Pogonomyrmex barbatus (seed-harvester ant) genome

 

From Reed Johnson June 3 2010

 

112 entries

 

revised May 5, 2011

 

CYP2 clan

 

>CYP15A1 Pb15Aseq1 504aa 8 exons tail-to-tail with Pb305Dseq1

70% to CYP15A1 honeybee

75% to CYP15A1 Linepithema humile

MLDLIYLFFALACLYCIYDCIKPRNYPPG(1)

PAWLPFFGCILKFGWLRSKHGYIYTALQELSRTYGPILGLKLGNQNVVVISTYDLVKKGLLQEEFNSRPDGFFFRVRAF

GKRKG(1)

VLFIEGPMWTQCRRFTMRHLRTFGIGQSTMRERLTLEAQNLISHLERTSEHGPVLMHTVFDVAVLNSLWFMIAGHRFLY

EDPKLQEALVLVHDAFR(2)

LTDTLGGVISQMPFLRFVIPELSGYNELMRILENLWRFLDEEIEMHEKDQSNDQPRDLIDAFLSEIYKNNENEDTIFDR

(1)

ENLLVLCLDLFLAGSKTTSDTLATTFLFLSLHPEWLKILQAELDDVVGRSRPPTEDDLSSLPMTEAFLAE(0)

VQRYLILAPLGVPHRTEKNVSFNGYQIPK(0)

DTIILFDYHSVHNDKTYWDQPEEFRPQRFLDEQGRFSQSNYSLPFGLG(1)

KRRCLGEQLARSSLFLFLAYIVHYFDLETSTEHARPDLNGYDGFTISPKPYYLKLTRRRSDHPGTIATW*

 

>CYP18A1 Pb18A1 524aa 5 exons tail-to-tail with Pb306A1

51% to CYP18A1 honeybee

MLVEQITGFLSDYGFWWTVLKDNFTLFVIFTVVISFLNYFRYLNSLPPGPWGLPFLGYIPFMTPQLHRQYKKMAEKYGP

IFCVNFGCKPVVILANHDTIREAFNRSEFAGRPNTPFIGIMEGYV(1)

INAEGPLWKNERKFLNTKFKQFGAKMMNNHI(1)

DTLLRYMARHEFEPIHVSSPLSLATTNVISYLVMGKRFTNDEFLFQRFMNLTTEGFRLFSSLTMANYVPAYRIFPGTQK

IKKKIQQNREEMSMFFEEVIKEHRQKYDSNNLNDIVDTYLYEIEKVREKGEENFEDRFEGRDVE(1)

RHLQQIMGDLFSAGMETVKTTLEWGIFFMLHHPNAAEAVQNELDQVVGRSRLPNLQDMDQLPLTKATIQEILRKSSVVP

LGAPHATTR(2)

PTTFQGYHIPANSEVISLIYAVHNDPELWGDPEVFRPERFIKSDGKIDKPPKYLMPFGVGQRICLGEKLARYELFLFFS

SLLHTFNIRLPEGASLPSIEDGILGTTFAPQPFKICLQMRDSILIDGNANNEFVRNVGA*

 

>CYP303A1 Pb303seq1 498aa 10 exons .

61% to CYP303A1 honeybee

76% to CYP303A1 Linepithema humile

MLTTAMLLLIIILLLLYLDCQKPKGYPPG(1)

PRWWPILGSLLEIARIRQETGYLVKTCSALCKKYGSIVGLKIGTDRIVVLNDLESIQAMLNNPDCDGRPNGPFYKARTW

GRRLG(1)

LIVVDGKLWIEQRRFVLRHLREFGFGRTSMATIIEDEALKLMEHFKKLLQNI(1)

SQSAGMIIPMHDAFGVTVLNTLWRMMAGKR(2)

YDTGDKELIHLQRILTKLLKEIDMIGAIFGHFPFLRFIAPEMSGYKAFVETHRELWTFLK(0)

EELYNHKNTYIPNLPRDLMDVYLTVLNSKNCTDTFSE(1)

SQLLAICVDLFIAGSETTSKVLGFGFLNLILFPHVQKKAHEEIDRVIGRDRFPTLADKPS(2)

MPYLHAIVLESIRMFVGRTLNVPHRALRDTSIAGYKIPK(0)

DTMLIVNYNTILMDETWDNPEDFQPERFLDDDGNIVTPEKYFPFSFG(1)

RHRCMGETLARSNIFIITATLLQAFTFSVVPGEPRPSTQEFVDGATAGPKPYRALVTLRT*

 

>CYP305D1 Pb305Dseq1 487aa 8 exons tail-to-tail with Pb15Aseq1

50% to CYP305D1 honeybee

66% to CYP305D1 Linepithema humile

MIVVVVTVVILTLFLITALRQRSNCPPG(1)

PFPWPFIGNQYYLQKLSRELGGQHLAFQYLSKKYNSGILSLRLGNQDIIVVTDSKIIHEICVTEEYDGRPWNEFTKLRN

MGLRKG(1)

ITMNDGPEWRELRHWTVRTLRNVGFAKREMMELLVDELAIILEKLKSNNVQCIRPVIAPAVINVLWMLVTGKRPSEDLS

R(2)

LQTFINLLERRAQCFDMTGGLLASFPWLRYIAPEMSGYNLLVALNNELKDFVI(0)

DTINEHKKRYIKGSEMDFIDMFLYEMYSQQDNIVFSD(1)

ENLLVTLIDFFIAGTNNTAATLDILFLQMANYQDVQRKLHEEIDTVIGSRFPVIEDRVK(2)

MPFTEAILTESQRLWLVTPIIGPRRVLANTILDGYKIPKNAIILMDAYCNNMNPEFFPEPTSFKPERHILKDGTHKPHNILLFGKG(1)

KRRCPGEALARSAMFLLFVGVMQKYRLLPMPGEKFIKMELSAGLTIAPKPYEMLILPR*

 

>CYP306A1 Pb306A1 488aa 7 exons SEQUENCING ERROR extra 'A' at 138172; tail-to-tail with Pb18A1

62% to CYP306A1 honeybee

70% to CYP306A1 Linepithema humile

MISLNLFGLLLILLLIYVLRKNRKTFQRLPPGPSGIPIVGYLPWIDAKRPYLTLTELTKKYGPICGLQMGSIYTVLLSD

PQLVRQALAKDVFAGRAPLYLTHGIMQGYG(1)

IVCAEGDRWRDQRKFVAGCLKNFGMVKLSGTKRDRMEERILAAVNESIS(0)

RLKRLPMEGGIDPLETLHHCLGNLMNDLVFGKVYENHDEVWKYLRYLQEEGVKHIGVAGPLNFLPFLR(2)

FLPRYKKIMTLLIGGKIKTHQIYQKIIDDYRARPEKTDNFLAAFNEAMSKADNEYYTQQQYYHLLADLYGAGVDTTLAT

FRWILLFMALYPDEQ(0)

KKIQNEMNELLGQKQPILEDRPLLIRLEAAILESQRLRSITPVGIPHGAIE(0)

DTQLNGYDIPKGTMIIPLQWAIHTNPMYWDDPLSYKPERFITEDGSIVKPKAFLPYQMG(1)

KRMCVGDELAKMILFLFTARFLHSFIISVPLDTQLDMEGICGLTLVPKSHRLIFTSRE*

 

>CYP307B1 Pb307Bseq1 505aa 3 exons .

71% to CYP307B1 honeybee

84% to CYP307B1 Linepithema humile

MIFVSTTTCFLLAVVLVALALIIVDYIMSKKTPKKLYDGEESSLQDPPGPRPWPILGSLHILGRYDVPYKAFGDLVKTY

NSQVIKLKMGSVQCVVVNGLENIKEVLITKGHHFDSRPNFIRYHLLFCGNKENS(1)

LAFCNWSDIQKTRREMLRGHTFPRAFTTRYNQLNGIIGGEMDWLIDHLTSISGVSLHVKPLIMHTCANIFIKYFCSRSF

SLDYIPFREMTENFDKVFYEVNQGYAADFMPFLMPLHQRNMTKMANWSHEVRKFVEKNIIGDRVTSWRSVIPEEDYVDC

LINHIKTDAEPKMSWEMAMFALEDIIGGHSAVGNLLVKILGYLVIRPHVQKIAQMEIDGVETPSAFVGLENRGSMPYTE

AIILEAIRLIASPIVPHVANQDSSIAG(1)

YKIEKDTFIFLNNYDLNMSESLWISPEEFMPERFVQNGKLLKPEYFLPFGGGRRSCMGYKMVQYISFSTIATLLKNFNI

LPVEKEIYKVPIGNLALPQDTFRFRFERR*

 

>CYP343A1 Pb305Aseq1 506aa 8 exons first exon a guess

57% to CYP343A1 honeybee

79% to CYP343A1 Linepithema humile

MWFIIIFLTMTIFTIKILHGWQRPSMFPPG(1)

PRGLPIVGNILDVKRLVDETKFYSHAWCRLADIYGPIVGLKLGISEPLIIVSGKDAVVEMMGRPEFDGRPDGFIHRFRT

GGERRGVLFTDGDIWRDQRR(2)

FALRTLKEFGFGKVTMEDIILNDAISLTSTIESLAKLGPITNLYNITSIAVLNSLWTLIAGSR(2)

YDLQNPKLTEILSVVNDLTRNSNATGGILTHLPFLRYIIPGLTGFTVLDQRLARMWQFFG(0)

SEITRHKQTRTHGEIRDFIDVYLAEMDSKQSNPTVSSFNE(1)

EQLIGVVKDLFTAGVETTNNTIGFIITYLVAKQDVQRKVYEEIERVLGKEVLPRTEYKNR(2)

LPYLNATIAEVSRLANVGPTSIPHRAMTDSTLLGYKIKKNYTLLANLRSVHMDEQHWGDPKEFRPERFINDKGEYIEDP

WLIPFGLG(1)

RRKCLGEILARNSVFLFTACLLQKFQFVLSPEHPDPILDGLDGFTIAPPNLSVIAIKRNDCLIFH*--

 

>CYP369A1 Pb342Aseq1 502aa 7 exons .

54% to CYP369A1 honeybee (old CYP342A1)

73% to CYP369A1 Linepithema humile

MSLLLFVIFLLLVTYKLYRFAYDKPPDTPPG(1)

IIRLPIGGAYWLLLWGNYKFPYLTIDYYVKKLKSKIISCYMGNDFVIIVNDYQNIKEVLAREEFDGRVSVQTIRDRAFG

KNLG(1)

IFFIDGLKWHEQRRFALRYMRDFGFGRRQEKLETEIMDEMSLLIDILKNGPIYEGEK(0)

EILKGNLAFFPDILYASSANNIWNVMFGYRFDRSEHDISRQLCRAAVKMQRGNDTTGGAIFQMPFLKHFGNMFGYKDHI

NGSNTMTAIVK(0)

KYLEYQQTILSENIDQGFADIYLKKLNDDKKSDTFTKEQMIILLIDMMFPAFSALPGVITHAIKYLMHNPRVMKKVQNE

IDNVVGTGRLITWDDRKD(2)

LPYLEAIIRETMRIETITPLSVIHRTVKNTTLSGYKIPINTPIFTNLAAMHHDPDVWGDPENFRPERFLKEDGQLIKDI

TLPFGFG(1)

HRLCAGETYARYNFFGTLALLLQNFNFFFVEGEPSSLEDKVPGLTVIPKELWIRLELR*

 

CYP3 clan

 

>CYP6AQ15 Pb6AQseq1 504aa 5 exons Upstream from Pb6AQseq2

69% to CYP6AQ10 Linepithema humile

MALITAYWGLDGLIVLTALIAAAYFYMTRKFNYWKKRGVLEMPPIPFFGNFSDCVFLKKSPGHFMKEFYDQAKGMPYIG

FYILDRPCLLIRDRELVKNVLIKDFNYFADRYGSPDTKDRLGYANLFFLKNPAWKVLRTKLTPFFTSGKLKKMFELMLE

CGNNLEIYLDSLKLEG(1)

KEKELDAKEIAAKFTTDIIGSIAYGLQVNSLNNPNAEFREYGKKIFYFNFIRGFELIATFFFPSIVRLAKMKAFGKEAT

VFLRKVFWDTILQRMASGQKRNDLIDILVELKKSYE(1)

FDGDDLVAQAAIFFTAGYEGSSSMISFTLYEIALHREIQDRLRKEILDALNESGGKITYDM(0)

VTSLPYLDMVVSETLRMYPTLPFLDRVVMDTYKVPNTDLVLEKGTPIYISMSGMHYDPEYFPDPNKFDPERFSEENKCN

IPPCVYFPFGDGPHICIG(1)

ARLGLLQIKLGLIKILSKYEVEPSAQTLIPMIMNPKALLTSSLTGQIHLNFRRVNAN*

 

>CYP6AQ16 Pb6AQseq2 503aa 5 exons Downstream from Pb6AQseq1, upstream from Pb6AQseq3

69% to CYP6AQ10 Linepithema humile

MALITAYWGLDGLIVLTALIAAAYFYMTRKFNYWKKRGVLEMSPIPFFGNFSDCVFLKKSPGHFMKEFYDQAKGMPYIG

FYILDTPCLLIRDRELVKNVLIKDFNYFADRYGSPDTKDRLGYANLFFLKNPAWKVLRAKLTPFFTSGKLKKMFELMLE

CGNNLEIYLDSLKLEG(1)

KGKELDAKDIAAKFTTDVIGSIAYGLQVNSLNNPNAEFREYGKTIFHFNFIRGFEFVAMFFFPSIVRLAKMKTFGKEAT

VFLRKVFWDTILQRMASGEKRHDLIDILVELKKSYE(1)

FDGDDLVAQAAVFFTAGYEASSSVMSFTLYEIALHREVQDRLRKEILDALDESGGKITYDM(0)

VTSLPYFDMVVSETLRMYPTLPFLDRIVMDTYKVPNTDLVLEKGTPIYISMSGMHYDPEYFPNPNKFDPERFSEENKRN

IPPCVYFPFGDGPRACIG(1)

ARLGLLQTKLGLIKILSKYEVEPSAQTLIPMIINPKALLTSSVTGHIHLNFRKVAN*

 

>CYP6AQ17 Pb6AQseq3i 515aa 5 exons ??? on last few aa on Cseqterm, Downstream from Pb6AQseq2

76% to CYP6AQ14 Linepithema humile

MALITSYWGLDGLIIFMAFMITAYLYMTRKFKYWKKRGVLELTPTPFFGNFMECLFLKKAPAYFLKEIYEETKGLPYVG

FYVLDKPFLLIRDRELVKNILVKDFNYFSDRYNTADPNDRIGYANLFFIRNPTWKAIRTKLTPFFTSGKMKKMFDLMLI

CVKNLDEYLESLNLDG(1)

KGKTLEVRDITARFTTDIIGSTAYGLDVNSFKDPDAEFRRYGKMIFQYDTIRGFEMLAIFFLPTIVRLTKIKMFGKEPT

EFLRKVFWETLSQRMKSGVKRNDLIDILIELKNNNNDKEFKDFT(1)

FDGDDLLAQAASFFSAGFETSSTTTSFALYELAIQPELQNTLRKEILEALEKSNGKITYDM(0)

AWSLPYLDMVISETLRMYPPLGYVNRVAMETYKVPEYNLVIEKGTPCYIPMLGLHYDPEYFPNPNKFDPERFNEENKRN

RPSCVYFPFGEGPHACIG(1)

NRFGLLQAKLTLLIILSKYEVTPSEKTSIPVEIDPRGAMTAPLNGVIYLNFRKVNVTTN?

