Postia placenta P450s

Black; isolated by RT-PCR

Blue; deduced from database (not isolated)

Green; isolated by RT-PCR with minor modification of intronic sequence

Yellow; Transmembrane domain

 

Named Feb 8, 2011

D. Nelson

 

CYP51 family (3 sequences)

 

>CYP51F1v1 PpCYP246 64% to CYP51F1 Phanerochaete chrysosporium 
99% to CYP51F1 PpCYP221 (2 aa diffs)

MANANFSEPWAGYLVQAQSQLASTSIPRLLLLLVVNIPVIAVVLNVLSQMLPRDRSLPPLVFHWIPWFGS

AAQYGQDPVEFFKSCREKHGNVFTFILLGRRVTVTLGPKGNDFVFGGKHTVVAAEEVYGPLTTPVFGKDV

VYDCPNEVLMEQKKFVKVSLTTDKFRDYIGMVDDEVTQFLSTDPAFRTYQMDDINEWGSFSVYKTLAEMT

ILTAARTLQGKEIRENMTKGFAELYADLDHGLTPLHWMFSNLPLPSYRKRDVAHEKMSQFYQNILRNRRN

NNVGCVDDVMASLMNQTYRDGRPIPDHEIAHMMIALLMAGQHTSSSTTSWVLLHLADRPDIAEQLYQEQV

KHFGLPGGGFREMTYDELKKLPILDAVIRETLRCHAPIHSIMRYIRDDLPVPQSLGAPSEDSVYVVPKGY

TVLASPALSQMDPLIWKDANTWDTTRWLDAAGMAAQAKREYDEDTKVDFGFGLVSKGTESPYLPFGAGRH

RCIGEQFAIVQIGTIISTIVRKIEMRLEGPFPKPDYSSMMVVPQQPCQIAYRRRKFD

//

>CYP51F1v2 PpCYP221 

MANANFSEPWAGYLVQAQSQLASTSIPRLLLLLVVNIPVIAVVLNVLSQMLPRDRSLPPLVFHWIPWFGS

AAQYGQDPVEFFKSCREKHGNVFTFILLGRRVTVTLGPKGNDFVFGGKHTVVAAEEVYGPLTTPVFGKDV

VYDCPNEVLMEQKKFVKVSLTTDKFRDYIGMVDDEVTQFLSTDPAFRTYQMDDINEWGSFSVYKTLAEMT

ILTAARTLQGKEIRENMTKGFAELYADLDHGLTPLHWMFSNLPLPSYRKRDVAHEKMSQFYQNILRNRRN

NNVGVRGDDVMASLMNQTYRDGRPIPDHEIAHMMIALLMAGQHTSSSTTSWVLLHLADRPDIAEQLYQEQ

VKHFGLPGGGFREMTYDELKKLPILDAVIRETLRCHAPIHSIMRYIRDDLPVPQSLGAPSEDSVYVVPKG

YTVLASPALSQMDPLIWKDANTWDTTRWLDAAGMAAQAKREYDEDTKVDFGFGLVSKGTESPYLPFGAGR

HRCIGEQFAIVQIGTIISTMVRKIEMRLEGPFPKPDYSSMMVVPQQPCQIAYRRRKFD

//

>CYP51F1v3 PpCYP218

MANANFSEPWAGYLVQAQSQLASTSIPRLLLLLVVNIPVIAVVLNVLSQMLPRDRSLPPLVFHWIPWFGS

AAQYGQDPVEFFKSCREKHGNVFTFILLGRRVTVTLGPKGNDFVFGGKHTVVAAEEVYGPLTTPVFGKDV

VYDCPNEVLMEQKKFVKVSLTTDKFRDYIGMVDDEVTQFLSTDPAFRTYQMDDINEWGSFSVYKTLAEMT

ILTAARTLQGKEIRENMTKGFAELYADLDHGLTPLHWMFSNLPLPSYRKRDVAHEKMSQFYQNILRNRRN

NNVGYEDDVMASLMNQTYRDGRPIPDHEIAHMMIALLMAGQHTSSSTTSWVLLHLADRPDIAEQLYQEQV

KHFGLPGGGFREMTYDELKKLPILDAVIRETLRCHAPIHSIMRYIRDDLPVPQSLGAPSEDSVYVVPKGY

TVLASPALSQMDPLIWKDANTWDTTRWLDAAGMAAQAKREYDEDTKVDFGFGLVSKGTESPYLPFGAGRH

RCIGEQFAIVQIGTIISTIVRKIEMRLEGPFPKPDYSSMMVVPQQPCQIAYRRRKFD

//

 

CYP53 family (8 sequences)

 

>CYP53C3 PpCYP204 
73% to CYP53C2 Phanerochaete chrysosporium 
47% to PpCYP090, 43% to PpCYP138 
scaffold 148 2852 - 5058

MSAPAALFTSNLVYGLAVIPVAVLLVHFVPYLLDPHGIRAYPGPFLARLSDIWLGWIAAQGHRSETVHEL

HKQYGTFVRIAPNHVSISDPEAIQYVYAHGNGTTKSNFYDAFVSIRRGLFNTRSRPEHARKRKIVSHIFS

MKSVMEFEPYTRMHVAQLLKQWDRLYELGIKGASGEEGEGWKGRDGRVWLDCLPWYNYLAFDIIGDLAFG

APFGMLHACADAAPVATEHKDAMASYGADNAPKVTYFPAVQVLNDRGEYSASMGVLPPHWRPLVVRFIPW

YRNGGKAVKRLAGIAIAAVSKRLTAPTDRADLLGKLQEGKDDEGNPMGREELTAEALTQLIAGSDTTSNS

SCALTYHLAANPRVQQKLQRELDEALGSDDDPVATYEQVKRLPYLEAVVNEALRVHSTSGIGLPRVVPEG

GLSVCGRFFPAGTVLSVPTYTVHRDAETWGADVDAFRPERWEERDKNAVQKAFNPFSFGPRSCVGRNLAS

MELLIIIASILRRYHFVLEEPKHKLETKEGFLRKPVACKVGLRRRSA

//

>CYP53D1 PpCYP164

scaffold 1 1470885 - 1472968

MDSSTPPLPPLGSIILAREGLTGLLLPGLSVLACLIATVIASSILLPYFNDPYKLRAYPGPFFAKFTSAW

LSWIIGHNRWSETVYHLHRQHGPIVRLGPDNVSISDPSALAAIYGHSSGALKSTFYDAISSIRIRNLFNT

RDRAEHSRKRRIEAHMFSPRGIRALEDTARVHFQVLVRQWDTLCAHTDKAIRGSAEGTIGTVHWKVHSGR

VWFDCMPWFTFWSFDTISDLAFGHPFGMLEAAKDTAKISKSNIKGMQAISQGNSHSDEAELELEEIPAIE

MLAEHLDIIVSLAFLPAWLQPIVGRLPSVRYGYDAAPKLAGLAVAAVANRFASKTKIDRADMLSELLRGR

DEDGKPYGPEELSAEAELLIIAGGDTTANSSCATTYHLARNPRIRAKLQAELDAALEGIDSDVAPYDAVK

DLPYLDAVINEGLRLHSTIGAGLPRVVPPGGLTVLGQHLKEGTVVSSPLYCLHRNEVVWGENAHEFYPER

WLEASADAKKEMMRSFAPFSVGPRACLGRNLALQQMHIVLATIFHRYNLVLESDAPLPLRDGFVRKPKNC

VVGVQRRK

//

>CYP53D2v1 PpCYP041

scaffold 2 626153 - 628222

MDSSTSLLPPLGSIILACEGLTSLVPLILSVMVCLIATVTISPTLLAYFNDPFELRAYPGPFLARFTSAW

ISWIISQNRWSETVDLMHRQHGPIVRLSPDHVSVASPAAFAAVYGHSSGALKAPFYNAFANFKIRSIFNT

RDRAEHSRKRRVEAHMFSPRSIRALEDTARVHFQVLVRQWDALCAPTGKTVRGSAEGTLGTISWKVHGDR

VWFDCMPWFNFWSFDTISDLAFGRPFGMLEAAKGSAHVSKSNTKSVQAVSQDTSHSNEAQSELLEIPAME

VLSELLDFTVALAYLPAWVQPVFGRLPMFRDGYDAAPKLANLSLTAVANRVASQTDRADMLSELLRGRDE

EGKPYGLEELSTEAELLIIAGGDTTANTSCATAYYIARDLQIQAKLQAELDVALDGVESDVAPYDAVKDL

PYLDAVINEGLRLHSTIGAGLPRVVPSGGMTVLGQHLKEGTVVSSPIYTLHRNEAVWGKNAYEFYPERWL

EASADAKKEMMQSFAPFSVGPRACLGRSLALQQLHILLATIFHRYSLVLENNAPAQLPLRDGFARKPMKC

IVGVQRRK

//

>CYP53D2v2 PpCYP089

98% to PpCYP041

scaffold 193 21498 - 23567

MDSSTSLLPPLGSIILACEGLTSLVPLILSVLVCLVATVTISPTLLAYFNDPFELRAYPGPFLAKFTSAW

ISWIISQNRWSETVDLMHRQHGPIVRLSPDHVSVASPAAFAAVYGHSSGALKAPFYNAFANFKTRSIFNT

RDRAEHSRKRRVEAHMFSPRSIRALEDTARVHFQVLVRQWDALCAPTGKTGRGSAEGTLGTISWKVHGDR

VWFDCMPWFNFWSFDTISDLAFGRPFGMLEAAKGSAHVSKSNTKSVQAVSQDTSHSDEAQSELLEIPAME

VLSELLDFTVALAYLPAWVQPVFGRLPMFRDGYDAAPKLANLSLTAVANRVASQTDRADMLSELLRGRDE

EGKPYGLEELSTEAELLIIAGGDTTANTSCATAYYIARDLQIQAKLQAELDVALDGVESDVAPYDAVKDL

PYLDAVINEGLRLHSTIGAGLPRVVPSGGMTVLGQHLKEGTVVSSPIYTLHRNEAVWGKNACEFYPERWL

EASADAKKEMMQSFAPFSMGPRACLGRSLALQQLHILLATIFHRYSLVLENNAPAQLPLRDGFARKPMKC

IVGVQRRK

//

>CYP53D3 PpCYP138

94% to PpCYP060

scaffold 4 969285 - 967242

MLTYDEALNFSTVLSALTCLSAGVITLSLLLPYFIDQLQLREYPGALLAKFTSGWISWIISRNQWSETVD

RLHSAHSMGSFVRLAPNHVSVSGPSAFEAIYSHPSSALKAPFYDIFSAGGAANIFTTRDRAEHARKRRVE

AHMFSPQSIRTLESTVSVHFHALEDQWDALCAHIQKAGSGGAEGIIGSVSWKVHDSRVWFDWFMFWSFDT

IADLSFGRPFGMLVSAKDVVRIPKSNASGIQAIAEAASHSKKTELEMVEVPLIEVLVKRGKTIAALAYLP

AWAQPIIGRLPGFREGYGAIPKLNGIAIAAVADRLRSPNGRADMLTKLLEGRDGEGYRYGPQELSAEAKT

LIAAGGDTTASASCAITYYIARDPRIQAKLQAELDAALDGIGSEIAPYGTVKVLPYLEAVVNEGLRLHSG

VGAGLPRVVPAGGMTILGHHLMEGTVVSSPIYTLHRSKAVWGANADEFYPERWIDASADTKKEMMSSFAP

FSIGLRACIGRNLAMQQLQIVTATIFRRYSIVLQDDAPLEIQDSFGRKPKKCIIGVKRRDLKVL

//

>CYP53D4 PpCYP120 45% to CYP53C2 Phanerochaete chrysosporium
79% to PpCYP090, 63% to PpCYP138
scaffold 36 443913 - 445886

MLSVLVCLIPTVIASTFLIPYFSDPYKLRAYPGPFLAKFTSVWASWVINHNRWSETVDLLHRKYGPIVRL

GPDSVSIADPSAFAVIYGHSSGALKAPFYDAFANHRIRDLFNTRDRAEHSRKRRVEAHIFAPQSIRALED

TARVHFEILVRQWDAMCAHAEKAGRGSAEGAIGTVPWKVHDGRVFFNCMLWFSFWSFDTIGDLAFGHPFG

MLETGKDTAQTVKSDVRGMEAIAQATSNSEKTKLELVDIPAIEALTARADTLFVVAYLPAWLQPIVGHLP

SLQSGYNAAPKLAGLAVAAVANKFASKTDRADMLSKLLEGRDKNGNLYGPEELSAETWLLIIAGGDTTAN

TSCATTYYLARNPRIQAKLQAELDTALDGIDSDVASYDAVKDLPYLGAVINEGLRLHATVGVGLPCVVPP

GGLTVLGHHLKEGSVVSSPIYSLQRSEAVWGENAREFYPERWLEASADAKKEMMRSFAPFSVGPRACLGR

NLALQQLYIMFATLFRRYDFVLENDAPLAVQDRLVQKSKECIIGVQRRKGLVSRQ

//

>CYP53D5 PpCYP060

scaffold 41 27336 - 25305

MLTFDEALNFSTILSALACLSAGVITLLLFLPYFIDQLQLREYPGALLAKFTSGWISWIISRNQWSETVD

RLHVQHGSFVRLAPNHVSVSGPSAFEAIYGHPSSAAKAPFYDIFSAGGAANIFTTRDRAEHARKRRVEAH

MFSPQSIRTLESTVSVHFHALVDQWDALCAHIQKAGSGGAEGIIGSVSWKVHESRVWFDCMPWFMFWSFD

SIADLSFGRPFGMLVSAKDVVRIPKSNASGIQAIAEAASHSEKTELEMADVPLIEVLEIRGKTVAALAYL

PAWAQPIIGRLPGFREGYGAIPKLNGIAIAAVANRLRSPNGRADMLTKLLEGRDGDGHSYSPQELSAEAR

TLIAAGGDTTASASCAITYYIARDPRIQAKLQAELDAALDGTGSEIAPYGAVKVLPYLEAVVNEGLRLHS

GVGAGLPRVVPAGGMTILGHHLMEGTVVSSPIYTLHRSKAVWGANADEFYPERWIDASADTKKEMMSSFA

PFSIGLRACIGRNLAMQQLQIVTATIFRRYSIVLQDGAPLEIQDSFGRKPKKCIIGVKRRDLKVL

//

>CYP53D6 PpCYP090

scaffold 162 161721 - 159661

MDSSTPPLPLLGGIILTREGLTGLLLPGLSVLACLIATVIASLILIPYFNDPYKLRAYPGPFLAKFTSAW

ISWTISHNPISEIVDHLHRQYGPIVRLGPNNVSIADPSGSAFSVIYSHSSGVTKSAFYDTFANFRIRNIF

NTRDRAEHSRKRRVEAHMFAPQSIRALEETARVHFQVLLRQWDAMCAHAEKAGRGRADGAIGAVPWKVHG

GRVWFNCMIWFSYWSFDTIGDLAFGHPFGMLETGKDVAQIAKSNARGMQAIAQGTSDSEKATLELVDIPA

IEVLTARADALFVVAYLPPWAQKIVGRLPSFRSGYAAAPKLAGMAVAAVANRLASQYDRADMLSKLLQGR

DEDGKPYSPEELSAEAWVLIIAGGDTTANSSCALTYHLARNPRVQAKLQAELDAALDGIDSDVAPYDAVK

DLPYLDAVINEGLRLHSTVGGGLPRVVPAGGLTVLGQHLKEGTVVSSPIYTLHTNEVVWGENAHEFYPER

WLEASADAKKEMMRSFVPFSAGPRACLGRNLALQQLHVMFATIFRRYSFALENDAQLTIQESFVRKPKNC

FVGVQRRK

//

 

CYP61 family (2 sequences)

 

>CYP61A1v1 PpCYP192 75% to CYP61A1_Phanerochaete_chrysosporium

MASAMRDHSSMKATMPSYTPGPSHLVPSSSFFSSSSGPATWLYTVIAIALALLALEQSVYRYKKRHLPGD

KWTIPIIGKFADSMKPTMEGYMAQWNSGALSAISVFNIFIVMASTNEYARKILNSPNHAEPCLVHSAKHI

LRPDNWVFLTGKVHVEYRRVLNTLFTRKALGVYVGIQDAITRKYIAKWLADSAQDSSPKPIMMAARDLNM

ETSLRVFCGPHIPDHAAKEITDKYWMITVALELVNFPIPLPGTKVYRAIQARKVALRWLEHAAHESKKSM

AAGGEPECMLDQWVHDLQDPTYKGRRDFSDLEMAMVVFSFLFASQDAMSSGLIYGFQHLADHPEVLAKVR

EEQERVRAGDFEKPMTLEMMDEMSYLRAVVKESLRVKPPVTMVPYKTLKAFPISDDYTVPAGSMIIPSFY

NSLHDAEVFPEPDAFTPERWLDANGSANQNPRNYLVFGSGPHKCIGIEYAVMNIGLVLADAAVLMNWDHV

RTEKSDKVQIIATLFPQDGCLLKITPRQHA

//

>CYP61A1v2 PpCYP147

99% to PpCYP192

MASAMRDHSSMKATMPSYTPGPSHLVPSSSFFSSSSGPATWLYTVIAVALALLALEQSVYRYKKRHLPGD

KWTIPIIGKFADSMKPTMEGYMAQWNSGALSAISVFNIFIVMASTNEYARKILNSPNHAEPCLVHSAKHI

LRPDNWVFLTGRVHVEYRRVLNTLFTRKALGVYVGIQDAITRKYIAKWLADSAQDSSPKPIMMAARDLNM

ETSLRVFCGPHIPDHAAKEITDKYWMITVALELVNFPIPLPGTKVYRAIQARKVALRWLEHAAHESKKSM

AAGGEPECMLDQWVHDLQDPTYKGRRDFSDLEMAMVVFSFLFASQDAMSSGLIYGFQHLADHPEVLAKVR

EEQERVRAGDFEKPMTLEMMDEMPYLRAVVKESLRVKPPVTMVPYKTLKAFPISDDYTVPAGSMIIPSFY

NSLHDAEVFPEPDAFTPERWLDANGSANQNPRNYLVFGSGPHKCIGIEYAVMNIGLVLADAAVLMNWDHV

RTEKSDKVQIIATLFPQDGCLLKITPRQHA

//

 

CYP63 family (7 sequences)

 
>CYP63B2 PpCYP030 
55% to CYP63B1 Phanerochaete chrysosporium
scaffold 21 116043 - 113759

MHPDSYYRLRLLNDFARIFVAPSILLCFILRTADISLGFLTIPAYPICIALCAYARLAYRDWQQDQEAHR

LGARRIPQVVGKWPGNLDIYLKLLKSTQTTYLGSFHLSLFEEYQTTTLNLRLLWQDVVMTMDEKHVQFIL

ATGFNKFWRGARQKERMEAFLGKGIFNRDGDEWKAHRALARPFFARDRIADFELFDRYTQSTLSLMASLA

AQNRPIDVQDIYSRFALDAASEFLFGKNVDTLSWQLPLPGTALIGPKGSATADEFGSFAQAFENAQVTVM

RRSRRGYFWPAYEILQRDPHEADMKIIQQWVDPLVERVLENKSNMRKAGVQNSLDQSVFLEYLADNTEDR

KVIQDQLLNILLASRDTTSMLLTFVTYLLALHPDVAKRLRAEVLQHCGVDGAPTFETIKNMNYMRAVINE

TLRVFPPVPTNGRESRPEPCLFPQSDGTYPERPEPLYVPPSTQVIYLPILTQRNPALWGADADVFDPDRW

LDDRLKIFTSNPMIFTPFSAGPRICIGQNYALNEASFFLTRLLQQFDTFTLAPEAQPEGSLPPPEWKHGK

GRETYERLWLNSALTAYVKGGLWVRFGKQE

//

>CYP63A5 PpCYP027 
54% to CYP63A3 Phanerochaete chrysosporium
scaffold 15 96702 - 94042

MSIPPGVSFVLRVLLVLCFAPACVVTAASLLWRTTLLTIPTSLVIFLAVISTPLAICVRVSYRQWKYQRA

AARLGAILPPRWAGKRLGNLDLTKQMLQTMKTGYTADFAWKAFNNLGNTVQINILWDTSYMTCDPNIIKC

VLATEFNNYEKGDIFKQQMASVLGTGVFNSDGEMWKWHRAMTRPFFNKDRISHFELFDRRSVQAIAKMTE

RFRSGYAVDFQDLVSRFTIDSATEFLFDSCVDSLQQPLPYPHNGRPTPFAQPAGAPVALAPSRAEAFATA

FMRAQIVLAERATMGRIWPLFETRKNRTDEYMCVVNEYLDPILKDALRRKEMASSEGGVSGDKQSDDIDG

ETLLDHLVRLTSDPVVLRDEVLNILIAGRDTTAGTLTFAVYFLCMYPEVFKRLRAEVLENVGSRGRPTYA

DIKEMRYLRAVINETMRLYPLTDCMCRLSINESTLPNPDPNGKPFYVPPKTMVTYTVFGMHRRKEYWGPD

ADEFDPDRFLDERVAKYLTKNPFIFLPFNAGPRICLGQQFAYNEMSFFLIKLLQHFSAMQLAPEAAPPES

LPPAEWASTGWGRKRFERFWPKSHLTLYSNGGMWVKMTEADGLGKDGLAVDI

//

>CYP63A6v1 PpCYP075

98% to PpCYP047, 56% to CYP63A3 Phanerochaete chrysosporium

scaffold 15 343135 - 345823

MALPPGVPFLIRVSLILAFAPVCVVIVANFIWRHTDVALPTWPVTLLSVASTPLTILVRVWYRQWKYQRA

AARLGAIMPPRWVGKKLGNLDILKEMLQTMQSGYIADFAWKLFNNLGNTVQMNVLGGTAYLTCDPNIIKS

VLATDFNNFEKGDLFKQEMASVLGTGVFNADGDMWKWHRAMTRPFFSRDRISHFELFDRRSEQAVAKMTE

RFHSGYAVDFQDLISRFTLDSATEFLFGSCVNSLHSPLPYPHNQHPTPFSHPSSKSLASNPSRAEAVASA

FMRAQIVLAERVAMGAIWPLLEMRKSRTGEHMRIIDEYLDPILKDALRRKEDMANIGAGIHDDKESSDTD

GETLLDHLVRLTSDPVVLHDEVLNILIAGRDTTAGTLTFVVYFLCMYPDVFNRLRAEVLEKVGPNARPTY

ADIKEMRYLRAVINETLRLYPVVPFNIRWSIHEGTLPNPDPNGKPFYLPPKTPVTYTVFAMHRRKEYWGP

DADEFDPDRFLDDRVAKYLTKNPFIFLPFNAGPRICLGQQFAYNEMSFFLIKLMQHFSAMELAPEAAPPE

SLPPAEWAVTGWGRKRIERFWPKSHLTLYSNGGMWVKMVEADDFDKDDRDVGI

//

>CYP63A6v2 PpCYP047

scaffold 70 339697 - 337010

MALPPGVPFLIRVSLILAFAPVCVVIVANFIWRHTDVALPTWPVTLLTVASTPLTILVRVWYRQWKYQRA

AARLGAIMPPRWVGKKFGNLDILKEMLQTMQSGYIADFAWKLFNNLGNTVQMNVLGGTAYLTCDPNIIKS

VLATDFNNFEKGDLFKQEMASVLGTGVFNADGDMWKWHRAMTRPFFSRDRISHFELFDRRSEQAVAKMTE

RFHSGYAVDFQDLISRFTLDSATEFLFGSCVNSLHSPLPCPHNQHPTPFSHPSSKSLASNPSRAEAVASA

FMRAQIVLAERVAMGAIWPLLEMRKSRTGEHMRIIDEYLDPILKDALRRKEDMVNIGAGIHDDKESSDTD

GETLLDHLVRLTSDPVVLHDEVLNILIAGRDTTAGTLTFVVYFLCMYPDVFNRLRAEVLEKVGPNARPTY

ADIKEMRYLRAVINETLRLYPVVPFNIRWSIHEGTLPNPDPNGKPFYLPPKTPCTVFAMHRRKEYWGPDA

DEFDPDRFLDDRVAKYLTKNPFIFLPFNAGPRICLGQQFAYNEMSFFLIKLMQHFSAMELAPEAAPPESL

PPAEWGVTGWGRKRIERFWPKSHLTLYSNGGMWVKMVEADDSDKDGRDVGI

//

>CYP63A7 PpCYP133

66% to PpCYP075, 55% to CYP63A3 Phanerochaete chrysosporium

scaffold 83 268512 - 265768

MAAMAITLAPGVSFLARLLLTIAFAPLCMVIGSHALAKFWHLESPFWLVCLLAVISGPLGFLARVIHRRW

SVRRAAVRFGAILPPEWVGNRIGNLDNMATMVHSFRSGYPTDFLWDKFDSLGHTIQTSILWDTQYMTCDP

NVMKTMLATDFQNFEKGAIFKEQMDSFLGTGVFNSDGDMWKWHRTMTRPFFSKDRISHFELFDVHAEYAI

VRMRERLNAGYAVDFQDLISRFTMDSATEFLFGTCVESLRSPLPYPHNHFPTPFATQPTSQEALSRADAF

SAAFLKSQHVIAERAIIGKIWPILEVLRNKTDEHMRVVNAFLDPILKEALRRKDDMRGYQAMDKTHDDTE

GETLLDHLVKLTSDPVVLHDETLNILLAGRDTTAGTLTLIIYCLCMYPQVRERLRAEIIDRVGRSRRPTY

ADIKEMRYLRAVINETLRLYPLVPVNQRRAINETTLPNPDPSGKPFYVPAGTLVTYSVLAMHRRPELWGP

DADEFDPDRFLDERVSKYLTKNPFIFLPFNAGPRICLGQQFAYNEMSFFLVKLLQRFSSMELAPEAAPPE

SLPPADWAVTGSSRKRIDRFWPKSHLTMYSHGGMWVKMTEAEDLELPAPNAEN

//

>CYP63D1v1 PpCYP107

96% to PpCYP139, 52% to CYP63A4 Phanerochaete chrysosporium

scaffold 15 170831 - 168243

MSPGPRYLARQLPRLLLPPTLVYILYRAIGGKSRYSASPLILTFLFVLSYPVSLAIFVQWKRYTVCHKAA

SLGAVLPPTVKHRWIGGIDLVVTVSRNFEKYFLVDWLFKWSAEYGHTFAREVLFERRLFTSEPEHIKSIL

STNFQAFEKGSTFRGQLGSLLGTGVFNSDGQMWKFHRSMTRPFFTKERISHFDIFDRNADAAFALMKARF

REGHSIDWQDLVLRFTLDSATEFLFGNNVCSLAAGLPYPPASAPPATPTRATADGFGDALKRAQFQTLMR

MRFGSTWPLFEFWSDKVHGAMHDVDAFVDPIVQRAVEAHEAAKGAGAGQSKGDRDHETLLGHLVGLTDDP

QILKDETLNILIAGRDTTAAALTFAVYSLARHSGVLLRLRREVLGRVGTVRRPEYEDFKEMKYLRAVINE

TLRLYPPVPLNMRYTTEAVLWPSRDPGGKPLYIPAKTRIQYSVFVMHRRKDLWGPDALSFDPDRFLDERM

QKYLIPNPFIFLPFNAGPRVCLGQQFAYSEVSFMLVRLLQQFETIELTPQACPNSIPPPTFTDSIGCEGT

ETAWVSSHLTIFAKNGLWLKMCEAPFVDMSSL

//

>CYP63D1v2 PpCYP139

scaffold 224 99244 - 96661

MSPGPRYLARQLPRLLLPPTLVYILYRAIGGKSRYSASPLILTFLFVLSYPVSLAIFVQWKRYTVCHKAA

ALGAVLPPTVKHRWIGGIDLVVTVSRNFEKYFLVDWLFKWSAEYGHTFAREVLFERRLFTSEPEHIKSIL

STNFQAFEKGSTFRGQLGSLLGTGVFNSDGEMWKFHRSMTRPFFTKERISHFDIFDRNADAAFALMKARF

REGHSIDWQDLVLRFTLDSATEFLFGNNVCSLAAGLPYPPASAPPTTPTRATADGFGDAFKRAQFQTLMR

MRFGSTWPLFEFWSDKVHGAMHDVDAFVDPIVQRAVEAHEAAKGAGQSKGDRDHETLLGHLVGLTDDPQI

LKDETLNILIAGSDTTAAALTFAVYSLARHPDVLRRLRREVLDCVGTVRRLEYEDFKKMKYLRAVINETL

RLYPPVPLNMKYTTEAVLWPSRDPGGKPLYIPAKTRIQYSVFVMHRRKDLWGPDALSFDPDRFLDERMQK

YLIPNPFIFLPFNAGPRVCLGQQFAYNEVSFMLVRLLQQFETIELTPRTCPDSIPPPTFTDSIGCDGTET

AWVSSHLTIFAKNGLWLKMCEAPFVDMSSL

//

 

CYP502 family (5 sequences)

 

>CYP502B2 PpCYP044

scaffold 28 430032 - 427446

MGLIIPVLGLVAAYYVWLHLNQPKKALPPGPKPLPVIGNITNLTAQELWLRASEWAKSYGDVVYLHVFGQ

GLVFLNDYDTAIDLLEKRAVPTRDSGAIYSDKPGLIMAGDLCGCENMVAFARYGDKSCCQRRLMQQALGV

NSIRAYQPLLEVETQDLLKRLLRDPEDYVGNLRRYAGGLTLNTLYGYHASANDDRFLTLADECVDILSNR

IASGGGIWPVDIFPFLQRLPDWFPGAGFKRKAAVWKIKMEEFVDKPYEYVKDRMRDGTAVPCFSTTLLQV

ERCEEEEFDIHWTANSMYSVSIDTTITALSHFNLAMVQHPEVLAKAQDEIDRVINPGRLPTFADRPSLPY

IECVMSEVLRWGVPVPLSLPHRLMEDDVYNGMHIPKGSLVFGNVWNMVRNPTLFPDPDAFVPERYLAPAD

EAAARRRDPRNYVFGFGRRRCPGMHLIEQSLWIVMATMVATLDIVKVRDAAGCEVEPEVQFDNAVFRMPR

PFRCDIRPRSEQALRVVRQAADVAA

//

>CYP50B3v1 PpCYP033

scaffold 28 543406 - 541331

MPLAMLMLGLVAAYYVWLHLNKPKKALPPGPKPLPVVGNITDLTAQELWLRASQWAKSYGDVVYLHVLGK

GLVFLNDYDAAVDLLEKRGAIYSDKPGLIMAGDLCGCENMVAFTRYGDKSRRQRRLMQQALGVNSIRAYQ

PLLEVETQDLLKRLLLDPEDYIGNLRRYAGGLTLNTLYGYHASANDDRFLTLADECVDILSNRIASGCGI

WLVDIFPFLQHLPNWFPGAGFKRKAAAWKAKMEVFVDKPYEYVKNRMRDGTAVPCFSTTLLQVERCEEEE

FDIRWTANSMYSVSIDTTITTISHFILAMVQHPEVLAKVQQEVDRVVGPGRLPTFADRPSLPYIECVMSE

VLRWGVPVPLSLPHRLMEDDVYNGMHVPKGSLVFGNVWNMLRNPTLFPDPDAFVPERYLAPADEATTRRR

DPRTYVFGFGRRRCPGMHLIEQSLWIVMASMVATLDISKARDAAGCEVEPEVVFDNAMFRTPQPFRCDIR

PRSEQVLRVVRQAADAAA

//

>CYP502B3v2 PpCYP195

94% to PpCYP033, 91% to PpCYP044 
63% to CYP502B1 Phanerochaete chrysosporium 
scaffold 144 193433 - 195530

MSLVIPVLGLVAAYYVWLHLNQPKKALPPGPKPLPVVGNITNLTAQELWLRASEWAKSYGDVVYLHVFGQ

GLVFLNDYDTAVDLLEKRGAIYSDKPGLIMAGDLCGCENMVAFTRYGDKSRRQRRLMQQALGVNSIRAYQ

PLLEVETQDLLKRLLRDPEDYVGNLRRYAGGLTLNTLYGYHASASDDRFLTLADECVDILSNRIASGCGI

WLVDIFPFLQHLPNWFPGAGFKRKAAAWKAKMEVFVDKPYEYVKNRMRDGTAVPFFSTTLLQVERCEEEE

FDIRWTANSMYSVSIDTTITTISHFILAMVQHPEVLAKVQQEVDHVVGPGRLPKFADRPSLPYIECVMSE

VLRWGVPVPLSLPHRLMEDDVYNGMHIPKGSLVFGNVWNMVRNPTLFPDPDAFLPERYLAPADEAAARRR

DPRNYMFGFGRRRCPGMHLIEQSLWIVMASMVATLDISKARDAAGCEVEPEVQFDNPVFRTPRPFRCDIR

PRSEQALRLVRQAADAAA

//

 

>CYP502B4 PpCYP009

scaffiold 262 47890 - 45078

MLGLMATYYVWLHLNKPNKALPPGPKPLPIVGNITNLTAQELWLRALQWAKSYGDVVYLHVFGQGLVFLN

DYDTAVDLLEKRGAIYSDNPGLIMAGHLCGCENMVAFTRHGHKSRRQRRLMQHALAVNSIRAYQPLLEVE

TQDLLKRLLRDPKDYVGNLRRYAGGLTLTTLYGYHASTNDDKLLTLADECVDILSNRIAAGGGIWPMDIF

PFLQHLPDWSPGAGFKCKAAIWKTKVKEFINNPFEIVKDHMVRDVAHIPRFSTTLLQELQERCETEIDSQ

HEVDICWTGNSMYSVSIDITMTTMLHFILAMVQHPEVLAKAQGDIDRVIGPGRLPTFSDRSSLPYIECVM

SEVLQWGGVPVPLRLPHRLMEDDVYNGMYIPKGSLVYGNVWNMVRNPTLFPDPDAFVPERYLAPADEATM

RRRDPRNYVFGFGRRQCPGTDLIEQSLWIVMASMVAILNISKARDAAGCKVEPEVVFDNAVFCMPRPFRC

DIRPLSEQVLRVVRQAADADA

//

>CYP502B5 PpCYP026

scaffold 320 11354 - 8932

MGLSTLVLGLVAAYYVWLYLDKPKKALPPGPKPLPIVGNITNLTAQELWLRASQWAKSYGDVVYLHVFGQ

GLVFLNDYDAAVDLLEKRGAIYSDKPGLIMAGDLCGCENMVAFTRYGDKSRRQRRLMQQALGVNSIRAYQ

PLLEVETQDLLKRLLLDPEDYVGNLRRYAGGLTLNTVYGYHASANDDKFLTLADECVDILSNRIASGGGI

WPVDIFPFLQRLPDWFPGAGFKRKAAVWKAKMEEFVDKPYEYVKDCMRDGTAVPCFSTTLLQELQERCDK

EVDAQRDFDIRWTANSMYSASIDTTMTTISHFILAMVQHPEVLAKAQEEIDRVVGPGRLPTFSDRPSLPY

IECVMSEVLRWGVPVPLSLPHRLMEDDVYNGMHIPKGSLVFGNVWNMVRNPTLFPDPDAFVPERYLAPAD

EATARRRDPRNYVFGFGRRRCPGMHLIEQSLWIVMASMVATLDISKARDAAGRAVEPEVVFDNAVFRTPR

PFRCDIRPRSEQAVRVVRQAADAAA

//

 

CYP505 family (3 sequences)

 

