLPSNSKLRVELTNSFLAEL

WYTLEHPPSIYVGEYYQYRKADGSCNNIMFPQLGAAGNTYARSVRPNVIRQGALPDPELIFDSVMKRTEYKSHPNNVSSI

LWYWASIIIHDLFWTDYRDMSKSKTSSYLDLSPLYGSNQDMQDTIRTFKDGKLKVDCYADKRLLGMPAGVSVLLIFFNRF

HNYTCDNLIAINEDGRFNKPSPTLEGEKAETAWKKYDNDLFQTARLITSGLYINITLLDYVRNIVNLNRVDTTWTLDPRA

DTGIDVGTKEGAERGTGNVVSAEFNLCYRWHSCISAKDEAWIEDFYYELFGKPGSDLTFHELIMGFSKFEGGIPADPAER

PIRKDKGYFTRDANGKISDDELADCIANAIEDPAGSFGAKNVPPSMRAVEILGIIQGRKWNLAGLNEFRKHFGLKPYETF

EDINSDPGVAEALRRLYDHPDFVELYPGIVAEEHKSPMVPGVGIAPTYTISRVVLSDAVCLVRGDRHYTIDYNPRNLTNW

GYNEVQYNLNLNHGCVFYKLFMRALPNHFKENSVYAHYPMVTPAENKKILTDLKRDHLFDWSRPTRQPKPHQVTTFAGAQ

HVLDHDEAKKEKGTAAYKSAWHAGLDSLLGLSLNNNNPDAHNSQRRDIHEQLYSAEWADTVRAFFAQTTDALLASESYNV

GGHLLVDVVRDVGNIVPTLFAAKVFDISLQTPTGKNNGLYTPHELYAVLAVIFAALLYDHDPIKTHQLRDAARTVARQLG

TALESAVKSQTSFFGSLLGGGGGSGSGNNPLTAYGNDLVKRLSKAGLSASDVAFGQVLPIVASSVPSIAEAFASAVDFYL

GKQGQVHLDAIRELARQPASASADAQLLGYVMEGIRLSGNALGAFRQASAMDVIKEEDGGEVKVQPGDRVFVSVKSAAQS

PTAFPNPEEVNPSRPLEAYKIFFFGTHSYLGHQVSQIALREMFRSLFKRDKVRRAPGPQGQLKKITRELNEELSQTFYLR

EDWGAVTPFPVTMKVTWDE