 

>CYP6AQ18 Pb6AQseq4i 291aa 2 exons INCOMPLETE 1st and 2nd exons only

61% to CYP6AQ14 Linepithema humile

MALITNHWSLDGIITLIILIIIVYFYMTRNFKYWQKRGVLEITPIPFMGNFTECLILKKSPGYFLKNIYDQAKGHPYIG

FYIFDKPFLLLRDHELIKNILMKDFNTFFDRYASADPSDRIGYATLFSIKNPAWKIIRMKLTPFFTSGKLKKMFGLMLE

CTKNLEDYLDSLKLKG(1)

KVIDVKDLSAKLTMNVINSTAYGLDTNPFKDPNFYKYGRMIFNNSYIRSWEILALFFLPNVVRRTRFKLFGKETTIFLR

KIFWETITKRMESDTKRNDLIDILVELKKNSSNEDIEG(1)

 

>CYP6AS59 Pb6ASseq1i 424aa 5 exons ??? first exon, upstream from Pb6ASseq2

71% to CYP6AS55 Linepithema humile

(1)

KTPVLIIKDPDLIKDVLIKNFSTFASRGIPTFEK(0)

TDPLPLHLFLLEPKRWRPLRIKLSPVFTSAKLKEMFFLISECADHLIQYTEKVASKNGLIECRELMAKYTTDVIGSCAF

GIEMNSMSDKDSEFRKMGRQFFESTWSNVIRERMREIVPGLYHLLGYILPQSESTKFFTRVIMESMEYRDMNTITRHDF

IDTLRELKKNSDQLDDIE(1)

LTDNLIASQAFVFFLAGFETSSTTMSNALYELALNPKIQDKLRAEIDESYVKYGEHLTYDNIKQLDYLDKVFKE(1)

TLRKYPPLSTLMRQATSNYTFENTKISIPKGMMVSIPAYAIHRDPNIYPEPDVFDPERFDDEAVKSRHSMVYLPFGAGP

RNCIG(1)

ARFAIYQSKIGLIKMLRNYKVETCEKTVKRYINDPKTFILSPIGGIHLKIVKIDRT*

 

>CYP6AS60 Pb6ASseq2 499aa 5 exons Downstream from Pb6ASseq1

62% to CYP6AS52 Linepithema humile

MDYFQVLCSIAAVILALYYFFTSTFDFWKSRGVPGPQPIVGFGNLKDVMLGKIAMSKFLMKMYTDYKDEPLIGIFVHRT

PILIIKDLDLIKDVLIKDFNSFGNRAFTVHEK(0)

AEPLSQNIFNLDLKKWRPLRAKLTPFFTTRKLKYMFFLISECADHLVDYVEQLVSKNEIVECYALTSKYTTDVIGSCAF

GIEMNSMTDETSEFCRIGRNIFIQPFTDYLRTKIKQNSPWLYDILGHILPQTEITKFFIRLVMDNIKYRDKNNIVRNDF

IDILRELREQSDNDIE(1)

FTDSFLVSQAFLFFSAGFETSSTAMTNAFYELALNQKIQDRLREEINQSFAKYGNNLSYENIKEMIYLDKVFKE(1)

TLRKYPAGLFLNKIATSDYTFKGTKVSILKGQNIWIPFYTIQHDPNIYPQPDIFDPERFNEEIVENRHPMAYLPFSDGP

RNCIG(1)

LRFAIYETKLGLIKMLRNFKFEPCEKTQIPYITNESTFVLSPKDGIYLKISKINQA*

 

>CYP6AS61 Pb6ASseq3i 176aa 1 exon INCOMPLETE 2nd exon only

70% to CYP6AS55 Linepithema humile

 (0)

TDPLSLHLFLLEPKRWRPLRIKLSPVFTSGKLKEMFFLISECADHLIQYTEKVASKNGLIECRELMAKYTTDVIGSCAF

GIEMNSMSDKDGEFRKMGKKFFEPTWSNVIRERMREIVPGLYHLLGYILPQSESTKFFTRVIMESMEYRDMNNITRHDF

IDTLRELKKNSDQLDDIG(1)

 

>CYP6AS62 Pb6ASseq3 498aa 5 exons Upstream from Pb6ASseq4i

70% to CYP6AS52 Linepithema humile

MELFEILCGIAVIILGLYYFLTSSYDFWKSRGVPGPRPIPGFGNFKDIMLIKLSIGDYSLKVYNDYKDEPMVGIYSRKT

PILVIKDPNLIKDVLIKDFPTFASRGIPTFDK(0)

ADPLSQHLFSLEPKRWRPLRIRLSPVFTSGKLKEMFSLISKCADHLVQYTEKVASKNEPIECRELTAKYTTDVIGSCAF

GIEMNSMSDEDGEFRKMGRKIFTPSWSNVMRARFRQMMPGLYSILGYILPQSEITKFFIRVIMESIDYRNTHNITRHDF

IDILRELKKNPDKLE(1)

LTDSLIASQAFVFFLAGFETSSTTMSNALYELAVNPKVQVKLRAEIDESYVKHGGNLTYDNVKQLDYLDKVFKE(1)

TLRKYPPVTILMRESTSNYTFEDTKISIPKGTRIWIPIYAIQRDPNIYPDPDVFDPERFDDEAMESRHSMVYLPFGDGP

RNCIG(1)

SRFAVYQTKIGLIKILRNYKIETCEKTQKHYVNNPKAFLLAPKDGIHLKIIKIDRI*

 

>CYP6AS63 Pb6ASseq4i 360aa 3 exons INCOMPLETE 1st, 2nd and 3rd exons, ??? downstream,

downstream from Pb6ASseq3

73% to CYP6AS52 Linepithema humile

MELFEILCGIAVIILGLYYFLTSSYDFWKSRGVPGPRPIPGFGNFKDVMLTKISMGDYLMKVYNDYKDEPMIGIYTRKT

PVLIIKDPDLIKDVLIKDFSKFADRGIPISEK(0)

ADPLSLHLFSLEPKRWRPLRMKLSPVFTSGKLKEMFSLISECADHLVQYTEKVTSKNEPIECRELMAKYTTDVIGSCAF

GIEMNSMSDEDSEFRKMGRKVFKPNWTNVMRARIRQIVPGLYNLLGYILPQSEITKFFTRVIVESMEYRDMNNITRHDF

IDTLRELKKNPDQLDDIK(1)

LTDNLIASQAFVFFLAGFETSSTTMSNALYELALNPKIQDKLRAEIDECYAKHGERLTYDNIKQLDYLDKVSK

 

>CYP6AS64 Pb6ASseq5i 214aa 3 exons INCOMPLETE 3-5th exons

76% to CYP6AS52 Linepithema humile

 (1)

LTDNLIASQAFVFFLAGFETSSTTMSNALYELALNPKIQDKLRAEIDECYAKHGERLTYDNIKQLDYLDKVFKE(1)

TLRKYPPGSILMRQTTSNYTFEGTKISIPKGMRVWIPVYAIHRDPNIYPEPDVFDPERFDDEAVKSRHSMVYLPFGDGP

RNCIG(1)

ARFAVYQSKVGLIKILRNYKVETCEKTMKRYINDPKAFILSPIGGIHLKIVKIDRT*

 

>CYP6AS65 Pb6ARseq1 493aa 5 exons .

71 % to CYP6AS42 Linepithema humile

MFEILCVCVMILWLLYYYLTADFDYWTSRGINGPKPIPFFGNIAEFMLGKNCLGNFYKKIYDRYTKEPMVGLFLRGNPA

LMLRDPDYIKQVLIKDFTVFSDRDGKVYEK(0)

ADPMSMHLFRIDAARWRPLRIRLSPVFTSGKLKDMFHLLLNCSDHFEKYLNEIVPKDGIVECRDLTSKFTVDVIGSCVF

GIEMNALKEENNQFQKMGRRIFRNTLKSFLKNILKEIPWLYQRIGYILDDHVVTKFMTNLTRETIEYRKQNNIRRHDFI

DTLIDFKDNPEKLD(1)

ITDELVAAQAFVFFAAGFETSSTTMSNAMYELAKNQSIQEKVREEIKDILKSSNGEILYDDIKKMSYLDKIFQE(1)

TLRKYPPVMYLTRKPLQDYVFEETKITLRKGLRVIIPIYAIQNDPNIYPDPDVFDPERFSAENVSQRNAMHYLPFGNGP

RNCIG(1)

ARFAINQTKVGLIKVLMNYKIDVCEKTQIPVLAPLSSLMLQTTHGIYVKLTKFT*

 

>CYP6BC4 Pb6BCseq1 520aa 5 exons .

81% to CYP6BC3 Linepithema humile

MLGILAILLDPFLLIGFFLGILYLYLTATFDFWECRGVPFKKPTVLVGNFGSLLLFRKSQPEGVKEMYQWFKDERFFGA

FRVRSPVLILRDPELVKSVCVKDFSHFLNRGIPINNAQ(0)

DPLSGHLFNLEGHKWKGLRSKLTPAFSSGKLKRMFYLLGECGEELQRLIKEASRNVDRAVEVRELATKFTIDVIGSCAF

GIQINALTDEESEFHRAAKTLSKPSYKATLWRMLRTSMPRLYRLLGVQIVDPGVTKFFMDVVSQMIDQREDNGTTRHDF

MDLLIELKNKGTLENEVSNPRVCNDEDVQAAKEID(1)

ESTIAAQAFVFFAAGYETSSNTIAFCLYELALNQDIQDKTRREVCGAIEAQGGKLTYDAVQEMKYLDMVILE(1)

TLRKYPPAPLLSRRCEHKYQIPNTEVELPVGIRVIIPIYGLHHDPTYYPDPSRFDPERFTEENKRTRHPYTYLPFGEGP

RNCIG(1)

MRFALLQIKMGIISFLKDHRVEICGKSTVPIKFSRRSLVTTSEEGFWLAITPSS*

 

>CYP6BD8 Pb6BDseq5 500aa 6 exons .

73% to CYP6BD7 Linepithema humile

MAILTQCALLDTLAILSSLFATLYLWMKWKHTYWQRRGIRSLPAHWFFGHFKDAILMRKSAGVVLGDLHHQGTDEDDVL

GIYILHKPFLLVRNPELIKQIMIKDFHIFPNHHFSARSSTDKVSKWSLFTIDNPEWKYLR(2)

AKMSPVFTSGKLKNLFLLMQESGEKMRDYLRDYVGKESKAVPIIIKDTFYKYTTDVISSVAFGIRTNCFDTPPPEFYVG(1)

RKAFTPSLRRSIQFFFLFFLPKIGKYVGASMLGDYTDYFRKIFWNSMDNRSATKMKRGDLIDSLLQLKDEKPDNNFH(1

)

ALLAQAAIFFVAGRETSITTMICVLFELAKQPELQKRVREEIFEKIQEANGVTYEAVQNMKYLHQVMNETLRLYPPAPI

LDRLPLSDYT(0)

FPGTKITIEKDTPVFVALRGLHSDPRYYRDPMCFDPERFSDERKNEIVPCTFLPFGEGPRNCIG(1)

LRLGILQTAVGLIAILRDYEVTLNPSWPSPIDPRSVFTSPVMKFLLNLKKI*

 

>CYP6BD9 Pb6BDseq4i 398aa 5 exons INCOMPLETE 3rd exon ???? combine with Pb6BDseq2i?

70% to CYP6BD5 Nasonia vitripennis

MLVSLILVFTIVILFWVYTS(2)

YKLNYWKRRGVEFLPPHRIFGNFKDAVLFRSAPGWHIGDLHKMARSDAPFVGFYIFHKPCLLLRDPEIIKYFMIRDFDN

FSDRHFAGSTQKDSIGMKNLFGLKNPAWKYLRTKITPTLTRGKLKQMLPLMLDTANPMMEYIKEQPINSDNVRVIDAQD

LNYKFTTDLIASVALGTKIDSFHYPNYEFSAAV(1)

QEFFYGFKRMVALVTVFFMPELVEVIGTRMLFNSSFVGKIFWNAMENREKTGEKRGDFIDSLLQLKNSEQDPVYS(9)

IPNTDITIEKGTPIYISLYGLGVDPRFWDEPEVFNPDRFAENKNIPDAYMPFGSGPRMCVG(1)

MKVGQLHAKVVLALLLKDYEVWQTKEHTSFLDPRSTFTASGNGINLHFRKI*

 

>CYP6BE9P Pb6BEseq1P 104aa 1 exon PSEUDOGENE FRAGMENT 2nd exon only, stop codon

66% to CYP6BE6 Linepithema humile

CSTDIIMFAVFGIKSNCINEPNSEFRLWGKKFFEENSFWIALCIFAPQILNFFSILFTNRQLSNFFF*MFRENVEYRHA

HKIVRYDFMNLLIQLMEEGYIEPDDG

 

>CYP6BE10P Pb6BEseq2P 17aa 1 exon PSEUDOGENE FRAGMENT 18aa from 4th exon, stop

codon, upstream from Pb6BEseq3P

72% to CYP4C13 Mastotermes darwiniensis, 62% to CYP6BE1 Apis mellifera
seq. between PERF and heme region

D*FSPEKVRNRHPYSYLP

 

>CYP6BE11P Pb6BEseq3P 104aa 1 exon PSEUDOGENE FRAGMENT 2nd exon only, stop codon,

downstream from Pb6BEseq3P

75% to CYP6BE6 Linepithema humile

GMYTFFKPNLVIVDLDLIQTLLTKNFVNFHDYGMYCNKKIDSLSDRLVLLSGKKWQNLRVKLTPTFTSGKIK*MFPILK

ECSEEFVKYLDNAQMKNCIEMKNMFA

 

>CYP6EL7 Pb6BDseq2i 101aa 1 exon INCOMPLETE 3rd exon only,combine with Pb6BDseq4i?

83% to CYP6EL2 Linepithema humile

FEGENLLYQSGTFFSGFESSSTCTSFTLMELANHPECQKLARKDINRAIEEHGWTYEAFTDMKYLDQAILESLRLHPPV

STIDRYTRQDYQ(0)

 

>CYP6ES2 Pb6BDseq1 485aa 5 exons SEQUENCING ERROR frameshift deletion of A at 498957

57% to CYP6ES1 Linepithema humile, 51% to CYP6BD4 Nasonia vitripennis

MEYLIYITILSVSLFYLYAKLSYWSRRGVKTPPTHWLFGNFKDCITFKKAPGQVMQEIYNSADSNDPYIGFYIFHKPML

LLRNSDLIKQTMIKDFEIFPNRRFGSLNERDFVGLDSILSIKQPRWKYLKSKLTPTLTGQKLKNMIPLMIESGKPMIKF

IENLKITETGQSKGEIRDISSRYVSDILASLFFGINTNSFEERENAFWENG(1)

LKSSIIFIILFFIPEWAFLLGPFIIKTKNNFRNIFWESMNARQKKEFNREDFTDSMLMLKNGEQNPIYE(1)

FKGDNLVAQPSSLYAAGFEATATAIAFVLYELARHPEHQVTVYEEIQTHLSGKELTIDLINKMTFLDRVITEALRLHPP

LPVVDRTALKNYK(0)

LPNTGLIIEENVSIYICVSAMGYDSNNFSNPQEFIPLRIEIENNKFYENMIFGIGPRACIG(1)

QRLARTLTKVPLIIILSNYFVSYEKNVSNAKALHLFTYVEDGLYINFKKREMIN*

 

>CYP6ES3 Pb6BDseq3 494aa 5 exons .