>CYP505D8v1 PpCYP223

65% to CYP505D6 Phanerochaete chrysosporium

scaffold 41 263589 - 259207

MTNPIPCPPSLPFLGHVTHIEKEVPLRSFMLLAHQYGEIYQMHQFSRHLLVISSYELVNECSDDKRFYKG

IGGALGEVRNGVGDGLFTARAEEENWGIAHRLLMPAFGTAAIRGMFDDMMDIASQLIMKWERFGPTAAIN

PAEDFTRLTFDTIALCAMSHRLNSFYREGNHPFVQAMVDFLVESGRRAHRPSLVTSVMGYQTKYEQDIKI

LADLADEIIAERRDNPIDKNDLLNKMLLGKDPKTGKGLSEENIRNNLLTFLIAGHETTSSTLSFATYYIL

KNPEAARKLREEVDDVLGDQPIQLGDLNKLPYLTACIREALRLGPAAPMRSVSAVDATTIGGGKYAVEKD

QTIVISVAMAMRDPKVWGEDADEFRPERMLDGKFEALPPNAWQPFGHGMRACIGRALAWQEMIIILALIF

QRFDLVMDDPSYELKLKQTLTIKPKDFHIRALPRKGRSIPLATSSSSLHKARLGSPAQPTNATVPVGSEP

RQQLYVLYGSNTGTSETFAQRVASDASVHGFRATMGTLDSFTEKLPTDGPVAIITASFEGEPADNAAHFV

EWLKSLKGQELANVSYAVFGCGNRDWVQTYQRIPKLVDSTLGERGARRLLEAGAGDASSAEFFETFDDWE

HKLWGTLSKVYKATLGEVQDATQVSHLAVKTVDAGTYRASVLRQPDAALGTVVENRLLTATGVPPKRHIV

FELPEGMAAHAGDYLAILPSNPIRDVHRAIARFGLSAEQEIVLTSSGPTPLPVDRSISVSALLLGYVELS

QPATSRDLRILASAAGAPAEAIQELVSSYAEKVLSRRISVLDILEEYPNIKLPFETFLTMLPSMRVRQYS

ISSSPLWDAQKVTLTVSVIDAPSIAGRKESFLGVASTFLGGLRTGDKVQIAVRASNAAFRPPTDPMTPMV

MFAAGSGLAPMRGFLQERAMQKKAGREVAKSLLFFGCRLPKEDFLYSDSDLKEWTELGIVDVRPAFSRSP

GDSRGCKYVQDRAWLDREEIDEAFHAHAKFYTCGSRKIAQGIKNSLTKLIMEKQNVDEAEATAMFGRVIQ

GRYATDIFE

//

>CYP505D8v2 PpCYP224 
63% to CYP505D6 Phanerochaete chrysosporium
97% to PpCYP223
scaffold 4 766891 - 771273

MTNPIPCPPSLPFLGHVTHIEKEVPLRSFMLLAHQYGEIYQMHQFSRHLLVISSYELVNECSDDKRFYKG

IGGALGEVRNGVGDGLFTARAEEENWGIAHRLLMPAFGTAAIRGMFDDMMDIASQLIMKWERFGPTAAIN

PAEDFTRLTFDTIALCAMSHRLNSFYREGNHPFVQAMVDFLVESGRRAHRPSLVTSVMGYQTKYEQDIKI

LADLADEIIAERRDNPIDKNDLLNKMLLGKDPKTGKGLSEENIRNNVCSALLFLSIQYAATLSFATYYIL

KNPEAARKLREEVDDVLGDQPIQLGDLNKLPYLTACIREALRLGPAAPMRSVSAVDATTIGGGKYAVEKD

QTIVISVAMAMRDPKVWGEDADEFRPERMLDGKFEALPPNAWQPFGHGMRACIGRALAWQEMIIILALIF

QRFDLVMDDPSYELKLKQTLTIKPKDFHIRALPRKGRSIPLATSSSSLHKARLGSPAQPTNATVPVGSEP

RQQLYVLYGSNTGTSETFAQRVASDASVHGFRATMGTLDSFTEKLPTDGPVAIITASFEGEPADNAAHFV

EWLKSLKGQELANVSYAVFGCGNRDWVQTYQRIPKLVDSTLGERGARRLLEAGAGDASSAEFFETFDDWE

HKLWGTLSKVWKISRGFTVDAGTYRASVLRQPDAALGTVVENRLLTATGVPPKRHIVFELPEGMAAHAGD

YLAILPSNPIRDVHRAIARFGLSAEQEIVLTSSGPTPLPVDRSISVSALLLGYVELSQPATSRDLRILAS

AAGAPAEAIQELVSSYAEKVLSRRISVLDILEEYPNIKLPFETFLTMLPSMRVRQYSISSSPLWDAQKVT

LTVSVIDAPSIAGRKESFLGVASTFLGGLRTGDKVQIAVRASNAAFRPPTDPMTPMVMFAAGSGLAPMRG

FLQERAMQKKAGREVAKSLLFFGCRLPKEDFLYSDSDLKEWTELGIVDVRPAFSRSPGDSRGCKYVQDRA

WLDREEIDEAFHAHAKFYTCGSRKIAQGIKNSLTKLIMEKQNVDEAEATAMFGRVIQGRYATDIFE

//

>CYP505D9 PpCYP225 61% to CYP505D6 Phanerochaete chrysosporium

scaffold 41 269512 - 26517

MTTPIPSPPSLPFLGHVTHIDKEVPLRTYVLLSQQYGEIYQMNQFSTQRVVISSYELVNECSDDKRFYKG

IKGSTLEQVRNGAGDGLFTAREDEENWGIAHRLLMPAFGTAAIKGMFDDMMDIASQLISKWERFGPTAVI

NPADDFTGLTFDTIALCAMTHRLNSFYRETNHPFVQAMADFLIESGHRANRPSLVTSVLGYQTKYEKDIK

IMSDLVDEIIAERRAHPIEKNDLLNKMLLGKDPKTGKKLPEKNIRYNLLTFLIAGHETTSSTLTFTIYHI

ISNPEATRKLREEVDEALGDRPIQLGDLNKFPYLNACLRESMRLSPPAPMRYVNAISDTIIGGGKYAVKK

DQTVIVNVATSMRDPQIWGEDADEFKPERMLDGKFEALPPNAWQPFGFGMRACIGRALSWQEMTIIIALI

FQHFDLVVDDPSYELQLKQTLTIKPKGYHIRAIPRKGGSVPIALSSSSLHKARLGDQPQPTQPASVAGSE

LRQQLYVLYGSNTGTSETFAQRVTSDAATHAGFRAVMGTLDSVAGKLPTDGPVVIITASFEGEPADNAAH

FVEWVTNVKGTELANVSYAVFGCGNRDWFQTYQRIPKLIDSVLEEHGARQLIEAGAGDASEADFFEAFDD

WERKLWETLSEARSFLGIRTIMSTYIPCGTVDAGTHRAAVLRQSDAALGTVVENRLLTAPGVPQKRHIVF

ELPEGMAARAGDYLAVLPSNPVRDVRRAIARFGLPAEQEIVLTATGPTPLPVDRAISVSALLLGYVELSQ

PATTRDLRILASAEGAPVEAIQELSSSYAEKVLAKRLSVLDILEEYPSIKLPFETFLTMLPSMRVRQYSI

SSSPLWDAQKVSLTVSVIDAQPISGRKESFLGVASTFLAGLNPGDKVQIAVRPSNAAFHPPTDLMTPMVM

FAAGSGLAPMRGFLQERAMQKKAGREVAKSVLFFGCRSPSEDFLYAEPDLKEWTELGVVDVRPVFSRSPE

MSGGCKHVQDRVWKDREIVSEAFYAHAKFYTCGSRKLAQGIKDTLTKIIMEKQNVDEVEAAASFSGIIQG

RYFTDVFE

//

 

CYP512 family (20 sequences)

 

>CYP512K1 PpCYP166 45% to CYP512G2 Phanerochaete chrysosporium 

MKQWSYVIYNLERSPAAGGRHCARHSLTLLISFSVHCQCYCGFHMLRLSYAAVIFLRYLKYGSEHAALYF

SAPSPIISCPAPLAISSTHSKSSRVLNMDVFLLYSHVILPLGICYIVVYLVRSTLKLYHIPTVGRPFVPL

LSSFSVLGSRRDHKDIIREGRRKYKNGIFKFAERYQWHIVVSDPRLIAEIIRAPENVLSFNEATAQSLQT

KYTIGREVFENGYHKSVVRSPLTRNLGVLFPDMHDELVAAFADEIPARDKWTKVFLIQAIMQIVCRTSNR

VFVGLPLCRDPAYLALNKRFTIEVFQIASFINKFPSTLRPFVGMFTSNVQRSTAEAFEHLGGVIAERLTE

RENGSWPDKHNDLMQWLIDAAPGEKHRTPRALVARILTINMAAIHTTTMTSSQALCYLAAYPEYIQPLRE

EVEAVVRDNGWTKEAMDKLYKVDSFIKETQRVKGMSSASMMRKAAQNFTFSDGTFIAKGTIVSVAMEGIY

KDDDIYPDAQTFRPFRFADMHDPDNGTGEQLSMVNTGINWLPFGHGKHACPGRFFASNEVKAMFAHLVMN

YDMKMEKEGELAQDERSAQILFRKRQR

//

>CYP512L1 PpCYP003 37% to CYP512G2 Phanerochaete  chrysosporium 

 

MSAAEGSNVFSSWHSIGIVVLLAVLYWAAHIVLSQRNSAIPAVGPQWLKGLTVVTRHREQLLWACSQYPD

RLIRIPIFPFGGAVVANGSKLINEIRTGPDDTFSPKGAVEKFIQSAYTTGSIVAETALHKPIIRNQFTRN

ADSVFLDLMDEIVFAFDNVLHLPESQEWVSFPALDTFVQVLAGCTNRVFVGLPLCRNREYQQIVTNYATQ

VVKSAYIINMFPDWCHPVIGRLVTRPQKYVEKLIGILGPTIDERWKSYRVYGKEWVDKPDDFLMWVMQDA

SPGYLQSNEVLVTYVLFINFASIHTTSMQFTHAMYDLASHPECVEPLRDEARATLRDHGWTKTAMEQMRK

LDSFMRESARMGPTNLVSLPRKLLRDWTFSDGTMVKKGTYMGASTFSVHFDEDKYANARIFDPWRFCKDE

KSSDKLVASSTEFLAFGAGKHACPGRFFAANEMKALLCFVLLNMDIKLMDGKGRPTDEYFGNSIIPNRSA

HLLFRRLECGERPRMMAS

//

>CYP512M1 PpCYP014

MSITLNRIPVLPTSLYVEGSVGRPSATLAGILHGVQQAALKSPTIAACVAVNVVVMYYIVSFLMSRNTTP

LVGYPRWLGSYAGALRFFVNSQGMVDEGYRRYKGRFFRLPLWTNWNYIVTNEKCIEEMYHLPDDVLSLRY

AAHDELAVPYTMGQQIHDDPYHLPILRGKLTRYIDYLVAECLDELPMAVEDEIGKKCGDSWQEFNAFDVS

IGIVARTFNRILVGAPTCRSAHYTETCKSFAMNTAMIGLLINLFPSFLHPIVGRLFTRLPYLLRRTLVDL

GPIIAERKAAKAEFGDNWTDRPNDLLMWLMDAAKGIEQEPARLAIRVLVINIATIHTTAATFTHGVNNLL

DHTEYIDALREEAESALHSHGWTKQAINQLVRSDSFFKESSRLNGLGTMSFPRKALRDITFSDGTTVPEG

SYISSAWSVHTDEEYWPDPMTFDAFRHIQDNTVGGKANNSSGFIRTNSRYLIFGHGKYPCPGRFLATYIL

KATLAHILLNYEIKASEQGRLPDILFQYNRSPNVRSTFMIRRRKVA

//

>CYP512N1v1 PpCYP013 96% to PpCYP039, 92% to PpCYP011

MLATPIPQYVDAHHLCRMEDKTQYIFALLGLLASFYFIYWKADPLYNIPAIGPSAPILSYLGAYRYYYHG

RQVLREGYRKYKVFRVPMLDRWVVVVSGADMNEELRKVPDTHVSLAQAVNEFTHLKYTVARDIADHPIHT

AVIRGPFTRNLKSLFPDIVNEIKTAFPEVMPLPTHVGEWVAISVRNTMACIVSRVSNRVFVGLPLCRDPK

FLDTLVEYALSFSKARDILSVMPGPVRGIVGNVLPWLKRATRHASVCIQPMVQERLQRLQDAGDDHGDKP

HDYLTWLIEETQKAKLSPDFVVQGILASNFSAVHTASNSITHALFNLAAHTQYMQPLREGVEDIIKEHGW

TYNAINEMWKLDSFMRESQRLCGVTGVSLMRKVLLDITLSDGTYLPQGTLVIAASSATHTDKTYYENAEA

FVPFRFYDMCTENGTLGTQFVNTSKDYLAFGHGKHACPGRFFVAHELKAMMAYIILHYDVKLEEGASRPE

DVWVWHDIAPASAKILFRKRQAKVE

//

>CYP512N1v2 PpCYP039

MASLLATPAPQYVDARHLDRMEDKTQYIFALLGLLASLYFIYWKADPLYNIPAIGPSAPILSYLGAYRYY

YHGRQVLQEGYRKYKVFRVPMLDRWVVVVSGADMNEELRKVPDTHVSLAQAVNEFTHLKYTVARDIADHP

IHTAVIRGPFTRNLKSLFPDIVNEIKTAFPEVMPLPTHVGEWVAISVRNTMACIVSRVSNRVFVGLPLCR

DPKFLDTLVEYALSFSKARDILSVMPGPVRGIVGNVLPWLKRATRHASVCIQPMVQERLQRLQDAGDDHG

DKPHDYLTWLIEETQKAKLSPDFVVQGILASNFSAVHTASNSITHALFNLAAHTQYMQPLREGVEDIIKE

HGWTYNAINEMWKLDSFMRESQRLCGVTGVSLMRKVLLDITLSDGTYLPQGTLVIAASSATHTDKTYYEN

AEAFVPFRFYDMCTENGTLGTQFVNTSKDYLAFGHGKHACPGRFFVAHELKAMMAYIILHYDVKLEDGAL

WVWHDIPPPSAQILFRKRQSEVE

//

>CYP512N2 PpCYP011

MLATPIPQYVDARHLCRMEDKTQYIFALLGLLASLYFIYWKADPLYNIPAIGPSAPILSYLGAYRYYYHG

RQVLREGYRKYKVFRVPMLDRWVVVVSGADMNEELRKLPDTHVSLAQAVNEFIHSKYTVARDITDHPIHT

AVIRGPLTRNLNLLFPDVVDEMKTAFPEVMPLPTHDGEWVAISVRNTMACIVSRASNRVFVGLPLCRDPK

FLDTLVEYALSVSKARDILNVMPGRVRGIVGNVLPWVKRATRHASVCIQPMVQERLQRLQNTDDDHGDKP

HDYLTWLIEETQKVKLSPDFVVQGILASNFSAVHTASNSITHALFNLAAHTQYMQPLREEVEDIIKEHGW

TYNAIKEMWKLDSFMRESQRLCGVTGVSLMRKVLLDITLSDGTYIPKGTLVVAASSATHTDKTYYENAEA

FVPFRFYDMCTENGTLGTQFVNTSKDYLAFGHGKHACPGRFFVAHELKAMMAYIILHYDVKLEDGALWVW

HDIPPPSAKILFRKRQSEVE

//

>CYP512N3 PpCYP140

MASLLATPTPQYVDAHHLCRMEDKTQYIFALLGLLASLYFIYWKADPLYNIPAIGPSAPILSYLGAYRYY

YHGRQVLREGYRKYKVFRVPMLDRWVVVVSGADMNEELRKLPDTHVSLAQAVNEFIHSKYTVAPDITDHP

IHTAVIRGPLTRNLNLLFPDVVDEMKTAFPEVMPLPTHDGEWVAISVRNTMAYIVSRVSNRVFVGLPLCR

DPKFLDTLVEYALSVSKARDILNVMPGRVRGIVGNVLPWVKRATRHASVCIQPMAQERLQRLQNAGDGHG

DKPHDYLTWLIEETQKAKLSPDFVVQGILASNPLPISYAGCSDQSITHALFNLAAHTQYMQPLREEVEDI

IKEHGWTYNAINEMWKLDSFMRESQRLGVNSGVSLIRKALLDITLSDGTYIPKGTLIVAAAFATHTDKTY

YENAEAFVPFRFYDMRAENGTLGMQFVNTSKDYPAFGHGKHACPGRFFVAHELKAMMAYIILHYDVKLED

GASRPEDVWVWHDIIPANTKVLFRKRQSKVE

//

>CYP512N4 PpCYP073

MSRYKSAINKCCLYGSRQACCTVTAQYGRQGTVCLRSFGPLGFLRHIPAIGPSAPILSYLGAYKYYHNAQ

EVLLEGYNKYKVFRVSMLDRWVVVVSGADMNEELRKVPDTHVSFVEAVDDFTYMKYTVAPDVIEHPLHIP

VVRGQLTRNLGLIFPDVVDEMEVAFPEVMPMPTQDDEWAAFPVRDTMAAIVSRISNRVFVGLPLCRDPKF

LDTLVEYALSVAKARDILSVVPGLLKGIAGNLLPWSKRAIRHATAYVEPMIQERLQNMQNVGDDDAKKPY

DYLTWLIEETQKAKQDPSLVIQLILLSNFAAIHTSSNSITHSLFNLAAHTEYMQPLREEVEAVIQEHGWT

KNAIDKMWKLDSFMRESQRLGGIAGISVMRKVVQDITLSDGTYLPRGTMIVAASLGTHTDEKYYKNAEAF

EPFRFSEMRMEGDAVRKQYVNTSKEFIPFGHGKHACPGRFFAVNELKAMMAYIVLHYDVKLEEGVSRPEN

VWVWHDVAPADTKVLFRKRQSKVE

//

>CYP512N5 PpCYP227

MSRYKFATITRWLDRSRQTWLAVPVQDGRQGAVYLCFLVHHDYLYPIPAIGPSAPVLSYLGAYRYYRDAR

KVLQEGYVKYKVFRVSMLDRWVVVVSGADMNEELRKVPDTHVSFAQAADEFLYMKHTVAPDVTTHPIHTP

VIRGPLTRNLNSLFPDIVDEMKAAFPDVMPSPTKDGEWVEIPVRDTMARIVSRVSNRVFVGLPLCRNPDY

LDTVFEFALSVAKARDFLSIVPGVVKDIVGNVLPWSKRAIRHAAVYLQPMVQERLQKLRSAHGEHADESH

DYLMWLIEETEKAKLNPDLVVQGILVSNFAAIHTSSNSITHSLFNLAAYTQYVQPLREEVEAVIKEHGWT

KDAIEKMWKLDSFMRESQRLSGIAGISVMRKVLQDVTLSDGTYLPKGTLVVAASFATHTDEKYYENSEIF

QPFRFSEMRMEGDAVRKQYVNTSREFITFGHGKHACPGRFFAVNELKAMMAYIILHYDVKLEEGISRPEN

VWVWHDVAPASTKVLFRKRQSKVE

//

>CYP512N6v1 PpCYP071

99% to PpCYP110

MEDKAQYVFALLGILATLYFVRWSTDPLRHIPAIGPSAPIVSYLSAYRYCRNAQSILQEGYHKYKVFRVS

LVDRWVVVVSGADMNEELRKVPDTHVSFQEAADDLVQLKYTIAPDVNEHPIHTPVIRGPLTRNLGALFPD

VVDEINVAFPELMPAAAKRGEWVAVSVRDTMGRIVSRASNRIFVGLPLCRNPDYLKTVVEFAFSVAKSRT

IINAAPAVFRPIVGHFLPWAKRAVRNAGVHVKPLIRQRVSKMQDAGDDQTDKSCDYLMWLIEEAQKTKQN

LDIVVQGILVSNFAAIHTSSNSITHSLLNLAAYPQHVQPLREEIEGIIKEYGWTKEAIGKMWKLDSFMRE

SQRLSGISGISVMRKVLQDITLSDGTYLPKGTLVVAAAFATHTDERYYENPEVFEPFRFYDMRTENDALR

KQYVNTSREFITFGHGKHACPGRFFAVNELKAMMAYIILHYDVKLEEGVSRPENVWIWHNISPASTKVLF

RERQSKVQ

//

>CYP512N6v2 PpCYP110

MEDKAQYVFALLGILATLYFVRWSTDPLRHIPAIGPSAPIVSYLSAYRYCRNAQSILQEGYHKYKVFRVS

LVDRWVVVVSGADMNEELRKVPDTHVSFQEAADDLIQLKYTIAPDVNEHPIHTPVIRGPLTRNLGALFPD

VVDEINVAFPELMPPAAKRGDWVAVSVRDTMGRIVSRASNRIFVGLPLCRNPDYLKTVVEFAFSVAKSRT

IINAAPAVFRPIVGHFLPWAKRAVRNAGVHVKPLIRLRVSKMQDAGDDQTDKSCDYLMWLIEEAQKTKQN

LDIVVQGILVSNFAAIHTSSNSITHSLLNLAAYPQHVQPLREEIEGIIKEYGWTKEAIGKMWKLDSFMRE

SQRLSGISGISVMRKVLQDITLSDGTYLPKGTLVVAAAFATHTDERYYENPEVFEPFRFYDMRTENDALR

KQYVNTSREFITFGHGKHACPGRFFAVNELKAMMAYIILHYDVKLEEGVSRPENVWIWHNISPASTKVLF

RERQSKVQ

//

>CYP512P1v1 PpCYP023

96% to PpCYP103, 99% to PpCYP103 with the N-term removed
57% to PpCYP151 

MCAGSIIASSAPRSDFSTRVRPPDGFHTAPLCASYYPIRCISSPQE

LYAIPAVGPSLPLLSYIGALRFTRHAHEMLQEGYVKYKGSAFRLAQLDRWVVVLCGPKMNEELQRMPDDQ

VSFLDAAEDLVQTKYTIAKNVIENPIHISVMRGPLTRNLAPLLLDVIDEINIGVEEHIPTRGDEWVSVPG

LATMTQIVSRASNRVFVGLPMCRDPEYFKIISNFPRDVAKGRFILSITPTFLKPIIGPLLPWSRRTVRQY

SALMKPIIEERQRLLLEHRDPHDPDRPNDFMTWLIEEGRAVDQPVDLLVNALLSSNFVAIHTSSISVTHA

LYNLAAYPEYQQPVRDELVEVIKAEGWTKQAFGKMWKLDSFMRESQRMFGISAISVIRKALKDVTLSDGT

VIPAGTLIAVAAEGTHYDEGSYDNPYIFNPFRFSDMREDEGERIKHQYVSTSSEYVSFGHGKHACPGRFF

ASNELKAILSRLILDFDMKFGGDGQRPPNQWFGSSIIPSQTANVMFRKRPDAGL

//

>CYP512P1v2 PpCYP103

50% to CYP512A1 Coriolus versicolor 

MASTPLLYVLVIILSAVYLLRRRSNP

LYAIPAVGPSLPLLSYIGALRFTRHAHEMLQEGYIKYKGSAFRLAQLDRWVVVLCGPKMNEELQRMPDDQ

VSFLDAAEDLVQTKYTIAKNVIENPIHISVMRGPLTRNLAPLLLDVIDEINIGVEEHIPTRGDEWVSVPG

LATMTQIVSRASNRVFVGLPMCRDPEYFKIISNFPRDVAKGRFILSITPTFLKPIIGPLLPWSRRTVRQY

SALMKPIIEERQRLLLEHRDPHDPDRPNDFMTWLIEEGRAVDQPVDLLVNALLSSNFVAIHTSSISVTHA

LYNLAAYPEYQQPVRDELVEVIKAEGWTKQAFGKMWKLDSFMRESQRMFGISAISVIRKALKDVTLSNGT

VIPAGTLIAVAAEGTHYDEGSYDNPYIFNPFRFSDMREDEGERIKHQYVSTSSEYVSFGHGKHACPGRFF

ASNELKAILSRLILDFDMKFGGDGHRPPNQWFGSSIIPSQTANVMFRKRPDAGL

//

>CYP512P2 PpCYP151

MTDLVPVYYAFAGVVAALLFYKWQSDPLRAIPTIGPSAPLLSYLGAIRFFKDASGVLQEGYDKYNVFKVA

MIDRWAVVVSGAKMNEELRSIPDDQMSFMDAADELVQTKYTIAPDVLIHPIHITVIKEQLTRNLAPLFHE

VVKEVEAAMQELIPAKGDDWIEIDGYSTVTQIITRASSRVFVGFPLCQNAEYLRIATTYSAEVMKGAMIM

SVLPDFLKHIVGPLLPWSRRALRRAAPFLLPIITERRRLLKEYGRDWEDKPNDLLMWIIEEARRVGREDS

TDLMVQGIMASNFTAIHTSSLTFTHALYHLAANPEYIQSLREEIEEVIRTDGWTKVSMGSMWKLDSFLKE

SHRVNGISGISVMRLALKDVTFSDGTFIPAGTFVAAAATSTHHDEENYSDATVFKPFRFSDMRASESEKN

KHHYVSTSAEYIGFGHGKHACPGRFFAANELKIMLASIVLNYDVKFEDEGKRPANVWFATTVLPAPGAKV

MFRKRQT

//

CYP512R1v1 PpCYP048

62% to PpCYP029, 99% to PpCYP086

MELSATTVVAVLSALYFLSSVFGLGKRSLRPIPTVGGPSLPLLRLAGSVRFLFKSAQVLQEGYDKFKGKA

FKHSEYFGWHVYVSGPRLTEELRRAPEDQLSCSEAINDSLQVEYTLSPGIHHDSYHIRIVRTQLTRNLGA

LFSQLRDEIVTAFADQVPLKGDGAEWVPVKGMDAVMEIVVRTSNRVFIGLPLCRDADWCALNKQFTIDCF

QGAAIISLFPKFLKPIAARFLTNVPKSVRRGQRHLEPIILERFRMMEEHGSDWADKPNDMLQWLMDDARG

EARGVRPLVLRLLSVNIAAIHTTSIAFTNALYLLAAHPEFAPLLRAEIEGVVAKEGWTKAAMNDMRRLDS

FLKETLRYTGLGAISLTRKALADYTFADGTFIPAGTTVSAPLRATHYDDGIWARAAVFDPWRFSTLREAE

GESAKHHMVSTSTEYLAFGHGQHACPGRFFAANEMKAMLAHVLVTYDVKMEQEGVVPPPTWFGPNLVPNW

NAKVLFRTRQAS

//

CYP512R1v2 PpCYP086

MELSATTVVAVLSALYFLSSVFGLGKRSLRPIPTVGGPSLPLLRLAGSVRFLFKSAQVLQEGYDKFKGKA

FKHSEYFGWHVYVSGPRLTEELRRAPEDQLSCSEAINDSLQVEYTLSPGIHHDSYHIRIVRTQLTRNLGA

LFSQLRDEIVNAFADQVPLKGDGAEWVPVKGMDAVMEIVVRTSNRVFIGLPLCRDADWCALNKQFTIDCF

QGAAIISLFPKFLKPIAARFLTNVPKSVRRGQRHLEPIILERFRMMEEHGSDWADKPNDMLQWLMDDARG

EARGVRPLVLRLLSVNIAAIHTTSIAFTNALYLLAAHPEFAPLLRAEIEGVVAKEGWTKAAMNDMRRLDS

FLKETLRYTGLGAISLTRKALADYTFADGTFIPAGTTVSAPLRATHYDDGIWARAAVFDPWRFSTLREAE

GESAKHHMVSTSTEYLAFGHGQHACPGRFFAANEMKAMLAHVLVTYDVKMEQEGVVPPPTWFGPNLVPNW

NAKVLFRTRQAS

//

CYP512R2 PpCYP029 52% to CYP512E1 Phanerochaete chrysosporium 

MSGSVATYALLALPVLYVLVTLFVPPQRNLRHIPTVGGPSNPFLAWIGALRYVSHSAEILREGYAK (0)

YKGGVFKHAEPGGWCVVVTGSRKIEELHRAADDELSFIAATNETLQVPYTLGPNVASNLYHVPIVRSQLT

RALPVLFPELRDEIVCAFGDAVGMPEEWKAVPAMEVVMDVVARTSNRLFVGLPLCRNADYCELNKQFTID

VFTGAAIINLFPSVLKPIARRLLTKVPQRIARGMKHLQPMIEERFHLIEAHGNDWPDKPNDLLQWLMDAA

QGEERTMRALVLRVLTVNIAAIHTSSL (0)

TFINALYLLAAY PQYIAPLRAEVEAVVESEGWTKAAMNKMRKVDSFLKESNRYTGLGAKSMTRLALKDFTFSDGTFIPAGTT

ISAPAHAVHFDEDIWPNADVFDPFRFSSLREEEGEGAKHQMVSTSLDYIPFGHGRHACPGRFFAANELKA

MLAHVAVTYDVKMEKDGVLP

PSMWFGTALVPNRKAQVLFRKRKA

//

>CYP512R3P PpCYP232 yellow not P450 CYP512-like N-term with errors

(pseudogene)

closest to PpCYP029
frameshift at & and deletion of 160 aa

MHICTLLLVCAAISNAAVWRLRYERDAALRFPSFSASRRTTQPCICPTATVRNVTDGLRM

YKGGMPTQAASASSSRTPRKFEELRRAATNEVSASLSCARLHASSSQPPRADIQVPYTLGPNIASNLYHI

PIVRSQLTRALPVLLPELRNEIVCAFGDAVGMSDGRCIRVRLSRMRLMYAAEWKAVPAMEVVMDVVARTS

NRLSVSLTFC

ESRSCFSIDVFTCAAIISLFPSVFKPIARRLLTKVPQRIARVMKHLQPMIEERGKDWQDKPNDLLQWLTD

TAQGEERTMRALVLRVLTVNIVAIHTSFL

TFINALFLLAAH &

P*MWFGTSLVPNRKAQVLFRKRKA*

 

HKCGLERRLCLTGRRRCSSRRERLDFPPRWTRPVGISMIAYRQLPTINHTIEADSISLATHIHSDLLHRL

VSVWRIPIRLCSPISQLHLELCMTIRSVLHSEAQIVIRTEERRNERHRFISSLACAGVLSPGIASASALA

ALKTGIAHDEHDMDPRRIPRLCGA

//

>CYP512S1 PpCYP085 40% to CYP512B1 Phanerochaete  chrysosporium 

MSSDLLIYALTASTALYLIALLRAISDHKLRVIPTVGGSSLPILYHYSIVRNISRIASISREGYNKYRGR

LFKYAEPAGWRIIVTNPQHIEEIARAPDDVLSLAESVNDMTQIVYTMGPEIHHHQWHNALIRGQLTRNIN

RFFPEMHDELVTALSEEICVEDSSWKEVGVKDSFIKVVCRTSNRVFVGLPMNADYCDLNERFTMDVVKGA

LVLKLFPAILRPF IARFCTNVPTNIDEGIVHLGPAILERLSKHGELGDKWTDRPNDMLQWLIDNAPPHERSVRPLVLRILSVN

FAAVHTTTTVLTQVMYHLAAYRQYVDPLREEVEAVVQEEGWTKSAIDKMYKIDSFVREVLRMSASSSSVN

RKALKDFVLSDGTVIPAGSNVGAGSYLRHFDDDIYEDASVFNPWRFYLKRSEDQSGTKGLIVNSGPDFLP

FGHGKHGCPGRFFAAVEMKAILAHVVVTYDVKMKEDGALPSSRWIFTALIPDQKAKVLFRRRQS

//

>CYP512S1P PpCYP237 Yellow not P450, 40% to CYP512A1 AB057426 Coriolus versicolor 
95% to PpCYP085
pseudogene missing the C-term

MSSDLLVYALFTSTVFYLIALLRAISDHKLRVIPTVGGSSLPILYHYSIVRNISRIASISREGYNKYRGR

LFKYAEPAGWRIIVTNPQHIEEIARAPDDVLSLAESVNDMTQIVYTMGPEIHHRQWHNALIRGQLTRNIN

RFFPEMHDELVTALSEGICVEDSSWKEVGVKDSFIKVVCRTSNRVFVGLPMCRNADYCDLNERFTMDVVK

GALVLKLFLAFLRPI

DMMTSVAQRPPQYINSITTLDASRLDSRDVITLYGPVSQVWDGKLLARRTGPTVGGSWWNSRVHTPDYQA

GNGALTQLLTGSPWLSSATSTGTSQLPHETKGWLYYYRPPSRPPTAGEVRLMDIATKINYRMLANVLLRD

QLVSQDLLERCKKQTDVHFVRRTSQQFFFHIEDPFILNLSNSTFTPYVWLDEDLVRSPRLRDQWRDSRKH

MPSPTYTGERAKTTGGPRSTLPKHAKKRVVVLRVLEIVEPIRPAIPDYDGHFKPPVEGALLQRGRKPVSI

DLDGVQFKGASNPLKVLYDRAYSPQTDIVS

//

 

CYP537 family (3 sequences)

 

>CYP537F1v1 PpCYP114 
50% to CYP537B4 Aspergillus terreus, 98% to PpCYP119

scaffold 65 211557 - 213267

MYALYFVCLGLLYVVYERLVLSSLSKVPGPAIAATTRLVLMYYEFTRRRRRWIHALHKKYGPIVRIAPDE

ISFATWDAAKEIYVSEGSGYDKTLFYKLFDNYETECMFSTLDRAPHGERRKRIADRYSKTFIMQPDVISG

VQERAEQFVAKCTEKPGSEAVDVYIYLHCYAIDCITYHLFDPHGLNSLADASDLMKVKELSHHDNLKDSY

MQYYFTELFRYTASFSRRVDRSKRIAAQIINIARRSDIAEHTVLYRLQTHEDKLDTRSIASELLDHTLAG

LDTTGDGLCFLMHQLSLPASAAIQEKLRLELTENTSMPIDDLPYLDAVVKEGLRCFSPIPMSLPRKVPRG

GRTIGDIFLPEETIVSCQAYTLHRIDEKVFPNPDNFVPERWLESEGNIERNQLLLAFSTGGRGCIGKHLA

LLEMKMLLRETYSSYRTSVASEMAASMDVDDQVIASRPIGRTCLLKFEKIM

//

>CYP537F1v2 PpCYP119

scaffold 94 52790 - 54499

MYALYFVCLGVLYVVYERLVLSPLSKVPGPAIAATTRLVLMYYEFTRRRRRWIHALHKKYGPIVRIAPDE

ISFATWDAAKEIYVSEGSGYDKTLFYKLFDNYETECMFSTLNRAPHGERRKRIADRYSKTFIMQPDVISG

VQERAEQFVAKCTENPGSKAVDVYIYLHCYAIDCITYHLFDPHGLNSLADASDLMKVKELSHHDNLKDSY

MQYYFTELFRYTASFSRRVDRSKRIAAQIINIARRSDIAEHTVLYRLQTHEDKLDTRSIASELLDHTLAG

LDTTGDGLCFLMHQLSLPASAAIQEKLRLELTENTSMPIDDLPYLDAVVKEGLRCFSPIPMSLPRKVPRG

GRTIGDIFLPEETIVSCQAYTLHRIDEKVFPNPDNFVPERWLESEGNIERNQLLLAFSTGGRGCIGKHLA

LLEMKVLLRETYSSYRTSVASEMAASMDVDDQVIASRPIGRTCLLKFEKIM

//

>CYP537F2 PpCYP102 
49% to CYP537B3 Aspergillus niger, 79% to PpCYP114
scaffold 120 153831 - 155542

