Pneumocystis carinii P450s

 

D. Nelson

 

August 9, 2009

 

1 sequence

 

>CYP51F1 Pneumocystis carinii

AY228706 58% to CYP51F1 S. pombe

contig_349-snap.1 from Fungal Genome DB

contig_349-snap.2 from Fungal Genome DB

MGFLKTILKVLGIENFTLSFVIIILTFFFLLHIFPQLYQKDSSK

PPVVFHWLPFIGSTIQYGMDPYKFFQKQKKKHGNIFTFILLGKKMTVALGPKGNDILF

NGKLSSLSAEEAYTHLTTPVFGTDVVYDVPNHVLMEQKKFVKTGFTIETFRAYVPLII

EEVKTYLETSPIFGKDKLSGVSSLMKALPEITIFTASRTLQGKEVRSNFDASFAKLYH

DLDGGFTPINFLAPWLPLPKNRLRDAAQKKMAQIYMNIIKQRRKTCQHEEKDMIWNLM

NQHYKDGRKLTDKEIAHLMIAILMAGQHTSAATGCWALLHLAEKPEYIKLLLEEQKRV

FGDNLDDLTYDNLKDMELLSYVIKETLRLHPPLHSIIRKVKSPILIENSPYIVPKNHY

LLAAPGVSSVDEEYFENALEFIPERWKCEKNTEDSDKIDYGYGLVTKGAFSPYLPFGA

GRHRCIGEQFAYMQLGTIITIFVHELEWTLPKNQITIPKPDYTSMVVLPERPSNIEWR

RRQKR