68% to CYP6ES1 Linepithema humile, 57% to CYP6BD4 Nasonia vitripennis

MDFLICTTALIIFLSLFYVYAKYRLSYWSRRGVKSPPTHLLFGNFKDCFIFKKPPSEILREIYNSANPDDPYIGFYIFH

KPILLLRDHDVIKQIMNKDFDVFPNRRFGSGLERDSVNLDSILSIKQPRWKYLRNKLTPILTGQKLKNMLPLMVECGKP

MIDFIEKSPINETGQNKCEVKDISSRYSTDVIASLAFGIAINSFDEKETDFWNNG(1)

MKIFKGFKRSIVFIILFFIPEWDFLIGPFIREPANYFRQVFWDSMNTRERLAFKRGDMIDYMLALKNGEQDPIYT(1)

FEGDRLLAHPTSFYIAGLEATATAIAFVLYDLACYPEHQTTLYNEIQTYLSGKELTMDLINEMSFLDSVVVESLRLHPP

LPVTDRIALRDYK(0)

LPNTELIIEKDIPVYISVNASNQDPKYFSHPQDFDPRRIKTGDKKFYESLAFGIGPRSCIG(1)

QRFALIIIKVALIMILSNYIMSYETKTTLNNNQAIHVFTYAADGLHVLFKKRN*

 

>CYP9P15 Pb9Pseq1 515aa 1 exon Upstream from Pb9Pseq2

68% to CYP9P11 Linepithema humile

MDWSWFSTPFGLLLTTLIVIVVSKVIATMNRMYFYWKGKGIPYMPNSLSSAIMGWKMLAGRFHFTEWCDYLYYYFPNAK

YFGMVDFATPAILLRDPELIKDTMVKDFEHFQDHRAFVDENLEPLFGKAVFFMHGDRWKEMRNVLSPSFTASKMKLMFD

LISDCAHDFANYFVEHPELCSEVELKGTFRRYTNDVIATAAFGLSVNSMKEQDNEFYIRGIEATKFSSGFLMMLKFIFL

RSFPRFSKMIGLTLFTNETSTFFRKIVADTIKMREEKGIVRPDMIHLLMQAREKEGTSAQVTLDDIVSQAFIFFFAGFD

TSSTLMCFVAHELAVHQDIQDRLREEIKQYLAEGNGKISYDSLSQMSYMDMVVSEALRKYSPVVILDRVCTKKYELPPA

QPGCKSLTIEPGTIIMYPGYSLQRDPTYFPNPEKFDPERFSDENKDKIVPYSYLPFGLGPRKCIGNRFALMETKILLAH

LLQKFTLKTTPKTVEPIVFNKKEFALQPVGGFWIRLEKRET*

 

>CYP9P16 Pb9Pseq2 513aa 1 exon Downstream from Pb9Pseq1, upstream from Pb9Pseq4

66% to CYP9P9 Linepithema humile

MDWSWFSTPFGLLLTTLIVIVVSKVIATVKRIYFYWKGKGIPYIPNSLSSAMIGWKMLAGRLHFTEWSDYLYYYFPNAK

YIGMVDVATPAIFLRDPELIKDTMVKDFEHFQDHRAFVDENLEPLFGKAVFFMHGDRWKEMRNVLSPSFTASKMKLMFD

LISECAHEFTNYFVEHPELCSDVELKKTFRRYTNDVIATAAFGLSVNSMKEQDNEFYARGIEATKFSNGFLMMLKFILL

RSFPKFSKMIGLTLFSNETSTFFRKIVADTIKMREEKGIVRPDMIQLLMQAREKEDAQMTLDGIVSQAFVFFFAGFETS

ATLMCFVAHELAVHQDIQNRLREEVKQHLAEGNGKISYDSLSQMSYMDMIVSEALRKYAPTVLLDRVCTKKYELPPAQP

GCKSLTIEPGTIIMYPAYSIQRDPNYFPDPEKFDPERFSDENKDKIVPYSYLPFGLGPRKCIGNRFVLMETKILLTHLL

QKFTLKTTPKTAEPITFNKKDFMLQPVDGFWIRLEKRET*

 

>CYP9P17 Pb9Pseq3 515aa 1 exon upstream from Pb9Pseq4

68% to CYP9P11 Linepithema humile

MDWSWFSTPFGLLLTTLIVIVVSKVIATMNRMYFYWKGKGIPYMPNSLSSAIMGWKMLAGRFHFTEWCDYLYYYFPNAK

YFGMVDFATPAILLRDPELIKDTMVKDFEHFQDHRAFVDENLEPLFGKAVFFMHGDRWKEMRNVLSPSFTASKMKLMFD

LISDCAHDFANYFVEHPELCSEVELKGTFRRYTNDVIATAAFGLSVNSMKEQDNEFYIRGIEATKFSSGFLMMLKFIFL

RSFPRFSKMIGLTLFTNETSTFFRKIVADTIKMREEKGIVRPDMIHLLMQAREKEGTSAQVTLDDIVSQAFIFFFAGFD

TSSTLMCFVAHELAVHQDIQDRLREEIKQYLAEGNGKISYDSLSQMSYMDMVVSEALRKYSPVVILDRVCTKKYELPPA

QPGCKSLTIEPGTIIMYPGYSLQRDPTYFPNPEKFDPERFSDENKDKIVPYSYLPFGLGPRKCIGNRFALMETKILLAH

LLQKFTLKTTPKTVEPIVFNKKEFALQPVGGFWIRLEKRET*

 

>CYP9P18 Pb9Pseq4 513aa 1 exon dowstream from Pb9Pseq3, upstream from Pb9Pseq5

66% to CYP9P9 Linepithema humile

MDWSWFSTPFGLLLTTLIVIVVSKVIATVKRIYFYWKGKGIPYIPNSLSSAMIGWKMLAGRLHFTEWSDYLYYYFPNAK

YIGMVDVATPAIFLRDPELIKDTMVKDFEHFQDHRAFVDENLEPLFGKAVFFMHGDRWKEMRNVLSPSFTASKMKLMFD

LISECAHEFTNYFVEHPELCSDVELKKTFRRYTNDVIATAAFGLSVNSMKEQDNEFYARGIEATKFSNGFLMMLKFILL

RSFPKFSKMIGLTLFSNETSTFFRKIVADTIKMREEKGIVRPDMIQLLMQAREKEDAQMTLDGIVSQAFVFFFAGFETS

ATLMCFVAHELAVHQDIQNRLREEVKQHLAEGNGKISYDSLSQMSYMDMIVSEALRKYAPTVLLDRVCTKKYELPPAQP

GCKSLTIEPGTIIMYPAYSIQRDPNYFPDPEKFDPERFSDENKDKIVPYSYLPFGLGPRKCIGNRFVLMETKILLTHLL

QKFTLKTTPKTAEPITFNKKDFMLQPVDGFWIRLEKRET*

 

>CYP9P19 Pb9Pseq5 515aa 1 exon downstream from Pb9seq4

67% to CYP9P12 Linepithema humile 

MDWSWFSTPFGLLLTTLIVIVASKVIAMVYRMHFYWKGKGIPYMSNSLSSIIMSWKMLTGRLHFTEWCDYLYNYLPNAK

YFGTTDFLTPVILLRDPELIKDTMVKDFEHFQDHRAFVDENLEPLLGKTIFFMHGDRWKEMRNVLSPSFTASKMKHMFD

LISECAHDFANYFVEHPELCSEVELKGTFRRYTNDVIATAAFGLKVNSMKEQDNEFYMRGIEAANFSNGFLMILKFILL

RSFPRFSKMIGLTFFSKETSTFFRKIVADTIKMREEKGIVRPDMIQLLMQAREKEGTNVQMTLDGIVSQAFIFFLAGFD

TSSTLMCFVAHELAVHQDIQDRLREEIKQHLAEGNGKISYDSLSKMSYMDMVVSEALRKYSPAVFLDRVCTKKYELPPA

QPGCKSLTIEPGTILLYPGYSLQRDPNYFPNPEKFDPERFSDENKDKIVPYSYLPFGLGPRMCIGNRFALMETKILLAH

LLQKFTLKTTPKTIEPIVFNKKEFALQPVGGFWIRLEKRET*

 

>CYP9P20P Pb9seq21P 523aa 1 exon PSEUDOGENE multiple frame shifts and stop codons

59% to CYP9P9 Linepithema humile 

MDSLLSSLFVLLLITLIVISVLKFVVLLYHMYFYWKDKGVTYQIRYLLITDWKLFVNRISFPDYCQYLYRYFPDAKYVG

VMNFSTPAVLLREPELIKDAVKDFKYFHDHRSFVDETVEPLFGKNIFSLRGDHWREMRNTLNTSSFTGSKMKFMFELIA

KCSHDFVDYLVVHPKLCHSIETKEIFRWYTTDVIATTAFGINVNFMKDPNNEFYIRGVETKFVNGLLTFVKVMILRAFP

RFASTVGLSFFPLATTKFFRRLVRETPVKTHEEQDIIRLDMIYLLMLGTGEKCQCSQNNIGRHRFASFHFFFASFEISS

TLICFVAHELTINSDIQDRLRKEIHCVKSNSEISYESLLKTSYGYGDFSSQRKYPSVVFTDRLCTKKYELPLSQSGYKN

IIIELDNVLMFFVYALHHNPQYFPNSNKFDPETFSDENKDNILPYIYLPHFHGPRKCIGNRFALMETKILIAHLLQKFT

LKTMEKTVEPIVYSKKDFSLQLLTDFRSAWRRKKYENIVCKTLFSQSSI*

 

>CYP9R18 Pb9seq1 517aa 1 exon upstream from Pb9seq2

75% to CYP9R6 Linepithema humile

MIYVIALSIIAGALGLYYYFFKDLNYFKKHGIVHIPPLPILGNMAPGILHRKPPAEHITEIYNLHSEAKYIGMYDLLCA

PIILLRDLELIKSITLKHFDMFPDHRGLVEDETQDPLFGKNLFFLRGEKWRQVRALLSPAFTSSKMKNMFKLMSECGAD

FGTFLAQLPPEQRMMQMKDAFNRYTNDVIATCAFGINVDSMRNPKNEFYVYGKEATTFDNIAFVLKICTFRLLPWLARL

IKLRLIRQKVADFFRDLVKITIKTRDEKHIVRPDMLQLMMENRDKEGKIELSIEDMVAQAFIFFFGGFETTSTLMSFVA

HEIAVNQDVQVKLQNEIDRVLEENNGQVLYEAVNAMEYLDAVICEALRMYPVLVVVDRVCVKDFELPPSLPGLKPFTIK

KGQSAWIPIYALHHDPKYFEEPEKFDPERFLGEKRKDSLNCGAYLPFGLGPRMCIGNRFALLETKVLLFHLLARCNLKT

CEKTPIPIKLGKGGFTIMPEGGFWLNVEPRNNTHRSLATNSIN*

 

>CYP9R19 Pb9seq2 516aa 1 exon downstream from Pb9seq1, upstream from Pb9seq3

70% to CYP9R9 Linepithema humile

MIYIIVLSIIASVLSFYYYFFKDLNYFKKHGILYKPPLPILGNMGPSIFGLKSSAELIKEFYDLNSEAKYVGVFDMPTT

PMIVVRDPELIKSITIKYFDTFPDHQSILADETMEDPLFGKNLIFLHGERWRQIRSLLSPAFTSSQMKSMFKLMSEYAA

DFSTFLAQLPPEQRMMQMKDAFNRYTNDVIATCAFGIIVDSMRNPNNEFYVHGKEATVFNAMVLKLCIYRFLPWLARLI

KLRLIHQKVTDFFRDLVEITIKTRNEKHIVRPDMLQLMMENRDKEGKIELSIEDMVAQAFIFFFAGFETTSTLMSFVAH

EIAVNQDVQVKLQNEIDRVLEENNGQVLYEAVNAMEYLDAVICEALRMYPILVAVNRVCVKDFELPPSLPGLKPFTIKK

GQSAWIPIYALHHDPKYFEDPEKFDPERFLGKKRKDSLNCGAYLPFGLGPRMCIGNRFALLETKVLLFHLLGRCNLKIC

EKTPIPIKLTKSCFTLVPEGGFWLNVKPRKNMHYTIAANLSN*

 

>CYP9R20 Pb9seq3 525aa 1 exon downstream from Pb9seq2

73% to CYP9R9 Linepithema humile

MIYIIVLSVTAGVLGFYYYFFKDLNYFKKHGILHKPPLPILGNMGSACLRLKPIVEFVKDFYNLYPEAKYIGIYDIPTI

PVIAVRDPELIKSIMLKHFDMFPDHRNFIDETQDPLFGKNLFSIRGERWRQVRSLLSPAFTSSKMKNMFKLMSEYSADF

TTFLAQLPPEQRMMQMKDIFTKYTNDVIATCVFGISINSMKNPKNEFYVYGKEATTLSSVTFLKFYIFRNLPLLARLIN

LKFVRQKIADFFRDLVETTIKTRDENGIVRPDMLQLMMENRSKEDKVQLTIEDMVAQAFVFFFNGFESTSTLMCFAAHE

IAVNQDIQKKLQNQIDQVLKENNGQVLYEAVNAMEYLDAVIYETLRMYPIVAVIDRSCAKDFELPPALPGKKSFTIKKG

RGIWIPAYALHHDAKYFEEPEKFDPERFLGEKRKHIFNCGAYLPFGLGPRMCIGNRFALLETKVLLFHLLARCDLKICE

KTPIPLKLAKGFNMKPEGGFWLNVEPRKNIDYILAANLNNGTLRCKKVDLI

 

>CYP9R21 Pb9seq17 513aa 1 exon MODIFIED Fixed missing N-term with 135nt (45AA)

from contig00684 starting at 91724, Upstream from Pb9seq16P

73% to CYP9R14 Linepithema humile

MEYWTIILSILTVVLAIYYYSSRKNLNVFQQHGIPYLKTSFVKRIWKTFVRPESFAKLIQETYNVHSEAKYIGVFDLSN

PVMVIRDVELIKFIAIKNFDSFEDHRFFGNETQDPLFGTNLIALRGDKWRDYRALVSPAFTASKMKMMYHLITECAVNF

SEYLMDVPSDKRIMEMKDIFTRYANDVIATCAFGINVDSMTNPENEFYAFGKKATNFNMIALLKILMYQYTPILIRLLN

IKIIDDRTNAFFVNLVDETIRTRDEKGITRPDVIQLLMDSRSKREPGKELSILDMTSQAFIFFLAGFESSSTLMSFAAH

EIAINPDVQEKLQNEIDQVLEDMNGQPSYEAINGMKYLNAVINETLRKYPVQPMTDRLCVKDFELPATLPNAKPFLVKE

GMMVWFPFYGLQHDPKYFPEPDKFKPERFLEEGKEKDNLNAYHPFGLGPRMCIGNRFALLETRTVFFHLLARCqlkpce

ktssssklqkggfsmrlegGFWLSILPREKRHPTIMNRN*

 

>CYP9R22P Pb9seq16P 517aa 1 exon PSEUDOGENE two frame shifts, upstream from Pb9seq15P,

downstream from Pb9seq17

76% to CYP9R6 Linepithema humile

MIYVIALSVIAGVLGFYYFFLKIITLKNMAYLHKPPIPILGNMGPSIFRLQSLAELVKDIYNLHSEAKYVGMFDMTNPL

IMVRDLELIKSVTLKHFDMFPDHLSVVETQDPLLGKNLFSIRGEKWRQVRPLLSPAFTSSKMKSMFKLMLECADDFGTF

LVQLPPEQRMIQVKDIFTRYTNDVIATCAFGITVDSMRNPKNQFYVYGKEATTFGSIALIKLYIIQSLPTLARLINLKF

IRQEIADFFRDLVETTIKTRDENGIVRPDMLQLMMENRGKEGKLELSIEDMVSQAFIFFFGGFDSTSTLMCFAAHEIAV

NPDVQKRLQDEIDQVLEENNREAPYEAVNSMEYLDAVICEALRMYPVVVAMDRLCEKDFELPPALPGMKPFTIKKGQGI

WIPVYGLQHDPKYFEEPEKFDPERFLGEKRKDSLNCGAYLPFGLGPRMCLGNRFALLETKVLLFHLLARCNLKVCEKTP

IPLKIARDGFNMKPEGGFWLNVEPRESIHHILSAKLVNGTRYM*

 

>CYP9R23P Pb9seq15P 484aa 1 exon PSEUDOGENE multiple frame shifts and stop codons,

upstream from Pb9seq14P, downstream from Pb9seq16P

64% to CYP9R9 Linepithema humile

MIYIIILSMIAGSLGLYYYLFEDFNFFKKHGIPKPLPLLGNMGSTLTRRQSVAELIKSIYILDAKYVGMYDLTKLLVMI

RDPELIKFITLKHFDMFMDHRSFFDETQDPFFVKNLVALRDDRWREMRFLDSRSILSPAFTSSKKNEKYIQVDVGLWYL

QVFGTITRPDRRKMEMKDVFTRYTNDIIAICAFGISVDSMRNPNNEFYIYGKEVIIFGILLVLKFYTFTIYNFILAGTN

TVETFSRTSNFFSDILSKSLKRESYRSTRHVLQLMMESRDKYGKTDLTMIAQAFTFFFGGFDISLTLMCFTAHEIAVNQ

DVQKRLQNEIDQVLKDNDGQVLYETVNSMEYLDAVINEILRMYPGGLALARVCVKDFELPSTLPGMKHFIIKKGQDIWI

PVYGLHHDSKYFEEPEKFDPKFLGERKKHTLNTMELSFLSVLGSRMCIGNRFALLETKDLLFHLLLLAHCENLTLNADT

TQVSRFQYEG*

 

>CYP9R24P Pb9seq13P 216aa 4 exons PSEUDOGENE multiple stops and frame shifts;

upstream from Pb9seq12

50% to CYP9R9 Linepithema humile

YFLNIDNNYTIIKIQNLFSGKNLVVLRDEK*WEMQIIFSPAFMFSKMKNI(2)

YQINITFSNYLASEKRVMKMKDVFTRYTNDVIVTCVTASMRNPNNEFYMYVPIITAANKFLLLKLYIFR(9)

PNMLQLMMKSRSKDSKTNLVIDEIVVQVCTFSFDNNLTLMCFAAHEIVVNQDV*RGL*NGIV*VSVYNNRRARYEVVND

ME(9)

EKERYT*IPIHGLHHDSKYF*N

 