MYTVYCVCLGLLYVVYERLVLSPLSKVPGPAIAATTRLVLIYHEFTRNRRRWIHALHMQYGPVVRIAPNE

VSMATWDAAKEIYVSGGSGYDKTSLYKLFDSYETECMFSTLDKAPHGERRKRVADRYIKSFVMQPDVVTG

MQERAQQFVAKCTEKTGSVSVDIYVYLHCYAIDCTTYHLFDPHGLNSLTSAADLAKVMELSHHDDLKGSY

MQYYFTELFRFTSQFARRADRSQGIAAQIMNIVLRNDIAEHTVLYRLQTHVDMLDSRSIASEIMDHTLAG

LDTTGDALCFLMYHLSLPASVTFQEKLHYELAENPSTPIDDLSYLDAIVKEGLRCFSPVLTSLPRRVPRS

GRTIAGVFLPEETIVSCQAYTLHRMDEKVFPHPEEFIPERWLEPEGSIERNQLLSAFSTGGRGCIGKHLA

LLEMKMLLKETYSCYRTSVSPEMTASMDVDDQFVTSRPIGRKCLLSFVKIV

//

 

CYP5027 family (18 sequences)

 

>CYP5027B1 PpCYP231

43% to CYP5027A1   Ustilago maydis 
scaffold 43 318558 - 316372

MDVSTNELAILAIVLLATGVLFYAKGTRRAPLPPGPRGIPFFGNLFQVDAMRPYPQYLKWAQKYGPVVSI

KLGGQHVIVLNSSEAADELLVTRSKQYSSRESPHVAFDLVSDQQQMLFMPYGREWKIVRKNVHGLLGPGS

SKQMRKMQDLESRVILHDLLCHGETSISEDFVEGPHGEVPERHWFSIIRRYTTSLMMTLMYGHRIHRIVD

NPELHQVYAVVSNFTHVSQPGRYLVDVFPVLRRLPDIMAPWRAEGKKMHEWEMGFWGKLFSDSRTALLDG

SGLDGFVQSYLRSRAEAGCEDLPGKGVTEDAAGWMRDKLVTYTASGIIEAGSDTTSTAMFSFVLLMLSNP

DALQRAKEEMDAVVGSSRMPGWEDEDRLPWLKACIKETLRRAPPLPLGVPHKTEEDDVYNGRLIPKGSTV

IGNIWAIHMDPIRYPNPTSFKPERFYHPDEKLDWASGPDTHDRDHYIFGWGRRFCSGKHIAEASLFIVLS

RLIWGFDLYTGSDAKTGQARLPDVNDEATFTDGLVAAPKIYPVGFKPRSEKHAEMIKASYRDVQNDWQSM

GLAGDER

//

>CYP5027B2v1 PpCYP129

98% to PpCYP123 syntenic, possible allele

scaffold 36 314913 – 312721

scaffold 36 is a probable allelic contig to scaffold 43

MDARTNELAIVAITLLATVVLLYAKGTRRAPLPPGPRGIPFFGNMFQFNVMRPNPQYLKWAQKYGPVFSV

KLGGQRIVVLNSSEAADELFVTRSKLYSSHESPHVGFDLVSDQQRMVFMPYGREWKISRKNVHGLLGPGP

SKQMRKMQELESRVMLHDLLCHGETSITEDFVEGPHGKVPERHWFSIIRRYTTSLMMTLVYGRRIERIVD

NPELHKVYDVMANITHVCQPGSYLVDALPFLRWLPDMLAPWRAEGRKMHEWEMAFWGKLFSDSRTALLNG

AGFNGFVQSYLRARAEAGLEDLPGKGATEDAAGWMRDKLVTYTAVSIIEAGSDTTSTAVFSFVLLMLSNP

DALQRAKEEMDLVVGSSRMPEWEDEDRLPWLTACIKETLRRAPPFPLGIPHKADEDDVYNGYLIPKGSTV

VGNIWAIHMDPVRYPDPSAFKPERFYNPDGKLNWASGPDTHNRDHYIFGWGRRFCSGKYVAEASLFIVLS

RLIWGFELHAASDPQTGKARLPGVNEEDTFTDGLVSAPKIYPVGFKPRSEKHAEMITASYKDVQNDWQSM

GLAGDER

//

>CYP5027B2v2 PpCYP123

scaffold 43 323007 – 320815 syntenic to contig 36 PpCYP129

MDASTNELAIVAITLLATVVLLYAKGTRRAPLPPGPRGIPFLGNMFQFNVMRPNPQYLKWAQKYGPVFSV

KLGGQRIVVLNSSEAADELFVTRSKLYSSHESPHVGFDLVSDQQRMVFMPYGREWKISRKNIHGLLGPGP

SKQMRKMQELESRVMLHDLLCHGETSITEDFVEGPHGKVPEKHWFSIIRRYTTSLMMTLVYGRRIERIVD

NPGLHKVYDVMANITHVCQSGSYLVDALPFLRWLPDMLAPWRAEGRKMHEWEMAFWGKLFSDSRTALLNG

AGFNGFVQSYLRARAEAGLEDLPGKGATEDAAGWMRDKLVTYTAVSIIEAGSDTTSTAVFSFVLLMLSNP

DALQRAKEEMDVVVGSSRMPEWEDEDRLPWLTACIKETLRRAPPFPLGIPHKADEDDVYNGYLIPKGSTV

VGNIWAIHMDPVRYPDPTAFKPERFYNPDGKLNWASGPDTHNRDHYIFGWGRRFCSGKYVAEASLFIVLS

RLIWGFELHAASDPQTGKARLPGVNEEDTFTDGLVSAPKIYPVGFKPRSEKHAEMITASYKDVQNDWQSM

GLAGDER

//

>CYP5027B3v1 PpCYP008

scaffold 36 367385 - 369573

MDISPNELAILTVVLLATTVLFYAKGTRRAPLPPGPRGIPFFGNLFQVDAMRPYPQYLKWADKYGPVFSV

NLGGQRIVVLNSSEAADELLMTRSKQYSSRESPHVAFDLMSDQQQMLFMPYGREWKVCRTCLPSSLVRSH

PSAAPRGLCSVVNQIVRKNVHGVLGPGPSKQMRKIQDLESRVILHDLLCHGETSITEDFVEGPHGKVPER

HWFSIIRRYTTSLMMTLVYGRRIHRIVDNPELYVVYDIMSNFTHVSQPGRYLVDVFPILRRLPDFLAPWR

EEGRKMHEWEMGFWGKLFSDSRTALLDGSGLNGFVQSYLRSRAEAGHEDLPGKGVTEDAAGWMRDKLVTY

TASGIIEAGSDTTSTAIFSFVLLMLSNPEALQRANEEMDAVVGSSRMPEWEDEDRLPWLKACIKETLRRA

PPVPLGVPHKTEEDDIYNGHLIPKGSIVIGNIWAIHMDSARYPDPSAFKPERFYNPNGKLEWASGPDTHV

RDHYIFGWGRRFCPGKYVSEASMFIVLSRLIWGFDLYAASDAKTGKVRLPDVDDEATFTDGLVAAPKIYP

VGFKPRSEKHAEMIKASYRDVQNDWQSMGLARDER

//

>CYP5027B3v2 PpCYP132

91% to contig 36 PpCYP008

scaffold 43 336993 – 339178 syntenic to contig 36 PpCYP008

MDVSTNELAILSIVLIATGMLFYAKGTRRAPLPPGPRGIPFLGNLFQVDAMRPYPQYLKWAHKYGPVFSV

NLGGQRIVVLNSSEAADELLVTRSKQYSSRESPHVAFDLMSDQQQMLFMPYGREWKVCRAYLSASTVRAH

LSALRWLCAAVNQIVRKNVHGVLGPGPSKQMRKMQDLESRVILHDLLCHGETSVSEDFVEGPHGKVPERH

WFSIIRRYTTSLMMTLVYGHRIHRIVDNPELYVVYDIMSNFTHVSQPGRYLVDVFPVLRRLPDILAPWRA

EGKKMHEWEMSFWGTLFSDSRTALLDGAGLNGFVQSYLRARAEAGHEDLPGKGVTEDAAGWMRDKLVTYT

ASGIIAAGSDTTSTAIFSFVLLMLSNPDALQRAKEEMDAVVGSSRMPEWEDEDRLPWLKACIKETLRRAP

PLPLGVPHKTEEDDIYNGHLIPKGSIVIGNIWAIHMDSARYPDPTAFKPDRFYNPDGKLEWASGPDTHDR

DHYIFGWGRRFCSGKHIAEASLFIVLSRLIWGFDFYAASDPQTGKARLPDVNDEATFTDGLVAAPKIYPA

GFKPRSEKHAEMIKASYRDVQNDWQSMGLARDER

//

>CYP5027B4v1 PpCYP079 
40% to CYP5027A1 Ustilago maydis, 93% to PpCYP087
scaffold 36 382563 - 384739

MAVSTNELAILAIVLLVTAVVFYTKGTRRAPLPPGPRGIPFLGNLFQFNVMRPYPQYLKWAQKYGPVFSI

KLGSQRIIVLSTSEAADELFVTRSKLYSSHESPHVGFDLVSDQQRMVFMPYSREWK

IVRKNVHGILGPGPSKQMRKMQDLECRIMLHDLLCHGDTSIVEDFVEGPHGKVPERHWFSIIRRYTTSLM

MTLVYGRRIHRIVDNPELHQVYEMMSNMTHVSQPGRYLVDALPILRWLPDIMAPWRAEGKRMHEWEMGFW

GKLFADSRTAFLNGTGLNGFVQSYLSARAEAGLEDLPGKGATEDGAGWMRDKLITYTAVSIIEAGSDTTS

TAVFSFVLLMLSNPDALRRAKEEMGAVVGSSRMPDWEDEDRLPWLTACIKETLRCAPPLPLGIPHKADED

DVYNGYLIPKGSTVIGNIWAIHMDPVRYPDPTAFKPERFYNPDGKLNWASGPDTHNRDHYIFGWGRRFCS

GKYLAEASMFIVLSRLIWGFDFYAASDPQTGKVKLPDVNDVDTFTDGLVTAPKIYPVGFKPRSEKHAEMI

KASYRDVQNDWQSMGLAGDER

//

>CYP5027B4v2 PpCYP087

93% to PpCYP079

scaffold 43 354671 – 356851, syntenic to contig 36 PpCYP087

MNTSNNELAILSIVLFVTGVLLYTKGTRRAPLPPGPRGIPFLGNMFQFNVMRPYPQYLKWAQRYGPIFSV

NLGGQRIIVLNSSEAADELLVTRSKLYSSHESPHVGFDLVSDQQRMVFMPYSREWKIVRKNVHGILGPGP

SKQMRKMQDLECRVMLHDLLCHGDTSIVEDFVEGPHGKVPERHWFSIIRRYTTSLMMTLVYGRRIHRIVD

NPELHQVYEMMSNITHVSQPGRYLVDALPILRWLPDILAPWRAEGRKMHEWEMDFWGKLFSDSRTAFLNG

TGLNGFVQSYLRARAEAGLEDLPGKGATEDAAGWMRDKLITYTAVSIIEAGSDTSSTAVFSFVLLMLSNP

DVLRRAKEEMDAVVGSSRMPDWEDEDRLPWLTACIKETLRCAPPLPLGIPHKADEDDIYNGYLIPKGSTV

IGNIWAIHMDPVRYPDPTAFKPERFYNPDGKFNWASGPDTHNRDHYIFGWGRRFCSGKYLAEASMFIVLS

RLIWAFDFYAASDLQTGKVKLPDVHDVDTFTDGLVTAPKIYPVGFQPRSEKYAEMIKASYRDVQNDWQSM

GLAGDKR

//

>CYP5027B5P PpCYP203 pseudogene top part = 43% to CYP5027A1 Ustilago maydis
scaffold 36 389160 - 391030

yellow not P450

MPISAHLKSTPSVLEEKFAGAWMTTVESHRRLAFTSSFLHPAMRTIRRGSRTCRRYTRHRECTARFVSIS

DETVGVRCMLINAEPSPQTVLHVCAMCCDNASRDVFGQPFAAVASSRNDDVEPSVMSCICQRFCCVSRRP

ASQPPLLKLTRVAGGSYYCLAFYHSALLRQWYSACP

Cyan is probably wrong seq, compare to PpCYP079

MTSWAPWCSALGKLVSIQRSAPLPPGMVFSVYMTLPTVTNRPDVQ

 

VLLSTTVLFYANGTRRAP*PPGPPGVPLLGNLFQFNVVRPYPQ

YLKWAQKYGPVFSVKLGSQRIVVLNSAEAADELLTIRS

NGRS

KWYSNREPSHVGFDLVIDQQRMVHMPYDKEWKVRR

 

VEPTFGIYGSSSPVGRSAPAVVINQ

VVRKNVHGFLGPGPSKQMGKTQDLESRVMLHDLLCH

(230aa gap) similar to CYP530A

GVPHKADEDDAYNDYLIPKGSTVIGNIWAIHMDPVRYPDPTAFKPGRFYDPDG

(small gap)

SWTG

YIFGWGIRF

(missing heme Cys here)

SGKYLAEASMFIVLSRLIWGFDFCAASDAKTGKARLPDVDDEATFTDGLVAAPKIYPVGFKPRSEKYAEM

IKASYRDVQNDWQSMGLVGDE

//

>CYP5027B6v1 PpCYP034,

98% to scaffold 36 PpCYP069

scaffold 36 404552 – 406738, syntenic to scaffold 43 PpCYP069

MDISTNELAALTVVLLATGMLFYANSTRRAPLPPGPRGLPLLGNLFQFDVMRPYPQYLKWAQKYGPVFSV

KLGGQRIIVLNSSEAADELLATRSKLYSSRESPHVGFDLVSDQQRMLFMPYGREWKIARKNVHSLLGPGP

SKQMGKTQDLESRVMLHDLLCHGETSITEEFVEGPRGEVPERHWFSVVRRYTTSVVMMLVYGRRIHRIVG

DPELHKVYDLMSNFTHVSQPGRYMVDALPVLRWLPDMLAPWRAEGRKTHKREMDFWGKLFSDSRTAFLNG

TGLNGFVQSYLRARTEAGLEDLPGNGATEDAAGWMRDKLITYTAVTIVEAGSDTTSTAVFSFVLLMLSNP

DALQRAKEEMDAVVGSSRMPDWEDEDKLPWLTACIKETLRRAPPAPLGIPHKVDEDDVYNGYLIPKGSTV

IGNIWAIHMDPVRYPDPTAFKPERFYNPDGKLNWASGPDTHNRDHYIFGWGRRFCSGKYLAEASMFIVLS

RLIWGFDFYAASDPQTGKARLPDVNDVDTFTDGLVTAPKIYPVGFKPRSEKHAEMIKASYREVQNDWQSM

GLAGDER

//

>CYP5027B6v2 PpCYP069

scaffold 43 377978-379855

MVISTNELAALTVVLLATGVLFYANSTRRAPLPPGPRGLPLLGNLFQFDVMRPYPQYLKWAQKYGPVFSV

KLGGQRIIVLNSSEAADELLATRSKLYSSRESPHVGFDLVSDQQRMLFMPYGREWKIARKNVHSLLGPGP

SKQMGKTQDLESRVMLHDLLCHGETSITEEFVEGPRGEVPERHWFSIVRRYTTSVVMMLVYGRRIHRIVG

NPELHKVYDLMSNFTHVSQPGRYMVDALPVLRWLPDMLAPWRAEGRKMHKREMDFWGKLFSDSRTAFLNG

TGLNGFVQSYLRARTEAGLEDLPGNGATEDAAGWMRDKLITYTAVTIVEAGSDTTSTGVFSFVLLMLSNP

DALQRAKEEMDAVVGSSRMPDWEDEDRLPWLTACIKETLRRAPPAPLGIPHKVDEDDVYNGYLIPKGSTV

IGNIWAIHMDPVRYPDPTAFKPERFYNPDGKLNWASGPDAHNRDHYIFGWGRRFCSGKYLAEASMFIVLS

RLIWGFDFYAASDPQTGKARLPDVSDVDTFTDGLVTAPKIYPVGFKPRSEKHAEMIKASYRDVQNDWQSM

GLAGDER

//

>CYP5027B6v3 PpCYP248

MDISTNELAALTVVLLATGMLFYANSTRRAPLPPGPRGLPLLGNLFQFDVMRPYPQYLKWAQKYGPVFSV

KLGGQRIIVLNSSEAADELLATRSKLYSSRESPHVGFDLVSDQQRMLFMPYGREWKIARKNVHSLLGPGP

SKQMGKTQDLESRVMLHDLLCHGETSITEEFVEGPRGEVPERHWFSVVRRYTTSVVMMLVYGRRIHRIVG

DPELHKVYDLMSNFTHVSQPGRYMVDALPVLRWLPDMLAPWRAEGRKTHKREMDFWGKLFSDSRTAFLNG

TGLNGFVQSYLRARTEAGLEDLPGNGATEDAAGWMRDKLITYTAVTIVEAGSDTTSTAVFSFVLLMLSNP

DALQRAKEEMDAVVGSSRMPDWEDEDKLPWLTACIKETLRRAPPAPLGIPHKVDEDDVYNGYLIPKGSTV

IGNIWAIHMDPVRYPDPTAFKPERFYNPDGKLNWASGPDTHNRDHYIFGWGRRFCSGKYLAEASMFIVLS

RLIWGFDFYAASDPQTGKARLPDVNDVDTFTDGLVTAPKIYPVGFKPRSEKHAEMIKASYREVQNDWQSM

GLAGDER

//

>CYP5027C1 PpCYP065
no allele found, looke on scaffold 43 between PpCYPo69 and PpCYP137
44% to CYP5027A1 Ustilago maydis cyan = intron
scaffold 36 439148 - 437031

MAPLDIAVLAITVIVTAVVYIRRSKPKLAHLPPGPPGLPILGNIFQINALRPYPKMREWALQYGPIFHLR

IGPQDVIVVNTAEAADELFITRSSQYSGRVSPHVAHDIMSDGQRLGFLPYGKEWKTARRELQGVIGPTPS

KTLKPIQELESRVLMYDLLCSNSWGDASVPVETSRGGFPERHWSSLVRRFVSTQQTSSTQTLTTEQTTSV

VVNLTYGQRVHRLDGFAKLHKIYDVIETVSRVAQPGNYLADTFPVLRLLPDMLAPWRREGRRMHEWEMEL

FGSLLKEGQAALEKGVILPGFVNQYLRSRADATTEVTSGNGTTEDGWMRDKLLAYVAGTILEAGSDTTAS

TIHSFVLFMLENEHVLHRAREEIDSVVGKDRLPTFEDEDKLPYLVACIKETMRRRPSVIMGVAHKAEEDD

IYGGYLIPKGAAVMGNVWAIHMDPVRFPNPTAFDPDRFYWPDKPISWASGPDPRNRDHYAFGWGRRFCQG

SYVAEASLFVAISRIVWGFNLCAPRNNVTGQPEVPNTMDEEASWMEGFISGPRKFNVTFEARSGKHAEII

QRAFDEAQMEWQAIGMKTDER

//

>CYP5027B7v1 PpCYP198

96% to scaffold 43 PpCYP137

scaffold 36 449638 – 447487, syntenic to scaffold 43 PpCYP137

MSAYDIIALAAVTLATLLVFLHGRSTDPPPPCPPGIPVFGNLFQVDALRPHPQFLKWAQKYGSIFSLKLG

PQRMIVLNTAAAADELLVNRSKVYSSRPSLHVAQDLVSDGQRMVFMPYDREWKVTRRNLQGVIGPGPSKR

LREMQELESRVVLYDLICHGDQSITEVHVPGPNGEVPERHWFSVIRRYTTSVVMHLAYGKRVHRILNSPQ

MRKVYDVMSNFTRVAQPGAYLADTIRPLRWLPGILAPWRMKALKMHEWEMELWGGLLSECRASLKKGIYH

SGFVPSYLRARAEVGCEDLPGTGVTPDGTGWMRDKLLAYTAGSLLEAGSDTTAATIQTFMLLMLHHPDAL

ARAREELDRVVGVERMPGWDDEERLPWVIACIKETLRRRPPTIMGMPHRVDEDDVYEGYHIPKGSTVIGN

IWAIHMDPVRYRNPAAFDPERFYDKDKMPKWASGPDSSHRDHYAFGWGRRFCQGSLMAEASLFIVLSRLI

WGIDFYAPLDPRTDKPMLPDFGDEVQTWSGGFVSSPFIFPVGFRPRSEKHAEIMRTAFDDVQGEWQAMGL

EEDER

//

>CYP5027B7v2 PpCYP137

scaffold 43 438586 - 436435

MFAYDIIALAAVTLATLLAFLHGRSTDSPPPCPPGIPVFGNLFQVDALRPHPQFLKWAQKYGSIFSLKLG

PQRMVVLNTAAAADELLMNRSKVYSSRPSLHVAQDLVSDGQRMVFMPYDREWKVTRRNLQGVIGPGPSKR

LREMQELESRVVLYDLICHGDQSITEMHVPGPNGEVPERHWFSVIRRYTTSVVMHLAYGKRVHRILNSPQ

MHKVYDVMSNFTRVAQPGAYLADTIRPLRWLPDIIAPWRMKALKMHEWEMELWGGLLTECRTALKKGIYH

SGFVPSYLRARAEVGCEDLPGTGVTPDGTGWMRDKLLAYTAGSLLEAGSDTTAATIHTFVLLMLHHPDAL

ARAREELDRVVGVERMPGWDDEERLPWVIACIKETLRRRPPTIMGMPHRVDEDDVYEGYHIPKGSTVIGN

IWAIHMDPVRYPNPAAFDPARFYDKDKMPKWASGPDSSHRDHYAFGWGRRFCQGSLMAEASLFIVLSRLI

WGIDFYAPLDPHTDKRMLPDFDDEVQTWSGGFVSSPFIFPVGFRPRSEKHAEIMRTAFDDVQGEWQAMGL

EEDER

//

>CYP5027B8v1 PpCYP163

99% to PpCYP181 adjacent gene but the address may be wrong

scaffold 112 218890 - 216774

MDVLSRESALLAGIAIFTLYLLHSVRARRKGGLPPGPPGIPILGNLLQLNPLRPHPTYLKWAQKYGPIFS

IKLGMQRVIVLNTAEVADELLVTRSKLYSSRPDLHVASDLVSDGQRMVLMANNRELKIARRTLQGILSPG

PSKKMRNMQDLESRVLLRDLVVHGDSSLTETFTEGPHGEVPERHWFSVFRRYTTSIVMSLSYGQRMNRFL

DNPDLHKVYEAMSVFMHASEPGNYLADVFPILRRLPDILAPWRKEGRRMHEWQMGLWGKLLDECSSDIAK

GIARTGFVSDYLRARAEAGLGDLPGNGATDDGVGWMRDKFLAYTAASVLEAGSDSSSTVMFSFILFMLSN

PDALQRAREEMDRVIGPDRMPGWEDEDRLPWLVACIKETLRIRPPFISGLPHVAEEDDVYNGYFIPKGSM

VIGNVYGIHMDPARYLNPSMFDPERFYNADSGLQWNSGPDSQNRANYVFGWGRRFCIGKHLAEASVFIVL

ARLVWGVDFYAPADSHTGMPILPDVKDEASWTDGLVSAPKIFSVGFKPQSEKHAEVIRRSYVDVQAEWEA

LGQPVDVQ

//

>CYP5027B8v2 PpCYP181

scaffold 112 230123-232237 (one of these locations is wrong)

MDVLSRESALLAGIAIFTLYLLHSVRARRKGGLPPGPPGIPILGNLLQLNPLRPHPTYLKWAQKYGPIFS

IKLGMQRVIVLNTAEVADELLVTRSKLYSSRPDLHVASDLVSDGQRMVLMANNRELKIARRTLQGILSPG

PSKKMRNMQDLESRVLLRDLVVHGDSSLTETFTEGPHGEVPERHWFSVFRRYTTSIVMSLSYGQRMNRFL

DNPDLHKVYEAMSVFMHASEPGNYLADVFPILRRLPDILAPWRKEGRRMHEWEMGLWGKLLDECSSDIAK

GIARTGFVSDYLRARAEAGLGDLPGNGATDDGVGWMRDKFLAYTAASVLEAGSDSSSTVMFSFILFMLSN

PDALQRAREEMDRVIGPDRMPGWEDEDRLPWLVACIKETLRIRPPFISGLPHVAEEDDVYNGYFIPKGSM

VIGNVYGIHMDPARYLNPSMFDPERFYNADSGLQWNSGPDSQNRANYVFGWGRRFCIGKHLAEASVFIVL

ARLVWGVDFYAPADSHTGMPILPDVKDEASWTDGLVSAPKIFSVGFKPQSEKHAEVIRRSYVDVQAEWEA

LGQPVDVQ

//

>CYP5027B9v1 PpCYP175

97% to PpCYP209, 96% to PpCYP181

scaffold 112 230123-232237 (one of these locations is wrong)

MDVLSRESALLAGIAVFTLYLLHSVRARRKGGLPPGPPGIPILGNLLQLNPLRPHPTYLKWAQKYGPIFS

IKLGMQRVIVLNTAEVADELLVTRSKLYSSRPDLHVASDLVSDGQRMVLMANNRELKIARRTLQGILSPG

PSKKMRNMQDLESRVLLHDLVAHGDSSLTETFTEGPHGEVPERHWFSVFRRYTTTIVMSLSYGQRMNRFL

DNPDLHKVYEAMSVFMHASEPGNYLADVFPILRRLPDMLAPWRKEGRRMHEWEMGLWGKLLDECSSDIAK

GIARTGFVSDYLRARAEAGLGDLPGNGATEDGVGWMRDKFLAYTAASVLEAGSDSSSTVMFSFILFMLTN

PAALQRAREEMDRVIGPDRMPGWEDEDRLPWLVACIKETLRVRPPFISGLPHVAEEDDVYKGYFIHKGSM

VIGNVHGIHMDPARYPNPSVFDPERFYNADSGLQWNSGPDSQNRANYVFGWGRRFCIGKHLAEASVFIVL

ARLVWGVDFYAPADSRTGMPILPDVKDEASWTDGLVSAPKIFSVGFRPRSEKHAEVIRRSYVDVQAEWEA

LGQPVDMQ

//

>CYP5027B9v2 PpCYP209

scaffold 95 194712 - 196831

MDVLSRESALLAGIAVFTLYLLHSVRARRKGGLPPGPPGIPILGNLLQLNPLRPHPTYLKWAQKYGPIFS

IKLGMQRVIVLNTAEVADELLVTRSKLYSSRPDLHVASDLVSDGQRMVLMAKNRELKIARRTLQGILSPG

PSKMMRNMQDLESRVLLHDLVAHGDSSLTETFTEGPHGEVPERHWFSVFRRYTTSIVMSLSYGQRMNRFL

DNPDLHKVYEAMSVFMHASEPGNYLADVFPILRRLPDMLAPWRKEGRRMHEWEMGLWGKLLDECSSDIAK

GIARTGFVSDYLRARAEAGLGDLPGNGATDDGVGWMRDKFLAYTAASVLEAGSDSSSTVMFSFILFMLSN

LAALQRAREEMDRVIGPDRMPGWEDEDRLPWLVACIKETLRVRPPFISGLPHVAEEDDVYNGYLIPKGSM

VIGNVYGIHMDPARYLNPSMFDPERFYNADSGLQWNSGPDSQNRANYVFGWGRRFCIGKHLAEASVFIVL

ARLVWGVDFYAPADSRTGMPILPDVKDEASWTDGLVSAPKIFSVGFRPRSEKHAEVIRRSYVDVQAEWEA

LGQPVDMQ

//

 

CYP5035 family (4 sequences)

 

>CYP5035F1 PpCYP005 40% to CYP5035A1   Phanerochaete chrysosporium
scaffold 15 201702 - 199490

MFQPGKVSSDRDAILVCALPAVATYLWLKWYEAKSLSTLTVLLGVVPAFSTVLLSQSLSFLRAASLSFVV

HYAVVLSCACLYRLSPFHPLAPYPGPFLCKISKLWLVYMTSRGKLHLYFHELHSRYGPIVRVGPNELSTT

EVDIFPFILGPQGMPKGSLWEGRRISGKRGAGAKNAKGHLIGARDKKLHAESRRVWNRAFTTAAVKGYEP

ILIRRTAQLSEELNERCAEKPQREVEADLSQWLSYFTFDFMGDMVFGGGFELMHDGDKDGIYKTMVAGLQ

LPALTQQIPWIAPSLSYLPYIGRHMKALGDFAFKQVTHRMQEGSIQNDLFYHLLDEAPEDRKPPPFPVIM

TNAVTAMLAGSDTTAVALCNVFYCILAHPACYTLLQQEVDAAFPPGQGEPVDASKLASMEYLNAVINEAL

RLYPSIPTSLQRSPTPGSGSHAIGNRLVVSEGTGVFVSPYAVQRDSRYFAPHPDSFMPQRWLARRDDKGS

ENMPFTVNPDAFIPFSSGPANCVGRPVAILAMRMVLAYLLQHFNMRLADGYDKAQWVEELRDYFAFQKGT

LPVFLKPRT

//

>CYP5035F2 PpCYP125

58% to PpCYP005, 54% to PpCYP122, 54% to PpCYP070
39% to CYP5035C1 Phanerochaete chrysosporium 

scaffold 44 35223 - 37388

MEHGVVAAAAFGVLAHQYFKRYEPTDLVSLTVLLGAVPAIPASLLARTGDSTLTAILTAYSVYIVSLLLS

IAIYRTTPLHPLSKYPGPFLCKLSKFWLVYLTTRGKLYLYFKEAHDKYGPIVRIGPNELSIVDETLLPSI

MGPDSMPKGPLWEGRRIQGKRGGGKTRGTLIGSRNNKDHAEARRVWNRAFTTPAVKKYEPIVIRRAAQLV

EELRKRCRAAERDGKGLAEANLSEWLSYFSFDFMGDFVFGSSFELMSDGDKDGFLRTMASGLYLPALTQH

VPWCMDALIYTPFVGKEMKQLGEFAFRQVSKRIKEGSIQDDLFYHLNDEGRESPEPPSMPLLMSNAVTAI

IAGSDTTASVMSNIFFFILHHRAIYNRLQAEVDAAFPPGEGEPTDAAKLAQLEYMNAVINETLRLRPPAS

TSLQRAPTPGSGGHVIGKDMFIPEGTAVYSPLYVYHRDPRYFSPDTDAFRPERWLAGEAEPDAVLNMSAF

IPFSIGQANCVGKPIAVLEMRLVLAYMIQAFEMRLVDSYRPEQWEEELRDFFVLQKGPLPVSLKARF

//

>CYP5035F3v1 PpCYP122

98% to PpCYP070, 38% to CYP5035D1 Phanerochaete chrysosporium 

scaffold 55 293189 - 290983

MSSADSLVLASVFASTAYLWFKKLEPTDPFSLVVLLGVGPALPIAVHGLPFTSIVCSVFASYATYYISLL

LLTALYRLSPLHPLYKYPGPTAGKLSKLWLVYKSSRGRLNEYFKQVHEKYGPIVRLGPNELSIVDDTLLP

SIIGTQGMPKGPLWDGRRTNRN

MDMDFIKANLIGARDLKQHADARKSWNRAFTSSSVKTYEPILIRRTTQLIDELRTKCINGKGGRAHVDLA

LWLGYFSLDFMGDFVFSGAFELMRDGDKEGLVPLMEAGTYIAALTQHIPWCLDIISFSPTLFRLAFGKMK

GLGEFAFRQAIRRMKEVPMQSDLMYYLNEEGQMDSNPPPAPLVLWSAVIAVIAGSDGPASALSNAVYELL

CNPQCFERLRAEVDSAFHPNAGEPINTARLSRMEYLNAFINEVLRLHPPIATCLQRAPTEGSGGHMLGSS

IFIPEGVAVYAAPYVYQRDPRYFAPDPDRFWPERWLLAKDTDIVVNTNAYIPFSIGPANCVGKPLALIQL

RMVIAYFVQAFDVCFAEGYDKQCWETELRDYFITHRGSLPVILTPRPSVR

//

>CYP5035F3v2 PpCYP070 short at N-term by 162 aa (see CYP5035F3v1)

scaffold 245 54692 - 56898

MDIDFIKANLIGARDLKQHADARKSWNRAFTSSSVKTYEPILIRRTTQLIDELRTKCINGKGGRAHVDLA

LWLGYFSLDFMGDFVFSGAFELMRDGDKQGLVPLMEAGTYIAALTQHIPWCLDIISFSPTLFRLAFGKMK

GLGEFAFRQAIRRMKEVPMQSDLMYYLNEEGQMDSNPPPAPLVLWSAVIAVIAGSDGPASALSNAVYELL

CNPQCFERLRAEVDSAFPPNAGEPINTARLSRMEYLNAFINEVLRLHPPIATCLQRAPTEGSGGHMLGSS

IFIPEGVAVYAAPYVYQRDPRYFAPDPDRFWPERWLSAKDTDIVVNTNAYIPFSIGPANCVGKPLALIQL

RMVIAYFVQAFDVCFAEGYDKQCWETELRDYFITHRGSLPVILTPRPSAR

//

 

CYP5037 family (25 sequences)

 

>CYP5037B5v1 PpCYP217 54% to CYP5037B3 Phanerochaete chrysosporium

MSRLFLVLDTGAAILLVALLFVVYRGRQSARGPLPPGPRGWPLVGNVFDMPATNEWNTFMSWGEKWGDVV

SVTLFGQHIVILNSIQHAYDMFEKKSNIYSDRPAITMAGEMVGWDRTLVLLRYGTRFRETRKLFSQLIGT

RSQTERFSQHLEHEVHRFLRRILREPTSVLKEIRKTTGAVILKMAYGYEVQEGDDPLVDLVDRAVDEFSI

STRPGAFLVDTFPILRHVPAWMPGASWKKKAKVWADDLEMTCNVPYAFTQQQMSAGTAIPSFTSTHLESN

PVPEKEIVIKNAAFSLYSAGADTTVSAISTFFLAMTCYPEAQRKAQAEIDAVIGNDRLPTLADRDKLPFV

TALCCEVLRWQPVAPLGVPHCPVADDFHAGFLIPKGTIVFPNIWKFLHDPDTYANPFDFEPERFIASPGK

TAEKDPRQIVFGFGRRICPGMYLADASLFISCAVSLAVFDISKVVRDGKVIEPVIDYTSGTISHPRPFEC

SIRPRSANAEALITAMHETRER

//

>CYP5037B5v2 PpCYP208

MSRLFLVLDTGAAVLLVALLFVVYRGRQSARGPLPPGPRGWPLVGNVFDMPSTNEWNTYMSWGEKWGDIV

SVTLFGQHIVILNSVQHAYDMFEKKSNIYSDRPVITMAGEMVGWDRTLAVLRYGKRFRETRKLFSQLIGT

RNHAERFSHHLEHEVHQFLRRVLREPTSLLKEVRKTTGAVILKMAYGYEVQEGDDPLVDLVDRAVEEFSI

STRPGAFLVDTLPVLRHVPAWIPGAGWKKKAQVWADDLEMTCNVPYAFTQQQMSAGTAIPSFTSAHLESN

PDPEQEILIKNAAASLYSAGADTTVSAVSTFFLAMTCYPEAQRKAQAEIDAVIGNDRLPTLADRDKLPYV

TALCWEVLRWQPVVPLGFPHCPVKDDIHAGYLIPKGTLVSPNIWKFLHDPDTYANPFDFEPERFIASPGK

TAEKDPRQIVFGFGRRICPGMYLADASLFISCAMSLAVFDISKVVRDGKVIEPVIDYTSGTISHPRPFEC

SIKPRSANAEVLITAMHETREK

//

>CYP5037D1v1 PpCYP184 48% to CYP5037B3 Phanerochaete chrysosporium

MPPMILAVAFTAFCILLLARLAKRRSVALPPGPQGWPIIGNALDFPTSHQWKTFAQWGDRWGDIMSVSLL

GRAVVVLNSFRLASEMLEKKSSIYSDRPTFVVAGEMVGWDHIGSQIQYGPRLRETRRLLSQFMGSREKAL

KFASHIEAETHRFLSRVLYNPETLVAQIRKTAASTILMMAYGYTVQEVEDPLIQVAERAISDASQALTPA

NFFVDMFPKLRHVPQWVPGFGWKKGVAKMADTLTEMREMPFEFVKKQLANGTAAHSFTSKHLEGRLSPER

EQLIKDTASALYVGGSDTTVSTIASFFLAMMRNPEVQKRAQAEIDAIIGNDRLPTLADRNDLPYVNALCS

EVMRMCPSAPIAFPHVLSEDDIHAGYALPKGTMVIANIWKFAHDPRLYSNPWEFNPDRFIATDKKPAEQD

PHDMVFGFGRRNCPGMHFADAAVFMTCAMSLAVFDITKPVVDGVIIEPAVEMSSGIISHPLPFQCSIKPR

SAKAESLILNTNELQA

//

>CYP5037D1v2 PpCYP148

MPPMILAVAFTAFCILLLARLAKRRSVALPPGPQGWPIIGNALDFPTSHQWKTFAQWGDRWGDIMSVSLL

GRPVVVLNSFRLASEMLEKKSSIYSDRPTFVVAGEMVGWDHIGSQIQYGPRLRETRRLLSQFMGSREKAL

KFASHIEAETHRFLSRVLYKPETLVAQIRKTAASTILMMAYGYTVQEVEDPLIQVAERAISDASQALTPA

NFFVDMFPKLRHVPQWVPGFGWKKGVAKMADTLTEMREMPFEFVKKQLATGTAAQSFTSKHLEGRLSPER

EQLIKDTASALYVGGSDTTVSTVASFFLAMMRNPEVQKRAQAEIDAIVGNDRLPTLADRNDLPYVNALCS

EVMRMCPSAPIAFPHVLSEDDVHAGYVLPKGTMVIANIWKFAHDPRLYSNPWEFNPDRFIATDKKPAEQD

PHDMVFGFGRRNCPGMHFADAAVFMTCAMSLAVFDITKPVVDGVIIEPAVEMSSGIISHPLPFQCSIKPR

SAKAESLILNTNELQA

//

>CYP5037E1v1 PpCYP170 
42% to CYP5037B3 Phanerochaete chrysosporium
scaffold 163 101042 - 98924