>CYP9R25P Pb9seq14P 482aa 1 exon PSEUDOGENE multiples stops and frame shifts,

downstream from Pb9seq13P, upstream from Pb9seq15P

43% to CYP9R9 Linepithema humile, 65% to Pb9seq20

MYVIALSVIAGVLGFYYYFFKDLNYFKKHNILYKPPIPLVGNMGPSVFRLHSIQAELSKDIYNLHSETNYVRIFDMTKL

YIIMRDPLLIKSITLNTSIPFVFPDHRFVNESQDSKYLAKIFFQFAERGSDKYDLYLQSSRRKMKNMFKLMSKYAADFG

SFLTQLEYASEQRMMQMKDIFARLMTLLLALLALLLIPETQRTNFTYMARKRLLSTILPNYTWIIFGNFSLLARLINLK

LIRQKIIDYFRDLAETTIKTRDENDIVRPNILQLLMESRNKEDKAKLTVEDMIHAFIFFFSGFDTASTVILYCSRKRSE

SRYIKKDFRIRSTESKKTMEKHLMKLMLRNIMLFTKLSECSLLLQRIDYAKISSYRQHYQGRIWTGVNKVSYYQERTKH

MNTDLRTSLCIFRKARNLIPNGFLMKEGKTVSIAEPIFFSGLVPECAFALLEIKVLFFHLLARCNLKVCEKTSLLLKLA

KSGIINEA*

 

>CYP9R26 Pb9seq12 517aa 1 exon tail-to-tail with Pb9seq11P, downstream from Pbseq13P

73% to CYP9R7 Linepithema humile

MIYIIILSTIAGALILYYFLFKNMNYFKKYGIPHVKPLPIVGNMGPAIFRQQSLTDFVKMMYNLNPNAKYVGMYDFWQN

PIIVLRDLELIKSVTLKHFDNFMDHFGVLDEQQDPFFGKNLIALRGDRWREVRSILSPAFTSSKMKSMFKLMSNCGVNF

STYLTQLPPEKRTMELKNIFTRYTNDVIATCAFGISVDSMRNPKNEFFVYGTEATNFSGFSLLKFFIMRNFPWLARIVK

LTFIREKITHFFRDLVKTTIKIRDDNGIVRPDMLQLMMENRSKDKAELSIDDMVAQAFIFFFGGFESTSTLMCFVAHEI

AVNQDIQKRLQNEINQVLEETNGEASYEAVNGMEYLDAVINEALRMYPIVVALDRLCLKDFELPPTLPGMKSFTVKKGH

GIWIPVHGLHHDPNYFEEPEKFDPERFLDEQKKDSLNCGAYLPFGIGPRMCIGNRFALLETKVLLFHLLARCDLKPCEK

TAIPLKIAKGGLTIKPESGFWLSIMPRNNIHHTPAVNAANKTG*

 

>CYP9R27 Pb9seq18 517aa 1 exon Upstream from Pb9seq19P

76% to CYP9R9 Linepithema humile

MIYIIALSVIAGVLGFYYYFFKDLNYFKKHGILHKPPFPILGNMGPSVLRLQSVAELVKDIYNLHSEAKYVGMFDMTNP

LIMVRDPELIKSITLKHFDMFPDHRSFVDETQDPLFGKNLFSIRGERWRQVRSLLSPAFTSSKMKSMFKLMSECADDFA

TFLAQLPPEQRMIQVKDVFTRYTNDVIATCAFGITVDSMRNPKNQFYIYGKEATTFNSIALIKLYIFRSLPTLARLINL

KIVRQKIADFFRDLVETTIKTRDENSIVRPDMLQLMMENRGKEGKPELSIEDMVSQAFIFFFGGFDSTSTLMCFAAHEI

AVNPDIQKRLQDEIDRILEENNGEAPYEAVNGMEYLDAVICEALRMYPVAVAMDRLCEKDFELPPALPGMKPFTIKKGQ

GIWIPIYGLQHDPKYFEEPEKFDPERFLGEKRKHSLNCGAYIPFGLGPRMCIGNRFALLETKVLLFYLLARCDLKVCEK

TPIPIKIAKDGFNMKPEGGFWLNVEPRENIHHTLSTKLVNGTC*

 

>CYP9R28P Pb9seq19P 449aa 2 exons PSEUDOGENE FRAGMENT multiple frame shifts and

stop codons, downstream from Pb9seq18

58% to CYP9R9 Linepithema humile

MIYIIILSMIVGSLGLYYYLFKDFNFFKKHGIPYIKLLLLLGNGIHHPPPIHS*AFKLIYYIHPDAKYVGMIKSLVMIR

DPELIKSMLKHFDMFMNHSSFFNETQGPFFAKNLISVYRCS**IEMRFILSPAFTFSKMKSMFKLMSNYDIDFSKYLAQ

LSAERRKMEMKDVFMTYANDVIATCAFGVCRLNEKSK**ILCLRQESDYFRHSACFTHLQFYLGWHEYLS*NFFVKK*P

IFLEILSKSYKNHIKIREGIV*SDMLQLMMESRSKNGRTD*TN*LSV**HQTFTFFFGGFDSNSMLMCFAAHKIAVN*D

VQKKLQNEID*VLKNNDGQVL*V*RVNSMEYLDAI(9)

INKTLRIYPGDLTLNRICVKDFELPSTLPGMKSFIIKKGQGIPVYGLYHDSKYFEKPEKFDPKRFLSKRKKHTLNCGAS

FPFGLGPRMSIGNIFVLLESFAVSNEMKNYKINMK*

 

>CYP9R29 Pb9seq20 513aa 1 exon Downstream from Pb9seq19P

70% to CYP9R6 Linepithema humile

MMYVIALSVIAGVLGFYYYFFKDWNYFKKHNILHKPPIPIVGNMGPSVFRLQSIAELIKDIYNLHSEAKYIGIFDMTKP

CIIVRDPELIKSIALKHFDIFPDHRSFVNESQDSIFGKNLFSIRGEKWRQVRSLLTPVFTSHKMKSMFKLMSKCAADFG

SFLTQLPPEQRMMQMKDIFARYTNDMIATCAFGITVDSMRNPKNEFYVYGKEATSFDGIALIKLYIFRNFPLLARLINL

KLIRQKIVDYFRDLVEITIKTRDENGIVRPDILQLLMENRNKEDKAKLTIEDMVSHAFIFFFGGFDTASTVMSFTAHEI
AVNQDIQKKLQNEIDRILKENNGEASYEAINAMEYLDAVIHEALRMYPPAATTDRLCVKDFELPPALSGMNSFTIKKGQ

NIWIPIYALHHDPKYFEKPEKFDPERFLGERRKDSLNCGAYIPFGLGPRMCIGNRFALLEIKVLFFHLLARCNLKVCEK

TPIPLKLARSGIIMKPEGGFWLNVEPREITLVDVRSLMI*

 

>CYP9R30 Pb9AGseq1 509aa 1 exon .

72% to CYP9R10 Linepithema humile

MEYWSILLSIVIGVISIHYLFKNFNFFKRHGVIHMPVVPILGSMTPFIFRQMAFTDLIMRMYNFNPNAKYYGFYATITP

TFLLRDPELIKSVLVKDFETFPNRHGFNSSAEPLLGKNLFSLRGEKWRNVRTLLSPSFTLSKMKMMFSLMSDCAVEFAE

FLSTLSADRSEIDMKDAFTKYTNDVIATCAYGIKINTMKDPTNKFYVYGKEAINFTGFRSLKFFFLRSFPTLSQILNIK

FLNDHVANFFKDTIMTTIATRDADHITRPDMLQLMMDIRGKEGRRQLDIDEMTAQAFIFFFGGFDTSSTAMSFAAHEIA

VNPEVQKKLQQEIDKGLEESNGEVTYEAINRLEYLDAVISEVLRLYPPVPFLERKCEGSYELPPTLPGEKSFTMKKDML

FWIPVFAIHRDEKYYDNPEKFYPERFLNNRTYHNSSCYIPFGLGPRMCIANRFALLEIKVLLFHLLARCELKPCAKTTY

PMKFSKKGLVFKPENGFWLNIQRRTNPMIDSKVDS*

 

>CYP9R31 Pb9seq9 515aa 1 exon Upstream from Pb9seq10

79% to CYP9R13 Linepithema humile

MDTWILLSLLAGTIAIYYYFFKNLKFFEKQGILHISPWPLVGNMAPAFLRQLSLAELIQKIYILNRDAKYVGFFDGMNP

VVIIRDPELIKAIGVKNFEAFPDHRAFIDEVNDPLFGKNLFSLRGDKWRDVRTLLSPAFTSSKMKTMFKLMSECAVSFT

DFLSKLPPDKSVMELKNSFTRYTNDVIATCAFGINVDSMKNPNNEFYVYGKEATTFNTLRTIKFYFVRSMPVITKMLGV

KFISERVAQFFKDLIRSTIYTRDTKNIVRPDMLQLMMETRGKRGPGKELTIEDMTAQAFIFFFGGFDTVSTLMCFVAHE

IGVNPDVQAKLRDEVDEVMKTTNGELTYEALNGMQYLDAVVNETLRMWPVAVFLDRISAEDFQLPPALPGDKPFLLKKG

MSVWFPVYGLHRDPKYFEKPDEFRPERFLDENKKEINSAAYIPFGIGPRMCIGNRFALLETKVMLFHLLARCELKPCVK

TTHPMRLSKSNFTMLAEGGFWLKIQARNNTNVSSNTANDYI*

 

>CYP9R32 Pb9seq10 508aa 1 exon Downstream from Pb9seq9, upstream from Pb9seq11P

73% to CYP9R10 Linepithema humile

MEYWSILLSIVIGVISIYYLFKNFNFFKRHGLIHMPVVPILGSMSSIIFRQIAFVDSIVKMYNFNPNAKYYGFYATTTP

TFLLRDPELIKSVLVKDFEAFPNRRGFSSADPLLGKNLFSLHGEKWRNVRTLLSPSFTLSKMKMMFSLMSDCAVEFAEF

LSTLSADRSEIDMKDAFTKYTNDVIATCAYGIKINTMKDPTNKFYVYGKEATSFIGSRSLKFLFLRSFPALSQILNIKL

ISDHVANFFKDTIMTTIATRDTEHITRPDMLQLMMDIRGKEGRRQLDIDEMTAQAFIFFFGGFDTSSTAMSFAAHEIAV

NPEVQKKLQQEIDKVLEESNGEVTYETISRLEYLDAVISEVLRLYPPVPFLERKCEGSYELPPTLPGEKSFTMKKDMLF

WIPVFAIHRDEKYYDNPEKFYPERFLNNRTYHNSSCYIPFGLGPRMCIANRFALLEVKVLLFHLLARCELKLCAKTTYP

MKFSKKGLVMMPENGFWLNIQRRTNPMIDSKVDS*

 

>CYP9R33P Pb9seq11P 441aa 1 exon PSEUDOGENE multiple stops and frame shifts;

Downstream from Pb9seq10

50% to CYP9R8 Linepithema humile, 55% to Pb9AGseq1

FGSVIPIIFRQLSFSDFILKMYNFYSMQNILYIILQPNILYLYYICKSHNRTDGRXTFPERQSFSNLNYSVLEKNILLI

FSLRGEKRRTMRALLNPSFIFSKMKMMFTLISEYAVEFVEFLTLPTDKDVMDMKNIFSKYMSVIIIHMAYGIEINFMKN

PMNKFYDFGQNAINFLLNQPIKFIFLRTFPTLGRILNIRFIKHNIKFLRYYIYYSCYYRAYADMLQLMMKIRERIERSK

TGYRNDRARVHFFFGGFETTSISMSFAAYEIAVNLKVQSKLEIDKILEELNEDITYEAINRFKYLYAVISETLKLHISX

PVVFLEKKFRGSYEFPPSLPGGKSFIVKKDMIINDSDFXAIHCDENYYDDLEKFYPEGFTSNKTYLNFLCYMPFELGPR

MCIANRYAILVMKDLLFHLLTRCELKSYAKTTYPMKWSKKGLVIILENS*

 

>CYP9R34P Pb9AGseq2P 464aa 1 exon PSEUDOGENE multiple frame shifts and stop codons

48% to CYP9R9 Linepithema humile, 61% to Pb9seq12

MDVKSLPIVENMRPAIFRQQLTDFVKIMYNLNSNVKYVNSSACMTFGKNPIVVLRDFEFVKSVVKTFQLYRPPWTTRSI

FGKNLIALCGHKREVRFILNPAFTSSKMKMFKLISNIVCLNSNCGVNFSTYLTGNCHKRTIEFKNIYLYKVHKRNRYLR

FWYQRCINLLSVYEKPEKICVRYRNITNFSGFSLLKFFIMRNFPRLARIIKLTFIQKKIYKEITHFFRDLVEKLLKEII

MISFVQTCYNWRSKDKAKLSIDDMVAAFIFSEASKVPPHCFAAHKIAVNQNIKRLNEIDQVLKEINETPYETLNDMEYL

NAMINEVLRMYPVAVALNKLYLKDFESLLLLSRANIIRTLLLRKPHMKPFTVKKRHGIKRFIILHHDPNYFEVPEKFYP

KRFLDEVRKDSLNCTYLPFAIDPIDCCIGNRFALLKRKVLLFHLARCDLKLCEKTVIPLKIVKDSSIKA*

 

Note: CYP9AS sequences are duplicated.  There are 2 copies of each and 3 copies

of one CYP9AS14

 

>CYP9AS11v1 Pb9seq27 507aa 1 exon Upstream from Pb9seq26P

70% to CYP9AS1 Linepithema humile, identical to Pb9seq4

MEPFTLLLTIITASICICLYYFVLSKISYFEQLKIPHERPIPLIGNMAPFIFRQMSPAENVQRLYKLFSHAKYFGMFDC

ITPVYVIRDPDLINTIAIKEFDNFCDHLGFVNETLDPIASRNLFNLQGDHWREMRKLLSPSFTSSKMKIMFELMCQCGE

NFANSIVQSGKNGKLYDMKEILSRYANDVVATCAFGINIDSFKHPNNEFYLLGKKALNFDGRLSFVFFINRNFPTLSKF

LKLRMFGPKVENFFKNIVSETVKVRDEQGIFRPDMIQLMMETRNKDSGPEFDINEMTAQAFIFFLAGFDSVSTAMCFMV

HEVGVNPNVQSKLKEEIDDVLKQTDGKPTYEAINRMKYLDAVVNESLRLYPIASFLDRKCIKKFELPPATPDSKSLILK

PGDNIWFPSYSLHRDPKYYPEPDKFNPERFVNGEVDNSVYMPFGLGPRMCIGNRFALMEAKVMLFYLLWHCDLLPDVKT

RNPMVLNKKAFVMMAEGGFWLKVRARMSKAPVT*

 

>CYP9AS12Pv1 Pb9seq26P 145aa 2 exons PSEUDOGENE FRAGMENT 200aa on N-term,

no frameshifts or stop codons but cannot be full P450 or alternate exon, upstream

from Pb9seq25, downstream from Pb9seq27

50% to CYP9AS6 Linepithema humile N-term

MLFSIIFLAKICLYSYTLYKLSYFELKIPHD*SILLISNIGCIVFSTYGFPKRLQRLCKLFSDVKYFGYYEFIISTYVI

RDPNLFNTIVIKQFDNFCDHD(1)

VLWKLLNSSFTASKIKTMFELMCQCAENSIDFMITQSKKKTESYMT*

 

>CYP9AS13v1 Pb9seq25 499aa 1 exon Upstream from Pb9seq24, downstream from Pb9seq26P

67% to CYP9AS8 Linepithema humile identical to Pb9seq6

MEPSTWFLAIVTASIGLYYYILYKLSYFERLKVPHERPTPLIGNMGSYIFRRMSIPENIQRLYNLFSDAKYFGFYDFMT

PTYVIRDPDLINTIAIKQFDNFCDHRSFANKILDPMASRNLFDLKGDYWREMRKILSPSFTSSKMKMMFGLMCQCAENL

ADFIVTQSGKNGKSYNMKEILSRYANDVIATCAFGISVDSFKHPNNEFFLVGQKCKFDSWLTFIFVVQRNIPLLAKLLK

LRMFGPHVENFFKNLVSNTVKIRDEQGIVRPDMIQLMMESRNKDTKLAYDINEMTAQAFVFFVAGFDATSTAMCFMAHE

IGVNPDVQNKLREEIDNVLKQTNGKPTYEAINHMKYLDAVVNETLRMYPLGSFIDRKCVKEYELPPATSDGKPIMLKPG

DNIWLSHYPLHRDPKYYSQPDKFNPERFVNGEIDNSIYMPFGIGPRMCIGNKFALMEAKILLFYLLWHCDLESDVKTKV

PMVINKHSLTMLAEGGFWLKVRARK*

 

>CYP9AS14v1 Pb9seq24 499aa 1 exon Upstream from Pb9seq23, downstream from Pb9seq25

69% to CYP9AS5 Linepithema humile, identical to Pb9seq6, identical to Pb9seq23

MELSTWLLTILTASIGLYYYILYKLSYFKRLKVPHERPTPLIGNMGPFIFRRMSIPENIQRLYNLFSDAKYFGFYDFMT

PTYVIRDPDLINTIAIKQFDNFCDHRSFANEILDPMASRNLFDLKGDHWREMRKLLSPSFTVSKMKTMFGLMSQCAENL

IDFMITQSGKNGKSYDMKEILSRYANDVIATCAFGISVDSFKHPNNEFFLLGQKSKFDGWLTFVFFMQRNIPALAKLLK

LRMFGPYVENFFKNIVSNTVKIRDEQGIVRPDMIQLMMETRNKDTGPAYDINEMTAQAFVFFLAGFDATSTAMCFMAHE

IGVNPDVQNKLREEIDNVLKQTNGKPTYEAINHMKYLDAVVNETLRMYPIGSFIDRRCVKEYELPPATPDGKPITLKPG

DNIWLSHYPLHRDPKYYSQPDKFNPERFVSGKVDNSIYMPFGIGPRMCIGNRFALMEAKILLFYLLWHCDLLPDVKTKV

PIVISKHSFTTLAEGGFWLKVRARK*

 

>CYP9AS14v3 Pb9seq23 499aa 1 exon Upstream from Pb9seq22P, downstream from Pb9seq24

69% to CYP9AS5 Linepithema humile, identical to Pb9seq6, identical to Pb9seq24

MELSTWLLTILTASIGLYYYILYKLSYFKRLKVPHERPTPLIGNMGPFIFRRMSIPENIQRLYNLFSDAKYFGFYDFMT

PTYVIRDPDLINTIAIKQFDNFCDHRSFANEILDPMASRNLFDLKGDHWREMRKLLSPSFTVSKMKTMFGLMSQCAENL

IDFMITQSGKNGKSYDMKEILSRYANDVIATCAFGISVDSFKHPNNEFFLLGQKSKFDGWLTFVFFMQRNIPALAKLLK

LRMFGPYVENFFKNIVSNTVKIRDEQGIVRPDMIQLMMETRNKDTGPAYDINEMTAQAFVFFLAGFDATSTAMCFMAHE

IGVNPDVQNKLREEIDNVLKQTNGKPTYEAINHMKYLDAVVNETLRMYPIGSFIDRRCVKEYELPPATPDGKPITLKPG

DNIWLSHYPLHRDPKYYSQPDKFNPERFVSGKVDNSIYMPFGIGPRMCIGNRFALMEAKILLFYLLWHCDLLPDVKTKV

PIVISKHSFTTLAEGGFWLKVRARK*

 

>CYP9AS15Pv 1 Pb9seq22P 196aa 1 exon PSEUDOGENE FRAGMENT two frame shifts and stop codon,

200aa on N-term, downsteram from Pb9seq23

60% to CYP9AS8 Linepithema humile, identical to Pb9seq8P

MEPSTWLLTILTASICLYYYILYKLSYFERLKVPHERPIPLIGNMDPFICRRMSISKNLQRLYNFFSDAKYFGFYDFYD

EYLINTIAIKFDNFCDHRSFTNEVLDPMAKENLFDLKKDHWREMRKLLSPSFTSSKMKTMFGLMCQCAENLVDFIITQA

GKNGMSYDMKEILSRYANLDFYSKAQYLECDNFNIEQF*

 

>CYP9AS11v2 Pb9seq4 507aa 1 exon upstream from Pb9seq5P

70% to CYP9AS1 Linepithema humile, identical to Pb9seq27

MEPFTLLLTIITASICICLYYFVLSKISYFEQLKIPHERPIPLIGNMAPFIFRQMSPAENVQRLYKLFSHAKYFGMFDC

ITPVYVIRDPDLINTIAIKEFDNFCDHLGFVNETLDPIASRNLFNLQGDHWREMRKLLSPSFTSSKMKIMFELMCQCGE

NFANSIVQSGKNGKLYDMKEILSRYANDVVATCAFGINIDSFKHPNNEFYLLGKKALNFDGRLSFVFFINRNFPTLSKF

LKLRMFGPKVENFFKNIVSETVKVRDEQGIFRPDMIQLMMETRNKDSGPEFDINEMTAQAFIFFLAGFDSVSTAMCFMV

HEVGVNPNVQSKLKEEIDDVLKQTDGKPTYEAINRMKYLDAVVNESLRLYPIASFLDRKCIKKFELPPATPDSKSLILK

PGDNIWFPSYSLHRDPKYYPEPDKFNPERFVNGEVDNSVYMPFGLGPRMCIGNRFALMEAKVMLFYLLWHCDLLPDVKT

RNPMVLNKKAFVMMAEGGFWLKVRARMSKAPVT*

 

>CYP9AS12Pv2 Pb9seq5P 129aa 2 exons PSEUDOGENE FRAGMENT stop codon in exon 1,

nonseqmatching splice sites, downstream from Pb9seq1, upstream from Pb9seq3

49% to CYP9AS4 Linepithema humile N-term, identical to Pb9seq26P except boundary

MLFSIIFLAKICLYSYTLYKLSYFELKIPHD*SILLISNIGCIVFSTYGFPKRLQRLCKLFSDVKYFGYYEFIISTYVI

RDPNLFNTIVIKQFDNFCDHGTF(9)

LLNSSFTASKIKTMFELMCQCAENSIDF

 

>CYP9AS13v2 Pb9seq6 504aa 1 exon upstream from Pb9seq7, downstream from Pb9seq5P

67% to CYP9AS5 Linepithema humile, identical to Pb9seq25

MEPSTWFLAIVTASIGLYYYILYKLSYFERLKVPHERPTPLIGNMGSYIFRRMSIPENIQRLYNLFSDAKYFGFYDFMT

PTYVIRDPDLINTIAIKQFDNFCDHRSFANKILDPMASRNLFDLKGDYWREMRKILSPSFTSSKMKMMFGLMCQCAENL

ADFIVTQSGKNGKSYNMKEILSRYANDVIATCAFGISVDSFKHPNNEFFLVGQKCKFDSWLTFIFVVQRNIPLLAKLLK

LRMFGPHVENFFKNLVSNTVKIRDEQGIVRPDMIQLMMESRNKDTKLAYDINEMTAQAFVFFVAGFDATSTAMCFMAHE

IGVNPDVQNKLREEIDNVLKQTNGKPTYEAINHMKYLDAVVNETLRMYPLGSFIDRKCVKEYELPPATSDGKPIMLKPG

DNIWLSHYPLHRDPKYYSQPDKFNPERFVNGEIDNSIYMPFGIGPRMCIGNKFALMEAKILLFYLLWHCDLESDVKTKV

PMVINKHSLTMLAEGGFWLKVRARKKALIT*

 

>CYP9AS14v2 Pb9seq7 499aa 1 exon upstream from Pb9seq8P, downstream from Pb9seq6

69% to CYP9AS5 Linepithema humile, identical to Pb9seq23, identical to Pb9seq24

MELSTWLLTILTASIGLYYYILYKLSYFKRLKVPHERPTPLIGNMGPFIFRRMSIPENIQRLYNLFSDAKYFGFYDFMT

PTYVIRDPDLINTIAIKQFDNFCDHRSFANEILDPMASRNLFDLKGDHWREMRKLLSPSFTVSKMKTMFGLMSQCAENL

IDFMITQSGKNGKSYDMKEILSRYANDVIATCAFGISVDSFKHPNNEFFLLGQKSKFDGWLTFVFFMQRNIPALAKLLK

LRMFGPYVENFFKNIVSNTVKIRDEQGIVRPDMIQLMMETRNKDTGPAYDINEMTAQAFVFFLAGFDATSTAMCFMAHE

IGVNPDVQNKLREEIDNVLKQTNGKPTYEAINHMKYLDAVVNETLRMYPIGSFIDRRCVKEYELPPATPDGKPITLKPG

DNIWLSHYPLHRDPKYYSQPDKFNPERFVSGKVDNSIYMPFGIGPRMCIGNRFALMEAKILLFYLLWHCDLLPDVKTKV

PIVISKHSFTTLAEGGFWLKVRARK*

 

>CYP9AS15Pv2 Pb9seq8P 175aa 1 exon PSEUDOGENE FRAGMENT stop codon, 2 frameshifts at X;

downstream from Pb9seq7

64% to CYP9AS8 Linepithema humile N-term, identical to Pb9seq22P

MEPSTWLLTILTASICLYYYILYKLSYFERLKVPHERPIPLIGNMDPFICRRMSISKNLQRLYNFFSDAKYFGFYDFXY

DEYLINTIAIK*FDNFCDHRSFTNEVLDPMAKXNLFDLKKDHWREMRKLLSPSFTSSKMKTMFGLMCQCAENLVDFIIT

QAGKNGMSYDMKEILSRYAN

 

>CYP336A15 Pb336seq1 501aa 1 exon head to head with Pb336seq2, upstream from Pb336seq3

68% to CYP336A8 Linepithema humile

MDVTVVLLSLVVLVILYFYLTRNFKYWQKRGVPCASGAVPGLGHMWDVVRMKINFSEFSNKIYDDNRNHSMVGFYNFMT

PSLFVLEPELVKTVLQTNFTNFHENGLKINPDLDPLLANNPFFNYGEKWIIGRKRLTYAFSSMRLKILLESVKQVCEKF

ENYVDKKLGKTGRAELELKELFARFTSQVVAGAGFGVDGMSFDDEKEKESFYTMGKSFLEGSSLNNLIFTFVLFIPSLG

KMLRMRLVPKKIDHFFRTLVVDIMEQRRRETTRRNDFLQLMVDLEKTEGDEFDSTVLASHAMSFFVDGNETSNTTLSFI

GYNLATNPKVQEKLREEVISVLNKYDGVITYEALREMTYMDQVISESQRITPALGFLSKICTEDIEIKGSDGVVCRVER

GTPVLIPIHALAKDPRYWENPEEFDPDRFGPDRKNSIERFAFLPFGEGPRICVGMRMALLQMKACLATFLRKYSLELSP

KTQLPLKYNSALLNTVEGGIWGIIRPL*

 

>CYP336A16 Pb336seq2 501aa 1 exon head to head with Pb336seq1

62% to CYP336A5 Linepithema humile

MAIVLVSLIVGVFVALYLYLTRNYKHWQKHGIPTIDGALPGFGHMLPVISMKTYFGDFCRKIYDDAKGHSMVGIYDFTV

PALMIRDPELIKTVLQTNFSNFSENAIFVDPKLDPLIAHNPFVLTGEKWLASRKRLTYAFSSMRLKILLESVKKVCGMF

EDYIDGKMINGKAEFEIKSLCARYTAQVVAGAGFGVDGYCFDDSKKEISFREKSQAIFEPSTRHSIMFSLVFLIPSLNK

IFQMGFVPKHVDHFFRTLVADLMEQRRKDRIPRNDFLQLMAELELAEGDKFDIETLTGQSLSFIIDGYETSSTVMSFIC

FHLASYPKVQEKLREEVLSMLNKYDGAITYEGLKEMTYMDQVLNESMRKVPAGTIIKKRCTEEFELRGSDGLVYRIKPG

MEVLIPIQGLHEDPQYWENPEVYDPERFNPERKKNIEKFVYLPFGEGPRICVGMRMAQLQIKAGLTIILRKYSMEVSPK

TRLPIQLIPGAILPTVKGGLWISFREL*

 

>CYP336A17 Pb336seq3 501aa 1 exon SEQUENCING ERROR missing 'A' at 764216,

downstream from Pb336seq1

63% to CYP336A4 Linepithema humile

MTIVLVSLIVGVFVALYLYLTRNYKHWQKHGIPTIDGVLPGFGHMLPVISMKTYFGDFFGKIYDNAKGHSMVGIYDFTM

PALMIRDPQLIKTVLQTNFSNFSENVGFFDPKLDLLVAHNPLVLTGEKWLASRKRLTYGFSSMRLKILLESVKKVCGMF

EDYIDGKMINGKAEFEIKSLCARYIAQVAAGAGFGVDGYCFDDSKKEISFRKKSRAIFELSTRHLIMFSLVFLIPSLNK

IFQMGFVPKHVDHFFRTLVADLMEQRRKDRIPRKDFLQLMAELELAKGDKFDIEMLMGQSLSFIINGYETSSTVMSFIC

FHLASYPKVQEKLREEVLSMLNKYDGVITYEGLKEMTYMDQVLNESLRKVPAGTIMKKRCTEEFELRGSDGLVYRIKPG

MEILLPIQGLHEDPHYWENPEVFDPERFNPERKKNIERFIYFPFGEGPRICVGMRMAQLQIKAGLTIILRKYSMEVSPK

TRLPVQLIPRAILPTVKGGLWVNFREL*

 

>CYP336A18P Pb336seq4P 68aa 1 exon PSEUDOGENE FRAGMENT 100aa on N-term, head to

head with Pb336seq3, upstream from Pb336seq5

61% to CYP336A4 Linepithema humile

NFKYWQKRGVPCASGAVPGLGHMWDVVRMKINFSEFSNKIYDDNRNHSMVEFYNFMTPSLGIMCIERI

 

>CYP336A19 Pb336seq5 498aa 1 exon downstream from Pb336seq4P, tail-to-tail with

Pb336seq6

66% to CYP336A8 Linepithema humile

MVILLSLVALVILYFYLTRNFKYWQKRGVPCASGAVPGLGHMWDVVRMKINFSEFSNKIYNDNRNHSMVGFYNFMTPSL

FVLEPELVKTVLQTNFTNFHENGLKINPDLDPLLANNPFFNYGEKWTIGRKRLTYAFSSMRLKILLESVKQVCEKFENY

VDKKLDKTGRAELELKELFARFTSQVVAGAGFGVDGMSFDDEKEKESFYTMGKSFLEGSTLNNLIYTFVLFIPSLSKML

RMRLIPKKIDHFFRTLVVDIMEQRRRETTRRNDFLQLMVDLEKTEDDKFDSTVLASHAMSFFVDGNETSNTTLSFIGYN

LATNPKVQEKLREEVISVLNKYDGVITYEALREMTYMDQVISESQRITPALGFLRKICTEDIEIKGSDGVICRVERGTP

VLISTQALAKDPRYWENPEEFDPDRFGPDRKNSIERFAFLPFGEGPRICVGMRMALLQIKACLAAFLRKYSLELSPKTQ

LPLKYNSVLLNIVEDGIWGIIRPL*

 

>CYP336A20 Pb336seq6P 497aa 1 exon PSEUDOGENE frameshift and multiple stop codons,

tail-to-tail with Pb336seq5, head-to-head with Pb336seq7i

60% to CYP336A5 Linepithema humile

MAIVLVSLIVRVFVALYLYLTRNYKHWQKHGIPTIDEALPGFGHILPVISMKIYFGDFCRKIYDDAKGYSMVGIYDFTV

PVLMIRETELIKTVLQTNFSNFSENAVFLDPKLDPLVAHNPFVLIGEKWLASRKRLTYAFSSMRVKILLESIKKVCGMF

EDYIDGKMINGKAEFEIKSLCARYTAQVVAGAGFGVDGYCFDDSKKEISFRKKSLAIFEPSTRSCXFSLLFFIPSLNKI

FQMSFVPKHVDHFFRTLVADLMEQRRKDRIPRNDFLQLMAELELAEGDKFDIETLTGQSLSFIIDGYETSSNVMSFICF

HLASYPKVQKLHEEVLSMLNKYDDTITYEGLKEMTYMDQILNESLRKVPAGTVIKKRCTEKFELRESDGLVYRIKPGME

VLIPIQGLHKDPQYENPEVYDPERFNPERKKNIERFVYFPFGEGPRICVEMRMAQLQIKAGLTIILRKYSMEVSPKTRL

PLQLIPGAILPTVKSGLWVNFRKL*

 

>CYP336A21 Pb336seq7i 174aa 1 exon INCOMPLETE no sequence information for 250aa

in middle, head to head with Pb336seq6P

70% to CYP336A7 Linepithema humile

MVILLSLVALVILYFYLTRNFKYWQKRGVPCASGAVPGLGHMWDVVRMKITFSEFSNKIDGVVCRVERGTPVLIPAQAL

AKDPRYWENPEEFDPDRFGPDRKNSIERFAFLPFGEGPRICVGMRMALLQMKACLATFLRKYSLELSPKTQLPLKYNSA

LLNTVEGGIWGIIRPL*

 

CYP4 clan

 

Note: no CYP4AA is found in this set

 