Note: scaffold 65 seems to be syntenic with scaffold 163

MSLPWEYCAIVCILICAVGYAVAKQRAKAPLPPGPARLPILGNALNVPLEFQWLKFTEWAGIYGEIFSLS

VLGHPILVLNSANAIEELFEKRSALYADRPHIPLAGEMIGYSSIPVLERYGRRHREGRKLISNSLDHRNQ

TDIHRIQRNKVALMLSKLVNNPKDLQLHSRWFIAAVVFQLTHGQKIESVDHVFVKLAEQFNKDFSRVLRP

GRFLVDNITILQYLPSWFPGMGFKRLAKECREHFLRLCHEPYACVKDQVAKGTALPSLTARLIEENRNPT

PDEEWFYKTTVMQFYAAGVDTTVSVLDSFFLIMSLYPDIQKKAQAEMDRVVEPGRLPDFDDRANLPYLDA

VLKEIYRWNPTAPMAVPHRVTQDDVYNGFHIPAGATVIANTWAVLHDPSLYPDPFQVNPDRYSKQEGGMN

PDPRRFAFGYGRRVCPGKVLADDSIFTVVACVLATLDISKAVGPDGQPIEPDVQYTGGTISFPGPFQCTI

KPRSAESARLIQNAAMHVDHMD

//

>CYP5037E1v2 PpCYP180

98% to PpCYP170

scaffold 65 308277 – 310394

Note: scaffold 65 seems to be syntenic with scaffold 163

MSLPWGYCAIVCILICAVGYAFSRQRAKAPLPPGPARLPILGNALNVPLEFQWLKFTEWAGIYGEIFSLS

VLGHPILVLNSANAIEELFEKRSALYADRPHIPLAGEMIGYSSIPVLERYGRRHREGRKLISNSLDHRNQ

TDIHRIQRNKVALMLSKLVNNPKDLQLHSRWFIAAVVFQLTHGQKIESVDHVFVKLAEQFNKDFSRVLRP

GRFLVDNITILQYLPSWFPGMGFKRLAKECREHFLRLCHEPYACVKDQVAKGTALPSLTARLIEENRNPT

PDEEWFYKTTVMQFYAAGVDTTVSVLDSFFLIMSLNPDIQKKAQAEMDRVVEPGRLPDFDDRANLPYLDA

VLKEIYRWNPTAPMAVPHRVTQDDVYNGFHIPAGATVIANTWAVLHDPSLYPDPFQVNPDRYSKQEGGLN

PDPRRFAFGYGRRVCPGKVLADDSIFTVVACVLATLDISKAVGPDGQPIEPDVQYTGGTISFPGPFQCTI

KPRSAESARLIQNAAMHVDHMD

//

>CYP5037E2v1  PpCYP158

scaffold 163 108168 - 106044

Note: scaffold 65 seems to be syntenic with scaffold 163

MSLPWEYCATVCILICAVGYAFSRQRAKAPLPPGPARLPILGNALNVPLESQWLKFTEWARIYGEIFSLS

VLGHPILVLNSANAIEELFEKRSTLYSDRPHIPLAGEMVGFSSIPALEHYGSRHKKGRKLIINTISSHNQ

TGIHRIQLNKASLLLSRLISSPNDFRLHSRWFVAAIVFQITHGQQIENFDHVFVKLAEQVNEDFSHVTRP

GSFLVDTIPILQYLPSWIPGMGFKTLAKVYRERFLRMCHEPYASVKEQVAKGTAPPSLAARLIEKNSNPT

PEEEWFYKTTVMQFYAGGADTTVSSLETFYLIMSLYPEIQKKAQAELDRVVEPGCLPDFGDRANLPYLDA

VLKEIYRWNPTVPAAVPHRVTQDDVYNGFHIPAGATVIANTWAVLHDPLLYPDPFRVNPERYLKHEDGLN

PDPRRFAFGYGRRVCPGKVLAEDTVFTLVACVLATLDISKAVGSDGLPIEPDVQYTGGTISHPGPFQCTI

KPRSAESAHLIQSVAMHVDFMD

//

>CYP5037E2Pv2 PpCYP234

82% to PpCYP158 (syntenic location) This seq is not correct at heme and 
other cyan region, may be becoming a pseudogene

scaffold 65 300452 - 302551

MSLPWEYCAIACILICAVGYAFARQRAKAPLPPGPARLPILGNALNVPPESQWLKFTEWARIYGEIFSLS

VLGHPILVLNSAKAIEELFEKRSTLYADRPHIPLAGEMYICLPSFSVCYGSRHREGRKLILNTLSSHNQT

DLHRIQINKASLLLSRLISSPKYFRLHSRWFVAAIVFQITHGQQIDNFDHVFIKLAEQVNEDFSYVTRPG

SFLVDTIPIREHLDAPCMDFVVQSDDCFGKRFLRVCHEPYASVKEQVAKGTAPPSLAARLIENNSNPTPD

EEWFYETTVMQFYAGGADTTVSSLETFYLIMSLYPKIQKKAQAELDRVVEPGRLPDFDDRANLPYLDAVL

KEIYRWNPTAPMAVPHRVTQDDVYNGFHIPAGATVIANTWAVFHDPSLYPDPFQVNPDRYSKQEGGLNPD

PRRFAFGYGRRISGTDSRSESARGKSLQTTLSSHLSLAMCPDGQPIEPDVQYTGGTISHPGPFQCTIKPR

SAESARLIQSAAMHVDFMD

//

>CYP5037E3v1 PpCYP187

scaffold 163 123609 - 125769

Note: scaffold 65 seems to be syntenic with scaffold 163

MALPLTHACLCVILVSGFVLWLDRRLRRFPMPPGPRGFPIIGNALQMPQEREWVKFTEWAKTYGGILHLS

IFNTHFIVLNDAEVIAELLEKRSAIYSDRPFFPLACDLIGYDKFIILEPYGPRLREGRKFLLNNFNTRNM

TAFHTVQKSKVSLFLRKILEDNANLRLHVRWLVAAIVFQVSHGRNITDFNDPFVKLVETTNEDFALSVRP

FVYLVDSLPFLKYVPDWVPGTGWKSVIRERRRTLHRLRDYPYEVVKQQLAQGTAKPSITASVIESNPHPD

PEEEELQKTSTSILYSAAADTSVSAIESFFLIMTLYPEVQKKAQVELDSVVEAGRLPDYSDRDKLPYIDA

LIKEVLRWNPVLPLALPHSLMEDDTYRGYHIPKGATVLANSWAVMHDPALYPDPFEVKPERYLSDQGALN

PDPRQFAFGYGRRVCPGQLLAEDTLFLLIASVLSTMNITKPIGPDGLPIDVNVEYTSGAISHPASVQCGI

AVRSVEAEKLILNNTLSRDGEA

//

>CYP5037E3v2 PpCYP007 97% to PpCYP187 
scaffold 65 288047 - 286042

MALPLTHACLCVILVSSFVLWLDRRLRRFPMPPGPRGFPIIGNALQMPQEREWVKFTEWAKTYGGILHLS

IFNTHFIVLNDAEVIADLLEKRSAIYSDRPFFPLACDLIGYDKFIILEPYGPRLREGRKFLLNNFNTRNM

TAFHTVQKSKVSLFLRKILEDNANLRLHVRWLVAAIVFQVSHGRNITDFNDPFVKLVETTNEDFALSVRP

FVYLVDSLPFLKYVPDWVPGTGWKSVVKERRRTLDRLRDYPYEVVKQQLAQGTAQPSITASVIENNPNPD

PKEEELQKTSTSVLYSAAADTSVSAIESFFLIMTLYPEVQNKAQVELDSVVEAGRLPDYGDRDKLPYIDA

LIKEVLRWNPVLPLALPHSLMEDDTYRGYHIPKGATVLANSWAVMHDPALYPDPFEVKPERYLSDQGALN

PDPRQFAFGYGRRVCPGQLLAEDTLFLLIASVLSTMNITKPIGSDGLPIDVNVEYTSGAIRRV

//

>CYP5037E4v1 PpCYP002 97% to PpCYP031 
scaffold 163 131232 - 133392

MDPPFIYVCLCVFLVSIVALQLGRRPHRFPMPPGPRRVPIIGNALQMPREREWVKFAEWAKAYGGIVHLS

VFSTHFIVLSDAGIISELLEKRSAIYSDRPYFPLASGLIGYDKFIILEPYGPRLREGRKLILNNINTRNA

AILHPVQVSKMLLFLRKLFEDSGHLRLHVRWLVAAVIFKISHGRDIQDPDDTFVKLVETTNEDFALSVRP

FVYLVDSLPFLKYVPEWVPGTGWKSVIRERRRMLHKLRDYPYEVVKQQLAQGTAQPSVTASLIEENPDPD

PEEEELQKTSTSILYSVLTNSQSVSAIESFFLIMTLYPEVQKKAQVELDSVVEAGRLPDYSDRDKLPYID

ALIKEVLRWNPVLPLALPHSLMEDDTYRGYHIPKGATVLANSWAVMHDPALYPDPFEVKPERYLSDQGAL

NPDPRQFAFGYGRRVCPGQLLAEDTLFLLIASVLSTMNITKPIGPDGLPIDVNVEYTSGAISHPTSVQCN

VTVRSAESESLILTNASRDGEA

//

>CYP5037E4v2 PpCYP031

scaffold 65 280651 - 278491

MDPPFISVCLCVFLVSIVALQLGRRLHRFPMPPGPRRVPIIGNALQMPREREWVKFAEWAKAYGGIVHLS

VFSTHFIVLSDAGIISELLEKRSAIYSDRPYFPLASGLIGYDKFIILEPYGPRLREGRKLILNNINTRNA

\AILHPVQVSKMLLFLRKLFEDSGHLRLHVRWLVAAVIFKISHGRDIQDPDDAFVKLVETTNEDFALSVR

PFVYLVDSLPFLKYVPEWVPGTGWKSVIRERRRMLHKLRDYPYEVVKQQLAQGTAQPSVTASLIEENPNP

DPEEEELQKTSTSILYSAAADTSVSAIESFFLIMTLYPEVQNKAQAELDSVVEAGRLPDYGDRDKLPYID

ALIKEVLRWNPVLPLALPHSLMEDDTYRGYHIPKGATVLANSWAVMHDPALYPDPFEVKPERYLSDQGAL

NPDPRQFAFGYGRRVCPGQLLAEDTLFLLIASVLSTMNITKPIGSDGLPIDVNVEYTSGAISHPTSVQCN

VTVRSAESERLILTNASRDGEA

//

>CYP5037E5v1 PpCYP241

scaffold 163 133989 – 136108 (location same as PpCYP078)

Note: scaffold 65 seems to be syntenic with scaffold 163

MIQTPVYTALCCLLVLVAARLLGKRSSHLPMPPGPRGLPVLGNALQMPREREWITFAKWAKTYGDIMHLS

VFGRHVIVLSSPDVILDLLEKRSTIYSDRPFFTMASEFIGFDKFVVMEPYGNRLREGRKLIQGNINARSA

SRLQQVQTSKVSQLLPKILRDNSNLRMHLRWYVAAVIFQVSHGRTIENFDDPFVRLAEASTEDFALSVRP

GAYLVDNFPFLKYVPNWVPGTGWKAVAKQRKHTLARLRDEPFEYVKQQLAQGTAPPSVTASVIESNPKPN

PDDAELQRTSTAILYASAADTTVSALESFFLIMGLYPEVQKKAQAELDTVVEAGKLPDYNDRPNLPYVNA

LIKEILRWNPVLPLALPHSLMQDDEYRGYHIPKGSTIFANSWAVMHDPSLYPDPFEVRPERYLSPNAALN

PDPRTFAFGYGRRACPGQILAEDSLFIIVVRVLSTMTIERALGTDNLPVEYTSGAISHPTTMDCRVTARS

TDAEKLILGVE

//

>CYP5037E5v1 PpCYP078

100% to PpCYP241 97% to PpCYP233
scaffold 163 133989 - 136108

Note: scaffold 65 seems to be syntenic with scaffold 163

MIQTPVYTALCCLLVLVAARLLGKRSSHLPMPPGPRGLPVLGNALQMPREREWITFAKWAKTYGDIMHLS

VFGRHVIVLSSPDVILDLLEKRSTIYSDRPFFTMASEFIGFDKFVVMEPYGNRLREGRKLIQGNINARSA

SRLQQVQTSKVSQLLPKILRDNSNLRMHLRWYVAAVIFQVSHGRTIENFDDPFVRLAEASTEDFALSVRP

GAYLVDNFPFLKYVPNWVPGTGWKAVAKQRKHTLARLRDEPFEYVKQQLAQGTAPPSVTASVIESNPKPN

PDDAELQRTSTAILYASAADTTVSALESFFLIMGLYPEVQKKAQAELDTVVEAGKLPDYNDRPNLPYVNA

LIKEILRWNPVLPLALPHSLMQDDEYRGYHIPKGSTIFANSWAVMHDPSLYPDPFEVRPERYLSPNAALN

PDPRTFAFGYGRRACPGQILAEDSLFIIVVRVLSTMTIERALGTDNLPVEYTSGAISHPTTMDCRVTARS

TDAEKLILGVE

//

>CYP5037E5v2 PpCYP233

scaffold 65 277893 - 275775

MIQTPVYTALCCLLVLVAARLLGKRSSHLPMPPGPRGLPVLGNALQMPREREWITFAKWAKTYGDIMHLS

VFGRHIIVLSSPDVILDLLEKRSTIYSDRPFFTMASEFIGFDKFVVMEPYGNRLREGRKLIQGNINARSA

SRLQQVQISKVSQLLPRILRDNSNLRMHIRWYVAAVIFQVSHGRTIDNFDDPFVRLAEASTEDFARSVRP

GAYLVDNFPFLKYVPDWVPGTGWKAVAKQRKHTLARLRDEPFEYVKQQLAQGTAPPSVTASVIESNPKPN

ADDAELQRTSTAILYASAADTTVSALESFFLIMGLYPEVQKKAQAELDTVVEAGKLPDYNDRPNLPYVNA

LIKEILRWNPVLPLALPHSLMQDDEYRGYHIPKGSTIFANSWAVMHDPSLYPDPFEVRPERYLSPSAALN

PDPRTFAFGYGRRACPGQILAEDSLFIIVVRVLSTMTIERALGTNNLPVEYTSGAISHPTTMDCKVTARS

TDAEKLILGVE

//

>CYP5037E6P PpCYP037 pseudogene
scaffold 163 176431 - 179965

Note: scaffold 65 seems to be syntenic with scaffold 163

yellow not P450 87% to PpCYP158 

MESVVVVLDAVGAIDLSRGRVPSSYPSVVQGTPLLGQRRSLPMWNRPGLPLPTSRSDFCFIAELGAVGGD

EVGEDALDEVSEVLCLSAEGFGSGDVEVKGLGLQPVRWLVRVELVVVRCLGSRWGRTELQGVQVVDGEYV

FWVSRWVSLVVANEFLMGDDLWVWTSCTTPGAASRVDGSPFCGGDKAAVCSVVL

40% to CYP5037B3 Phanerochaete chrysosporium

 

IVQYLPSWIPGMGFKTLAKVYRE*FLR &

YASVKEQV

AKGTAPPSLAARLIEKNSNPTPDEEWFYKTTVMQFY

GGADT (0)

TVSSLETFYLIMSLYPKIQKKAQAELDRVVEPGCLPDFNDRANLPYLSAVLH

IKEIYRWNPTVP

SVVIPHRVTQDDVYNGFHIPAGATAIANAW

AVLHDPSLYPDPFRVNPERYLKHEGRWNPDPRRFAFSYGR

RVCPGKVIAEDSIFIFVACALATLDISKAVGPDGLPIESDVQYTADAVR*

 

SHPGPFQCTIKLRLAESARLIQSAAMHVDYMD

//

>CYP5037E7 PpCYP082

scaffold 163 184692 - 182560

MTQTPVYTALCCLLVLVAARLLGKRSSRLPMPPGPRGLPLLGNVLQMPREQEWTTFAKWAKTYGDIMRLS

VFGRHIIVLSSPDVIFDLLEKRSTIYSDRPFFTMASEFIGFDKFVVMEPYGNRLREGRKLIQGNINARSA

SRLQQVQTSKVSQLLPKILRDNSNLRMHIRWYVAAVIFQVSHGRTIEDFEDPFVRLAETIAEDFALSVRP

GAYLVDNFPFLKYVPDWVPGTGWKAVAKQRKHTLNRLRDEPFEYVKQQLAQGTAPPSVTASVIESNPKPN

ADDAELQRTSTAILYASAADTTVSALESFFLIMGLYPEVQKKAQAELDTVVEAGKLPDYNDRPNLPYVNA

LIKEILRWNPVLPLALPHSLMQDDEYGGYHIPKGSTIFANSWAVMHDPSLYPDPFEVRPERYLSPNPAIN

PDPRTFAFGYGRRACPGKMLAEDSLFIIVVRVLSTMTIERAQGADGLPVNRPVEYTSGAISHPTTMDCRV

ISRSADAEKLIIGV

//

>CYP5037E8v1 PpCYP112

scaffold 45 254373 - 256521

MTDAEGFSGLAYVSGICFLLLASLTWLRQQSHRLPYPPGPSGLPVLGNTLQMPHERQWLQYVEWGRKYGK

IIHLSMLGHSMIILNSADVIVELLEKRSKLYSDRPTIPLAGEMIGYDQYIALEHYGSRQTEGRKLITGAL

SVRNMPKLHQIEESKVVHLMSRLIARPVEFRLHLRWFVAAVAFEYTHAYQVEDCDDYFVRLAERVNNDFN

TVVKPGKYLVDIFPFLKHIPDWMPGTKFKAVAKEARERVQRLADETFEIVQTRVADGTARASFTADLIES

NPERTPEEEDIFKTTSMTFYAAGTDTTVSTLESFFLIMTLHPEIQRKAQAEVDHVIGLDRLPKVSDRPRL

PYVEGLIKEAFRWNPVFPLALPHYLNQDDVYEGYHIPANSTVIANSWAILHDSSLYPQPFEVLPERYLQQ

EHGLNPDPKSFAFGYGRRVCPGQPLADDLVFIVAITILATLNISQPIGADGLPVKPDVSYTGVALSHPGP

FECAIAARSVEAEHQIIHAASC

//

>CYP5037E8v2 PpCYP247

96% to PpCYP112

MTDAEGFSGLAYVSGICFLLLASLTWLRQQRHRLPYPPGPSGLPVLGNTLQMPHERQWLQYVEWGKKYGK

IIHLSVLGRSMIILNSADVIVELLEKRSKLYSDRPTIPLAGEMIGYDQYIALEHYGSRQTEGRKLITGAL

SVRNMPKLHQIEESKVVHLMSRLIARPVEFRLHLRWFVAAVAFEYTHAYQVEDCDDYFVRLAERVNNDFN

TVVKPGKYLVDIFPFLKHIPGWMPGTKFKAVAKEARERVQRLADETFEVVQTRVADGTARASFTADLIEG

NPERTPEEEDIFKTTSMTFYAAGTDTTVSTLESFFLMMTLHPEIQRNAQAEVDHVIGSDRLPKVSDRPRL

PYVEGLIKEAFRWNPVFPLALPHYLNQDDVYEGYHIPANSTVIANSWAVLHDPSLYPQPFEVLPERYLQQ

EHGLNPDPKSFAFGYGRRVCPGQPLADDLVFIVAVTILATLNISQPIGADGLLVKPNVSCTGVALSHPGP

FECAIAARSVEAEHQITHAASC

//

>CYP5037E9v1 PpCYP004

scaffold 45 264755 - 266901

MTFAGIIYAICVCILIFTTASWLRKQRACWSYPPGPPGLPIVGNTFQVPLTEQWLKYAEWAKTYGDVMHL

SVLGRSIIVLSSASAISGLLDKRSIHYSDRPVIPMAGEMVGFSRYIALERYGGRLKEGRKLITNSLSTRN

MPEVQRMQEMKVIHLVSRLMRSPADFRLNLRWFMASVVFQYSHGYEVKTFEDYYVKLAEQVAKDFSRAVQ

PGKYLVDSLPFLIHVPGWMPGAGFKAAARAMAERLQRLANESYHHVQKQVARGTAPPSFTANLIENNLHP

TPDEEDMYKTTTMVFYVAGADTTTSVLEALFLLLTLYPDIQQKAQAEVDRVVGFDRLPNFSDRPRLPYVE

GLIKEVYRFNQVFPLALPHCATQDGVYAGYHIPAKSILIANSWAVVHDPTLYPQPFDILPERYLKQEDGL

NPDPRSFTFGYGRRVCPGQPLADDSAFIVTATVLATLNICQTIGLDGLPIKPKATFGGGAVCHPGPFECT

ILPRSIDAERLVIHAASALVG

//

>CYP5037E9v2 PpCYP182

92% to PpCYP004

scaffold 53 69651 - 67508

MGFTGIIYAICVCILIFTAASWLRKQRARWPYPPGPSGLPIVGNTFQVPLTEQWLKYAEWAKTYGDVMHL

SVLGRSIIVLSSASAISDLLDKRSVHYSDRPVVPMAGEMVGFSRYIALEHYGGRLKEGRKLITNSLSTRN

MPEVQRMQEMKVIHLVSRLMSSPADFRLNLRWFMASVVFQYSHGYEVETFEDYYVKLAEQVAEDFSRAVQ

PGKFLVDSLPFLMHVPDWMPGTGFKATAGAMAERLQRLADESYHHVQTQVARGTAPPSFTANLIENNPHP

TPDEEDMYKTTAMVFYVAGADTTTSVLEALFLAMTLYPDIQQKAQAEVDRVVGFDRLPNFSDRLQLPYVE

GLIKEIYRLNQVFPLALPHCATQDGVYAGYHIPEKSIVIANSWAVVHDPALYPQPFDILPERYLKQEDGL

NPDPRCFTFGYGRRVCPGQRLADDSVFIVTATVLATLDICQTLGPDGLPIKPKATFGGGAVCHPGPFECT

ITPRSIDAERLVIHAASALVG

//

>CYP5037E10 PpCYP127 
44% to CYP5037B3 Phanerochaete chrysosporium 
scaffold 26 171759 - 169608

MALPLTYACLCVFLVSSFVLWLDRRLRRFPMPPGPRGFPIIGNALQMPQEREWVKFTEWAKTYGGIIHLS

VFNRHFIVLNDAEAIAELLEKRSAIYSGRPFSPLASELIGYDKFIILEPYGPRLREGRKLLLNSFSTRNM

ASFHTVHKSKVSLFLRKLLEDDVNFRLHVRWLVAAIIFQISHGRNITHFNDPFVKLVETTNEDFALSVRP

FVYLVDSLPFLKYVPDWVPGTGWKSVVKERRRTLDRLRDYPYEVVKQQLPSITASVIESNPNPGPEEEEL

QKTSTSVLYSAAADTSVSAIDSFFLIMALYPEVQKKAQAELDTVVEAGRLPDYSDRDKLPYIDALIKEVL

RWNPVAPLALPHSLMEDDTYRGYHIPKDATVLANSWAVMHDPVLYPDPFEVKPERYLSDQGAPNPDPRQF

AFGYGRRVCPGQLLAEDTLFLLIASVLSTMNITKAIGPDGLPVKVDVEYTSGAISHPISVQCSITVRSAE

SERFILANASRDGEA

//

>CYP5037E11v1 PpCYP134

scaffold 26 468244 - 470423

MSHIDVYTGLYGLLASILVYWLGMRWNRSRRSFPPGPRGLPLIGNALHMPADREWVQFAEWAKTYGSIVH

LSVFGRSIVLLSSPEVITDLLEKRGAIYSDRPILHFAGEMVGYNRFILLEPYSTRLREERKIILSNINPR

RGAEIHQVQEAKVIQLLDKLLDTPDCFRDHLRWFVAAVVFQISHGHEVKDFEDRFVRLAEETTHDFSLAA

QPGQHLVDSLPLLKRIPDWAPGTHFKDVARAGRLLLRRLRDEPYDHVKRQIARGTASPSITASVIESNPN

PTPEEEDLQKSATCMLYATGADTTVSALGSFFLIMTLYPEVQRKAQAELDSVVEHGRLPTFDDRSKLPYL

ECVMKEIIRWNPVSPLALPHSLTQDDVYEGYHIPAGSTVIPNTWAILHDPSLYPHPFEVIPERYIDADDK

LNPDPRTFAFGYGRRVCPGQFLADHSLFIVVATVLSTMNIGRAKRDDGTPIDIHVEYSGGAISHPNEFQC

CITPRSQEVGRIVRHAAGSNLAETA

//

>CYP5037E11v2 PpCYP100

98% to PpCYP134

scaffold 48 447673 - 449851

MSHIDVYTGLYGLLASILVYWLGKRWNRSRRSFPPGPRGLPLIGNALHMPADREWVQFAEWAKTYGAIVH

LSVFGRSIVLLSSPEVITDLLEKRGAIYSDRPILHFAGEMVGYNRFILLEPYSTRLREERKIILSNINPR

RGAEIHQVQEAKVIQLLDKLLDTPDCFRDHLRWFVAAVVFQISHGHEVKDFEDRFVRLAEETTHDFSLAA

QPGQHLVDSLPLLKRIPDWVPGTHFKDVARAGRLLLRRLRDEPYDHVKRQIARGTGSPSVTASVIESNPN

STPEEEDLQKSATCMLYATGADTTVSALGSFFLIMTLYPEVQRKAQAELDSVVEHGRLPTFDDRPKLPYL

ECVMKEIIRWNPVSPLTLPHSLTQDDVYEGYHIPAGSTVIPNTWAILHDPSLYPHPFEVIPERYIDADDK

LNPDPRTFAFGYGRRVCPGQFLADHSLFIVVATVLSTMNIGRAKRDDGTPIDIHVEYSGGAISHPNEFQC

CITPRSQEVGRIVRHAAGSNLAETA

//

>CYP5037E12 PpCYP168

scaffold 206 81781 - 83908

MSLPWAYCTAVCILICAAGYTFAKQRAKAPLPPGPARLPILGNALNVPFEFQWLKFTEWAGIYGEIFSLS

VLGHSILVLNSVNAIEELFEKRSALYADRPHIPLAGEMVGFSSIPVLERYGRRHREGRKLILNSLDHHNQ

TDIHRIQRNKAALMLSKLVSNPKDRRSHSRWFIAAVVFQLTHGQQIEHVDHIFVKLAERFNKDFSHMVRP

GRFLVDNIPILQYLPSWLPGMGFKSLAKECREQFLRLCNEPYAYVKDQVANGTALPSLAARLIEENTNPT

PEEEWFYKTTVMQFYAAGADTTVSSIESFVLIMSLYPEIQQKAQAELDCVVGPGRLPDFSDGAYLPYLDA

VLKEVYRWNPVLPISVPHRVMQDDVYNGFHIPIGATVIANSWAVLHDPLLYPDPFQVIPERYLNQEGGLN

PDPQKFAFGYGRRVCPGRVLAEDSIFIFVACVLATLDISKAVGPDGLPIESGVQYTGGTVSHPGPFQCTI

KPRSAESVCLIQSAAMHVDYMN

//

 

CYP5137 family (7 sequences)

 

>CYP5137A3 PpCYP043

52% to CYP5137A1 Phanerochaete chrysosporium

scaffold 7 734227 - 731986

MDALSSGILLLTLACIYAMIRRLRKPSVSNIPGPQPESFLMGNLSELHQGQAAVADFEWQTVYGGIARIK

APFGEDMLWISDPKALQYIYQTSGYNFPKQPERRAVSRLVGDHGLTWADGDTHKRQRKVMFPAFGGPESR

ALLPIFEHHAEQVAIRWKEILETAPEHSAILNVIQHISPATLDAIGEAAFDYKLGCLDNSDNELAKAYLN

LVADIFARPSKSKILFTSIAHYLPMRLAEFLYDHLPGKGLQKARFNRDVAHSVAEGLLQSKSQALMLGKG

SRDVMSMLVKANASENDLSRLTHDEMIAQMRTIMMAGQETTTNTLSFALVELARYPHYQSRLRAEIRAAK

RTVRERGDVSLSVQDMESMPFLQAVVREVLRFHPVVPHTYRQAGKDDVLPLSKPLTLRSGEVVTEVAIPA

GIRLVLSVAGYNRDKGIWGEDAHTFNPERFLHRSGKRGPTVGVFGNILTFSGGVRACIGWRFALYELQAF

IVQLISNFEFALTDDIKRLRRDNAVIMVPTLEGENGVQAPLRVSLASDAGC

//

>CYP5137A4v1 PpCYP049

97% to PpCYP095, 61% to PpCYP126, 49% to PpCYP095

scaffold 9 436554 - 438808

MSTLSSAALLLTLACIYVAIRRLRRTSVSGIPGPQPESFLMGNLGELHQGQAGEADFKWQSVYGGIARIK

APFGEDMLWISDPKALQYIFQTSGYNFPKQPERRALSRLLGDHGLTWADGTTHKRQRKVMLPAFGGPESR

ALLPIFEHYAEQVTLRWKEMLETAPGRSAVLNVIKYIAPATLDAIGEAAFDYKLGCLENSEDELAKAYQN

LLADVFARPSKAKIFFTSIAHYIPMPLAEFMYDHLPGQGLEKARFNRDVAHSVAEGLLKSKSHDLMLGKG

NRDVMSILVKANASENDRARLTHDEMISQMRTIMLAGQETTSNTLSFALMELARYPQYQTRLRAEIRAAE

QTVRERGDVSLSVQDMEAMPFLQAVVREVLRFHPVVPHNYRQAGQDDVLPLSKPLTLRSGEVVTEVAIPA

GMRLVLSIAGYNRDKDIWGSDAHVFNPERFLEHSGKRGPTVGVFGNVLTFSGGIRACIGWRFALYELQAF

IVQLISNFEFALTDDIKRLRRENALVMVPTLEGEAEKGVQVPLRVSLAGDLDY

//

>CYP5137A4v2 PpCYP095 
53% to CYP5137A1 Phanerochaete chrysosporium
scaffold 129 30015 - 27773

MGTLSSAALLLTIACIYVAIRRLRRTSVSGIPGPQPESFLMGNLGELHQGQAGEADFKWQSVYGGITRIK

APFGEDMLWISDPKALQYIFQTSGYNFPKQPERRALSRLLGDHGLTWADGMTHKRQRKVMLPAFGGPESR

ALLPIFEHYAEQVTLRWKEMVETAPGRSAVLNVIKYIAPATLDAIGEAAFDYKLGCLENSDDELAKAYQN

LLADVFARPSKAKIFFTSIAHYIPMPLAEFMYDHLPGQGLEKARFNRDVAHSVAEGLLKSKSHDLMLGKG

NRDVMSILVKANASENDRARLTHDEMISQMRTIMLAGQETTSNTLSFALMELARYPKYQSRLRAEIRVAE

QTVRGRGDVSLSVQDMEAMPFLQAVVREVLRFHPVVPHNYRQAGQDDVLPLSKPLTLRSGEVVTEVAIPA

GMRLVLSIAGYNRDKDIWGGDAHAFNPERFLDHSGKRGPTVGVFGNVLTFSGGIRACIGWRFALYELQAF

IVQLISNFEFALTDDIKRLRRENALVMVPTLEGEAEKGVQVPLRVSLAGDLDD

//

 

>CYP5137B1 PpCYP092

90% to PpCYP249

scaffold 34 121970 - 119790

MTVPLALLILVSTIVLRVLYKLWSRISVADIPGPEPESFWIGNLQQIRRQEVGTMDAQWGEAYGKIARVK

VALGMDALWVSDPQALHYILQKSGYTFEKTPERTVLSKLLGDDGLDGADAETHKRQRKLMDPAFGAPVIK

ALFPTFVQYAEILSTKWSKLVESSPGAPCVINVASHLNVATVDAVCETSFDYHTGCLENADNELAKSYMN

LMAVVACRPSDARLVLDNLAEFLTEPVATWLCRVLPGEAFAKLRRNRQAAHKVAEEFIETKVGKDISGTG

KRDVMSIFAQSSTSPDPSTHMSRYEVISQMRSIMFAGSETTTSTMSFALLELARHPKYQDRLRAEIRVVE

KSIRARGLTAADADAMPFLQAFLKEVVRVHPAVPYMYRRPVRDEVLPLSTPITTRSGKVISEVPVRKTLR

LILSVPGYNMDKDVWGEDAHEFNPERFLRPTEKNGPNVGLWANTLTFSAGARGCIGWKFALYEMQAFLF

VLVSRFQFSLTKDISRLRREYAGSLVPTLEGEVEKGAQLPLGVSLAEQHQD

//

>CYP5137B2 PpCYP077

93% to PpCYP249

scaffold 133 101999 - 105271

MTVPLALIILVSTIVLRVLYKRWSRISVADIPGPESVSFWIGNLQQMRQQEVGTMDAKWGEEYRKIARVK

VALGMDALWVSNPQALHYILHKSGYTFEKTAERKVLSKLLGDDGLDGANPETHKRQRKLMDPAFGAPVIK

ALFPTFVQYAEILSFKWCKLVESSPGPACAINVASHLNVATVDTVCEASFDYYTGCLEDADNEPAKSYMN

LMAGVASRPSDARLVFDNLAEFLTEPVVTWLCRVLPGEAFAKLRRNKQEVHKVAEEIIETKVGKVLSGQE

KRLTPDMAAQASTSPEPSTRMSRYEVISQMRSIMFAGSETTTSTMSCALLELARHPEYQDRLRAEIRVVE

NSIRARGGGGLIAADADAMPYLQAFLKEVVRVHPAVPYMYRRPVRDEVLPLSTPITTRSGKVISEVPIRK

TLRLILSVPGYNMDKDVWGEDAHEFNPERFLRPTEKNGPNVGLWANTLTLSAGARSCIGWKFALYEMQAF

LFVLVSRFQFALTEDISRLRREYAGSLVPMLEGEVEKGAQLPLGVSLAEQQQD

//

>CYP5137B3 PpCYP249

MTAPLTLLILVSTIVLRVLYKRWSRISVADIPGPESESFWIGNLQQMRQQEVGTMDAKWGEAYGKIARVK

VALGMDALWVSDPQALHYILQKSGYTFEKTAERKVLSKLLGDDGLDGPNPETHKRQRKLMDPAFGAPVIK

ALFPTFVQYAEILSFTWCKLVESSPGPACAINVASHLNVATIDTVCEASFDYYTGCLENADNELAKSYMN

LAVVASRPSDARLVFDNLAEVLTEPVVTWLCRVFPGEAFAKLRRNKQEVHKVAENLIETKVGKVFSGTRK

RDVMSMFAQASTSLDPSTRMSRYEVISQMRSIMFAGSETTTSTMSCALLELARHPEYQDRLRAEIRVVEK

SIRARGGGGLTAAHADAMPYLQAFLKEVVRVHPAVPYMYRRPVRDEVLPLSTPITTRSGKVISEVPIRKT

LRLILSVPGYNMDKDVWGEYAHEFNPERFLRPTEKNGPNVGLWANTLTFSAGARSCIGWKFALYEMQAFL

FVLVSRFQFSLTEDISRLRREYAGSLVPMLEGEVEKGAQLPLGVSLAEQQQD

//

>CYP5137B4 PpCYP126

scaffold 46 171484 - 173697

MEDYLALPVLIATILLYTLYKRLTRISIADIPGPERHSFWTGNWQQLRREEVGTMDNEWRDAFGGIARIW

HALGRDALWVSDPQAINYILGKSGYAFEKTPERRVTALLLGDEGIDGADGATHRRQRRVMEPAFSVPVVK

AFFPTFMQYAESLCLQWADLIDGSPGGSSAVNIADDVNCAMVDTVCDAAFDYHTGCLQNAHNQLAKSYMN

LMSAFGSRPSSARIVFDYFTEYLTPRFVAALYRNLPIRGFAKLRHNRAVAYTVAGELLEQRLMGDLPGTA

QLGLMDVFARATVSPDANSRMSRSEVTSQMRIIMFAGSETMTNTLTFALLELARHPEYQHRLRAEIRAAE

KDVRARGAEGIALADVEAMPFLQAFIKEVIRFHPVAPYLYRRPMENDVLPLSTPITTRSGKVIREVPIPK

GLRLVLSIPRFNSDPTIWGEDAHVFNPERHLKSERNGPTGFGLYANTMTFGAGVRGCIGWRFALYELQAF

LVSLVSHFDFSPTEDIARLRREHAGSMVAMLDGETEKGAQLPLRVSLAARD

//

 

CYP5138 family (1 sequence)

 

>CYP5138A2 PpCYP173 Cyan is too long, may be an Intron

54% to CYP5138A1 Phanerochaete chrysosporium 

MVTILAVCCALLAAVVGYVLSTFLALFLRQARSPLRNLNGPASPSFFMGNLREMHDMENNNLVARWENQF

GSTFVYRGFVGGHRLMTTDPAAVSHIMGRAYAYPKPEFVRDSLASMASSREGLLTVEGEVHRRQRKILVS

VYISVPARTKCDGRNRQIHTFNAPHSENTQAMQGVRIDILPWLNRATLDVIGEAGFGYRFNSLSATAGSS

EGETELAHAFSVIFSAARQFRIISVLQAWFPVLRKIVRGSSYDLVEKSHASIRAIGLSLIRERQSAVVST

EFATPTGIGSAASAEPQKAFEGRDLLSVLIRSNLSAEPSQRLSLSETLCQIATFITAGHETTSTALTWTL

YALARAPDIQSKLREQLKAISVDSSDPSKPPAPEHLDVILSCTYLDYVVREALRLHAPVTSTMRVASADD

VIPVSKPFYDRHGSVRTSIHVKKGDIITIPIQAMNKNTEVWGDDAAEFRPERWARQKSAGPPGLWANMLT

FGNGNSTYGTRACIGFRFAINEIKIFLFVLVRDIEFLMDESIEIEKKVNVVARPWVKSEPDMGNQMPLYL

RRVPP

//

 

CYP5139 family (11 sequences)

 

>CYP5139D1 PpCYP117 48% to CYP5139A1 Phanerochaete chrysosporium
scaffold 20 105228 - 107587

MTVPTLTTGNILLSFGVAALAVVSWKLVSILINIVLSPLRNIPGPPNSSWVYGNMKEIFKEEHTVMHEAW

VATYGNTIKYKEWFSRNKLCTVDTRALNYILSHSNKYQKSSVARFILGEVLGDGLFVVEGEQHRKQRRIM

NPGFGPSQIRELNEIFVEKAQKLCQVWRNEISKSGESARINVLNGLNKMTLDVIGLAGFNYDFDALNIDG

KPNELNQAFSVMFRSLESFSMFSLLKAFIPALRLIPDSRSQRIANARKVMRRMGMKLITKKKSEILRLAA

DGEKEKGNLQSRDVLTLLIKANMATDLPESHRLSDEDVLAQVPTFLVAGHETSSNATAWCLYALTQAPEV

QQKLREELWNIPTENPTMDELNELPYLDAVVRETMRVHAPIPSTVRVAMTDDAIPLDTPFVDVHGQVQDS

IRVRKGDPIFIPILAMNRSKALWGEDAFEFKPERWESVPDAVQQIPGVWANQLSFLGGPRACIGYRFSVT

EMKALIFALVRSFEFELAVPPEEVIKKSTPVQHPLVRSEMSKGGQLPLLIKPYHRI

//

>CYP5139D2 PpCYP128

scaffold 24 445275 - 447659

MLSLTAHDIPWAAGATLLAWAAYKIGRILLLPYTSPLRGLPGPPASSWLFGNVNELMGTEDFALYSEWLE

KYGPTMKLNSWFKIPKLFTIDTRAMNYVLSHSQEYPKPERSRHNLVQILGNGLVVAEGELHRRERRIMNP

AFGPAQIRELTEIFVEKSQQLRDIWWNDVAIRGGSARIDIQSGLTKMTLDVIGLAGFNYEFNALNPDGKP

NELNAAFEVMFEYLSNLRKSYWLIIRSRFPILRCIPDGYSRRTAAAHKVTRRIGLQLIAEKKAALKQMAQ

SGEKTAGTALKSRDLLTLLIKANTSPDIPEDQRLSDEDVLAQVPTFLVAGHETTSNATTWCLYALAQRL

DVQRKLREELREVPVDNPSMDQLNALPYLDAVIRETMRLYPPVVAGIRIASKDDEIPLAVPYMDAHGRMH

DTVRIDKGTTFPIPILGVNMSKALWGEDAREFKPERWESVPEAVQPIPGVWSNLMTFIGGPRACIGYRFS

LVEMKALIFTLVRAFEFEMAVPIEDITRKIGLVQRPFVRSEMEKGTQMPLIVKQHVRL

//

>CYP5139D3v1 PpCYP169

56% to CYP5139A1 Phanerochaete chrysosporium 
98% to PpCYP205, 84% to PpCYP117, 71% to PpCYP197, 56% to PpCYP216
scaffold 24 524769 - 527104

MTVTAVNVLLSLGVAALAVAVWKAVVMVIQIATSPLRNIPGPPNSNWVYGNLKEIFAAENSVLHEGWVAK

YGNTIKYKGWLSRNRLFTVDTRALNYILSHSNEYQKPALARYNLGEVLGEGLLIVEGEQHRQQRRIMNPA

FGPAQIRELTEIFVEKAQKLCLFWRNEISKSGEPARIDVLNGLSKMTLDVIGLAGFNYEFDSLNIDGKPN

ELNQAFSVMFRSLEGFAIVFPLLKALIPPLRLIPDGRSRRIAKARKVMRRMGMELITKKKAEILRAAAGE

KEKDNLQSRDLLTLLIKANLATDLPESHRLSDEDVLAQVPTFLVAGHETTSNATAWCLYALTQAPEVQQK

LRDELWSIPTENPSMDELNELPYLEAVVRETMRVHAPVPSTIRVAMTDDVIPLDTPFVDVHGQVQDSIRV

KKGDPIFIPILVINRSKALWGEDAFEFKPERWESVPDAVQHIPGVWANQMSFLGGPRACIGYRFSLIEMK

ALIFALVRAFEFELAVPPEEIIKKSTAVQRPLVRSEMVKGCQLPLLIKPYHTV

//

 

>CYP5139D3v2 PpCYP205

scaffold 90 245428 - 243096

MTVTAVNVLISLGVAALAVAVWKAIVMVIQIATSPLRNIPGPPNSNWVYGNLKEIFATENSVLHEGWVAK

YGNTIKYKGWLSRNRLFTVDTRALNYILSHSNEYQKPALARYNLGEVLGEGLLIVEGEQHRQQRRIMNPA

FGPAQIRELTEIFVEKAQKLCLFWRNEISKSGEPARIDVLNGLSKMTLDVIGLAGFNYEFDSLNIDGKPN

ELNQAFSVMFRSLEGFAIVFPLLKALIPPLRLIPDGRSRRIAKARKVMRRMGMELITKKKAEILRAAAGE

KEKDNLQSRDLLTLLIKANLATDLPESHRLSDEDVLAQVPTFLVAGHETTSNATAWCLYALTQAPEVQQK

LREELWSIPTENPSMDELNELPYLEAVVRETMRVHAPVPSTIRVAMTDDVIPLDTPFVDVHGQVQDSIRV

KKGDPIFIPILVINRSKALWGEDAFEFKPERWESVPDAVQHIPGVWANQMSFLGGPRACIGYRFSLIEMK

ALIFALVRAFEFELAVPPEEIMKKSTAVQRPLVRSEMDKGCQLPLLIKPYHTV

//

>CYP5139D4 PpCYP179

scaffold 90 200717 - 198111

MSSRIVMPGERLRLRVAMLEYVDLDRTRYTLGSERRYPRLGWLEDGRILLLPYTSSLRNLPGPPASNWLF

GSINDLRASENFMLHDAWLEKYGPTLKFNIWFKIPRLLTIDTRAINYILSHSQDYPKPERTRHDLTEILG

NGLVVAEGELHHREVSHSINDVVSSADGQSHSAAQDYGKTHNPAFGPAQIRELTDIFVEKAQQLRDMWRK

EVAEGTARIDVQGGLTKMTLDVIGLAGKSASSVRFRSPCFNYEFSALNPDGKPNELDTAFEVMFSYLSEF

ERSYWPLLRSMFPILRRIPDGYTRRTAAAQKVTRRIGMQLIAEKKEAVRKAAQSSDKGVESALQSRDLLT

LLIKANMSSDVPEDQRLSDDDVLAQVPTFLVAGHETTSNATTWCLYALSHQPDVQHKLREELWGIRTDNP

SMDELNALPYLDAVIRETMRLYPPVVGTFRIASKDDIIPLATPYTDSAGRVHDSVSIKKGTSFSIPIVLM

NRSKALWGDDALVFRPERWESLSEAVQQIPGVWGNMMTFLGGPRACIGYRFSLVESVFRTYIELLAHLTR

VFCRMKALIFTLVRSLEFEQAVPTQEIMKKIGLVQRPFVRSEMDKGTQMPLIVKPYVRD

//

>CYP5139D5v1 PpCYP215

scaffold 78 254771 - 257139

MLTLAVHDILWAVGAALLACAAFKIIRVLLLPYTSSLRDLPGPPASSWLLGNVSELMAAEDFALHFEWLE

KYGPTMKYNVWFKLPELLTIDARAINHVLSHSQDYPKPEETRVSLVEILGNGLVVAEGELHRRQRRIMNP

AFGPAQIRELTEIFVDKAQQLRDIWRNEVTTCGGTVRIDVQSGLTKMTLDAIGLAGFNYNFNALNPDGKA

NELNRAFEMMFQRMADLERSYWLIIRSLIPILRYIPDGYTRDTAAAQKVTRRIGMQLIAEKKAAVRQAAQ

SGEKNAGSELRSRDLLTLLIKANMSPDIPEDQRLSDDDVLAQVPTFLVAGHETTSNATTWCLYALSQQPN

VQHKLREELWGVPTDSPSMEELNALPYLDAVIRETMRLFPPIAGTVRIATKDDEIPLATPYMDAKGRMHD

SIRIDKGTAFPIPIIGMNRSKALWGEDAREFRPERWGSIPEAAQQIPGVWSNLMTFIGGPRACIGYRFSL

IEMKALVFTLVRAFEFELAVPVEDITKKIGLVQRPFVRSEMEKGTQMPLIIKSHTRE

//

>CYP5139D5v2 PpCYP210

97% to PpCYP215

ascaffold 78 289464 - 287096

MLTLAVHDILWAVGAALLACAAFKIIRVLLLPYTSSLRDLPGPPASSWLLGNVSELMAAEDFALHFEWLE

KYGPTMKYNVWFKLPELLTIDARAINHVLSHSQDYPKPEETRVSLVEILGNGLVVAEGELRRRQRRIMNP

AFGPAQIRELTEIFVDKAQQLRDIWRNEVTTCGGTARIDVQSGLTKMTLDAIGLAGFNYNFNALNPDGKP

NKLNNAFEMMFQRMSDLERSYWLIIRSLIPILRYIPDGYTRDTAAAQKVTRRIGMQLIAEKKAAVRQAAQ

SGEKNAGSELRSRDLLTLLIKANMSPDIPEDQRLSDDDVLAQVPTFLVAGHETTSNATTWCLYALSQQPN

VQHKLREELWGVPTDSPSMEELNALPYLDAVIRETMRLFPPIAGTVRIATKDDEIPLATPYMDAKGRMHD

SIRIDKGTAFPIPILGMNRSKALWGEDAREFRPERWESVPESVQQIPGVWSNLMTFIGGPRACIGYRFSL

IEMKALVFTLVRAFEFELAVPVEDITKKIGFVQRPFVRSEMEKGTQMPLVIKLHTRE

//

>CYP5139D6 PpCYP197

scaffold 71 19119 - 16867

MVFVTTTNVLLSMSGAIAAIVLWKVISILRAPYTSALRNLPGPPSPSWPLGHLKMMFSAEDSAALYESWV

ERHGTTFKYNGWAGTYRLFTADTRAVNYIQSHSNDYWKPEISRFSLIQILGHGLLSVEGDRHRQQRRVMN

PAFGPAQIRGLTEIFVEKAHKLCEFWRNELSKNGEPGRIEVLNGLSKMTLDVIGLAGFNYDFNSLNVDGK

PNELNEAFNVLFRSLDGFAILPVLQAVFPPLRLLPDRRSRRIASAVKVMRRIGMELISNKKAEIVAAAIS

DQKEKNKLQSRDLLTLLLKSNLSRDNPESQRLSDKDVLAQVPTFLIAGHETTSNAVAWCLYALTQNSEIQ

QKLRDELWSVPTEDPTMDELNELPYLEAVVRETMRVHAPVPATERVAIKDDVILLNTPYIDIRGQVQDSV

RVRKGDHIFIPIIAMNKSKALWGEDAFEFKPERWESIPDAVQTIPGVWANMMSFLGGAHSCIGFRFSVVE

MKALVFALVRSFEFELAVPAGQLTAKTIGVQRPAVRGEQNQGCQLPLLIKVYKRN

//

>CYP5139D7v1 PpCYP235

scaffold 87 163613 - 165957

MSVIAWAFGAALVAFSCWKLLKISGLLQPYMSPLGDIPGPPSPSFLYGNMHEIQNSETSIVREQWVDMYG

PT

LKYKGWLNVDRLYTLDTRAIHHVLTHSHDYPKMELSRYFLTQVTGNGLIVAEGDLHRKQRRVM

NPAFGPTQIRGVTKIFVDKAHQLRALWTATLELTGGPARIDVLSGLTKVTLDVIGLAGFNIDFGSLNPNG

HARHSELTDAFNVMFGALGDTRTSLFRAMKAYLPPLRLIPDSTSARVTAARKVIDRVGMQLIMEKKAEVI

KAERTGEKDTLHSRDLLTLLIRANMSTDIPENQRLSDAEVLAQIPTFLAAGHETTSNSTAWCLYALAQHP

AVQSALRDELLSVPTDSPSMDDLNALPYLDAVVRETMRLHAPVSSTMRYAAKDDVIPLAAPYTDRNGEVC

DGIRVSKGSPIIIPILAMNRSKAVWGEDAHEFRPERWESTIETAQHMPGVWAHMMSFLGGPRACIGYRFS

LVEMKALMFVLVRGFEFELAVPICKKRMLVQRPFVSDEMDKGAQLPLLVKPYVRA

//

>CYP5139D7v2 PpCYP040

98% to PpCYP235, cyan probable error in assembly see PpCYP235

scaffold 198 119158 - 121525

MSVIAWAFGAALVAFSCWKLLKISGLLQPYMSPLGDIPGPPSPSFLYGHEIQNSETSVVREQWVDMYGPT

 

AEGKNSRS

NPAFGPTQIRGVTKIFVDKAHQLRALWTATLELTGGPARIDVLSGLTKVTLDVIGLAGFNIDFGSLNPNG

HARHSELTDAFNVMFGALGDTRTSLFRAMKAYLPPLRLIPDSTSTRVTAARKVIDRVGMQLIREKKAEVI

KAERTGEKDTLHSRDLLTLLIRANMSTDIPENQRLSDAEVLAQIPTFLAAGHETTSNSTAWCLYALAQHP

AVQLTLRDELLSVPTDSPSMDDLNALPYLDAVVRETMRLHAPVSSTMRYAAKDDVIPLAAPYTDRNGEVC

DGIRVSKGSPIIIPILAMNRSKAVWGEDAHEFRPERWESTIETAQHMPGVWAHMMSFLGGPRACIGYRFS

\LVEMKALMFVLVRGFEFELAVPICKKRMLVQRPFVSDEMDKGAQLPLLVKPYVHA

//

>CYP5139D8 PpCYP216

scaffold 179 87051 - 84721

MVEDILKALSIGIITFYLLKLLSFLLQPYTSPLRDVPGPPSSSWFLGNINNIHNSQPAVLQEAWTDKYGK

TIHYKGWFNRDRLYTLDTRALGHILNHSNDYFKPELARHTLSSILGEGLVVAEGKQHRRQRKVMNPAFGP

TQIRDLTDIFVDKAVQLRDVWNRMIPEDNQPARIEVLKGLSKMTLDVIGLAGFNHQFHSLESDGSDDELG

KALRVMLRSTSGWNVWLPALAYFFPPLRLLSHMSDGAHARKVMTRIGLELVREKKIQIAKAALEASKDGA

QERLHGRDLLTLLVKANMASDITDSQRLSDENVLAQVPTFLVAGYETTSVATTWCLFSLSQALDAQQKLR

EELMTMSTDTPSVDDLTALPYLDAVIRETLRLHPPIHTSIRVAEKDDVIPLDTLYVDAKGRTHDYVRVTK

GTIIDVPIVALNRSKELWGDDAHEFKPERWESVPAAVHAVPGIWSNTMAFLGGQHACIGYRFALNEMKAL

LFVLIRAFEFQLAVPPAKITSSVRTMIQRPVVCDEVEKHSQLPMLVKRYVGS

//

 

CYP5140 family (1 sequence) plus revised Phanerochaete seq.

 

>CYP5140A2 PpCYP015 63% to CYP5140A1   Phanerochaete chrysosporium

MPASILDSFLTASTSTFLLAALSTFLVYFAASVVYQLFFSPLAGLPGPWYAAISDFWLTTHVVRMQQCRI

VQDLFERYGPVVRVGPNKVVFCNASTMRSVYCVHKFDKSTYYKSLLT (2)

NNNDHA (2)

MTTLPNAQHAVRRKAYAPHYTPSNLVLFQTDLHDYSLKLVD (0)

ILHNMSGKSSVDCLNLFRHLNVDIIGCTVFGTRPGSLDNWALNMQDPLATAIYDFPKRGVL (0)

RSAVPTWAWNLVCRIPNHRWRQVCDSDRIMAQ (0)

FVAGRLYEMRAKIQA

GPVAGGTEAEKEKVSLLQRMLQYRVFTTHECMADQ  

DIISESMGHM (2)

VAGVDTSSTTLSYFLWELSRRGDVVRRLQQELDDAMPDPRVIPDISVLNKLTYLNAFVKEGLRVYGAAPS

LLERVVTSTTVSSDDDNFDLMGYALPPGTIISTQAWSMHRDVDIFPSPETFLPERWLEVEGLEGEQERLM

RMHQHMMPFGVGTRICGGHNLAQMMLRTVIAALVRNFNVIANSAETNERTMEMRDAFILFPAAKECKLVF

RPRSQ

//

 

>CYP5140A1   Phanerochaete chrysosporium             JGI gene model pc.96.21.1 revised

MNASSIDFFPRNLATSPVFSAKPFLLALSLISTYLVSVAFYRLFFSPLASIPGPWYAAVS

DLWITTHVLRMQQCRVVQDLFDTYGPIVRIGPNKVAFCDAGTMRSVYCVHKFDKSAYYKSLLT (2)

NNNDHAMTTLPHAEHAIRKKTYAPHYTPANLALFQPELNDLALKLTD (0)

ILSIRSSSVDVLDLFRHLMVDVIACTVFGSRSGSLDNWNKGVRDPLSIAVYDFPKRGIM (0)

RSA  V P  T  W  A  W  K  L  V  C  K  V  P  N  A  R  F  R  E  M  C  N  S  D

N  I  M  A  E  (0)

YV G  S  R  L  Y  E  M  R  A  N  M  Q  A  A  (2)

E  G  T  V  N  V  G  D  E  H  K  M  P  L  I  Q  R  L  L  G  T  K  M

P  S  D  E  K  N  Q  K  D  V  V  T  I  E  R  D  I  V  S  E  A  M  G  HL (2)

IAGVDTSSTSLSYMFWELSRRRDVMQRLQAEIDEIMPDPRVIPDATVLNRSEYLNAFVKE (1)

SLRDPIALHFDMMGYALPPGTIVATQAWSMH

RDEDVFPSAETFLPERWLVDPHADREVEEERLARMHLHLVPFGVGTRQCGGQNLAHLMIR

IVVAVVVRNCEVRADVRETNERSMSMRDAFVSPLLWLLLGSERS

 

 

CYP5141 family (4 sequences)

 

>CYP5141A5 PpCYP145

55% to CYP5141A4, 67% to PpCYP124

scaffold 8 694739 - 692245

MQKTLLLVLSFLAVYVVKKYQDWRRAIRSIHDLPGFRHVFGTQASVLARRIPYLCTGSLSPWLRKHDDFV

QYDSDIITGVRLFPCDATLFVADAEALKEITSARTRFPKPLHEYEAVNLYGHNIVGTEADEWKRHRKITA

PSFSERNNRLVWDETIGIVQELCEDVWGGKDHVVENIVDVTIPLALFVIGTAGFGRRMSWKAEVDVSYGH

TMPFKDALHVISVELWIKALLPSWFIRWAPIPRIRAFKTAYTELERYMIEMIEERRSSEKKEQRYDLFTS

LLVASEEESDGITKLSDSEVMGNIFVFLIAGHETTAHTLAFTFILLALYQDQQEIMYQQIKSVIPDDRLP

SYEDMGKLTQCYAVILETLRMYPPVCLIPKTTAEDTTLHTRNMAGEPIAIPCPAGTGIGIHVAGIHYNPR

YWKDPYTFNPSRFLEDWPRDAFLPFSGGARSCLGRRFSEMEAVAALAYIIARYRVEVKEEPQYAAETFEQ

RKERMLTCKTAVTLYPAKAPLVFKRR

//

>CYP5141A6 PpCYP124

scaffold 50 145293 - 147788

MHSLLVLFVSLLALGALKKHLDFRAAVDKIHNYPGLRFIFGVQSFIFGKRIPYFAAGGLSLWDTKHQDFV

DHDADIISSVNIFPTCATYMIADAQAIKEITTNRARFPKPLQQYKILTFFGSNIVVTEADEWKRHRKISA

PSFSERNNRLVWDETINIVKELSDDVWRGKNEVTMDNIVDLTVPIALFVIGVAGFGRRMSWVEDFTVPAG

HSMPFKDALHLVSNHLWMKVLLPAWFLRSAPIPRVRKFHTAYEDLEKYMIEMIQARKTAEKKEERYDLFS

SLLDANEEETDGNTKLSDSELMGNIFIYLIAGHETTAHTLAFTFILLALYQDEQEKLYQHIKSVVPDDRL

PAYEEMGKLTYCYAMLLETLRMFPPVNLIPKQAAEDTTLHTSNMAGEPVAVPCLAGTALAIHTPGLHYNP

RYWEDPFAFKPARFLGDWPRDAFLPFSAGPRSCLGRRFSETEAVAVLTYIVARWRIDVKEEPQFAGETFE

QRKARLLDSKSAITLYPVRAPLVFKRR

//

>CYP5141E1 PpCYP115

93% to PpCYP101, cyan = insertion compared to PpCYP101

scaffold 24 145140 - 147522

MVSDQYISSVAPSPVLYLLFVFFVCVWFLRVYILYRETVKRNKGWIGPRTLIGVETVFSQICRPIPGISL

GYDYPWLSKHNDYPSDGCDAYFMVSAFPVGYSSLWLSDAAAIKEIASSRLRFPKPVELYKVLLVFGPNIV

ASEFDSWKRYRRMVASAFSDRNHEYVWYSASKLGVDLLDNVFKNEKEVVLDDVTEITLPLALYMIAIAGF

GREVTFQHDGVVPHGHKMSFKAAIDIIAKDIFLKLLLPKFSFTLHPRLRKLQLAFEEIEEYIKEMIRERQ

TSTQEEGRSDLLNNLLEANGDSEIKGEKPLTDEELIANVFIFLLGGHE

ASSQALAFALAALSLYP

DEQEALYQQIKQVMPNGELPKYEDIHLLAYSLAVINETLRMYPPVNASPKYCAEDTVITVTHASGSKKLI

PVPKNTKIFLHITGVHYNPRYWKDPHVFNPSRFLTDYPREAFIPFSSGSRSCIGRKFFETEAVAILSLII

SRYKVSIKEDPRYAHETFEDKKQRIFTANIKLTLTAANQIPLVFTRR

//

>CYP5141E2 PpCYP101

scaffold 197 88803 - 86421

MVSDQYISSVAPSPVLYLLFVSFVCVWFLRVYLFYRETLKRNKEWIGPRTLIGVETVFSQIFRPIPGISL

GYDYPWLSKHNDYPSDGYDAYSLVSAFPMGYSSLWLSDAAAIKEIASSRSRFPKPVELYKVLLVFGPNIL

ASEFDNWKRYRRMVASAFSDRNHEFVWYSASRLGMDLLDNVFKNEKEVVLDDVTEITLPLALYMIATAGF

GREVTFQHDDVIPRGHKMSFKTAIDIIAKDIFLKLLLPKFAFTLHPRLRKLQLAFEEIEEYIKEMIRERQ

TSTQEEGRSDLLNNLLEANGDSEIKGEKPLTDEELIANIFIFLLGGHE

DEQEALYQQIKQVMPNGELPKYEDMHLLAYSLAVINETLRMYPPVNASPKYCAEDTIITVTNASGSKKLI

SVPKNTKIFLHITGVHYNPRYWKDPHVFNPSRFLANYPREAFIPFSSGPRSCIGRKFFETEAVAILSLII

SRYKVSIKEDPRYAHETFEEKKQRIFTANIKLTLTAATQIPLVFTRR

//

 

CYP5144 family (4 sequences)

 

>CYP5144K1v1 PpCYP098

98% to PpCYP104, 44% to CYP5144C5

MPTTLRMLNNNLLIVIGTFAVCVYIVLQRSKARLPLPPGPRKWPLIGNLLDMPGGRAWLKYAEWSREYGS

DIIHLSAAGTSILVLNSAELVNELMEKRSAIYSSRAQLTMLHELMGWKDAFSFAPTNPTWRAQRKIFMQA

LNPNNAALFHGKQLRATHELLWRLHKGPANLFHELHHWAAILIMDITYGIRGDAADPYIETAVEALDSMA

IAGAPGAFLVDAVPLLRHMPEWTPGAGFKRQAREWNVLRQKMANRPFIAAKQQITSGSYTPSLVSNALEA

VDKNQDLAEQEELIKGAAVTSYGGGSDTVVAAVSAFVLAILQHPEIQAKAQRQLDEVLGHGELPSFQDVQ

SLPYITALVKEVLRHNPVTPLAIPHLLSEDDTWDGYWLPKGSIVMANAWAILHDENTYPDPMPFNPDRFL

RPDGKLDETVKDPATASFGFGRRLCPGRHIALSSIWISVASILACYVIRKEVDAAGREVVPDGEWYGGPT

LFNRPLPFKCRFTPRSKAAEAIIVSLENTV

//

>CYP5144K1v2 PpCYP104

MPTTLRMLDNNLLIVIGTFAVCVYIVLQRSKARLPLPPGPRKWPLIGNLLDMPGGRAWLKYAEWSREYGS

DIIHLSAAGTSILVLNSAELVNELMEKRSAIYSSRAQLTMLHELMGWKDAFSFAPTNPTWRAQRKIFMQA

LNPNNAALFHGKQLRATHELLWRLHKGPANLFHELHHWAAILIMDITYGIRGNAADPYIETAVEALDSMA

IAGAPGAFLVDAVPLLRHMPEWTPGAGFKRQAREWNVLRQKMANRPFIAAKQQITSGSYTPSLVSNALEA

VDKNQDLAEQEELIKGAAVTSYGGGSDTVVAAVSAFVLAILQHPEIQAKAQRQLDEVLGHGELPSFQDVQ

SLPYITALVKEVLRHNPVTPLAIPHLLSEDDTWDGYWLPKGSIVMANAWAILHDENTYPDPMPFNPDRFL

RPDGKLDETVKDPATASFGFGRRLCPGRHIALSSIWISVASILACYDIRKEVDAAGREVAPGGEWYGGPT

LFNRPLPFKCRFVPRSKAVEATIVSLENTV

//

>CYP5144L1 PpCYP207

51% to CYP5144C3 Phanerochaete

MSSQSLEPFVLLFATFLVLKTLSLRRRGAALPPGPKGLPILGNVYDLPRSREWLAYQQWSHELDSDLVYL

NLCGSHVVVVNSIEVARHLFEERSTLYSDRPQMTMLNDLVGCDWHFVFMGYGDHWRERRRIFHQHFHPTA

ALQYRPRAIHGARVLIQRLLETPDDFMMHLRHMAGSLIIGVAYGLEVKPKDDPYVETAEKALHAMAMAGN

AGSFLVDYIPILKYIPAWFPGASFQRKAQEWRKATTAMVEAPFAAVKKAMLDGSATPSIILTLLRDMEEK

DNNNVALEKLYSGVAAAAYTGGSDTTVSALGSFFLAMMLNSEVQTKAQQALDDVVGRERLPDFSDEASLP

YISAIVWEVLRWQPVTPLAVPHRLTHEDEYNGYRIPAGSIVVGNAWAMLHDERHFPEPSVFKPERFLLSD

GRLNESMRDLVMPAFGFGRRICPGKSLAYASLWASVSSVLCTFDVVKPTDETGRPIEPSGEYTTGLVSYP

LPFKCRFKPRSDAAEALICSAMQEYD

//

>CYP5144M1 PpCYP051

45% to CYP5144C4 

MTSLLCLAAFFAFFAFLYYGLVSQKSQRLPLPPGPKTSMFGSVDLPKTYPWKTYAQWKKTYGDVIYIHVF

GNPIIVLNSAKAATELLDKRSSIYSSRPQRTMVSELMGWDWLFSTVPYGTWWKRHRTLFHQYLNANTTPN

YHPIQTDETHVMLKNLAATPDNFLHHVRRLTGAAIVVKAMYGHQVAPEGDAFVALADKALASLAQSGIFG

TYLVDYIPLLKYVPAWIPGAGFKHQASEWRKLNRAMLSQPIEMVKQDMARGAAVSCFATTELEKWYNSGQ

DPDQERIIKDVAATTYAAGADTSVSAVQSFFLAVTVYPNVLKKAQAEIDRVVGSDRLPTFNDRMSLPCID

WIVWECLRWNPVTPLGLAHSTTEDDVYEGYHIPQGTTVLPNVWNILHDEATYPDPFAFNPDRYADAKTNT

ERGINDVPWAAFGFGRRMCPGRWLAIDTIWIAVATAAAVFDISAPLDAEGRPVQQTVEYTSTLLSRPHPF

HCRIAPRSEAAAALIEQCTQT

//

 

CYP5148 family (2 sequences)

 

>CYP5148B4v1 PpCYP172 73% to CYP5148B1 Aspergillus clavatus

MLIYSPHVLTDIARSAQGIAAIAALILGILWLLPFLSGHSYDVFGRRPRDKDSLSIPDGPLGLPIVGSFP

FLTHYPELTLHKWRKRFGPLYSMWLGNQLLVIVSDPGIAKDLMVTNGAVFSSRKEMFIKSQIIFAGRGIT

ATPYNDRWRKHRRIATGWLNLRAVIDYSNVLDYEATVMMMNLYLIGKGGVAPINPQPHAGRCSLNNMLTI

VFGTRTDSIDHPLVNRALMLSREFMNCTGPVSNLVDFVTPLQWFPTRMSIRGKRLHKDLVKTYGGMIKDI

ERRMNAGETVPDCLAKTMILAREEELDHLDMAILASAFMIGGVETTASIMQWFSALIPAYPDIQLKAQAE

\LDRVVGRDRLPTIEDEANLPFCHAIIKEVERCHNPFWLGTPHVASEDSAYEGYYIPKDTVVILNTYSIH

HDPERHVNPHDFDPERYIKDSTNNTESANLANPYDRDHWMFGAGRRICPGMIVAEREIWLAISRMLWAFD

MVEIPGEPIDLKEYDGLSGRSPVPFRIKLIPRHENVAKVLGLEQL

//

>CY5148B4v2 PpCYP042

95% to CYP5148B4v1

MLIDSPHVLTDIARSAQGIAAMAALILGILWLLPFLSGHSYDVFGRRPRDKDSLSIPDGPLGLPIVGSFP

FLTHYPELTLHKWRKRFGPLYSMWLGNQLFVIVSDPGIAKDLMVTNGAVFSSRKEMFIKSQIVFAGRGIT

ATPYNDRWRKHRRIATGWLNLRAVIDYSNVLDYEATVMMKNLYLTGKGGDAPINPQPHAGRCSLNNMLTI

VFGTRTDSIDNPLVSRALMLSREFMNCTGPVSNLVDFVTPLQWLPTSMSIRGKRLHKDLVETYGGMIKDI

ERRMNAGGTVPDCLAKTMILSRQEEELDHLDMAILASAFMIGGVETTASIMQWFSALIPAYPDIQLKAQV

ELDRVVGRDRLPTVEDEQNLPFCHAIIKEVERCHNPFWLGTPHVASEDFVYEGHYIPKDTVVILNTYSMH

HDPERHVNPHDFDPERYIKDSTNNTESANLANPYDRDHWMFGAGRRICPGMIVAEREIWLAISRMLWAFD

MVEIPEEPIDLKEYDGLSGRSPVPFRIKLIPRHENVAKVLGLEQLKSVVESEILNV

//

 

CYP5149 family (1 sequence)

 