>CYP4G71 Pb4Gseq1 558aa 7 exons GC donor on 5' of 3rd intron

79% to CYP4G11 honeybee

90% to CYP4G65 Linepithema humile 

MSAAEPEMIAGSVASATSTGLSASTVFLALLVPALVLYYIYFRISRRHMIELAEQIPGPDGLPLIGNALMFLGNSDT(1

)

IFRTLYRKSFEFDQIIKIWLGPKLLVFLMDPRDVEVILSSHVYIDKSTEYRFFQPWLGNGLLISTG(1)

PKWRAHRKLIAPTFHLNVLKSFIDLFNANSRAVVERMRKEGDKEFDCHDYMSECTVEILLETAMGVSKNTQDRSGFEYA

MAVMK(2)

MCDILHLRHTKVWLRPDWLFNLTKYGKDQIRLLEIIHGLTKKVIARKKQEYKSGKRNVIDASGQNGNAKTNGK(0)

GLSFGQAAGLKDDLDVDDNDVGEKKRQAFLDLLMEAGQNGSILTDDEVKEQVDTIMFE(0)

GHDTTAAASSFFLSIMGCHPDIQEKVIQELDEIFGDSDRPVNFQDTLEMKYLERCLMETLRLFPPVPIIARKINTDLKL

V(1)

SGDYTIPAGTTVVVTTFKMHRQPHIYPNPEVFNPDNFLPEKTANRHYYAFVPFSAGPRSCVGRKYAMLKLKIILSTILR

NFRIKSDIKESDFRLQADIILKRAEGFKIRLEPRERATATA*

 

>CYP4M27 GH996933 European corn borer Ostrinia nubilalis

65% to CYP4M8 Trichoplusia ni

ERKEYVEKNGFDIYETDNDDTVFLNQRRKKTAMLDLMLLAQKDDLIDDDGIQEEVDTFMF

EGHDTTAAGLTYCLMMLANNNQIQGKIFKELREVFGASERSATMEDLTKLRYLECCIKES

MRLYPPVPFISRTLTENVKLGEYIIPKGTYCHIHIFDLHRREDLYPNPTQFIPDRFLPEN

CIGRHPFAYIPFSAGPRNCIGQKFAMLEMKSAVSAILRRFELVPVTRPEDLKLASDLVLR

NSEPVYVSFIRRTI*

 

>CYP4AB15 GE363597 Nasonia (3 aa diffs)

LIDEQGIKEEVDTFTAAGYDTTGMGMVYMLLLLAENKDVQKLARAESDRILSASGGRITM

TEIQQMDYIERCVKESLRLFPTAPNISRTIIKDIQLKNCMVPAGTDVFVPIYDVHRDPKY

WPDPLKFDPDRFLPEEVHKRHPFFYLPFSHGPRNCIGQKFAIAEMKALVARIVYNFYLEP

VTYTKDLQFTAHIVLLLTVPPCTKFIKRSRSKD*

 

>CYP4AB44 Pb4ABseq10i 136aa 3 exons INCOMPLETE short scaffold, missing both ends,

to aa 100 and from aa 240

61% to CYP4AB2 Solenopsis invicta (fire ant)

(0)

VQFIFVSRCIVSVLGAKWQSRRKLLNPMFHFAILQQFVDVFVKQSEDMTNSLKNTGDHIVNDLMFFISEYMLNTICE(1

)

TGMSTSPHKLGSLQQQYRNAVDQMLELIVYR(2)

TIRPWLHYDWIFAFTPKGRQQMKHLKII

 

>CYP4AB45 Pb4ABseq11i 216aa 5 exons INCOMPLETE short scaffold,

missing both ends, to aa 30 and from 250

55% to CYP4AB1 Solenopsis invicta (fire ant) N-term

 (1)

YTNELIINIPAVNFCIHNIYTFSENIWKLQFTLFDKYYPIFKIWFFYKPFVCIRHPDDIEV(0)

VILKTHFNKGFLYKFLHPLFKKGLLTSED(1)

AKWQSRRKLLNPTFHFAILQQFVDVFVKQSEDMTNSLKNTDDHIVNDLMFFISEYTLNTICE(1)

TGMSTSPHKLGSLQQYRNAVHQMLELIFYR(2)

TIRPWLHYDWIFAFTPKGRQQMKHLKIIHGFSQK(0)

 

>CYP4AB46 Pb4ABseq1i 177aa 3 exons INCOMPLETE, last 3 exons only

61% to CYP4AB1 Solenopsis invicta (fire ant)

 (0)

DRAREEVNTVMHESGGKLTIQSLQKLSYLERCIKETLRLYPVAHFISRVTSEDVKLQ(1)

TYLVPAGTFVYISIHGAHRDPNYWSNPEVFDPDRFLPEKTQNRHPYSYLPFGAGPRNCIG(1)

QRFARLEMKCMIASLIYNFYLEPMEYLKDIQLNTDILIRSAYPLRLKFVPIVKKHTNFNT*

 

>CYP4AB47 Pb4AZseq10 491aa 12 exons INCOMPLETE missing internal exon aa 350-400

(N's)

, completed using transcript contig13794

59% to CYP4AB1 Solenopsis invicta (fire ant)

MLIVIFLLQCITVHYNT(2)

RLISKIPNKPGLPFIGNALEYCTHSQE(1)

KLWDRQRAAFKEFYPIYVFWCGPIPFISIFHPNDVE(0)

IVLSNSKEHLGKGYIYTFMYPWLGTGLLTSEG(1)

SKWRERRKILTPAFHFIILKQFVNVFVEESNRMIRSLKNMNTLIIDDLRNFISQHTLNAICE(1)

TAMGISLENMGEFQQQYRKVVHEMGDILIYR(2)

IMRPWLHLDMTFALTPMGRKHAKNLKILHGFTEK(0)

IIAERKQYHERTNKQYLKHLESDVELSNTDEEIMGI(1)

KKKRSAMLDLLIAASYNNEINNSDIREEIDTFTFE(0)

GHDTVAMGLTYAILALAEHKDIQERVRSEVKTVMHENEGKLTIAALNNMSYLERCLKESLR(1)

LYSFLDSYLVPSGAIMQIHIFDIHRDPNFWPNPDVFDPDRFLPEKIQKRHPYSYLPFSAGSRNCIG(1)

QRFAMLEMKTVIAALVNNFYLESVDYLKNLRFKLDMITRVTHPIRVKFVPIKHS*

 

>CYP4AB48 Pb4ABseq12i 468aa 11 exons INCOMPLETE cannot find first exon (45aa on

N-term)

, upstream from Pb4AZseq12

56% to CYP4AB1 Solenopsis invicta (fire ant)

 (1)

DFRNLLYIQCKCYYPIGKTWIGPIAMVTVSHPNDIQ(0)

EILSNTKHLAKSHISNFLNPWLGTGLLTSEG(1)

TKWHNRRRILTPTFHFNILNQFVEVLIEEGNNVTQSLKNIKESTVDDLASFISHHTLNAICE(1)

ITMGISLREIGEFEEQYRQAIHEIEEISFYR(2)

LLRPWLYFNVIFALTPMGRRQAKCLKILHGFTEK(0)

IIAERKQYHKSTNEQYLKNFANEIHKIETNDKTDIGV(1)

KRKRLTMMDLLISKIRDNKMNDADIREEINTFIYK(0)

GHDTVTMGLTYAILLLAEHKDIQ(0)

ENVRKEINAIMQANEGKLTMSALNNMLYLERCLKESLRLYPSMAFIMRTLSEDIKLQ(1)

SYLVPSGTLMLIGIHDVHRNPNFWPKPEIFDPDRFLPEKIQNHHPYSYIPFSAGPRNCIG(1)

QQFAMLEMKAIIAPLVYNFYLEPVDYLKDLRFVADFLNRVAHPVRVRCVPINRTPSTLFNAT*

 

>CYP4AB49 Pb4AZseq12i 400aa 10 exons INCOMPLETE missing C-term from 400 (N's)

, transcripts not complete either?, GC donor on second intron, downstream from

Pb4ABseq12, upstream from Pb4ABseq13

59% to CYP4AB1 Solenopsis invicta (fire ant)

MILTLLLLCFLLILLYYYYILCDRKFVQLIDKIPSVPSLPIFGHALILWMPSRE(1)

DLWKLLHVYTNIYYPIWKLWLGPFAYVSICHPDDLE(0)

KVLSTTKHLEKGSVYTLLNPWLGTGLLTSKG(1)

TKWHEKRKILTPTFHFNILNQFVEMLIEEGNHMTQSLKNIEGSTVNDLVSFISFHTLNAICE(1)

TTMGTSLHKMGEFQKQYRQAIYEMGEIILYR(2)

LIRPWFVFDTIFALTPMGRKQIKCLKILHEFTEK(0)

IIAERKRYHELTEGRYLKNFANGISNIETDDDEMLGV(1)

KKKRLAMLDLLISVAQDYGMSDLDIREEVDTFTFE(0)

GHDTVAMGITFAMLLLAEHKDIQ(0)

ERVRNEVNTIMQANEGKLTMSALNNMSYLERCLKESLRLYPSVPHILRIASEDIKLR(1)

 

>CYP4AB50 Pb4ABseq13 516aa 12 exons GC donor on first intron, downstream from

Pb4AZseq12, upstream from Pb4ABseq14i

61% to CYP4AB1 Solenopsis invicta (fire ant)

MIIILLLLCIFFLILLYYYILYNGRFVRLINNIPSIPSISLLE(1)

DLWKFLRVYSKYYYPIWKFWLSPYHFGMVLVSICHPHDLE(0)

KILSNTKQHIAKGFLYRLLHSWLGTGLLTSEG(1)

TKWHKRRKILTPTFHFNILKQFVEVLIEEGNNITQSLKNIKGSTIDDLTSLISHHTLNAICE(1)

TAMGTSLHEMDEFQAQYRQAIHEMGEIMMYR(2)

FLNPWLIFDIIFNLTSIGRRQIKCLKILHAFTEK(0)

VIAKRKQYHECTDGRYLKNFANSINEIEEDDKEMTGS(1)

KKKRLAMLDLLILEARTNEMSDRDIREEVDTFIFE(0)

GHDTVAMALTFAILLLAEHKDIQ(0)

ECVRKEVNAIMQANDGKLSMSALNNMSYLERCLKESLRLYPSVPYMMRVSSEDVKLQ(1)

SYLVPSGTTLFLNIYSTHRDPNFWPNPEIFDPDRFLPEKIQNRHSYSYIPFSAGLRNCIG(1)

QRFAMLEMKAIIAPLIYNFYLEPIDYLKDVRLKLDIINRPVHPIRLRCIPINHTPSTSFRTI*

 

>CYP4AB51 Pb4ABseq14i 121aa 3 exons INCOMPLETE missing from aa 120, downstream

from Pb4ABseq13

46% to CYP4AB25 Solenopsis invicta

MIIILLLLCFFLILLYYYIYHNGKFKRLINNIPSVPFLPLFGHIFVFWKATQE(1)

DYWKLISMHNEIYYPIYKIWLGPFAFVNICHPDDLK(0)

KILGSTEHHLEKGYLHILLQSWLGTGLITSKG(1)

 

>CYP4AB52 Pb4AZseq13i 401aa 9 exons INCOMPLETE missing 120aa on N-term

58% to CYP4AB1 Solenopsis invicta (fire ant)

 (1)

TKWHKMQKILTPMFHFNILKQFVEVLIEEGNNITQSLKNIKGSTVDDLAFFIGHHTMNVICE(1)

IVMGTSLQEIGAFQEQYRQAIYELREIYFYR(2)

SLKPWLYFDMIFALTPMGRRYAKYLKILHGLTEK(0)

IVAKRKEYHERTDGRYLKNFDNETNIEADDKEVIGGM(1)

KKRRFTMLDYLISVARNNDINDIDIREEIDTFIMK(0)

GHDTVMMSVIYALLLLAEHKDIQ(0)

ECVRNEISAIMQANEGKLSMSALNNMSYLERCLKESLRLYPSMPFIMRTISEDVKLD(1)

SYLVPSGTTVFLNIYDTHRNSHFWPNPDVFDPDRFLPEKIQNRHPYSYIPFSAGPRNCIG(1)

QRFAMLEMKAIIAPLIYNFYLEPIDYLKNIRFMADFVLHVVHPIRVRCVPIDRTPSTLFKAI*

 

>CYP4AB53 Pb4AZseq1i 210aa 6 exons INCOMPLETE missing both ends, to aa 175 and

from aa 400

65% to CYP4AB30 Linepithema humile, 97% to Pb4AZseq9i

(1)

TSMGTSLQELDNKAQEYRQAIYEMGGILIYR(2)

IMRPWIASDTIFALTSMGRKQAKCLKILHAFTEK(0)

IIEDRKQYHERTNGRYLNFANGMDKLDDNEVIGI(1)

KKKRLAMLDLLISLARDNQITDQDIREEIDTFMFE(0)

GHDTVAMGITFAILTLAEHKDIQ(0)

ECARKEVSDIMEANDGKLTMSALNEMSYLERCLKESLRLHPSVPFISRVLSED(0)

 

>CYP4AB54P Pb4ABseq8Pi 85aa 2 exons PSEUDOGENE FRAGMENT two exons on C-term,

stop codon in first exon, upstream from PbABseq9

63% to CYP4AB32 Linepithema humile

(2)

DINFWQNPKVFDANRFSPEKIRHDYSALSS*LLDAGPRNCIG(1)

QRFVLLQIKVMIAPSIHNFYLEPMDYLKDLSSKIDLVFCSLFIK*

 

>CYP4AB55P Pb4ABseq9i 391aa 9 exons INCOMPLETE possible pseudogene,

missing first exon but no sign of it, no transcripts, downstream from

Pb4ABseq8, upstream from Pb4AZseq9i

71% to CYP4AB1 Solenopsis invicta (fire ant)

(1)

AKWHSRRKILTSAFHFNILQQFVEILIEEGENMTKSLKDTGGTIVKDLLPFVSEYTLNAICE(1)

TAMGTSLQGLGAFQQRYRKAVQEMGEILIYR(2)

LMRQWLRNNWIFSLMPKGRQQTQALKILHGFTEQ(0)

IIAERKLYHERTNDQYLKSHVSTDNIETYGC(1)

QRKRLALLDLLIAVSREGLLTDSDIREEVDTFMFE(0)

GHDTTAMGICFTLLLLAEHKDIQ(0)

DRVRDEINIALQESEQKFTMKVLQNLSYLDRCLKESLRLYPSVYFISRITSEDVKLQ(1)

SYLIPTGTLIHLNIYGVHRDPNFWPNPEVFDPDRFLSEKIQNRHPYSYLPFSAGPRNCIG(1)

QRFALLEMKAMIAPIIHNFYLEPVDYLENLRLKIDLVLRPTHPIRVRFVPIKEAHKII*

 

>CYP4AB56 Pb4AZseq9i 544aa 7 exons INCOMPLETE missing middle exons from 180-380

(N's)

, completed aa sequence with transcript contig05201, downstream from Pb4ABseq9i,

upstream from Pb4Gseq1

56% to CYP4AB1 Solenopsis invicta (fire ant), 97% to Pb4AZseq1i

MIISLLLFCSFLILLYYYILHYEKFVRHINNIPSMPSHPLLGHTITLWLCTQE(1)

NLWKLQRKLCKEYYPLYKLWLGSIAMVSVHHPDDLE(0)

KVLSNPKHHLSKGYLYDSLKPWLGTGLLISDG(1)

QKWHSRRKILTPTFHFNILKQFIEILIEEGNHITQSLRNVKDSTVDNLVSFVSHHTLNAICG(1)

TSMGTSLQELGNKAQEYRQAIYEIGGILIYRTMRPWIASDTIFALTSMGRKQAKCLKILHAFTEK

VIEDRKQYHERTNG

RYLNFANGMDKLDDNEVIGMKKKRLAMLDLLISLARDNQITDQDIREEIDTFMFEGHDTVAMGIT

FAILTLAEHKDIQE

CARKEVSDIMEANDGKLTMSALNEMSYLERCLKESLRLHPSVPFISRVLSEDVKMQSYLVPTGSV

LHINIYDIHRDPNF

WPNPEIFDPD(0)

SYLVPTGSVIHINIYDIHRDPNFWPNPEIFDPDRFLPEKIRNRHPYSYLPFSAGPRNCIG(1)

QRFAMLEMKAIMAPILYNFYLEPVDYIKDFQFISDIITRVADPIRVKCVPIDRH*

 

>CYP4AB57 Pb4ABseq15 532aa 12 exons head to head with Pb4ABseq16P,

upstream from Pb4AB17P

59% to CYP4AB1 Solenopsis invicta (fire ant), 94% to Pb4ABseq18

MINILLFFIFILLAYNFYVHYGRNGRLINRIPGPSSYSIIRKILQSSRSN(2)