>CYP5149B1 PpCYP019

42% to CYP5149A1

MFCTQSSSVVLLLALLISWGVYHGFKHRSAPLPPGPRPLPFVGNALQMPRHNIAQSLASLSEEYGDVIYM

HVFGIEFIILNCAEAVLELLDHRGALYSERPHSVMAMDMIEKKHAVLFHQYDENLKKHRRLLRNAVDAKR

SEDYWQMQYAESHKLMAAFLTSPDDFIAHLRRSAGAFTLRLAYGYEVQGGPGEDAFVNLAEELARVTGVA

SEPGRWLVDAFPWLRHVPAWFPGAGFRRWADHARRVIDDFATQPYLSSKEAALQGISSFASETTEFVEAE

TGRPLTRDEDEFLKWTSASIYSGGTDTAVAVNSAFLLLMALYPAAQRKAQDEIETIVGKDRLAVMEDRPR

LPYIEALMKEVHRFIPITPLVPHSTRVDDEYRGYRIPKGSWVIANTWAVMRDPRLFPEPEVFWPERYLAE

GNRCTEDPRDYAFGYGRRRCPGVHVAESSFFIFVTHFLAVFTVSNPVDERGQKLTSPGPSTDAHISHPRP

FRCTIKPRNQALTELILQL

//

 

CYP5150 family (33 sequences)

 

>CYP5150D1 PpCYP219

82% to PpCYP038 

scaffold 31 45030 - 47410

MATLIVLLYGLLAFGTVWLVRRQSKNHDAHRVMRNIPGPPSRSWMKGNIMQYFTRHGRAFQRDVALNYGP

VVRLQGPLGRKILYVSDPKALHTIIIKEENVFEEPESTLITFNLLFGDCLVGSLGENHRRQRKLLNPVFS

VNHMRHMLPMFYNVIFKLREVVMAKVRGGEKEIDVLEWTGRAALELIGQGGLGYSFDPLVSDKEARNEYG

DALKAMLPALMNIESLRQILPHLVKMGPKWFRRLATDIFPNAHVQTVKHVVDTMSKRSQEIFREKKAALK

SGDEAVLRQVGEGKDIMSILLRANTAASDADKLPESQMVAQMSLLVFAATDTTSNTLAHILQLLAEHSNV

QSKLREELLQSGAGTGNTSYDELMKLPLLDAVCRETLRVHPPATLLVRVPRKDSILPLSEPVIGLDGTII

KDVPVPEGTEIVIGVFGSNVNKSLWGEDALEWKPERWLSPLPRAVNDASIPGVYSNLMTFLGGKRACIGF

KFSEMEMKVVLAVMVSNFVFELEKEIEWNVAGVDYPTVVWDGDRPQLPLKVRVYKS

//

>CYP5150D2 PpCYP022

scaffold 31 117549 - 119904

MDSLYSLLFLALAGGAAWYAWQRSQRRKHHVLENLSGPPSRSFLKGSLGEMYNRHAMPFQKDVALNYGSV

VKLRGLFNRPIVFISDPAALHTMLIKEEHIFEESRSFILGNMLIFGPGLLATLGDQHRKQRKILNPVFSV

AHMRDMLPLFYNVIHRLRDAISLQVTKGQSEIDMLQWTGRVALELIGQSGLGYSFDSFVSDMKDDYGAAL

KALFPRLMDIDILQRLLPYVPFTVPAGIGRLAINLIPNAAVQKVKSIVDTMSTRSTRIFVSKKKALADGD

KAVLEQVGKGKDIMSVLMKANSLASEDDRLSEKELISQMSTLVLAATDTTSNTVARILHLLSEHPDIQDK

LRQEILAAGAHEKCSYDELNKLPLLNAVCRETLRLYPAVTTLMRVPNKDTVLPLHEPIMGIDGTIIKEIP

ISRGTEVLIGAWACNLKKSLWGEDSTEWKPERWLNGLPTAVLEAPIPGVYSHLMTFLGGKRACIGFKFSE

MEMSCSVGLSIHIHVRVDGKVITWNMAGVIYPTMSRESETPEMFLKVGLYSEGAKTK

//

>CYP5150D3Pa PpCYP228 YELLOW NOT P450, TOP 46% TO CYP5150A4 Phanerochaete chrysosporium 
scaffold 31 179269 – 182793 (-) pseudogene

MDTPFFLLPIFFAVGSLWYFWKQVHCRSVNIILENIPGPTASSFLTGSLEPFFNRFAMEYQKDLHINHGP

VIKLRSFLNRPMVLVGDPKALHTILIKEEHIFEEPDWFIKGRVNIDLVIFQGEQHRKQRKILNPVFSVKH

MRSMLPMFYSIIHKMRDAILAQIQDGHSEIDMLHWTGRAALELVGQGGLGYSFGSLASEMQDDYGDALKA

LTPSLVSVDLLERLVPWVCGIGPAWLRRLAIDVFPNAGLRRLKSVVDCMTRRSVEIYESKKEALNKGDKD

VVQQIGEGKDIMSVLMKANQVASDGDRMTEEELIGQMSTLIFAASDTTSNALVHILQTLAEHQDWQKKLR

AELLGAGAGNQISYEQLNRLPLLDAICRETLRLY

LASKAQLKDAEVNGVNCTENDYHTLHANFVKGLPKELYVSLATRVARDRPSTMKAWYDEVRNADAAEQGA

LTVTDTRDYGEPMDIDAAAVAATFASTSGGRKWELGAVLNEADRKLHRDGNLCFYCHIKGHSAKDCRKKA

AARQGGGRPNPGGSGKDDFRARIKALSADEKQELYEELTMEDF

//

>CYP5150D3Pb PpCYP206 YELLOW NOT P450

scaffold 31 151611 – 148432 (-)

MPDAEMKSNIWPLRTGSRREGMPRGLIPNRERPATSVWLGAKRALGRAASSGPIVRRMRKMFRDLRTRHR

DDRAELRVSVAHRRRCRRASKAKSKCWETELSIYTPKHTHVGDSTLLTLLLSNPTDVFNKLKAHNPEATN

ATDRAALEAYLSARRDYDEAVKAADEAIDHHKRLLRQQDDRVLTELIRLDNLKVAHHFQPLLPRSIRAQH

NKFIPRAIPNAYLPLPAPLPTSAFRRPPIPSRFLQATPRSTTIPADRQPNPGWTPKGSCRRCGSSRHWVR

DCRKEAPGHLERECGTRPMKRHVSAPPEEPARRVGVVVDNVFLEGIINEAKERKEKERQTKAVPIPPPRS

ANPEPPTSSVAGP

56% TO CYP5150A2 Phanerochaete chrysosporium, CYAN = INTRON?

81% TO PpCYP052, Possible C-term to PpCYP228
pseudogene

LRPHPDTPVVFRKVDPDWTPDTTQWT

PNKDTVLLLSEPIRGLDGKMIYEIPVAKGTEVLVGMWACNVNKSLWGEDSLEWKPERWLSDLPDALKQAS

VPGVYSN

IMTFLGGRRACI

GFKFSEMEMK

IVLSVLLSTFTFQPTTASIVWNMGPVNYPTVGKDNNTPRLPLK

VGVYQAP

//

>CYP5150D4 PpCYP052 
65% TO PpCYP185 51% TO CYP5150A4
scaffold 31 175599 - 177983

MGTAVICLSFALVGCSLWYLHQTIRRRSVNSVLENIPGPPSASFLKGSLVPFFNRHAFEHQKEIFKNYGP

TVKLHSFLNRPMLLVGDPKALHTMIIKEEHIFQESNVFILTNLLIFGQGLVSTLGEQHRKQRKILNPVFS

VNHMRHMLPMFYNVIHKMRDAILDQVKGGSDQIDMLYWTGRAALELVGQGGLGYSFGSLASEMQDDYGDA

LKALLPTLVNIDLLQRLLPYVYGIGPAWLRRLAVDASPNTDVQKVKSVVDRMSKRSVEIYESKKGALEKG

DDEVVQQIGEGKDIMSVLMKANKAASVEDCLTDEELIGQMTLIFAATDTTSNALVHMLQFLADRQDWQDK

LRQEILEAGAGTGIPYDEINKLPVLDAVCRETLRLFPANTTVMRVPNKDTVLPLSEPIRGLDGKMIHEIP

VAKGTEVLVGMWACNVNVSIWGEDSLEWKPERWLSGLPNSVKNAAVPGVYSNLMTFLGGKRACIGFKFSE

MEMKVVLSVLLSSFIFKPTGAPIVWNLGGVNYPTVGRESNTPRLPLKVEVYTGS

//

>CYP5150D5 PpCYP220

86% to PpCYP214 

scaffold 31 214294 - 211952

MADSTLLLCCALFVSAAWLLRTQFRQRSSYHVIRNIPGPPSNSWLKGNFMKFFDRHGQLFQQDVALNYGP

VVRLEAVCGHKMLYISDPKALHTMLIKEETVYEETDAFFASMKLLFGDCLLATAGEHHRKQRKMLNPVFS

VSHMRHMLPIFYSTIFKSTCWNGQVALRWSSLGRGGLGYSFDPLAVNTETRNTYGDAIKAMNTSLIEVEV

FRRYLDILMELGPRRFRRFVVDMFPNTHVQHVKDVVDTMDEKSREIFRKKKTALAKGDEATLRQVGEGKD

IMSILIKANSAASEQDRLPEDELIAQMSLLVSAATDTTSNTLSRILHLLAEHREMQERLREEILKSSAGN

GDISYDVLNKLPLLDAVCRETLRRYPPVTILIRAPRKDSVLPLSEPICGIDGTMIKEIPIPKGTELIIGT

FGCNVNKSLWGEDSLEWKPERWLSPLPRAVTEASIPGVYSNLMSFIGGKRACIGFKFSEMEMKVVLSVML

SNFTFELTDKPIEWNVSGVWYPTVGRDSDLAQLPLKVGLYKA

//

>CYP5150D6 PpCYP038

scaffld 31 231847 - 229461

MAAPIVLLYGLLALGAMWFVRRQSKHRNAHHVMRNIPGPPSRSWMKGNVMQFFTRHGQEFQRDVALNYGS

VVRLEGPLGRKILYVADPKALHTIIIKEEHVFEEPEPFLVSNNLIFGECLIGSLGDIHKRQRKMLTPVFS

VNHMRHMLPVFNTVVFKLREVVLAKVREGEKEIDVLEWTGRVALELIGQGGLGYSFDPLDSEKEARNEYG

DAIKSLLPAMMNIEQLRQLTPHLVKMGPRWFRRLAVDLFPNAHLQTVKHVSDTMSERSQNIFHEKKVALN

NGDEAVLRQVGEGRDIMSILLRANTTASEQDKLPESEMIAQMSRLLVFAATDTTSNTLARILQSLAEHSD

VQSKLREELLHAGADTGDLSYDDLMKLPLLDAICRETLRLYPPVTILLRVPRKDSVLPLSEPVVGLDGSI

IKDVPVPKGTEIIIGTLGSNVNKSLWGEDSLEWKPERWLSPLPRAVNDAPIPGVYSNLMTFLGGKRACIG

FKFSEMEMKVVLAVMVSNFTFELTEKEIGWNVALVWYPTVGKDDDRPQLPLKVRLYKP

//

>CYP5150D7 PpCYP212

scaffold 31 235648 - 238032

MAAYAWLYCALALGATWYLQRYLRQRDAYSVLRNIPGPPSYSWAKGHINQYFNPRGQAFHEEVALNYGSV

VKLDGMFGSKLFYVADPKALHTILIKEENTWEEPDAFLALNQLMFGDCLVGTLGEHHRRQRKMLNPVFSV

NHMRHMLPIFYNVILKLREVILAKVKAGESEIDVLEWSGRAALELIGQGGLGYSFDPLLVNSESRNEYGD

ALKSCFPALSKVDILRRYAHYLIKMGPRWFRRSVVDMYPNPDVQNIKEVVDTMSAKSYEIFNQKKVALKR

GDEAVLRQVGEGKDIMSILIKANTAASEDERLPESELIAQMSLLVFAATDTTSNTLARILQLLAEHQEIQ

VKLRDEILQSSAGGNDISYEELNRLRLLDAVCRETLRLFPPVTTLRRVPRKDSVLPLSEPIYGVDGRVIN

EIPVAKGTDVIIGTYGVNVRKQLWGEDSLEWKPERWLSPLPSAVTAAAIPGVYSNIMTFLGGKRACIGFK

FSEMEMKVVLAVMLSTFTFERTEKVIQWNIAGVSYPTVEGNSQPQLPLKMGLYRP

//

>CYP5150D8 PpCYP214

scaffold 181 126412 - 128735

MADPTLLLCCALFVSAAWLLRTQFRQRSSYRIIHNIPGPPSNSWLKGNFMKFFDRHGQTFQQDVALNYGP

VVRLEAFCGKKMLHISDPKALHTILIKEEIVYEETDAFFASFKLLFGDCLLATAGEHHRKQRKMLNPVFS

VSHMRHMLPIFYSTIFKLREVVRAEVQSGKNEIDVLEWTGRAALELIGQGGLGYSFDPMVANTETRNAYG

DAIKSINSNLLAVENLRRYLDILIDLGPRRFRRFVVDMFPNPHVQRLKYVVDTMDEKCREIFREKKTALA

KGDEATLRQVGEGKDIMSILIKANSAASKEDRLPEDELIAQMSLLVSAATDTTSNTLSRILHLLAEHREM

QEKLREEILKSGAGNGDISYDVLNKLPLLDAICRETLRRYPPVTILVRAPRKDSVLPLSEPICGVDGTMI

REIPIPKGTELLIGAFGCNVSKSLWGEDSLEWKPERWLSPLPRAVTEASIPGVYSNLMSFIGGKRACIGF

KFSEMEMKVVLSVMLSNFTFELTDKTIEWNIANVWYPTVGKDSDLPQLPLKVGLYKA

//

>CYP5150D9 PpCYP211

91% to PpCYP214

scaffold 181 132656 - 134999

MADPTLLLCCALFVSAAWLLRTQFRQRSSYRIIHNIPGPPSNSWLKGNFMKFFDRHGQTFQQDVALNYGP

VVRLEAFCGKKMLHISDPKAMHTILIKEENVYEETDAFFASMKLMFGNCLLAAAGEHHRKQRKILNPVFS

VNHMRHMLPIFYRTIFKLREVVRAKVQSGKNEVDVLEWTGRAALELIGQGGLGYSFDPLAANTETRNAYG

DAIKAMNASLIEVEFFRRYLNILMRLGPRRFRRFVVDMFPNSHVQRVKDVADTMDEKSREIFHEKKTALE

KGDEATLRQVGEGKDIMSVLIKANSAASEQDKLPEDELLAQMSLLVLAATDTTSNTLSRILHLLAEHREV

QEKLREEILKSGAGNGDMPYDVLNKLPLLDAVCRETLRRYPPVTILVRAKDSVLPLSEPICGVDGTMIRE

IPIPKGTELLIGIFGCNVSKSLWGEDSLEWKPERWLSPLPRAVTEASIPGVYSNLMSFIGGKRACIGFKF

SEMEMKVVLSVMLSNFTFELTDKPIEWNVAGVWYPTVGKDSDLPQMLLKVGLYKA

//

>CYP5150D10 PpCYP243

scaffold 181 136735 - 139088

MDSLYSLLFLALAGGAAWYAWQRSQRHKNHVLENLSGPPSHSFLKGSLGEMYHRHAMPFQKDVALNYGSV

VKLRGLFNRPIVFISDPAALHTMIIKEEHIFEESRSFILGNMLIFGPGLLATLGDQHRKQRKILNPVFSV

AHMRDMLPLFYDVIHRLRDAISLQVTNGQSEIDVLEWTGRVALELIGQSGLGYSFDSFVSDMKDDYGSAL

KALFPRLMDIDILQRLLPYVPFTVPAGIGRLAINLIPNAAVQKVKSIVDVMSARSMRIFVSKKKALADGD

EAVLEQVGKGKDIMSVLMKANSLASEGDRLSEKELISQMSTLVLAATDTTSNTVARILHLLSENPNIQDK

LRQEILAAGAHEKCSYDELNKLPLLNAVCRETLRVYPAVTTLMRVPNKDTVLPLHEPVIGVDGTIIKEIP

ISRGTEVLIGAWACNLKKSLWGEDSTEWKPERWLKDLPSAVLDAPIPGVYSHLMTFLGGKRACIGFKFSE

MEMKVVLSVLLSTFTFEPTGKSITWNMAGVIYPTMSRESETPEMFLKVGLYSGGRKD

//

>CYP5150D11v1 PpCYP046 
53% TO CYP5150A4 Phanerochaete chrysosporium, 96% to PpCYP141
scaffold 142 42682 - 40338

MHDVLGFALICLILGVLGRIFVRVFVKSPLDNVPGPPALSFAKGNIPQLYNRNGWGFIKDLSEKYGGVVK

IHGTYGSKQLFVFDPVALSSVVIKDQYIYERSDETVSSTHLLLGDGLLTSQGERHRKQRKLMNPVFSINH

MREMMPIFYRISRNLRDAIASRVDNGAQDIDILDWMSRTALELVGQAGLGYSFDPLIRDKADSYAEALKA

LIPTAFTLRTYLPFLPYVMKIGTPAMRRRILELIPSTRLQRVKEISDAVDAHSKRIFKQKKQAMTQGDEA

VLKQVGEGRDILSRLMQANMTASEEDRLSENELLGQMSTFIFAAMDTTSGALAHTLQLLAECPDVQNKLR

AEILEAQGGEQEIPYDTLVDLPYLDAVCRETLRLHAPVTIVNRKTREDVVMPLSQPIRGTDGTYMSEIPV

PKGTEVVVGILASNRNPALWGPDAGVWKPERWLAPLPETVNAARVPGVYSHLMTFLGGGRACIGFKFSQT

EMKVVLAVLLSSFKFSLSNKDVVWNSAEVQYPTVGTSNQPAMPMKIDRIKSI

//

>CYP5150D11v2 PpCYP141

scaffold 21 329865 - 332220

MHDVLGFALICLILGVLGRIFVRVFVKSPLDNVPGPPALSFAKGNIPQLYNRNGWGFIKDLSEKYGGVVK

IHGTYGSKQLFVFDPIALSSVVIKDQYIYERSDETVSSTHLLLGDGLLTSQGERHCKQRKLMNPVFSINH

MRDMTPIFYRISRNLRDAIASRVDNGAQDIDILDWMSRTALELVGQAGLGYSFDPLIRDKADSYAEALKA

LVPTAFTLRTYLPFLPFVMKIGTPAMRRRILELIPSTRLQRVKEISDAVDAHSKRIFKQKKQALAEGDEA

VLNQVGAGKDILSRLMQANMTASEEDRLTENELLGQMSTFIFAAMDTTSGALAHTLQLLAECPDVQDKLR

AEILEAQGGEQEIPYDTLVDLPYLDAVCRETLRLYAPVTIVNRKTLEDVVMPLSQPIRGTDGTYMNEIPV

PKGTEVIVGILASNRNPALWGPDAAVWKPERWLAPLPDTVNAARVPGVYSHLMTFLGGGRACIGFKFSQT

EMKVVLAVLLSSFKFSLSNKDVVWNSAEVQYPTVGTSNQPAMPMKIDRIKSI

//

>CYP5150D12v1 PpCYP091

100% to PpCYP242

scaffold 177 114804 - 117161

MLDILRFVLICGILWILRRVLLRVFIHSPLDKIPGPPPVSFAKGNLPQLYDRNGWDFIKGLGEKYGGVVK

INGLYGAKMLFVFDPAALSSVVVKDQYVYERSEDATKSTRLMLGDGLLTSQGETHRKQRKLMNPVFSINH

MRDMMPIFYQISRNLRDAIASRIDNGEKEIDVLDWMARTALELVGQAGLGYSFDPLVQDKADAYAEAIKA

LVPTAFGLRLYRPLLPIALKIGTPAIRRRILKLIPSTRLQRMREISDAIDAHSKRIFEEKKQALARGDEA

VLKQVGAGKDILSRLMQANMTASEEDRLPENELLGQMSTFIFAGMDTTSGALAHTLQLLAEHPDVQDKMR

AEIVAALGGGQEIPYDTLVDLPYLDAVCRETLRLYAPVTTVNRTAQEDIVLPLSEPIRGTDGNLIQEIPV

PKGTEVIVGILASNRNPALWGPDAAEWKPERWLEPLPDTINTARVPGVYSHLMTFLGGGRACIGFKFSQL

EMKVVLAVLLSSFKFSLSSKEIVWNVAGIQYPTVGASGKPEMPMKIDRVKNT

//

>CYP5150D12v2 PpCYP242

scaffold 177 114804 – 137778 (note same start as PpCYP091)