YKFPALCSYILNIYVFSVLSEDLWKLQILDQYYPVSKVWLFSIPFVFIRHPDDIEV(0)

KILKMHKEKSFIYNFLHPWLNTGLLTSRG(1)

AKWQSRRKILNPTFRLAILQQFIEVFTKKGEDMANSLKNISDHIVKDLMLFISEYTLNTICD(1)

TVMGISLQEFDLFQQQYRNAVNQMLEFVVYR(2)

GLRPWLYLDWIFALTSKGRQQKKLLNIIHGLSQK(0)

IIAEKKLYHEQTNGRYLKNCDKCTIEEDNVEAVTI(1)

EKRRLTMMDLLIAASREGYLTDSDIKEEIDTILFA(0)

GHDTTAMTICYVLLLLADHKDVQ(0)

DRVREEVNAVMHESGGRFTMQSLQNLSYLERCIKETMRLYPVVYFISRVTSEDVKLQ(1)

SYLIPAGTSLLISIYGVHRDPNYWPNPEIFDPDRFLPDNIRNQHPYAYLPFSAGSRNCIG(1)

QRFALLEMKSFVASLIYNFYLEPIENLKDVQFNADMMIRPAYPLGLKFVPIIKKHADFKG*

 

>CYP4AB58P Pb4ABseq16Pi 120aa 3 exons PSEUDOGENE FRAGMENT 150aa on N-term,

multiple stop codons, no start, unmatches splices, head-to-head with Pb4ABseq15

53% to CYP4AB36 Linepithema humile

EYSKLIINFPAVYS*HIQHNIYIFSEDI*KLLIILFDKYYPIFKV*LFSILFVY(9)

SKSFIYNVLHPALKTGFLTSGV(1)

DKWQSRPKILNPTFCFVMLQ*FVDVFIKQSEDMTNFLKNMGDYIVNDL

 

>CYP4AB59P Pb4ABseq17Pi 57aa 1 exon PSEUDOGENE FRAGMENT second exon, 75aa,

frameshifts?, downstream from Pb4AB17P, upstream from Pb4ABseq18

34% to CYP340F1 Bombyx mori probably a false positive hit

NCIQRIFTNKQYKSFTI*SHIFFKKFVMSSLCFMKTSTN*HNKTKCGI*YFRLRLPFGHL(9)

 

>CYP4AB60 Pb4ABseq18 532aa 12 exons downstream from Pb4ABseq17P

59% to CYP4AB1 Solenopsis invicta (fire ant), 94% to Pb4ABseq15

MINILLFFIFILLAYNFYVHYGRNGRLINRIPGPSSYSIIRKILQSSRSN(2)

YKFPALYSYILNIYVFSILSEDLWKLQILDQYYPVSKVWLFSIPFVFIRHPDDIEV(0)

KILKQKSEKSFLYNFLHPWLNTGLLTSRG(1)

AKWQSRRKILNPTFRLAILQQFVDVFIKRSENMANSLKNISDDTVKDLMLFISEYTLNTICD(1)

TVMGISLQEFDLFQQQYRNAINQMLEFMVYR(2)

GLRPWLYLDWIFALTSKGRQQKKLLNIIHGLSQK(0)

IIAEKKLYHEQTNGRYLKNCDKCTIEEDNVEAVTI(1)

EKRRLIMMDLLIAASREGYLTDSDIKEEIDTILFA(0)

GHDTTAMTICYVLLLLADHKDVQ(0)

DRVREEVNAVMHESGGRFTMQSLQNLSYLERCIKETMRLYPVVYFLSRVTSEDIKLQ(1)

SYLIPAGTSLLISVYGVHRDPNYWPNPDIFDPDRFLPDNIRNQHPYAYLPFSAGSRNCIG(1)

QRFALLEMKSFIASLIYNFYLEPIENLKDVQFNVDVMLRPAYPLRLKFVPIVKKHADFKA*

 

>CYP4AB61 Pb4ABseq2 510aa 12 exons contains Pb4ABseq3P in intron on opposite

strand

59% to CYP4AB1 Solenopsis invicta (fire ant)

MIIILLLLIFTLLIYNFYIYYGRDGRLINRIPGPSSYSIVKKFLQK(1)

NIWKLHVIIFDQYYPIFKIWFFFRPVVCIRHPDDIE(0)

IILKKHIEKSFIYNVLHPWFSTSLLTSGG(1)

AKWQSRRKIINPTFHFVILQQFVENVFNKQSKDMVNSLKNMGDPIVKDLMLFVSEYTLNTICD(1)

AGTSTSLRKYFDSLQQQYRHAVDKMFEFVIYR(2)

GLRPWLYHDWIFALTSKSRQQRRFLKIINGFSQKV(0)

IIAERKLYHEQINGQYMKTCDKVALAEENNSETIIS(1)

KKKQLAVLDFLIAASRESYLTDSDIQGEINTFIAA(0)

GYDTTAMTICFTLLLLAEHKDIQ(0)

DRVREEVNTVMRESEEKFTMQSLLKLSYLERCIKEALRLYPIAYFISRVTSEDVKLQ(1)

SYLVPVGTTVIISIHGVQRDPNYWPNPEIFDPDRFLPENIRNQHPCAYLPFSGGPRNCIG(1)

QRFALLEMKSMIASVIYNFHLEPIENLKDIQLNGDMLMRPANPLRLKFIPITKTHIDI*

 

>CYP4AB61-ie4b Pb4ABseq3Pi 50aa 1 exon single exon fragment inside intron of

Pb4ABseq2 on opposite strand

53% to CYP4AB27 Solenopsis invicta, 91% to Pb4ABseq2

FHFVILQQFVDNVFNKQSKDMANSLKNMEDPIVKNLMLFVSEYTLNTICG(1)

 

 

>CYP4AB62P Pb4ABseq4Pi 122aa 2 exons PSEUDOGENE FRAGMENT 2 exons on C-term, G-

>E in heme-binding sequence, stop codon in last exon

60% to CYP4AB26 Solenopsis invicta

(0)

LNHLQIKCYFIKFFRIIFSTNWDLISIYGVHRDPNYWSNSEIFDPDRFLLDNIRNQHPYAYLPFSAGSPKCIE(1)

QFAFVEMKSLVASLIYNFYLEPIENLKDVQFNADMLIRPAYAFKICSNR*

 

>CYP4AB63P Pb4ABseq5P 487aa 11 exons PSEUDOGENE  missing 30aa from aa180-210

59% to CYP4AB1 Solenopsis invicta (fire ant)

MIIILLLLCSSLILLYYYILHYEKFVRPINKIPSMPSYPLIGHLLHFWMASPE(1)

DLWKLIRSMAVTYYPISNLWLGPIAAVGIRHPDDIE(0)

KILSSTTHHLAKGYLYKYLHPWLGTGLLTSKG(1)

IKWHKRRKILTPTFHFNILKQFVEILIKEGNHLTQSLKNSEGSTIDNLVFFISKHTLNAICV(1)

LRPWLVFDIIFALTSMGKKQNRCLKILHGFTEK(0)

IIAERKKYYECNKGHLENFADITDDKLDEIDDKQVIGV(1)

KKKRLAMLDLLISVARDNEINDLGIREEVDTFIFE(0)

GHDTVATGLTFAILLLAEHKDIQ(0)

QRVRDEVNAIMHANKGKLTMSALNDMSYLERCLKESLRLYPSVPYVMRSVSEDVNLD(1)

SYLIPSGTLLYIGIQEVHRDSNFWPNPEVFDPDRFLPDKIQNRHPYSYIPFSGGPRNCIG(1)

QRFAMLEMKAMIAPLIYNFYLEPVDYLKDLRFKVDIINRTVDPIRIRYIPVDQTQSTL*

 

>CYP4AB64P Pb4ABseq6P 490aa 11 exons PSEUDOGENE Unmatched splices on last

intron breaking heme binding sequence, missing missing 20aa inside exons, no

transcript support

56% to CYP4AB1 Solenopsis invicta (fire ant)

MIVTMIITFLLFIFILLTYNFYVHYGQNGRFINRIPGPSGYPIIE(1)

DLFKFLISLNQNYSIFKLWLFFTPIVAIRHPDDIE(0)

VILRSTTHIEKSFLYKPFQNAVNTGLFTSGG(1)

TKWRSRRKILTPTFHFAVLQQFADTIIKKGENMAKCLKNMEDTVVEDLTSFVSEHILNAFCV(1)

MRLWLYNDWIFSLTSKGRHQKMLIKMMNAFTQK(0)

LISERKLYHERTNGRYLKTSDKTDKTDKNTLAEKDDSETITI(1)

KKKRLAMMDMLIAASRENYLTDSDIQEEINTIMIA(0)

GTDTTSMTMSYVLLLLAEHKDVQ(0)

DRVRVEINAAIHKDGGKLIMQSLHNLSYLERCIKETLRLYPVAYVISRITSKDVKLQ(1)

SYLVPAGTALLINIHGVHRDPNYWPNPEIFDPDRFLPENIQNQHPYSYLPFSAGPRNCIG(9)

DNGFALLQLKAMLAPLIYNFYLEPVEYLKDIQLKGDILIRPTYPLRLKFVPNLFIKTHTDIKGNIDP*

 

>CYP4AB65P Pb4AZseq7Pi 54aa 1 exon PSEUDOGENE FRAGMENT last exon only, upstream

from Pb4AZ6P

42% to CYP4AB32 Linepithema humile C-term

(1)

PLDYLTIGIPLIYKFNLQLIEYLKDIQFKAEMMIRPSQLLRLKFVPITKTCTDV*

 

>CYP4AB66P pseudogene Pb4AZseq6P 286aa 8 exons PSEUDOGENE missing first exon,

stop codon first and sixth exons; frame-shift seventh exon; missing

heme-binding sequence; unmatched splices seventh intron, upstream from Pb4AZseq5P

~51% to CYP4AB2 Solenopsis invicta

(0)

IILGIIVHIEKSFIYDVLHP*LKTGLATSGSNII(2)

IKWQLRRKILTPIFHFNILQQFIDK(1)

(37 aa gap)

TAMGTSLQRLNSFQQQYRK(1)

(80 aa gap)

KIWLAMMDLLIATSKEDYLSDSKKIDTFLFA(0)

SHDTTAMTICFVLLLLAEYKDVQ(0)

DRAREEVNAVMNESGKKLTMQSLENLSYLERCIKETLRVYPVVYFIS*ITSKDVKLHMYLIKLS(9)

PASIVLNINIYDVHRDLNYILNPETFDPDRFLPEKIQNRHP(2)

XXXXXXXXXXXXXXX

QRFALLKLKVMIAPLVYKFYLKSMEYLKDIQFKAEMLIRLSHPSSKIYSNH*

 

>CYP4AB67P pseudogene Pb4AZseq5P 360aa 11 exons PSEUDOGENE GC donor on first

intron, stop codons in first and fifth and eighth exons, unmatched splices first,

third, fourth, eighth introns, downstream from Pb4AZ6

50% to CYP4AB2 Solenopsis invicta

MIFTILILLMFILLAYNFYVHYE*NGRLINHIPGPSGYPIIDG(9)

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

IMLGTTMHIEKSLIYDVLSLYDVTSLVKNS(2)

FLLSVKWQSRRKILTPIFHFNILQQFID(9)

XXXXXXXXXXXXXXXXX

STIVKDLFSFISEHTLNALCG(1)

NCHGYFSAKMGTFQQQYRNVVQQMSEIVTYR(2)

IMRPWLYNDWIVSLMPKDRQ*KRALKILHEFIQKICKKLYI(1)

xxxxxxxxxxxxxxxxxxxxxxxxXXX

KKKRLAMMDLLITASREGYLSDSDIQEEIDTFLFAIC(1)

HDTTATMCFVLLLLAEHKDIQ(0)

DRAREEVNAVMHESGKLTMQSLQNLSYLERCIKETLRL(1)

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxX

HRNRNY*LDSETFDPDRFLPENIRNPHPYSYLPFNAGPFN(9)

QQFALLKLKAMIAPLIYKFLEPVEYGTFKGHLI*

 

>CYP4AB67-ie6b pseudogene Pb4AZseq5P 360aa 11 exons PSEUDOGENE GC donor on

first intron, Pb4AZseq8Pi 22aa 1 exon PSEUDOGENE FRAGMENT very short sequence

in intron of Pb4AZseq5P

68% to CYP4AB26 Solenopsis invicta

(2)

IARPWLYNDWVFSLTPCNIKYS*

 

>CYP4AB68 Pb4AZseq2 515aa 12 exons .

62% to CYP4AB1 Solenopsis invicta (fire ant)

MIFIILVLLIFILLAYNFYVHYERNGRLINRIPGPSGYSIIGNLLMFQGSFE(1)

KFWKLHVTLSDQYYPIFKVWLLFKPVVVIYHPDDME(0)

IILGTMTHIEKSFIYNMLHPWLKTGLLTAGG(1)

TKWQLRRKLLTPAFHFAILKQFINILIKEGEDMANSLKNIESTIVKDLVSFVSEHTLNALCE(1)

TAMGTSLQGLGPFQQQYRNAIHQMSQILTYK(2)

TMRPWLHNDWIFSLTSKGRQQKRILKILHGFTQK(0)

IIAERKLYHEQINEGYLKSFDKDTLAEEDNSETITI(1)

KKKRLAMIDILIATSREGHLTDSDIQEEIDTFLFA(0)

GHDTTAITMCFVLLLLAEHKDVQ(0)

EHVREEINAVMHESGGKLSMQSLQNLSYLERCIKETLRLYPIAYFISRITSEDVKLQ(1)

SYLVPAGTILYINIYGAHRNPNYWQNPEVFDPDRFLSEKIRNRHPYSYLPFSAGPRNCIG(1)

QRFALLKLKALIAPLIYKFYLEPVEYLKDISLKAELLIRPSHPFRLKFVPIINACTDV*

 

>CYP4AB69 Pb4AZseq3 520aa 12 exons GC donor on 1st intron, upstream from Pb4AZseq4

60% to CYP4AB1 Solenopsis invicta (fire ant)

MIIILLLLCFLLILLYYYILHGKYASYINKIPSLPSLPLFGHIFIGWLATQE(1)

NAWKLLQIYSMIYNPIWKLWLGPFALVGICQPDDLE(0)

KILSSTKHLTKGFIYNFLNPWLRTGLLTSKG(1)

TKWHERRKILTPAFHFSILKQFIEILIEEGNHITQSLKNIKGSTVDDLAAFIGHHTLNAICE(1)

TTMGTCLQRMGESQVQYRQAIHEMGNIFVYR(2)

LMRPWLAFDSIFALTPMGRKQAKCLKILHGFTEK(0)

IIAEKKQYHERNNRRYLENFSNKIDKIEADDEEVIGM(1)

KKKRLAMLDLLIAVAPDYNMNDLDIREEVDTFVFE(0)

GHDTVAMGLTYAILLLAEHKEIQ(0)

ECVRKEVSAIMQANKGKLSMSALNDMSYLERCLKESLRLYPSVPYISRILSEDVKLQ(1)

SYLVPSGTTIILNVYNIHRDSHFWPNPDVFDPDRFLPEKIQNRHPYSYIPFSAGPRNCIG(1)

QRFAMLEMKAIIAPLVYNFYLEPIDYLKDFRFIVDLINRVAHPIRVRCIPIDHTPSTSFKTI*

 

>CYP4AB70 Pb4AZseq4 513aa 12 exons GC donor on 1st intron, downstream from

Pb4AZseq3

59% to CYP4AB1 Solenopsis invicta (fire ant)

MIINLLLLFLLLCFSFMLLYYCILYDGKFVRLINKIPSVPSFPLFGHAIILWIISLE(1)

DLWKVTHAIFKYYYPIWKIWIGPKVIIGICHPDDLK(0)

KILTSTKQHLTKGYVSSILKPWLGTGLLNNEG(1)

TWHKRRKILTPTFHFNILKQFVEVFIEEGNHISQSLKNIKGSTVDDLVSFISHHTLNAICE(1)

TTMGTSLHEMGEFEEQYRQSINDLGKILFNR(2)

LFKPWLASDIIFALTSMGRKQAKSLKILHGIIEK(0)

IIAERKQYYERTNGRNLQNFAKDTDNKEVIGM(1)

KKKRLTMLDFLILEARDNKMNDVDIKEEIETFIFK(0)

GYGTITMSLTYTILLLAEHKDIQ(0)

ECVRKEVNAIMQANKGKLSMSALNDMSYLERCLKESLRLYPSIPYIIRTSSEDIQLQ(1)

SYLVPPGVILYLSIYNVHRDPNFWPNPEMFDPDRFLPEKIQNRHPYSYIPFSAGLRNCIG(1)

QQFAMLEMKAIIALLVYNFYLEPVDYLKDLRFVADLVNRVAHPIRIRCVPIDHRS*

 

>CYP4AV8 Pb4AVseq1 502aa 8 exons.