MLDILRFVLICGILWILRRVLLRVFIHSPLDKIPGPPPVSFAKGNLPQLYDRNGWDFIKGLGEKYGGVVK

INGLYGAKMLFVFDPAALSSVVVKDQYVYERSEDATKSTRLMLGDGLLTSQGETHRKQRKLMNPVFSINH

MRDMMPIFYQISRNLRDAIASRIDNGEKEIDVLDWMARTALELVGQAGLGYSFDPLVQDKADAYAEAIKA

LVPTAFGLRLYRPLLPIALKIGTPAIRRRILKLIPSTRLQRMREISDAIDAHSKRIFEEKKQALARGDEA

VLKQVGAGKDILSRLMQANMTASEEDRLPENELLGQMSTFIFAGMDTTSGALAHTLQLLAEHPDVQDKMR

AEIVAALGGGQEIPYDTLVDLPYLDAVCRETLRLYAPVTTVNRTAQEDIVLPLSEPIRGTDGNLIQEIPV

PKGTEVIVGILASNRNPALWGPDAAEWKPERWLEPLPDTINTARVPGVYSHLMTFLGGGRACIGFKFSQL

EMKVVLAVLLSSFKFSLSSKEIVWNVAGIQYPTVGASGKPEMPMKIDRVKNT

//

>CYP5150D13v1 PpCYP063

98% to PpCYP068

scaffold 96 156973 - 154583

MAVLLDLIRTTSLVGTLWILWRIAKRLLGRSPLDNVPGPASQSFFKGNLGQLFDRHGWDFLYGLGVKYGS

VVKINGTFGSKQLFVFDPLALNSVVVKDQYVYEEPEEVLASMHLMLGDGLLATVGERHRRQRKLLNPVFS

VAHMRHMIPIFYEITHNLRDAISTRVKDGPKEVDILDWMARTALELVGQAGLGYSFDPLIRDEADSYGEA

IKAIVPTMFPLRLVRPLLPISMKMGPRALRRAIVSLLPNQHIRRAKEISDSLDDHSRRIFEEKKLAMAKG

DQAVLHQVGEGKDIMSKLMQANLLASEEDKLPEDELLGQMTTFIFAGMDTTSGALAHILQLLADHPDVQT

KLRAEILEAQGDGEDISYDQLVELPYLEAVCRETLRLYAPVPFLTRTARKDMIMPLSSPIRGVDGNMMNE

IHVPAGTGIIIGILASNHNPEIWGPDAAEWKPERWLTPLPDAVSNARVPGVYSHLMTFLGGSRACIGFKF

SQLEMKVVLSILLSTFTFAPSEKEVFWNIAGIQYPTVGRTSRKAEMPLKVGLVKA

//

>CYP5150D13v2 PpCYP068

scaffold 5 389403-387018

MAVLLDLIRTTSLVGTLWILWRIAKRLLGRSPLDNVPGPASQSFFKGNLGQMFDRHGWDFLYGLGVKYGS

VVKINGTFGSKQLFVFDPLALNSVVVKDQYVYEEQEEFLASMHLMLGDGLLATVGERHRRQRKLLNPVFS

VAHMRHMIPIFYEITHNLQDAISTRVKDGPKEVDILDWMARTALELVGQAGLGYSFDPLIRDKADSYGEA

IKAIVPTLFPLRLVRPLLPISMKMGPRALRRAIVSLLPNQHIRRAKEISDSLDDHSRRIFEEKKLAMAKG

DQAVLHQVGEGKDIMSKLMQANLLASEEDKLPEDELLGQMTTFIFAGMDTTSGALAHILQLLADHPDVQT

KLRAEILEAQGDGEDISYDQLVELPYLEAVCRETLRLYAPVPFLTRTARKDMIMPLSSPIRGVDGNMMNE

IHVPAGTGIIIGILASNHNPEIWGPDAAEWKPERWLTPLPDAVSNARVPGVYSHLMTFLGGSRACIGFKF

SQLEMKVVLSILLSTFTFAPSEKEVFWNIAGIQYPTVGRTSRKAEMPLKVGLVKA

//

>CYP5150D14v1 PpCYP130

96% to PpCYP236

scaffold 20 374013 - 371663

MAYAITLPDALLLCSVVGALLYFVKTRVVSLPFNNIPGPPAQSFWSGHMEQYFDRHGHKFRESIAQDYGP

VVKLDGFLGSQRLYIFDPKAMHNILIKYGDVFEETDSFLRINTHFFGPGLLSTAGDQHRRQRKMLNPVFS

ANHMRHMLPIFYRVAYKLRTAIASKLQGGPQEVDMMSWVGRAALELIGQGGLGHSFDPLVSDVKDPFGAA

MKYLFPSLQDVIIWQQLIPYVDSIGSPRFRRWILEMLPSRAVKQMISSVDIMTRRAIDIFETKKAALEKG

DGDMSQHAGEGKDIMSILMRANREVAEADRLPEDEVIAQLVTLVFAATDTTSSTLTLILQLLAEHPDVQG

KLREELAKAFQAGELSYDELMQLPYLDAVVRETLRLHPPLTTITRVNREDVVLPLSQPIQGVNGKMISEI

VVPKGTTTFVGVLGANTNKAKWGEDALEWKPERWLSPLPAAVTEVSTPGVFANLMTFIGGKRSCIGFKFS

EMEMKVVLSVLLPTFTFGPTEKPIIWNFAPVAFPSIGRDSLKSQMPLSVGLI

//

>CYP5150D14v2 PpCYP236

scaffold 87 163613 - 165957

MAYAITLPDALLLCSVVGALLYFVRTRVVSLPFNNIPGPPAQSFWSGHMEQYFDRHGHKFRESIAQDYGP

VVKLDGFLGSQRLYIFDPKAMHNILIKYGDVFEETDSFLRINTHFFGPGLLSTAGDQHRRQRKMLNPVFS

ANHMRHMLPIFYRVAYKLRTAIASKLQGGPQEVDMMSWVGRAALELIGQGGLGHSFDPLVSDVKDPFGAA

MKYLFPSLQDVIIWQQLIPYVDFIGSPRFRRWVLEMLPSRAVRQMISSVDIMTGRAIDIFETKKAALEKG

DGDISQHAGEGKDIISILMRANREVAEADRLPEDEVIAQLVTLVFAATDTTSSTLTLILQLLAEHPGVQD

KLREELVKAFQAGELSYDELMHLPYLDAVVRETLRLHPPLATITRVNREDVVLPLSQPIQGVNGQMMNEI

VVPKGTTTFVGVLGANTNKAKWGEDALEWKPERWLSPLPTAVTEAPTPGVFANLMTFIGGRRSCIGFKFS

EMEMKVVLSVLLPTFTFGPTEKPIIWNFAPVAFPSIGRDSLKSEMPLSVGLI

//

>CYP5150D15v1 PpCYP053

scaffold 46 279747 - 277369

MSAVGFLLLGFLVTVVAWVSRRIVRLRRIASALDNIPGPASSSFLQGNMADYFGRQGWKFTEHVAQDYGG

IVKMHALCGERMLCVQDPKALYTVLIKEASVFEESDAFLSTNQNIYGPGLLASMGEQHRKQRKMLNPVFS

AAHMRHLLPTFYRITGKLRDAISSQVWEGPQEVDMMSWMGRIALECIGQGGLGYSFDPLVGGKMTDEYGN

ALKRLFPTLQEVNLWRELLPYVDWIGTPSFRRMALDLFPVEAIHKLKGIIDLMSMKSTALFHAKRGALKI

GDEFVVRQVGEGKDIMSILIKANMMADDADKLPDDQLIAQMSTFLLAATDTTSNALARILHNLAQYPEVQ

GKLRAEVTDAFKEGDLPYDKLIQLPYLDAVCRETLRLYPPVTFSTRVPREDSVLPLSKPMIGVDGSVMSE

VPVPEGTLIVLGVLGANTNKARWGADALEWKPERWLSPLPSTLTEAATPGVFSHIMTFLGGKRACIGFKF

SELEMKVVLSTLISTFTFELTDKEISWNQSPVHYPSVGTDATEPCMPLKVGLVNRV

//

>CYP5150D15v2 PpCYP055

scaffold 238 53498 - 51118

MSAVGFLLLGFLVTVVVWVSRRIVRLRRIASALDNIPGPASSSFLQGNMADYFGRQGWKFTEHVAQDYGG

IVKMHALCGERMLCVQDPKALYTVLIKEASVFEESNAFLSTNQNIYGPGLLASIGEQHRKQRKMLNPVFS

\AAHMRLLLPTFYRITGKLRDAISSQVWEGPQEVDMMSWMGRIALECIGQGGLGYSFDPLVGGKMTDEYG

NALKRLFPTLQEVNLWRELLPYVDWIGTPSFRRMALDLFPVEAIHKLKGIIDLMSMKSTALFHAKRGALK

IGDEFVVRQVGEGKDIMSILIKANMMADDADKLPDDQLIAQMSTFLLAATDTTSNALARILHNLAQYPEV

QGKLRAEVTDAFKEGDLPYDKLIQLPYLDAVCRETLRLYPPVTFSTRVPREDSVLPLSKPMIGVDGSVMS

EVPVPEGTLIVLGVLGANTNKARWGADALEWKPERWLSPLPSTLTEAATPGVFSHIMTFLGGKRACIGFK

FSEMEMKVVLSTLISTFTFELTDKEISWNQSPVHYPSVGNDATEPCMPLKVGLVNKGQ

//

>CYP5150D16v1 PpCYP016

scaffold 38 78217 - 75879

MIDSTVLLYCALLVAATWLMRMQSSQRSTYRTLGNIPGPSSHSWLKGNFMKFFDRHGEIFQQDVALNYGP

IVRLEGRCGRKILYVSDPKALHTMLIKEENVYEATDAFFASRRLIFGECLLATAGEHHRRQRKILNPVFS

VSHMRHMLPIFYNVIFKLREVVRTKVEAGKSNIDVLEWTGRAALELIGQGGLGYSFDPLAADTETRNEYG

DALKALNANLMQVEIFIRYADVLIELGPRRFRRFVTDIFPHPHLQRVKDVIDTMDEKSRAIFREKETALE

NGDKAVLHQVGEGKDIMSVFIKANNAASEQDRLPENELIAQMSLLLSAATDTTSNTLSRILYLLAEHREL

QSKLREEILESDAGSGNISYDELNKLPLLDAVCRETLRRYPPVTNLVRAPRKDSVLPLSEPICGVDGTMM

KEVAIPKGTELLIGTFGCNVNKALWGEDSLEWKPERWLSPLPRAVTEASIPGVYSNLMSFMGGKRACIGF

KFSEMEMKVVLSVMLSNFTFELTDKPIEWNIGVVWYPTIGRHSDLPQLLLKVGLYKA

//

>CYP5150D16v2 PpCYP213

scaffold 81 295612 - 297949

MVDSTILLYCALLVAAAWLLRMQSSQRSTYRTLGNVPGPSSHSWLKGNFMKFFDRHGGTFQQDVALNYGP

IVRLEGRCGRKILYVSDPKALHTMLIKEENVYEATDAFFASRRLIFGECLLATAGEHHRRQRKILNPVFS

VSHMRHMLPIFYNIIFKLREVVRTKVEAGKSEVDVLEWTGRAALELIGQGGLGYSFDPLATDTETRNEYG

DALKALNANLMQVEIFIRYADVLIELGPRRFRRFVTDIFPHPHLQRVKDVIDTMDEKSRAIFREKETALE

NGDKAVLHQVGEGKDIMSVFIKANNAASEQDRLPENELIAQMSLLLSAATDTTSNTLSRILYLLAEHREL

QSKLREEILESDAGSGNISYDELNKLPLLDAVCRETLRRYPPVTNLVRAPRKDSVLPLSEPICGVDGTMM

KEVAIPKGTELLIGTFGCNVNKALWGEDSLEWKPERWLSPLPRAVTEASIPGVYSNLMSFMGGKRACIGF

KFSEMEMKVVLSVMLSNFTFELTDKPIEWNIGVVWYPTIGRHSDLPQLLLKVGLYKA

//

>CYP5150D17v1 PpCYP066

97% to PpCYP001 
scaffold 94 47611 - 50024

MDALDVRSQLCLAGAVVVFSLLLLFRGKSDSALNNIPGPPSQSLWTGNLNQWLARDGAEFQRNVAFNYGP

VAKIHGFLGRPILYVADPKALQTILVKEEHVYQEMPAFFAHMNLLFGPGLLGTAGDKHRKQRKLLNPVFS

IRHMRHMLPIFYGVVHKLRDAIAMRVSDGPAEIDFLHWMGRTALELIGQGGLGYSFDKLVEDGDNEYGHA

IKSLQPTLQRINILRRLLPYVHKLGPVWFRRLVMQYFPIKNVREAKMCVDTMHRCSTEIYKSKKIALARG

EEAVLKQVGEGKDIMSILMKANMAASAADRIPEEELLAQMSTFISAATDTTSNTLARILEQLATHPETQQ

KLREEIITADAGETMAYDDLDSLPLLDAVCRETLRVFPPVTNLARTPIQDAILPLSEPIVGVNGTVMHEI

MVPKGTEIFIGVQGSNGSQARWGGDSYEWKPERWLSPLPKTVTGAPVPGVYSNLMTFMAGRRACIGFKFS

EMEMKIVLAVLLSNFTFELTAKPIEWNVSGVRYPTVGKESNVAQLPLKVGLYNNCKT

//

>CYP5150D17v2 PpCYP001

51% to CYP5150A2 Phanerochaete chrysosporium
scaffold 65 206422 - 208828

MDALDVRSQLCLAGAVVVFSLLLLFRGKSNYALNNIPGPPSQSLWTGNLNQWLARDGAEFQRNVAFNYGP

VAKIHGFIGRPILYVADPKALQTILVKEEHVYQEMPAFFAHMNLLFGPGLLGTAGDKHRKQRKLLNPVFS

IRHMCHMLPIFYGVVHKLRDAIAMRISDGPAEIDFLHWMGRTALELIGQGGLGYSFDKLVEDGDNEYGHA

IKSLQPTLQRINILRRLLPYVHKLGPVWFRRLVMQYFPIKNVREAKMCVDTMHRCSTEIYKSKKIALARG

EEAVLKQVGEGKDIMSILMKANMEASVADRIPEEELLAQMSTFISAATDTTSNTLARILEQLAIHPQTQQ

KLREEIITANAGETMAYDDLDSLPLLDAVCRETLRVFPSVTNLARTPIQDTILSLSEPIVGVNGTVMHEI

MVPKGTEIFIGVQGSNGSQARWGGDSYEWKPERWLSPLPKTVTGAPVPGVYSNLMTFMAGRRACIGFKFS

EMEMKIVLAVLLSNFTFELTAKPIEWNVSGVRYPTVGKESNVAQLPLKVGLYSNGKT

//

>CYP5150D18 PpCYP081

scaffold 107 269951 - 267548

MSTDNIPTQLGIAGAVAVLLFLLRRWSSRSTLRNIPGPPPQSQWTGNLKQWFARDGADFQRDVSFNYGPV

AKIHGFLGRPILYVADPKALQTILVKEEQVYQETKAFFAMTYLLFGPGLLATAGEKHRKQRKLLNPVFSI

KHMRHMLPIFYGVLHKVRDAITMRVSDGPQEIDMLKWMGRTALELIGQGGLGYSFDKLVEDGDNEYGRAL

KHLQPTLQRINVLRRLIPYVYKLGPAWFRRMVMHYFPLGQVRDAKEIVDTMQRCSSEIFASKKIALARGD

EAVMKQVGEGKDIMSILMKANSMASEADRIPEEELVAQMSTFLFAATDTTSNTLARILQQLAIHPDTQQK

LREEILAANAEEYMAYDDLDALPLLDGVCRETLRVFPGVTNLARTPTQDTILPLSEPVVGTDGTVMREIL

VPRGTEILIGIQGSNGRKERWGEDSYEWKPERWLSPLPKTVTENPVPGVYSNLMTFMAGRRACIGFKFSE

MEMKVVLAVLLSNFTFELTDKPIQWNISGVRYPTVGKDSNVAQLPLKVGLYKKPTLQ

//

>CYP5150D19 PpCYP193

50% TO CYP5150A4 Phanerochaete chrysosporium
scaffold 9 710212 - 712568

MNLLISTAAWGLLGSLAFAICKCIRCLVFSPLDNIPGPLHLSFWSGNVGRFFDRHGLKFHMQLAQNYGRV

VRMHGPFGRRILYVYDPLALHSMLAKDQTSFEESSNFIYCNQLLFGPGLLSTVGEQHRKQRKMLNPVFSI

NHMRRLLPIFNQAVHRLRVAISWEVIEGTEEIDMLDWMGRLSLELIGQGGLGYSFDPLVEDAKNEYGNAL

KIIFAALQDVFFLRPLLPYASLLGPRWIWRRLLDLIPYAPARRLKTLVDVMADHSVLIFEQKKIASANGD

QALERQLEEATDIMSILMKKNMTAANEDKLDESEVVAQVSTMTLAATDTTSNTACRILHLLAEHPEAQNR

LRQEIMGASSGEDISYDELNQLPYLDAIIRESLRLYPPATLISKEAIADTILPLSEPIIGMDGKMIAEIP

IARGTEIYVGILGSNTNKAMWGEDALEWKPERWLSPLPRTLMETPIPGVYSKLMSFLGGKRACIGFKFAE

VEIKTTLFVLLSTFKFDVTNKSIVWNVATVNYPTVGMDSAKPEMPLRVQLLS

//

>CYP5150D20 PpCYP185

scaffold 41 30951 - 33309

MDTLPTVLFLVLAGGAAWSAWQRSQRRKNHVLENLPGPPSRSFLKGSLGEMFHRHAWPFQTDVALNYGPV

VKLRGFLNRPIVFVSDPTALHTMIIKEEHIFEESQSFILGNKLIFGPGLLATLGDQHRKQRKILNPVFSV

AHMRNMLPLFYDVIYRLRDAISLQVKSGQSEIDILAWTGRVALELIGQSGLGYSFDDFVSDMKDDYGAAL

KALFPRLMDVDILQRLLPYMPLTVPAGVRRLAISLMPNAAVQKLRSIVDVMSARSVRIFMSKRKALADGD

EAVLEQIGKGKDIMSVLMKANELASENDRLSEEELIGQMSTLVFAAVDTTSNTVARILHILSERPHVQDK

LRQEILAAGAHNKFSYDELNKLPFLNAVCRETLRLYPIGTTVMRVPNKDTVLPLSEPVVGVDGTIIKEIP

IPKGTEVLVGAWACNIKKSLWGEDSTEWKPERWVNGLPTAVLEAPIPGVYSHLMTFLGGKRACIGFKFSE

MEMKVLLSVLLSAFTFEPTGRPIIWNLAGVVYPTTSRESETPEMFLKVGLYSEGAKTE

//

>CYP5150D21 PpCYP178

94% to PpCYP193

scaffold 75 222427 - 224780

MNILISTATWGLLGSLAFAIWKRIRCLVFSPLDNIPGPSRQSFWSGNVGRFFDRRGLKFHMQLAQNYGCV

VRMHGPLGRRMLYVYDPLALHSMLAKDQTSFEESSNFICCNQLLFGPGLLSTVGEQHRKQRKMLNPVFSI

NHMRRLLPIFNQAVHRLRVAISSEVIEGTEEIDMLDWMSRLSLELIGQGGLGYSFDPLVEDAKNEYGDAL

KVIFAALQDVFFLRPLLPYASLLGSRWIWRRLLDLIPYTPARRLKTLVDVMADHSVLIFEQKKIASEKGD

QALERQLEEAKDIMSILMKKNMAAANEDKLDESEVVAQVSTMTLAATDTTSNTACRILHLLAEHPEAQNR

LRQEIIEASSGEDISYDELNQLPYLDAIIRESLRLYPPATLISKEAIADTILPLSEPIVGIDGKMIAEIP

IARGTEIYVGILGSNTNKAMWGEDALEWKPERWLSPLPRTLMETPIPGVYSKLMSFLGGKRACIGFKFAE

VEIKTILFVLLSAFTFDVTKKSIVWNVATVNYPTVGMDSAKPEMPLRVQLVS

//

>CYP5150D22 PpCYP096

scaffold 309 23100 - 20941

MPRGSIPNRERPATSVWLGAKRALGRAASSGPIRRAPSKASKSVEGEIEVLGTESKCRAGCECRKEVYRG

PAGLGAYQRLNSFLLHFHIDHSVSGNGLVFGKGLLTTLGHQHRKQRKLLNPIFSINHMRHMLPIFNKVAE

NLKEGITIKVRSGVREQDMLEWMSRTALELIGQGGLGHSFDPLVKEVDNTYGHALKALMPALFSLAILRR

LLPYVVNIGSPAFRRRVLELIPNKRIQRVRELVDIMDQTTRQIWENKKAAFAKGDEAVLQQVGEGKDIVS

KLLQANEDVSEEDKLPDEELLAQLATLTSAAVDTTSSALARILHLLAENQDVQEKLRREIVDAHKDGNEL

SYDELVELPYLEAVCRETLRLYSPASWVTRKTRQDTIMPLSKPLRGVDGTLIHEIPVPKGTEVVVGIRAA

NRNPDLWGPDSDEWKPERWLSPLPNTVTNAHVPGVYSNLMTFLGGSRACIGFKFSQMEMKIVLVTLLQSF

KFTLSDKPIVWNLSGIAYPTIGPVDPVARLPLNVEVISS

//

>CYP5150E1v1 PpCYP149

95% to PpCYP190

scaffold 33 472830 - 475278

MSVAHAGASVLLALVLWALVKRLTATKARAIDIAGPEKDHWLKGNYHRIFQDGLEYNLQLTEKYGGAVRI

HALLGEEQLYVSDPRALHHIVVKEQDVYEETDMFIMGNKLIFGEGLISTLGEQHRKQRKMLNPVFSLANM

RDLLPTIQPIADQLCDLLVSKITAGEQEIDIVPWTSRGALEYICQAALGYTFDALNPEKTSEYAEALRRF

SPTALRLILIRPFVPFFVRNFSLQWRNRIMDWYPSSLMHRTCKGIYADKKSAIEGTLVDGSLKLNEPQGA

TGFRSRGRDIMSILLRANRPSNVRDMLTESELLGQMNTIIFAGFETTAIATSRLLYLLASRPDAQARLCR

EVRAAKMAHVGDSARWQDVNLSYDVLMGLPYLDALVRETLRVYPPTSILSRTTRKSTVLPLEFPVRSASG

QEVTSVPLPENTTVIISILAANHNKEIWGEDASDWRPERWLTSTGERILPGNRDGIKYPGVYASMMTFLG

GGRACIGFKFAEMEMNQVLTTLLSTLHFSLPAEKEIYWKMNGLQVPVVRPPAGDGQTPQVPLKIRLVRDD

DY

//

>CYP5150E1v2 PpCYP190 cyan = possible intron

51% to CYP5155A1 Phanerochaete chrysosporium  with cyan removed
scaffold 27 91653 - 94111

MSVAHAGASVLLALVLWALVKRLTATKARAIDIAGPETDHWLKGNYHRIFQDGLEYNLQLTEKYGGAVRI

HALLGEEQLYVSDPRALHHIVVKEQDVYEETDMFIMGNKLIFGEGLISTLGEQHRKQRKMLNPVFSLANM

RDLLPTIQPIADQLCDLLVSKITAGEQEIDIVPWTSRGALEYICQAALGYTFDALNPEKTSEYAEALRRF

SPTALRLILIRPFVPFFVRNFSLQWRNRIMDWVPIKPLKEFRRIVEVMHRTCKGIYADKKSAIEGTLVDG

SLKLNEPQGATGFRSRGRDIISILLRANRSSNVRDMLTESELLGQMNTIIFAGFETTAIATSRLLYLLAS

RPDAQARLRREVRAAKMAHVGDSARWQDVNLSYDVLMGLPYLDALVRETLRVYPPTSLLSRTTRKSTVLP

LEFPVRSASGQEVTSIPLPENTTVIISILAANHNKEIWGEDASDWRPERWLTSTGERVRLSDGENPPDGY

VVVERSEEEDKVPGNRNGIKYPGVYASMMTFLGGGRACIGFKFAEMEMKQVLTTLLSTLHFSLPAEKEIY

WKMNGLQVPVVRPPAGDGQTPQVPLKIRLVRDDDY

//

>CYP5150F1 PpCYP153 
44% to CYP5150A4 Phanerochaete chrysosporium
scaffold 154 93727 - 91439

MTTFDLLHSIVYIALTWALWYALRSWLVKSPLDDIPGPKRQSFAKGDYARLYHRHGLDFHFHIWKKYGRV

AKIHAPFGAQALYVYDPKALHHLLIGDPTAVEQSHFIVESYRLILGPGLMSITGDRHHRQRKVLNPVFST

ANLQAMMPIVGHVAQELRDVIANQVGKSAQEIDMLRWMNRGALEILGQAGLGYSFGPLSADAPDQFARAL

KGLFPSMSRLGFLRQLTPLFIKCGSARFRRAVVERIPSSAVKNLLSIIDVMDEASRNIFLSRKRAIMGET

SDSPGQVGEGKDLMSFLLRANMATDMEDRLTDDELLGQISSFVLAGTDTTASVVTQILQHLAEHTAIQDR

LRQELNDVDVEHISFTALMKLSYMDAVVKETLRLNTPAAMVSRQTQKDVVIPLASPLRTLDGSLRNEIVA

PKGTIIFLGLLALHRDKDIWGEDANEWKPDRWLRPLLTTVADAHIPGVYSPLMTFVGGNRSCIGFRFAEM

EIKQLLAVLISSFRFAATQKNIVWNIATVRFPTIGPEGSVPQLPLIVSRV

//

 

CYP5151 family (1 sequence)

 

>CYP5151A3 PpCYP006 64% to CYP5151A2 Coprinopsis cinerea

MPTSYIMLVNAVLAAFIPLLVYLLYLVFIQPRFNPLRKLPGPPSKRWRADHLGMVMNPSVSPRMHEAFVK

QYGRNITIRGPIPWDYRFFTLDPVALGHVMKNSHLYEKPWQSRRLITGLIGCGMLAAEGAAHKRQRRVAT

PAFSIQNMRALVPLVFAKGHELKERWAAMIADPIAGDSGKDARRRIDVCHWVSRATFDVIGSAGFDYQFN

AIQNESNELFNAYKEMFEVAISQQQGSYRGLFAIYFPIIDVLFPDKAVRTVRRCQGVIRRVAGQLVQEKK

RKIAEAEASGVAHQGKDLLSLLLRSNAAADLPPEQRISDEDILHNINTFMFAGSDTSSLSITWTLFLLAR

YPSIQTRLRAELLAVAPTASLAALTSEEIASLYAAVTDLPFLENVVRESLRLIPPVHSSIRVATQDDVVP

TSVPVRTRMPDGSVQDLMHVMVPKGAFIHVPVEGFNMDREVWGHDAWAFNPDRWDNLPEAVASQPGLYNN

TLSFSAGPRSCIGLRFSIIEIKTFLYILLTNFVFAETESQVGKANVVLTRPYVIGKHMEGSQCPLYVSPY

VAEA

//

 

CYP5152 family (3 sequences)

 

>CYP5152A3v1 PpCYP064

98% to PpCYP088

scaffold 51 206151 - 203980

MFLQIVTSVLATGLLYALISVLQQNRTLSASLPPGPPGHWLFGNAPPRAFPYRHFAELTETYGPVFTLRF

GRRIVCVIGRYQAAVDILMKHSAETSDRPRSVAANEIMSKGHRVLMTPAGERLKKYRRALHAFLQPSSSA

TYKPMQYKNAKNYVLDCLHDGRHHLYHGRKYAASVVMSVAYGKTTPTSYSDPEVLQINKSLARLGAALKP

GAYLVDTYPILKYCPGYASHLRRYREEELALITKQANAVRELLAKGEAPPSFTAYLIENQERLGISDDEL

AYLSGAIFGAGSDTTAAALGIMTMAAACYPEAQARVQAQLDEVVGRDRAPTFEDEDLLPEVTAFVLEAYR

WRPVSAGGFSHRATKDVVWNGYVIPAGAEIIGNHWAISRDPEVYPNPEDFKPARWLNEHGRIRNDLKFIN

FGFGRRVCVGQHVADQSLFINTALVLWAFRISQDAQCPIDTYAFTDTANVHPLPFSLHFEPRVKDMEAML

GAQAE

//

>CYP5152A3v2 PpCYP088

scaffold 193 21498 - 23567

MFLQIVTSVLATGLLYALISVLQQNRTLSASLPPGPPGHWLFGNAPPKAFPYRHFAELTETYGPVFTLRF

GRRIVCVIGRYQAAVDILMKHSAETSDRPRSVAANEIMSKGHRVLMTPAGERLKKYRRALHAFLQPSSSA

TYKPMQYKNAKNYVLDCLHDGGHHLDHGRKYAASVVMSVAYGKTTPTSYSDPEVLQINKSLARLGAALKP

GAYLVDTYPILKYCPGYASHLRRYREEELALITKQANAVRELLAKGEAPPSFTAYLIENQERLGISDDEL

AYLSGAIFGAGSDTTAAALGIMTMAAACYPEAQARVQAQLDEVVGRDRAPTFEDEDLLPEVTAFVLEAYR

WRPVSAGGFSHRATKDVVWNGYVIPAGAEIIGNHWAISRDPEVYPNPEDFKPARWLNEHGRVRNDLKFTN

FGFGRRVCVGQHVADQSLFINTALVLWAFIISQDAQCPIDTYAFTDTANVHPLPFSLHFEPRVKDMEAML

GAQAE

//

>CYP5152A4 PpCYP113 
58% to CYP5152A1 Phanerochaete chrysosporium, 76% to PpCYP088
scaffold 92 66951 - 64800

MFLQIAACFTVIGLLYGLVSNLQQNRRLAASLPPGPPGHWLFGNVPPKNFPFIRFAELTEIYGPVFTLRF

GRRIVCVVGRHQAAVDILVKHSAETTDRPRAIAASEMLSQGFRILMTPAGERLKKYRRAFHTCLQPSAAA

TYKPIQYNHAKNYILDCLHDGKCHLEHGRRYAASVVMYIGYGKTTPTSYSDPEVQEVNKCLGRLSEVIKP

GAYLVDTYPILKHIPGYASHLWRYGREELALYTRQANAVRKQLEKDEAQPSFAAYLIENQERLGLSNDEL

AYLSGAIFGAGSDTTAAAIAVMTMAAACYPETQARVQAQLDEVVGSDRAPTFEDEEMLPEVTAFVLEVYR

WRPVSAGGVPHRSTKDIVWNGYVIPKGTEIIGNLWAIGRDPELFPDAEEFRPQRWLNENGRIRDDLKYPV

FGFGRRVCVGQHVADQSLFINTALALWAFKISQDPAKPIDVLAFTDTANIRPLPFTLRFEPRVKDIEAVL

EAHLD

//

 

CYP5156 family (1 sequence)

 

>CYP5156A3 PpCYP024 
50% to CYP5156A1 Phanerochaete chrysosporium (modified)
62% to CYP5156A2 Gloeophyllum trabeum (partial)
MYSTVGFVVFLTACLPYATALKVALAIPSTVFCLWLSLLTTCKDDDPDEPMSLPTGHFSINTSFFRTRYD
FINRGFELTGQSIYKFKLLRVTILIMPPARPR (2)

ADLFNSRDLDLTAGFKALSGA  (0)

IPMLPGVTTDLDPKQTATIHRRLATAQNSDHLERLIPKLLFDSCRILESWGESGVLDPFTKLPELTFQTN

VRSLACAEIADNAATVAHLKQLYDTLDAATTPTSVLFPWLPSPSAIRRLLATKKIYDVISAAVDVRSQCG

PAQDDTLQLLLDSGDDKMTIVGFTMGLLIAGARSTGTTSSWLITFLAGHRQWKDRTARELHQLLAEHALS

TAPSTPRAPAHTARSPSPPPLADLAARLAAVPLAAWEAHTPVLDAVLRETLRLAQPHTALRQNCSAAPVR

VGGAAVPPGAFAVFPFSDVHLSAALYPDPWRFDPARPASKMPFAFVGWGAGATVCLGQRLARVQLKLVTA

LVVLGFDLAPVDRAGRELAELPRPNWNDALACRPADGSCFLRYERA

//

 

CYP5158 family (2 sequences)

 

>CYP5158B1 PpCYP032

49% to CYP5158A1 Phanerochaete chrysosporium

MLLNEKAFSLELGRYLLAIPIVIVLWLWRQRQRRAFPPGPPARFIIGNILQVSPLGAWFKFCQYKEQYGD

LLFFHGLGNHVLVLNSMKAINDLLDKRSGIYSNRPTFTVVSELMGLSQSMPLLPYGEEWRAHRRLAHTAL

SPAAVKRYHGVQEDLAALLCQRLLQSPEDFFNHVRLIAGNVILSVVYGLPVETAEDEYIAHAERTMQVIS

EATVPGAYLCDLMPFLKHLPSWVPFQREASTGREMIERLVSKPYEHVKREMDAGRAPPSMTQDLLSVRIN

DMQDIEQRIKWTAGAMYGAGGETTYSTVLVFIMAMALHPDKQRRAQQELDSVVGTGRFPSISDRAHLPYV

NAVIKETMRWHPVLPLSIARMSAQDDLYNGYYIPKGTIVIPNVWAVALDCPQGTEFIPERFLGDDAPIDP

ATWAFGFAKRICPGKYLGENSVFILITTLLAMFDIMPDPSEDLRPNFTLNLVSYPHPFKCRIQPRSEAHA

QMMLLRASNYSA

//

>CYP5158B2 PpCYP074 
45% to CYP5158A1 Phanerochaete chrysosporium 
78% to PpCYP032

MRDSLARNILLPTAPSLGAIACLLLAIAIGLLLLPRSQPHCFPPGPPVKPIVGSILQVSPQGAWYKFSEY

QKVYGDLLFFRGLGSHVLVLNSMKAINDLLDKRSSVYSNRPTFTVVGELMGLGQSMPLLPYGEEWRAHRR

LAHSALSPTAVRRYHGIQEDMAALLCMRLLREPEAFFSHVRLIAGNIILSVVYGLPVETSEDEYIAHAER

TMQVIGKATVPGAYLCDLMPFLKHLPSWVPFQREASTGREMIERLVTKPFEHVKRAMEAGSAPPSVTQDL

LSTNIDDMHDVEQRIKWTTGAMYGAGGETTYSTVLVFIMAMALHPEKQQRAQQEIDRVIGIERFPRISDR

AHLPYVNAVIKETMRWHPVLPLSIARMSAQDDLYDGYSIPEGTVVIPNIWGIANDCPRATEFDPERFLNE

GAPVDPSSWAFGFGKRLCPGKFLGENSVFILITALLAIFDITPNSSEDLQPDFTLDLVSYPRPFKCRIQP

RSEGHAQLAISRAAQRSF

//

 

CYP5339 family ( 2 sequences)

 

>CYP5339A1 PpCYP188 
35% to CYP5154A1 Phanerochaete chrysosporium
scaffold 63 56759 - 58904

MSTIAITVCLLIIFLFHRVLLFRRKLKVVVILLVRGVSFIHYQAVNNLPGIRCTFPLLSLLNAIIGTNKW

NPGLLWAWTWRASLYSSYGSETISVVPIFGAPAISTSSVEIARQLMSQDNTAQLLLSNNIVFATPDTYKK

HRRAVGPAFSAKTYTMVARETVQLYHEMVRCEGWTSQTSIHLDNVSQWMSKFTLGVLTRCAFGMSFSWND

DDHAEGMSIGTTLALVVQGTIIRQVVPQWAYRLPIRRLREVDEAYTRMTAFMQSLVADKKAEAVTVEGND

TSPNDLFSRLIQASESEGKNGLTDKELISNVFIFLFAGHDTTAHVLTTTLALLALHEDEQEKAVEAIHEA

LPDFRNPTFDDFDALKKVLACFLEAARLFPPVSGILRVSGSTIALRQKGDYQPLFIPPGIKVNVDTIGIL

YNPKYFPDPERYDPSRWYGENSELDFTFFGIGPRACIGRKFALTEAVCLLVCLLRDWKLDVPLEHGETGE

MWRQRVMQIKFLGLTLGVPDVPLLMTKRTTA

//

>CYP5339B1 PpCYP144 36% to CYP5154A1 Phanerochaete chrysosporium
46% to PpCYP188
scaffold 239 83851 - 81725

MVFVRPISHRPDGGLLDTSRTCPRCLFEASGKMTILLLLLILINHLCRELVEFLGSAPGLDWRWLWRKTV

YKHYDSRTISAVPLICGAPLICTASLDVAKQVLSGDKRYYKGPTSTAALRLWGENVLSAEHDVYKKHRKI

VGPAFTGSTYVSVARQTVNLYKEMIEGEGRDKLNVIELSSINEHMQKFALGVFTRCGFGMPFHWVSPDDP

DMSYEEALATALSGAAARVAMPQIAYRLPIKRYSMDASTNKRMAVLIRQFVETRRSELAGNHEADDATGH

DILTCLVYASQLEGEKGLTDSELIGHVFALIFAGHETTGHTLSATLALLALHNEEQDMAVKNILDVLRDG

RDPVDRQTFDDYPKLERVRACFQEAARMFPSTNLVTRDTAEAVVLSLPHTNGSEPLVVPPGVRILIDMIG

IRKALPHPERFDPSRWLGVPERDLTFFGIGPRACLARKFALTEVVLVLTMLLRDWKVSVRLERGESMEQW

RLRIMNFSLIGLGFGIQPAPLVLTRRT

//

 

CYP5340 family ( 1 sequence)

 
>CYP5340A1 PpCYP106 33% to CYP5139B2 Cryptococcus neoformans

MDWSTYNAALPTVGVVNALGALIALWVVYAIAQHMRRRAHCTPLASPPNPSFLFGIGRSLFKHPDPAAVY

EQWAEKYGSVFRIPATLGYSRVVLCDPKAIQHFYSHETFLYQQTTLTKQSIESLLGRGVLWAEGESHKRQ

RKALTPAFSNAAIRRLTYIFFDSAYKIKTAWDSIIAAEGDDSAIIEVQAWMNHVSLDSIGIAGFSHDFGT

LHGKHSTVAETFDSFSSLKPTLIGVAVFIVGLAFPRVMMRIPTAFRMLVKQLNASMAEVADDLLANTRKE

SEGEDKAEDKSIIGLLVKAESHQSDLHISQDEVMAQMKVLILAGYETTSISLTWCLVELCKKPEIQAKLR

DELSQISSGDPTWDQLTNGFPYLDAVVHETLRLHPPLGETTRMATEDAIIPLSTPLKIPTGTVVDSVAIA

KGDIVTVPIHLMNSWPEFWGPDAREFNPERWLAEDGVPKKAQELQGHRHLLTFVDGPRICLGRGFALAEF

KAVLSVLIRNYTFEFRDGPDTQIERVRGILPRPGVAGEKGAKIPLRVRRLE

//

 

CYP5341 family ( 4 sequences)

 

>CYP5341A1 PpCYP057

Scaffold 21 239434 - 241975

MLPTSLAEQAVLIVLASALYCVVSNLFQSKTSVQALPVPLGAQWIWGHERTVFVREPGRAFRGWIREKGL

TFRIKAAFRAPDVVVLSDPVGIAHILQKKVYDYPHSQVVRPRVARLLGKGLGWVEGETEHKRMRHMVTPP

FSHENIRAMSQDIAAASMQIVDDLTLEVQGSSKDSSYNALEWTAKATLNVIGRVVFLHDFEGGNSEDAKL

ILNARRRGVNPVLQYAGFLTLMLLRRFPILNKLPIWAIQSQGLAKMVIQSGVAYEMIRRNEGLVGNIQPK

QQRDLLTRLLSAHAEGRISRQELLEQISTFVISGHETTTQTLGFTIFELARHPDIQRRLRAELAELGREP

TYDDFHARLPYLDAVLKETLRLYPGLPYMERTAACADIIPLRDPVQLSTGQLITALPVAPGQVVLIPIIA

IHRLDAVWKDADTFRPERWLHDLPASESLCNGWANTLAFSDGPRSCIGMRLAIYQYKVILTQMMGRFRFV

DSGADIMLKVSSSLQAWDACAIEKGPCIPVRLELL

//

>CYP5341A2 PpCYP035 
81% to PpCYP057, 30% to CYP5139C1 Sporobolomyces roseus
39% to PpCYP186 and PpCYP189
scaffold 142 134125 - 136644

MFPASLAEQATSVILVLALLWAASSVLRSKSIVQALPVPSGAEWVWGHEKTVFMKEPGRACREWIHIHGL

TFKIKAAFRAPDVLVLGDPLGITHILQKKVYDYPHSEVVRPRVARLLGQGLGWVEGEAEHKRMRHMVSPS

FSHENIKAMSQDIAVASVQVIDNLTLEVQGSSDGALINVLDWTAKATLNVIGRVVFLHDFQGGNSDDAQL

ILNARRRGVGPVLQYAGFLTLMLLRRFPILNKLPISAIQSQGLAKTVIQSGVAHEMIRRNEALVANKQLQ

QKDLLTRLLSAHSTGKLSHEELLEQISTFVVSGHETTTQTLGFTVFELARHPVVQERLRTELAELGHEPT

YDDFQARLPYLDAVLKETLRLYPGLPYMERTAIRADVIPLREPVRLSSGELISALPVLPGQVVLIPIIAI

QRLDAVWKDADTFRPDRWLHDLPPSEALCTGWANTLAFSDGPRSCIGIRLAIYQYKVILTQMMDRFRFVD

SGADIMLKVSSSLQAWDSAAIEKGPCIPVRYELL

//

>CYP5341B1v1 PpCYP189

scaffold 4 978215 - 980716

MYSTFPTTEHALLLLTLVAILYVYRSVVRRRSEDVHRLLTAPRDVASLWWGHELLAFEGEATEMYTRWAS

VCGPIFKIKAALFHPDIVVVTDHAAVQYIFQNVDDYVKSPAFRPPVANVLGKGLVWAEGDDHKNQRRILA

TAFSPEAVKGMSDDIAECSEKLESRLTNHVLSHGGGSTVNIVEHTSTCTLDIIGRVAFGYDFKAGQSTEA

QQIRASWEGHVNSGIQFGAFIAMLVIRACPSVFLLPLPAIKAGGRIREIVSKLSMRLLRRGAFNDRGRDI

LSILMKNDGARAAKEERLTPQQVVDNISTFMMVGHETTAGSLNFTLLELARRPGLQRRLREEVRRKGREL

TYEDVQRLELLDAVVKEGLRLYPASPQTERVALKDDVIPLSKPVRTSDGTSIISLRVAAGQVFHIPFTTM

HVNPAVWGPDAAEFKPERWLVPGGVPPPSELPHGWSGLVTFCDGPRNCIGYRLAIYEFKVILATLVRSLE

FRETTAEVHTRISPTLQPVTDGQGGLLPLYISLAA

//

>CYP5341B1v2 PpCYP186

98% to PpCYP189

scaffold 41 50609 - 48093

MYSTFPTTEHALLLLTLVAILYVYRSVVRRRSEDVHRLLTAPRDVASRWWGHELLAFEGEATEMYTRWAS

VCGPIFKIKAALFHPDIVVVTDHAAVQHIFQNVDDYVKSPAFRPPVANVLGKGLVWAEGDDHKNQRRILA

TAFSPEAVKGMSDDIAECSEKLESRLTNHVLSHGGGSTINIVEHTSTCTLDIIGRVAFGYDFKAGQSTEA

QQIRASWEGHVNSGIQFGAFIAMLVIRACPSVFLLPLPAIKAGGRIREIVSKLSMRLLRRGAFNDRGRDI

LSILMKNDGARAAKEERLTPQQIVDNISTFMMVGHETTAGSLNFTLLELARRPGLQRRLREEVRRKGREL

TYEDVQRLELLDAVVKEGLRLYPASPQTERVALKDDVIPLNKPVCTSDGTSITSLRVAAGQVFHIPFTTM

HVNPAVWGPDAAEFKPERWFVPGGVPPPSELPHGWSGLVTFCDGPRNCIGYRLAIYEFKVILATLVRSLE

FRETTAEVHTRISPTLQPVTDGQGGLLPLYISLAA

//

 

CYP5342 family ( 1 sequence)

 

>CYP5342A1 PpCYP200 33% to CYP5144C1 Phanerochaete chrysosporium

MAWLSASLTILLRSPFYPAIVLAVYALWFTPVGGFNGPRAWHIIGNTLQVPADGLWRWSIQLYKEYGAIV

HLRLMGDDVLILNNSCDAEELLNKRAIHYSGRKNSIYLEYRSNGKRMLLLPQGDELRSQRRAMKFMFRPD

ALRAYHLRQEQQARGLLNDLLLDPKNYAIALKRFSSGIIMGICYGKRVDEHDEDLKEILESNRTLNQDAL

PGAHLVDLFPILDHLPDFLAPWRKDARAKHVHESSLFCRLADAVRTRMRQGTASHCLIAQLWEQQSGLAL

DDKSVAYLGGSAFEAGTQTTGCSLHSFLAACLIWPEIQTIAQTEMDKVLGDAPPTLSDMMQLPLVFSIVK

ELIRWAPVTPLAFPHMAECDDEYKRVKVRIAPAIWNMQHDSENFPHADRFDPFRFYDPNDECCVRKDASL

IDDFWTFGFGRRACPARYLAVNSMWIAVASLLWAFKFEPSRDHKTGALVNYNLGDLKWQTGVNMYDSVVR

AFHRY

//

 

CYP5343 family ( 1 sequence)

 

>CYP5343A1 PpCYP160 36% to CYP665A1 Aspergillus nidulans
36% to CYP619B2 Aspergillus nidulans, 37% to CYP665A1 Aspergillus nidulans

MLNTQLLLVLAGLAFLFLTAKKWITRRHTNQTLPPSPPPLPLLGNLHIFPTKDVHYQFTKWARQYGEIYT

LYLGPTTAIVLTSPLAIQQILEKNSALTSDRPDNYIARLVTGDDHNLVLAHYTDTWRSLRRGAHGILTAQ

ACLDHLAIQQAEAVQLSHDLLTDPGGFATSIRRYSFSVIMSVLYGKRVPRYASPEATALFKMLELWVNIL

SPGAHPLIEMFPALRCIPGPFASWRRLCKKVRIIQRQLYFGLLDEVEARSDQGNGNGCFMETVCARAQEW

GLDRELTGYLGGVLIEAGSDTTSAFIQTLVLLLVAHPQVQRKAQVELDAVVGTDRMPILEDLEDLPYVRA

VILETHRYRPVAPLAVPHAATAGFNYGQYTIPKGAILFVNTYGVFHDETIFKDPETYNPSRFLENPEKEK

LLDLAFGAGRRVCPGMNLARNSIAINTMNLLWGFDFMKARDATGAMIEPDVWDYSEGVATCPNPFKCDIN

PRSRHHEEIVRRDFIASRDAFLPFEHNLSASDKAFIREQWKD

//

 

CYP5344 family (4 sequences)

 

>CYP5344A1 PpCYP116

37% to CYP5037B2   Phanerochaete chrysosporium 
49% to PpCYP058, 49% to PpCYP253, 40% to PpCYP076

MNISLTSPLATLGEDYALSHIIPSTQGLLILAVAFALGARWVISRPKSKAPYPPGPRGLPLIGNLLQLDS

ECWHIFTEWKKTYGPIVYLNIGGQPVVVLNTHKVAGDLLDRRATNYSDRPRLIVAGETLTRGILLGLTRY

GDVWRRMRRACHEALNVGIAGNYHHFQQTEAVLLAYGFMKEPEHWYNHLRRAAASTITSMVYDMPPLKSC

TDPSIANINDMAARITKSAYPGTHLVEFFTFLEFFPKFLARWKREADQWYNRYTVGFEKSYNDIHDRVVK

GEEQRQSFCATLAESESRHNLTRKEASWLAATMYVAGSETTASTLSWFVLCMCAFRDAQEKASAEIEEVV

GRSRPPNFSDWDQMPYVRALIKEVLRWHCVDPLGLPHAAVQDDIYEGYFIPKGTICLANIWAMNRDPDIY

GPDAHLFRPDRHLDEKGQLKASPADTKDEGHVSYGFGRRLCVGRHVANFSLFIDITTLLWALKLEPEKDA

KGNFIEPDTVGIVNVGLVVHPVPFKIVTTPRFPEAAAMLSDMRDDVLQSVQY

//

>CYP5344B1v1 PpCYP058

scaffold 21 102951 - 100626

MPASFLASLRAWIASSTIGQRILLALALGLLLITARVISKSKGTMPPGPRGLPLLGNIFQLPKLPWYRFT

EWKEEFGPIFSLNFAGTPVVVLNSHEVVGDLLERKSTIYSDRPRFIMAGEILTGGMLIVFTGYGKVWRKL

RRAGQEGLNVRASEKYQPLQESEARLLTTNMLREPAEWDAHLQRAAASSIASAVYAWPPLTKSDDGLVHR

IDELMRRLVMAGLPGRYLVEIFPIMKHLPTWMAKWKREGLEWHRRDTEMFEGFYDNVARFMASGKYKPSL

TAGLIERQEKNGLSKKEVSWLAGTMIGAGAETTAASLSVFMLAMTLYPDVMRKAQAEIDALVGRERMPTF

ADRPHLPYVCALVKEVLRWRPVGPVGVPRRTSEDDWYKGYFIPKGTLVIANVWAMNRDPAIYPDYDEFRP

DRFLDASGNEIDIAGTHGQGHVTYGFGRRICIGMHVANQALFIDIAALLWAFNIEAPTGPDGNPILPSRT

DFVDEGLVFRPAAFRCKVTPRIDDVATMLATLEKNA

//

>CYP5344B1v2 PpCYP253 37% to CYP620E5_Aspergillus_oryzae
99% (1 aa diff) to PpCYP058

MPASFLASLRAWIASSTIGQRILLALALGLLLITARVISKSKGTMPPGPRGLPLLGNIFQLPKLPWYRFT

EWKEEFGPIFSLNFAGTPVVVLNSHEVVGDLLERKSTIYSDRPRFIMAGEILTGGMLIVFTGYGKVWRKL

RRAGQEGLNVRASEKYQPLQESEARLLTTNMLREPAEWDAHLQRAAASSIASAVYAWPPLTKSDDGLVHR

IDELMRRLVMAGLPGRYLVEIFPIMKHLPTWMAKWKREGLEWHRRDTEMFEGFYDNVARFMASGKYKPSL

TAGLIERQEKNGLSKKEVSWLAGTMIGAGAETTAASLSVFMLAMTLYPDVMRKAQAEIDALVGRERMPTF

ADRPHLPYVCALVKEVLRWRPVGPVGVPRRTSEDDWYKGYFIPKGTLVIANVWAMNRDPAIYPDYDEFRP

DRFLDASGNEIDIAGTHGQGHVTYGFGRRICIGMHVANQALFIDIAALLWAFNIEAPTGPDGTPILPSRT

DFVDEGLVFRPAAFRCKVTPRIDDVATMLATLEKNA

//

>CYP5344B2 PpCYP076 
53% to PpCYP253, 53% to PpCYP058, 40% to PpCYP116 
36% to CYP5144C4 Phanerochaete chrysosporium
scaffold 144 9692 - 11996