68% to CYP4AV1 honeybee

80% to CYP4AV7 Linepithema humile 

MSVAAVLLAGGSWVTVFLSFCLLFLLLVLLVQRGKFLYDLRKVPYPTALPIVGNAYQLNCSQEE(1)

FFQKLVKWAREFGDIYLLWVGLRPFIFLYRVEAVQPLLSSSVHIDKSLEYQYLKPWLGTGLVTSTG(1)

EKWHFRRKLLTPTFHSGLLEVYLKTVKEEANILISCLKREVDKWFDVVPYSKRAALDIICD(1)

TAMGYKLNAQKNSKDEYVEAVDK(2)

IASIVQMRFTNVWTQSDTIFKLTKAGQEHDHSIQIIQEFVDK(0)

VIVERKAEWKLKRDDNFNDSTKKKRALLDLLLEMSQDGAILSDEDIREEVNTFMYAGHDTMATSISWTLYALGRHPEYQ

(0)

EKILDEYNSVLGMAEITLENISKLTWLEACIKEQWRIYPVAPLIARQIYKPIEIM(1)

GNQIPPGSTVLINSYLLHRDIRYFPEPHIYRPERFLADGPKLPPYAFIPFSAGSRNCIGWKFATLVIKVVVLSVLKAFH

VESLDKEDELRLISELVLVNANGIRLKITPRER*

 

>CYP4BW7 Pb4BWseq1 505aa 10 exons.

72% to CYP4BW6 Linepithema humile

MDVFFLLCTLCVIAVISVILPRIYQHYVLRKKLKRLPQIKANPIFGVIFQLLKLSEWE(1)

RVLWFYDYMKQYKNGIYGYWLGNKPFVNIYHPDYLE(0)

AIFPSTVNITKGEPYDMLRPWLGNGLLTSTG(1)

KQWFHDRRLIGPTFHFSILNQFAVILSEKAEILTKCLEKEIRKDPGKAINIFPFIINVALDIICE(1)

TAMGVNVRAQEVVTEYTSTVHK(2)

TSTLILERLFRPWHWSDLLYYSFPAGKQYKSALNILHRFTKE(0)

SAREKQNGHVEFEDKNDDSDIG(1)

KRKRKAFLDLLLDQNEKDDTPLTDDEVRAQVDTFMFE(0)

GHDTTAVAMTWALFLLGSHPEHQEKVHKELEEVFGDSETPATVKELSELKYLDRVIKETLRLYPSVPMITRELVEDVTV

G(1)

NYTFPKGITVVLAILLTHRNPVVWPDPDKFDPDRFLPENSANRNPYAYVPFSAGPRNCIGQRFAMLEEKTVLTAILRKW

RVKSVKTPDMVKYGGSIILRPNEDIPIHFIPKK*

 

>CYP4BW8 EH413513 Solenopsis invicta

81% to CYP4BW6 Linepithema humile 

AKDDSPLTDEELRAQVDTFMFEGHDTTAVAINWTLFLLGNNLEHQEKVHDELEEVFGDSE

TPASVKELSQLKYLDRVIKETLRIFPSVPVISRELVEDVKLDDNILPKDYTVVVPMLLIH

RNPEVWPEPLKFDPDRFLPENSKHRNPYAYVPFSAGPRNCIGQRFALLEEKTVLTAILRK

WRVKSVKTLDTIQFGGALILRXVRKCSYILHPRNEQFASKYILFI

 

>CYP4CY3 Pb4BZseq1i 317aa 7 exons INCOMPLETE, missing 1st exon

64% to CYP4CY2 Linepithema humile

(1)

ATHRIRRKMIQPLLNIKFLSEYVTCFDNYSNQCADILEKVVDSPTFDLKPHIKQYAANIFLG(1)

NTLYVTKREKSIH(0)

KPIIYNYFRLFKETYNR(0)

ITSRKEMKHTALENNNENFEKPKAAFDHYLNRIQLHNVTNESCMVSDENFIDDVRSFYAA(0)

EKLRQEISFTFGNEKVNAQGLISMQYLHMVIQETLRLFPITPTVSRQLTGDIKLE(1)

SCTLPDGCYVLIPIFAIHRNSAYWPKPLEFIPERFSSENSSSRHRYTYIPFGTGPRDCIG(1)

QRYAFLAIATIITNLVRRFRFATSNSIEDIKLISDIVLRSQDVKLNISYA*

 

>CYP4DC1 Pb4CAseq1 450aa 9 exons .

43% to CYP4CX9 Linepithema humile

MLFESFTLICLTIVIIYFFCSWYQKVFFIKRLNLPELKAIPLLGTSYIFLYGISGG(1)

ILNIINKTAEKYSSYSLLQFYMIHKVLIGMCEPDQIK(0)

IVLRSQCCLNKSTFYKYAEPLFGTGLLTAPV(1)

HIWTRSRRMIAPTFSTSMLKKFFKVFVKEALVLNEELGQIEQNNNEIIFLKYVSKCVLRITCG(1)

LKKILRNRFWKIYLHSDIIFNLTAMGREQKKILNFMNSVIDK(0)

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

SSDTTVFTTYIAVFMLANFPEIQ(0)

FNFMKGKLYKEMLDIYGLETLKSAPIKYDDIQRMHYLDCIIKETLRLFPVIPLIGRKVMENLKIGEF(0)

KYVSGDHILPKGTDVIIPIIYLHRNEKYWPNPLTFDPDRFLPDKIKDRPSHCYIPFGDGPRNCIG(1)

MNYGMIAIKVILATLVRAFVFKVDKSIDIKDIELNAYIMLSTIKPLKVKIEKRNLQQMRENMLNAI*

 

>CYP4DC2 Pb4CAseq2 450aa 9 exons .

47% to CYP4CA1 Nasonia (GND to the end)

cyan is the location of the ETAM exon

~50% to CYP4CX9 Linepithema humile

MLFKSFMLICFTIAIIYFFCNWCQKIFFIKRLNLPESKAMPLLGTSYIFLYGIFGG(1)

VLNVVNKMAENPSPFKLHLAHNVLIGIYEPDQVK(0)

IVLRSKNCLDKSIIYKYAEPLFGTGLLTAPV(1)

HIWTRSRRMIAPIFNAYMLKQFFEVFVKEALVLNEELEQIAQNNNKIVFLKYVTKCVLKITCGKIIKFNIFLYIYVYII

AI(2)

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

LKEIARYRFWKIYLHPNIIFNLTAMGREQKKILNFMQAVVDK(0)

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

GNDSITFTTHLVVFMLANFPEIQ(0)

EKVYKEMLDIYGMETPNTTPVKYDDIQRMHYLDCVIKETLRIFPTVPLIGRKLMEDLKIG(1)

DHILPKGTDVVIPIIHLHRNKKYWPNPLTFNPDRFLPDKIKDRPSYYYIPFSDGPRNCIG(1)

INYGMIVIKVILATLVRAFIFKVDKSIDIKDIQLNTYIILSTIKPLEVKIEKRNLQQNSVKIC*

 

>CYP4DC3 Pb4CAseq3 413aa 8 exons .

48% to CYP4CA1 Nasonia

~47% to CYP4CX9 Linepithema humile

MFENFMLICLIIVIIYFFCSWRQKVLFTKRLNLPESKAMPLLGTSYSFLYEIFGG(1)

ILNVINKMAEKYPSPTQFYVAHKVLVGIYEPDQIK(0)

IVLRSKNCLDKSIIYKYGESLFGTGLLTAPV(1)

YIWTRSRRMIAPIFNAYMLKKFFKVFAKKALILNEELEQIAQNNNEIVFLKYIAKCXXXXXX(1)

XXXXXXXXXXXXXXXXXXXXXXXXX

EIARYRFWKIYLHPDIIFNLTAMGREQKKILNFMQAAIDK(0)

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

XXXXXXXXXXXXXXXXXXXXXXX (0)

EKVYKEMLDIYGMETPNTTPVKYDDIQRMHYLDCVVKETLRIFPTVPLIGRKLMEDLKIGEFVYTILF(0)

KYVSGNHILPKGTDVVIPIIHLHRNEKYWPNPLTFNPDRFLPDKIKANPSYYYIPFSDGPRNCIG(1)

MNYGMIAIKVILATLVRAFIFKVDKSIDIKDIQLNIYIILSTIKPLKIKIEKRNLQQNSVKIC*

 

Mito clan

 

>CYP12K1 Pb12Kseq1i 463aa 7 exons INCOMPLETE missing internal exon aa 423-490 (N's)

66% to CYP12K1 Linepithema humile (argentine ant), 51% to CYP12K1 Nasonia

?

MIHVRFLIREISRSSLLSRVQCRAKSVVAYPSEHNETKVNNDVNIELQNARPVEEIPGPKALPLLGNWFRFLPYIG(1)

EYGRVSVKTHLRMMRDKYGDIVKLDKLAIGRTMIFLFTPELCEKLYRLDGQRPLRIAMHSLLYYRQNREHIWDGEYGLA

IS(2)

QGKMWHDFRSKVNPHMMQPRTVKVHVPQINEVAVDFVKRMRTLRDPETLELPSDFKNELLKWALEG(1)

ICSIAMDCRLGCLEPNLAPDSEPQIMINCVQEMFELMYRIEILTSLWKVYNTPNLKKFFRVMDTLNG(2)

IAKKHIERAKAKFDARDNNTNQYDRSILEKLLRIDKHTAYVMALDMLTAGVDT(0)

TGNTAGSMLYYIANNPEKQEKLREEVMSLLPDKTSPVTQEVLDQTKYAKACIKESLRLFPISIGTLRTMQTEVCLGGYK

IPAGVC(0)

 

VIRNFRIEWHHGPLEYESRFINTLSSPMRFKLIDL*

 

>CYP12K2 Pb301B1i 489aa 8 exons INCOMPLETE missing internal exon aa 150-195 (N's)

43% to CYP12K1 Nasonia vitripennis

56% to CYP12K1 Linepithema humile

?

MTWIRFFIREINACLHLAMQNHARSIKGCSTEYNEIRNINNELQHARSTKDIPGPKALPLFGNWFRFMPYG(1)

EYYNVNVLTMMRMLRDKYGKIVKLDGIINKPPHIFLLCPDLCKDMYKLQGKWPTRISLEPMHYY RMSREHIYNGQYGLVTR(2)

this seq not very likely

(gap) missing C-helix

EIRGLKDPKTLELPSDFMNEIYKFSLES(1)

MCLIALDCRMGCLGSNLSMNSESQIMINCVQESFELMYRLENQPSLWKVYNTKDLKKLFHIFDTIND(2)

ISTKHIEYAKMKLSKTTDITNLEKRSVLEKLLCIDKQIAHTIALDLIASTDT(0)

TSNAAGALLYHIANNMEKQEKLRKEVMSVLPDKTTPVTVDILSRIPYVKACIKESMRLFPIASGVSRTMQRDVCIGGYI

IPKG(0)

TNVTACHSVLSMNPIYFPRPQEFIPERWLRDTPEYSLYKKTHPFVYMPFGYGVRMCIGQKFAEMELQTLLLK(0)

MIRNFRIEWHHGPLKYKSQIVNTVSSPLLFKLIDL*

 

>CYP302A1 Pb302Aseq1 511aa 8 exons .

63% to CYP302A1 honeybee

78% to CYP302A1 Linepithema humile 

MYARVKLCGEREIIKQLCSRSFSINSCHFDTNKPKPFKDIPGPKSLPVIGTLYKYLPYIG(1)

EYSFTVLHTNGILRLKRYGPLVREEILGQPIIYVYRPEDIAEIFKAETGLHPERRSHLALLKYRKDRNNVYNTGGLLPT

(2)

NGIEWWRLRREFQKVLSKPSSVIDYLQDTDAVVQEFVQLCSREKPNDFLHLFSRLFLEL(1)

TCLVAFDVKMESLSEKEKHPHSRSSRLIDAAFITNSVTLKLDNSLMLWRFFETPLYKKLCKAQNYMEE(2)

VALQMVIQRNQNALIHRKQSLLEEYLKNEALDIKDIVGMACDMLLAGVET(0)

STYTTSFILYHLARNIDVQEKLRSEAMALLLDPTSPITAETLRNATYTKAVIKETFRLNPISVGIGRILQTDVILSGYH

IPKGV(0)

TVAVTQNQIISRLPEYFNEPDSFIPERWLRNNDRINKLGEKPIDPYIVLPFGHGPRSCIARRFAEQNMQVVLLR(0)

ICRNLRFTWCGGSLNTVSLLINKPDAPIKLKFEKLYE*

 

>CYP314A1 Pb314A1 515aa 10 exons .

missing 10 aa from last exon

76% to CYP314A1 honeybee

87% to CYP314A1 Linepithema humile

MLLSGAWFETIAAALLAILVLATGYWPPWWFWTRNYNANAD(1)

TGDHGRKFKTARDVPGPFALPILGTRWIYSCFGYYRLNKIHEAYKV(1)

DLNRRYGPLCKEEALWNCPVVSVFSRRDIEAVIKRSSRYPLRPPQEVISHYRRSRRDRYTNLGLVNE(2)

QGVTWQKLRTALTSELTGASTVFGFFPALNIVTDKFIDLIRERRATRSTVRGFEELAYRMGLES(1)

TCTLILGRHLGFLNPDSNSRLTTRLAEAVRIHFTASRDAFYGLPLWKLLPTSAYKQLIESEDTIYN(2)

IISELVETTILEKQNDARDESIEAVFLSILRQKDLDMRDKKAAIVDFIAAGIHT(0)

LGNTLVFLFNLIGRNPEVQETLYNEAQSLAPPGCDLTVDDLRKAKYLRACIMESFR(2)

IVPTTPCIARILDESIELGGYRLDPG(0)

TVVLLHTWIAGLSDDNFKDPSKCLPERWLKTSTILPHSPMLVAPFGAGRRICPGKRFVELALQLILAK(0)

XXXXXXXXXXEDLGLQFEFILAPQSPVSLGFRDRVSR*

 

>CYP315A1 Pb315A1i 294aa 3 exons INCOMPLETE short scaffold missing last 300aa on C-term

58% to CYP315A1 honeybee

68% to CYP315A1 Linepithema humile

MNLHGDFNISFTNCGVLGCDPRLVIPNENGVLPSWSFPGYDLVRNSALSRTFVRNFSTLATKEPPEPQGIPFFGTMLSL

IMEGGAQKLHEYVDKRHRELGPVFRDYIGPLRAVFVNSPDEYRKIFLQLEGPMPQHFLPEAWKLYNEIRKQHRGLLFM(

2)

DGDEWLHFRKILNKAMLGSNPEKYMCAPCQEAAENLVKKWKNYSRTGCTIPELQHQLYQWSIEV(1)

MLATLMGSRWRDCEQQMRSDIESVALMLHQIFMYSATLSMMPAKLAMRLKLPVWTKFVKTVDVILDKVRNLVP

 

>CYP334A1 Pb334A1 534aa 10 exons .

63% to CYP334A1 honeybee

MTQSHAIPTVSATATSTKAMPLLETINSEITAESFKIPISKVEPRANIEKASLPFEEIPGPMILKLWEKYWKYVPLLG(

1)

RLSWNRNVTPIKFLFDEYGCIVRINGPLVNDIVMIHR(2)

PEHIAEVFKQESKLPIRSGIDILQHYRLNHHKYRSAGAFSL(2)

QSSEWLEVKKKVDQPFHEITSDYIEKLDSVCDELINRIHNIRNRQDE(0)

VPTNFHRELTAWGMECFYVTMFNKHLGFLDSTSKSTSEATKIINALITAHTYMSRCETGFQVWRFFETPFAKKLYAACD

VLDE(2)

IIGKYIRQAQTKLQTSSKQEKSTIEKRNLSLLEKMIIQHIDPNDISILLMDMIILGVQA(0)

IINCEAFLLYFLAKNPRIQKRLYNEIISISPKIKYTLTKESLENMPYLKACIKESLR(2)

LRPAFPYLTRLLPSAISLHGYTIPKG(0)

TFVIMANQITSQREEHFEDPEKYQPERWLNFDEYAYNNYQEYSCLPFGYGVRSCLGKSMAETQMMLLTAK(0)

LVREFTIEYDYAEIRSRFLMINVPNRPLRFRFVNRS*