MLPSAPTLATTALVVLLLAVYFVSHHSIHRLPPGPRGLPLLGNVFQVPSKMPWLKFAEWKAVYGPIFSLN

MAGQIIVVLNTHKVTADFIDRRSTIYSDRPRFIMASEILTGGIFMIFANCGEVWRKMRRVAHEEFNPRAA

EKYRNAAERRGADNTGHSAGSFVLGGLSLNARGTAASILTAVYGWPRITYKDKSVVTRIHAHTARIAAAV

VPGAYLVELFPALNYLPVWLAKWKREGLEWHEQETRMFQAFNAKVREKKTGAAGTHCFVDSLNTNQRYHG

LSEKESAWLAGIMFSAGAETISASLANVVLALTLHPEVMHKAQAEIDAVVGRECLPTFAHQSELPYLRAL

IKETLRWRPTGPVAVPRRTTQDDWYDGYYIPKGTTVIPNVWAMNRLPDVFPSPEDFIPERFLDETGVFDV

IPPDTHGMGHVNFGFGRRICAGLHFANQELFIQVAMLLWAFNFETPLDNDGVPLAPPKGEYIDAGIVVVP

APFECKLTMRRTDIATMIMRELEG

//

 

CYP5345 family (1 sequence)

 
>CYP5445A1 PpCYP010 28% to CYP5156A1 Phanerochaete chrysosporium

MLLFLISLPYDKSFMSGSFPLPDGMLYLVCIAFTVFVIVDVLRYLLACRHLPYCASESGVLVLPWLCYVG

APNFFLKPYDYIARLHDQFAFSWLRFRARNHEVIVMFGSEARKKYFNLRRFSFSEGYTFLHPNVKLLGPT

QVPEGRQALPWYIRHFMRADILEQFLTPMLSDVQAFMQALSTEGVVDIYDVVDRVVFTIVSRVVASEDLA

ADSQKLQNAWRALAWVHKGSHPASLILPWLPTPSRIRTIIGGTTLFRMSSAILRERKCRQATSHMDVVQV

LVDEDAGSMHAAMVMIGVIFAAHTNTSPVLCWLLIMLAQNPLWLSKIQDEIDRFFQLHDINGPSQIDSLA

GMNLSLIEEALPSLDLCLHECIRIVMNGTSIRRNVGEDLDIAGRKIRGGDFVMYMLADVHLNNDFYTDPL

LFDPGRKHPVDAEFLGWGAGNHPCAGQRLAKLIIKVFCLVFLYKYDIQVVKKNGQVLREAVKPTYHLFEV

ASHEVDVYVHELDDDEWDDEVSENNV

//

 

CYP5346 family (1 sequence)

 

>CYP5346A1 PpCYP059 27% to CYP5311A1 Phycomyces blakesleeanus
may need some improvements near the heme and I-helix regions

MAVDLLSPQALATVLISAVSLIVWRLTVGGFGSRKYKLPPLVEYKVRVLTLWAMWDYPTAFTVNSYEKYG

PVFRVYFRGYVQAVVGKEHVRDIFLNPAFSYEEAVKDEFRLADMLGTSQTDLEPHRLFAVIITPFLARFI

PVLSNVLTRGFDRGVGADIQAPLQVESPSNLIMDVIARATTVCFFGEELGTNSELIPVYKDFAASIGHFV

NRKSPVLALLPSVAKLYMVKFNLSSPTAVYRAKVLQYTMPIVHERRRLMKELGDEYDPPLDSLQAYLNTV

PLDQPVNEHELATMMLTLVFFSIHTTTKRTTICLYNLAKYPQYVPELLEEQRAVLGDDWADGTVTLDQLK

NLSKLDSFIRESLRTSGRSIALPHKIVGMDEWHLPGGYVLPKG

MLDKGAARIGPDMIAFVVFDHS

HACPGRFFAVHEMKIALSLILKRYSVRFPDGAKPTDGSPLLFTPRKTA

//

 

CYP5347 family (2 sequences)

 
>CYP5347A1 PpCYP191 cyan possible intron, 
37% to CYP5157A1 Phanerochaete chrysosporium, 40% to PpCYP099

MYIFYSFAAPLLLLLALRLKGLPPTPEDIFSNPREAYGAALRQHGPVIAVRRKGNLEYVVGPEFARHVLT

CDRDFSFEEGSAAIMNLQPIMALTGGTLFRDLKDFVREGIIARMDEIVDQLYPIYDRDCEVFVDLVAKPE

HESSRPDLFNHTRDTLSEATLLLLLGQEYVSKRNMRIVEDVSNGMAQLTGQYQNFSFVGKYLPWLWVLLT

WINVIIIKIPFGFVRLLGPRLWVDVSRYEKIARKSKASEQEPRNVLYLIVKTYINSGEQYIGVFRRMYIA

MLLLCLIFASVHTTTVVSQWVLFQLATRPEYLNPLREELLKVREEAANGELHLTAASLRAAHLLDSFIRE

VMRLKGDTISTMRYTTADVPLGGYVIPNGSFVTPMSSTVHENPEIFGDEPTKFDGFRWVELNKDAAMTGS

AHIVFGLGRFACPGRVLAVNATVPDEATLNPEIKLIVLSLIGRATPSLLEGRFEVTDPLNTVTQPPKGTL

IFTPLDRPLL

//

>CYP5347B1 PpCYP099 36% to CYP5157A1 Phanerochaete chrysosporium

MPFSPCDEIALRTKFSPVAALPYLMLQAVLLTAVFLYSIWRAFLKHIPSANAPPLVDLTEKEIFTDPQKA

YRRALADHGPIIAVRRKGRLEYIVDESLTASVLTTDGDFSFEGGTTTILNLHYFLAIFPSWVSDLEDTVQ

NGINARLENVVEQIFPIFVKRTEDIMHRHQGQPIDMFEHAHASIAEAMTVLILGERYVNETNIALVTAVA

AEIATLTGIYQNTSIFARSMPVLWRIFTWFRVMMYSVSYRFLGHLGPVVWRELRGKTWRPDPTIQKEDEW

DNGNVTLLAYLACKHADPDTGEVTVLSAVKVIVILLGIVFASVHQSASVVVWVVFKLATSSEYLDSIRQE

MKEYVDPETGNISPSCTYRALKGANHLDAFIREVMRTKGDTLMPCRSTTHDMLLADYAIPRGSLLLPLAT

LSNESVDYHGMDAHIFRPERWSGQNAKPAVMTSPSYLPFGLGRWACPGRFLAVMEIKMMVWSIIARATPI

LRDGMYEVIDPLNTIAVPPKGELTLKPQRAE

//

 

CYP5348 family (43 sequences)

 

>CYP5348A1 PpCYP240

39% to CYP5144C1

scaffold 133 54609 - 56888

MDTFPVHDVFLCVGIALFLPIAYSVIHFLWAGQRRHLPVPPGPTSLPLIGNAYQLFWRSPHEAFTLWARQ

YGGLVYLRFFYTGMLVVNSLRVAQDLMEAKSAVASDRPRFVLFSDLMGMENDMVLMPYGDKWRRYRRWVQ

DIIQNKHNVIDLPALQRRETLTLLAGLVQTPDAFTLHIQRWSAAFSMHISYGHDIKSLDDEHVRLIELAL

KATTDAGGPASTLVDLFPILKYIPTWMPGAGFKRRAIYVRHLRTKMQDAPFQTVKNALLSGNATPSLTSS

LLEALWKEGDSAEYNEYDIKCVAAVLYAAGTESMSTTLTAFIQAMVLHPDVYTKTQQELDRIVGGSRLPN

LTDRASLPYVENVLKELYRWSCAVPLGVPHRLMTDCTFHDYGLARGSTIIPNMWAMTRDETIFSDPERFL

PERFMSYGVDGTKGEEQAIDPRGIVFGFGRRICPGRQFADSSLWLAVATIAAALNICKATGPDGATIIPV

PAFPSGSIRHVADFQCVIRPRSQAIEGGLLSPAWMEEW

//

>CYP5348A2 PpCYP061

scaffold 34 98968 - 96746

MDSYLSYDAVVVVIALLFLLYTFGKRRSYPDFLLPPGPRALPIIGNAHQFGSRSPQEVFDDLAQEWGGIA

YLRIFGAPLVVVSSARVARELTETHSRSTSDRPQLVLFTELMDFSNDMVIMRYGDRWRRHRRWIQDILQN

KKEVFDLSAMQREGTIRLLKSLLESPDAFRTHIKIWSAEMMMKLAYGFEITTTDDKRLKLVEEVLEASSD

TSALAVTLMDVFPMVKYIPKWFPGAGFKRKALHVSAVRHRVQDSLQQEIKQAMMSGSAKPSMTSRLLESA

SGELEKEAEWDIKGVANVLYLGGSETSASALTAFFLAMVLYPEVYAKAQQEVDEVIGRDRLPDPADRSSL

PYMECILKELFRWACPVPLGIPHSLMDDCQYNQFRLPGGSKLIFNQWAMTRDETIYPSPDEFIPERFQSD

ENGLKGMEPVEDPRGIVFGFGRRICPGRHMADNSVWLAIVTVTAMLSISKAVAADGKEILPVPTVPSRPD

PIRSYEEFKCIIRPRSQAIVTTIMQADLRRA

//

>CYP5348A3 PpCYP229

scaffold 34 103363 - 101119

MDSYLICDAAAILVTFILFLYSFGKTLSYPNLPLPPGPRALPIIGNAHQLFSAPAQEAFAHLAQKWGDIV

YLRIFKTSMIVVSSAHIARELTEMNSGNTSDRPRFVLFRELMDMTNDVVLMPYGDKWRRHRRWLLDVIQN

TKDIIDVSTMQQIQTARLLKGFVGSPDTFLTHIKLWSAAMMMKLAYGFDVTTLKDEYIELIEEALKATTG

SAGPASTLVDLFPPLRHIPEWVPGAGFKRRALAMKEIRRRMQASPYRRVKQAMRSGSVPPSVTSRLLQSA

SEELDEATEWDIQGIATVLYTAGTETSESTLTAFIQAMVMFPEVYAKAQQEIDEVIGRDRLPEFADRESL

PYLECVLKELYRWSCPAPLGVPHRLIGDCQYNQFRLPGGSTLMFDLWAMTRDTATYPRPEDFLPERFQSG

PENEEPPEDPRGIVFGFGRRICPGRHLVDNSLWLAIVTITATLSISRAVDADGKEIMPVLAFPSSAVKCI

MRIFSVIRPRSQAIVDIVMQMDSEQV

//

>CYP5348B1 PpCYP230

37% to CYP5037B1 Lentinula edodes (Shiitake mushroom)
scaffold 34 156200 - 158398

MYLNQLDVLAMLLAAVVCLICVLQHRYSKRRLLPPGPRGLPLVGNILQIPLENQFKTFTEWGKTYGDLVY

ASLFQQPLIIVNSVRAAQHLMEKRGAIYSDRPRFVLLDDIFGLRPVTSLLPFGDAWRQQRRWLQDVLQTH

NTIHGYRSLQRSGVTKLVARLTTSPELFFTHIGGYATDFSLKVAYGLDELFAEAFIGLAKECMEAIFQSG

SLVATLVDFLPFLRYMPSWMPGSGFNRHASNIRLKARQLMNLPFNTVRGNMNSGTYERSFTSTVIEDRFK

GQMTAQEEDNVKGAAWTIWIAGAETSSLVLLTFILAMVLHPEVLVKAQKEIDSITGGERLPELEDRGNMP

YLQHVIMEVYRWNPPFPLGISHRLMQDDIY

EDYFIPEGSTVIPNTWAMSRDPSVYYDPDVFRPERYEEMDADAVKAADPRRYVFGFGRRICSGKTLADAN

FWLGAASILATMDIGKAMDANGNEIEPAVSFISAFTSFPRPFVCSIRPRSMLAARIVAELDASELHA

//

>CYP5348B2 PpCYP142 (incomplete)

Yellow not P450

37% to CYP5037B1 Lentinula edodes (Shiitake mushroom)
63% to PpCYP230 
scaffold 34 166578 - 170381

MHLGTADVLAIFLAVVVCIVGARWNRSKHRPLPPGPRGVPLLGNILQIPLENQFKTFTDWGNIYGGCGGG

KRAEVGRTASTAAQELMEKRGAIYSDRPRFVLLQEIYGLKPMTSLIRFGDDWRQQRRWMQDALSTYNTIR

SYRPLQMNEVNKLIARFATSPDSFFTHVQSYGSNFTLEIGYGLDETFAKEKFSHIAEKALVAVFQSGTLV

ATLVDFFPFLQYVPSWMPGGRFKRHASDTRQIIRQMIELPYNTLRENMDSGKYRRSFASTFINEKFNGQM

TPQQEENLKGAASTLWMAGAETTSVVLLTFILAMVLYPDVAAKVQTEIDSVTGGERLPEIEDRKHLPYLE

CVLMEVYRWNPPLPLSVSHRLMQDDIY

RSIPNRERPATSVWLGAKRAFGRAASSGPIVRRMRKMFRDLRTRPREDRAELRVSVVHRRRCRRASKAKS

NCCVTESKCQAGCDCRKEVYRGPEGLGAYHLLPIEIWTALGPPRDARSAMVVNGSKRHDNPRRFRTPRGR

R

//

>CYP5348C1v1 PpCYP111

scaffold 34 59500 - 61679

MLSVLSSIETLDMAVALLALLSYLLYILWNRKLRTVYPPGPTPIPFLGNFCQLPVENQHEKFQEWAQTYG

NIVYAQLFRTPLVLLNSLDTIQDLMVKKGAIYSDRPQFVLWEDIYGFKPIPTSLNADDDWREHRKWMQSA

LETDQALVEMHPLLRSSVDKLLMKLVNSPDAFFAHVQRYTSELTIDIAYGMDKLTADDRYHRIAQDAVDA

IAHGSSLFAALVDFFPILKYIPAWVPGSAYNSYATRARNAVYQMINEPFNLLLETMASGVYKPSFASVLI

EAKSENGQLSTRAESHIKGAAATVYAAGAETSADVVLTLILAMLLHPNVSEKAQKEIDSVVGPDRLPEFH

DRKRLPYLESVLSEVHRWNPPAPLGVPHRLKCNDEYKGYFIPKGASIISNIWAISRDTSIYPDPDTFWPE

RFGQMDAETFKAYDPKKYVFGFGRRVCPGRHLADLTTWLAAANILATMDIRKARDHAGAEIEPKVSFVSA

LTRGPQKFACSICPRSLASVELIKQQLPDKPA

//

>CYP5348C1v2 PpCYP072

scaffold 46 250430 - 252608

MLSVLSSIGTLDMAVALLALLSYLLYILWNRKLRTVYPPGPTPIPFLGNFCQLPVENQHEKFQEWAQTYG

NIVYAQLFRTPLVLLNSLDTIQDLMVKKGAIYSDRPQFVLWEDIYGFKPIPTSLNADDDWREHRKWMQSA

LETDQALVEMHPLLRSSVDKLLMKLVNSPGAFFAHVQRYTSELTIDIAYGMDKLTADDRYHRIAQDAVDA

IAHGSSLFAALVDFFPILKYIPAWVPGSAYNSYATRARHAVYQMINEPFNLLLETMASGVYKPSFASVLI

EAKSENGKLPTRAKSHIKGAAATVYAAGAETSADVVLTLILAMLLHPNVLKNAQKEIDSVVGLDRLPEFH

DRKRLPYVESVLSEVHRWNPPAPLGVPHRLKCNDEYKGYFIPKGASIISNIWAISRDTSIYPDPDTFWPE

RFGQMDAETFKAYDPKKYVFGFGRRVCPGRHLADLTTWLAAANILATMDIRKARDHAGAEIEPKVSFVSA

LTRGPQTFACSICPRSLASVELIKQQLPDKPA

//

>CYP5348C2 PpCYP196

scaffold 34 86218 - 84093

MVLILSLLSCFFCIRWSQRKQKQYPPGPTPIPFIGNFHQMPIENQPETFTKWAHTYGEIVYVHLFNKTFV

FLNSLRATQDLMVKKGTIYSDRPTFVMWDDVYNLKPVTTSLKMNGDWREHRRWMQSALETDKALLGLHPL

IRSSVDKLLVKLLNSPDAFFTHVRRYSSDLTLDIAYGMDNLTNDDHFNSTAQKAADAIVHGATVAALVEF

LPILTYIPAWMPGTIYNQDVVKGRHNVRQLLDVPFSLLVKKIISGTYRPSFASALIEAKSENGQLSSWAE

SHIKGASATLYAAGSETSAAVLLTLILTMVLHPDVLEKVHNEITSVIGSDRLPEFGDRKLLPYVEHVLME

VLRWNPPVPLGVPHCLAQDDIYNGYFLPKGASVISNIWAISRDPSIYPDPDAFRPERFEEMDAETLEMYD

PRKYVFGFGRRICTGRYVADLSIWLAAVNILATMDIKKARDTFGAEIEPEFSFVTALTRYPREFICSIRP

QAPAAAELIIAKSH

//

>CYP5348C3 PpCYP020

scaffold 34 90939 - 88551

MPGILASSGTPEAAVVLLSLLTCYLCTRWSHRKYKAYPPGPTPMPFLGNLHQLPVKDQHETFREWAHTYG

EVVYAQIFRKPMILLNSLRAVQDLMEKKGAIYSDRAGLTLWEDVYDFKPVTAFMNADEDWREHRKWLQAA

LETERALTGLHTTLKSSVDKLIIKLLDSPNAFFAHVQRYTSDLTLDLAYGMDELTADEAYSRTAEDAVHA

IAHSDSIVASLVDSFPILKYILAWMPGAAYNRDAAKARHVIRQMLDILFDLLLKNITSGVYKPSFASALI

EAKSDNGQLLPRVAYNIKGAAATLYVAGAETSAVVLLTFVLAMTLYPEILQKVQQEIDAVVGIERLPEFR

DRKKLRYLECVLLEVYRWGPPTHLGVPHSLTQDDNYKGYFLPKGSTVISNIWAISRDPSIYPDPDAFRPE

RFEEMDAEKVKASHPKMYVFGFGRRICPGRHLAEMSFWLAAATILATLDIHKARDGKNIEPTVSFITGMT

RCPQEFVCSIRPRNQTVVELIGQEDAR

//

>CYP5348C4 PpCYP150

scaffold 203 68868 - 66656

MPGVLASIRTSEVAVVLLSLLAYYLWTRWTHRKYKAFPPGPTPIPFFGNFRQLPFKDQHETFREWAHTYG

DVVYAQLFRKPMIILNSLRAVQDLMEKKSAIYSDRPGFILWEDVYDFKPVTTFINADDDWREHRKRLQAG

FETEKALTGFHTPLKSSVNKLIIKLLNSPDAFFAHVQRYASDFTLDIGYGMDELTADDAYNRTAEDAVHA

VFHSDSIVASLVDFFPILKYVPSWMPGAAYNRDAAKARHVIRQMLDVPFDLLVKNITSGVYKPSFASAWI

EAKSENGQLSPQVAFHIKGAAATLYVAGAETSAVVLLTLILTMTLHPEILQKVQQEIDAVVGFERLPEFH

DRKQLPYLECVLLEVYRWNPPVPLGVPHSLSQDDIYKGYFLPKGSSVISNIWAISRDPSIYSDLDVFRPE

RFEEMDAEKVKVCDPKRYIFGFGRRICPGRHLADMSIWLAAATVLATLDIRKARDLNGNEIEPTASFITG

LSRSPREFVCSIRPRSQTVAELIAQEGAR

//

>CYP5348D1 PpCYP161

MNASFDPQTVAAVVALGLLCRWLLALWYNTVNLPPGPTGLPFLGNVHQIPLQYPHKTLYEWGQRYGDIIH

ARLFQKHVLVLDSTKAAEDLLDKRAAKYSDRPHFTLLEDLLQWKPLMVFMSQGETFRLHRKWYQSFLENR

QSLRTYESMQQREVDSLLLALLESPENVAYHLKRFTGSLMLEIAYGYTETSEKDAYIRLASETITQSLEA

GTLVASLVDFFPILLYLPHWFPGGGFKSNAMKLHGRVWQIMESPFRYVQQAIACSTARPSFTSFMIDQTA

KEGQLAEEDELNIKGAAILMYSGGTDTTNTALLTLLLAIALHPEVLRKAQAEIDEKIGPSRLPTLEDRAS

LPYVECIVKEAYRWNPVLPAGIPHQLREDDEYRGYHIPRGSMVISNIWAMTRDSATYPDSDSFLPERHLP

SRGGPICRDPKSIVFGFGRRICPGRFLADSSVWLIAANLLATFDIMNARHPNGDVITPENAFLSGAVSHP

KPFICTIRPRNKAYTEMITQRSTSSLAI

//

>CYP5348E1v1 PpCYP136

scaffold 46 152832 - 155025

MQLPVQLSSPLALAVLSIATCQLALVWWYQRKRTNPLPPGPSALPFLGNAHQIPLQYPERIFSQWARTYG

GVMYLRLFKKSVLILDSVKAAQDLMDKRGAKFSDRPQLTLITDVFAFKPMMFTMPYGDLWRRHRKWYQAS

LESKAALDTYNAVQEMETCTLLSALVSDSEHFADQVKRFTGAILLEIVYGHAVTSVKDDLIRLSDEMMTQ

AVSAGSLVATLLDFFPFLMHIPEWFPGGGFKREGARVRHLMRQLLDVPFNEVQQAMLEGSGKACLTTYML

EEQAEHGDLTPDDVDNIKGAATLLFIAGTDTTITTLLTFFLAMVLHPEVVHKAQAEIDRVVGRTRLPSLM

DRDALPYLDQVLKEVYRWNPPVPLGIPHQVRDDDVYNGRHIPGGSMVVSNIWSMSRDPDTYEDADRFWPE

RYEGKSSDELARSDPRRIVYGFGRRLCPGRFLADSSIWLAAARVIATLDIRKVLDAEGKEMTPSAEFISG

AVSHPKPFSLDILPRDEVAAKLIAQLDPNHLFSVQGEAI

//

>CYP5348E1v2 PpCYP067

scaffold 64 176120-178291

MQLPVQLSPPLALAVLSIAACQIALVWWFQRKRTNPLPPGPSALPFLGNAHQIPLQYPERIFSQWARTYG

GVMYLRLFKKSVLILDSVKAAQDLMDKRGAKFSDRPQLTLITDVFAFKPMMFTMPYGDLWRRHRKWYQAS

LESKAALDTYNAVQETETCTLLSALVSEPEHFADQVKRFTGAILLEIVYGHAVTSVKDDLIRLSDEMMTQ

AVSAGSLVATLLDFFPFLMHIPEWFPGGGFKREGARVRHLMRQLLDVPFNEVQQAMLEGSGKACLTTYML

EEQAEHGDLTPDDVDNIKGAATLLFIAGTDTTITSLLTFFLAMVLHPEVVHKAQAEIDRVVGRTRLPGLM

DRDALPYLDQVLKEVYRWNPPVPLGIPHQVRDDDVYNGRHIPGGSMVVSNIWSMSRDPDTYEDADRFWPE

RYEGKSPDELARSDPRRIVYGFGRRLCPGRFLADSSIWLAVARVIATLDIRKVRDAEGKEITPSAEFISG

AVSHPKPFSLDIRPRDEVAAKLIAQ

//

>CYP5348F1 PpCYP152

MTLVSDLGIERPMAWAVLLFVVAHFAYARYLNHKRTLPLPPGPSRLPLVGNVHQLPLQYQQRTFTEWGKQ

YGEIVFAKFFVRPAIILNSLEVAQDLMEKRGSKYSDRPRFVLINELVRFKPMVFMSYTDEWRRQRKWYQT

AIQARNAIDSYLPLQRRETNKFLLDLIQTPQAFENHVKRFSAAMMMEIAYGHSVSSVDDEFVKFADNALT

GAIEADSLVATLVDFFPFLRHIPTWMPGSGFKRRAFIARQRVREMLDTPYDKVRREVAAGTAKPSFLTYL

LDELSKDNEITPEDQESIKYAVCLMYGAGSDTTIITLLSFLLAMVLHPEVYRKAQAEIDRVVGSERLPEL

EDRPSLPYLECVLKEVYRWNPPAPLGVPHNVTHGDVYRDHYIPKGTMVIGNIWAMTRDPSMYPDPDTFLP

ERFENLDPETAEQCSPHRMVFGFGRRLCPGKQLGDYIIWLAAANMIATLDICKARNASGEEITPEAAFDS

GAVSHPKHFECDIHPRSQKVADMVVQLNAHTT

//

>CYP5348G1 PpCYP167

MQLPPTLVDYLIVFVLCVVIFNSVYTRWLKISPHFPPGPQRLPLIGNIHQIPFEYQQRMFASWAKHHGDI

IYMQLFHKPSIIVDSVRVAQELMEKRASKYSDRPQFVMVKEYLQPKPSLVFMSWGEKCRRLRKFFQSALE

NKAALEGYRPLQRREIHRLLRDLAQSPMGFMAHVKRYAGAIILEIDYGHRVTSAQDEWMVYVDHTVDEFT

TTGSLAASLVDFLPLMKHIPSWMPGGGFKKRALIVGAKVRDMMEIPYRKVQRDMASGCAKPSFMTSLLEK

MTQDGCLSAEEEYDIKASCLVMYTAGSDTTITSLMTFILAMVLHPHVLDKAQAEIDRVIGSERLPELDDR

EALPYVDCIVKEVYRWNPPVPLGIPHRVMEDDIYRGYVIPGGATIIPNIWSMGHHTDIYSDPEKFFPERF

EEMDTQTANQKDPRKFIFGFGKRICPGRYLADETVWLAIANILATMNIQKCRDPSGQEITPIPSFKTGIV

SQVDPFLCEIKPRTEKAANLVGQHNAGDV

//

>CYP5348H1 PpCYP143

MQGFQDLVVYLSILFGAILCCGGYLRLYHGKQHLPLPPGPRGLPVLGNVHQIPTQYQQNTFLSWAKRHGE

IVYLRFFQKPAIIISSLKAAQDLMEKRGSKYSSRPYSVFMLEFVLPRPNLVLMPYTDQCRLHRKLFQATF

ESRTMLDSYRPLQRRYVDILLADLVRDPEGFIAHLKRYAGALTIELAYGHHADIVNEEFMAFADKAMASV

TEAGGVASTLVDFFPFMKYIPEWIPGGGFKRHAFMTQNMIREVMSTPYSIVRESMKNGNAQQCFTTFLLG

ELSEDGRLDDDTAWDIKGAATVLYLAGSDTTMTTLISFILTMVLHRHIFKKAQAELDSVIGSERLPNLDD

RDSLPYLECVLKEVYRWNPPAPLGIPHSVTEEDTYRVYAIPAGAIVIPNIWAMSRDVEQYSDPDTFLPER

FEAMSPQETNKKDPRKYVFGFGRRICPGRFLADSSVWLAIANIVATMDIQKARDISGKEITPIPSFKTGI

VSHVNPFICDIKPRTTKTTDIATKLKNVTSG

//

>CYP5348J1 PpCYP174

scaffold 72 51129 - 53365

MSTGFNRTDALVITSLLFLTLLINRLALSTRGHRLPPGPSRIPFLGNLHQVPLVDQQKTFAEWMQKYGDV

IYIELFSKPFLIVSSVQAAQDLMEKRASKYSDRPYFLLLREFVMTKPLMIFMSYDNRYRRLRRWYQGSLE

NKAVLEGYRPVQTREIGRLLSSLIETSEDFISHIKRFNGAVMLDIAYGHRVTSVDDEFMIFADKTIATIT

ALGSFAATLVDFFPIMKYLPSWMPGSGFKKQAVRGKEMWDAMEDIPYQKLRNAMESDSVKRSFTTFMLDE

VSHDGKLTEDDEVDVKGSATLMYAAGVDTSMTSLSTLMLAMTIYPEVARKAQAEIDQVVGLSRLPDLSDR

DVLPYVESIVKEVYRWNPPAPLGVPHCVRDDDNYRGYDIPGGSMIVPNVWAMSRDSALYPDPEAFRPERF

EGLDADATSLLDPRKYVFGFGRRICPGRYLADSSVWLVTASILATMNVGRARDAAGHEIVPAPSFKNGII

SHVDPFVCTILPRSERAVRLIEELVAHSAENPIV

//

>CYP5348J2 PpCYP199

scaffold 126 187137 - 184896

MSLALNRTDLLVVTGALFLTLLTTRFIRAAQRYHLPPGPTRIPLLGNLHQVPLRDQQKTFAEWVRKYGDI

IYIQLLSKPFLIVSSVQAAQDLMEKRAVKYSDRPYFLLLCQFVMTRPLMILMQHDDRWRRLRRWYQGSLE

NKSVLDGYRPVQRREIGRLLSSLVEAPKDFIPHIKRYNGAVMLDIAYGHRVTSVEDEFMVFADKTISTIT

NLGSIAATLVDFFPILRYFPAWVPGGGFKKQALMAKEMWDEMEDIPYRKLRHEMVCGRPASDNGYLLCRT

ILRTLNLASRSARQSLRKTTAGSDTTMTTLSSFVLAMTLHPEVARKAQAEIDQVVGTSRLPELDDKDSLP

YLECIIKELYRWNPPAPLGVPHSLRVDDNYRGYDIPGGSMIVPNVWAMSRDSALYPDAETFRPERFEGLD

AEAMNTRDPRKYIFGFGRRICPGRYLADSSVWLVMASVLASMDIGRAHDAAGREIIPTPSFNDGIVSHVK

PFQCTIRPRSGRAAQLIREFTEQTAETASA

//

>CYP5348J3 PpCYP176

scaffold 1 523069 - 520837

MSLVLNRTDLLVVAGALFLTFLTTRFIRAAQRYHLPPGPTRIPLLGNLHQVPLHDQQKTFAEWVKKYGDI

IYIQLLSKPFVIVSSVRAAQDLMEKRAVKYSDRPYFLLLCEFVMTRPLMIFMQHGDRWRRLRRWYQGSLE

NKSVLEGYRPVLRREIGRLLSSLAEAPQDFMSHIKRYNGAVMLDIAYGHRVTSAEDEFMVFADKTISTVT

SLGSFAATLVDFFPILRYFPAWTPGSGFKKQALMAKEMWDEMEDIPYRKLRHEMGSDAVNRSFTTFMIGE

VSHDGKLGADDEIDIKGSATLMYVAGSDTTMTTMTTFVLAMTLYPEVARKAQAEIDHVVGLSRLPGLDDK

DSLPYLECIIKELYRWNPPVPLGVPHRLCVDDNYRGYDIPGGSMIVPNVWAMSRDPSLYPDTKTFRPERF

EGLDAQAMKFRDPRKYIFGFGRRICPGRYLADSNVWLFLASVLASMDIGRAHDAAGHEIIPTPSFKDGII

SHVEPFQCTIRPRSERAAQLIRESTGNTSA

//

>CYP5348J4 PpCYP244

scaffold 203 60549 - 58314

MLPASIETLLCASILLGIICHYLCTRILPSSRSVLPPGPPQLPLLGNVHQISLEYQHKTFAEWARKYGDL

ICIHAFHRPILIVSSANVARELLEKRGGKYSDRPYSILANKLVFPKPILGFMPYDETCRRLRKYFLGALE

TKSAVEQYRPMQRAEIGRLLSDLTHNPKEFLSHIRRYNGALMMEITYGLPVSSADDEFMAFANGTVSALS

TIGSAASTLVDFIPMLRHIPTWMPGAGFKRRALEVKDMWAEMTRIPFEKVRSAMALGTAKPSLTTFMLQE

ALRDSALAEDDEYIISNAASQMYGAGVDTTLNALLTFFLAMTIHPEIVKKAQAELDLVVGNSRLPELSDR

DSLPYIDCIVKEVLRWNPAAPLGLPHRLQEDDTYERYTLPAGSMIVTNIWAMGRDPSLYSEPDEFLPERF

QEVDAEKAASQDPRKYVFGFGRRICPGRFLADSSIWLLAANILATMDIRRARDSVGREVVPTPSFKSGLI

SEVEPFECDIRPRSERAMDLITERYAEVFTQDN

//

>CYP5348J5 PpCYP146

scaffold 34 159927 - 162153

MLLPLNSYVLLCVSTLLVVAGHYACARWLFPTRRFPLPPGPPRAPFLGNVHQVHLTYQHKKIAEWSRKYG

DLLCVKIFHKPMFIISSIKGARDLLQTRSTKYSDRPHSVVLNDLPILAFIPYDEQCKRLRKWDQGALETK

AALKQYHHIQRKEVGILLSDLVHTPKEFFSHIRRYNGALMLETAYGHPVSSAEDEYMVFADSATAAVAEI

GSIASTLADFVPILKYIPTWMPGAGFKRQALRARDMWAEMTRIPYQRICDDMALGKARPSFTTFMIQQVS

RDRNLTDDNNHDISNAASVMYGAGVDTTLHTLLTLLLALTIYPQVVDKAQAEIDRVIGTSRLPELADRES

LPYLGCIVQEVLRWNPATPLGIPHRLQENDSYNGYGLPEGSMFITNTWAMSRDPGLYPDPEVFRPERFEE

MDAETASARDPRKYTFGFGRRICPGRYLADTSIWLVAANILATMNIRRACDSAGREIIPTPSFKSGAVSH

VEPFECDIRPRSQQAMDLITERNSEH

//

>CYP5348J6 PpCYP012

scaffold 228 52521 - 54758

MSLPHDSYVLLCVSVLLVVAAHYAYSRWLFPTRRLPLPPGPPRAPFLGNIHQVPLTYQHKKFAEWSQHYG

DLFCVQVFQKPMFIVSSIKVARDLLETRSAKYSDRPYSVVANELVFPLRRPTLGFMPYDERFRRLRKWFQ

DALETKASLQQYHHIQRREVGRLLSDLVHTPKEFFSHIRRYNGALMLEIAYGHPVASAEDEYMAFADRSV

AAVTDIGSVASTLVDFVPILKYIPTWMPGAGFKRQALRVKDMWAEMTRIPYQRVRDDMALGKAKPSFTTF

MIQEVSRDGHLTDDNEYDISNAASQMYGAGVETTLHTLLALLLALTIYPNVVDKAQAEIDRVIGTSRLPE

LADRDSLPYLGCIVQEVLRWYPAGPLGMPHALREDDSYNGYRLPRGSMIVANIWAMTRDPALYPDPEVFR

PERFEEMDAETAGARDPRKYTFGFGRRICPGRYLADSSIWLVTASILATMNIRRECDSAGREIIPTPSFK

SGIISHVEPFECDIRPRSQRTIDLIAERKYETTG

//

>CYP5348J7 PpCYP177

scaffold 228 62901 - 60665

MPLPLDSYVLLCVSVLLVVAAHYAYSRWLFSTRRLPLPPGPPRAPFLGNIHQVPLMSQHKKFAEWSRNCG

DLFCVQIFHKSMLIISSIQVARDLLETRSAKYSDRPYSVVANEFVFPFRRPILGLMPYDERFRRLRKWFQ

GALETKASLQQYHHIQRREVGRLLSDLVHTPKEFFSHIRRYNGALMLEIAYGHPVASAEDEYMAFADRSV

AALTDIGSIASTLVDFVPILKYIPTWMPGAGFKRQALRAKDMWAEMTRIPYQRVRDDMALGKAKLSFTTF

MIQEVSRDGHLTDNDEYDISNSASQMYGAGVETTLHTLLTLLLAFTIYPKVVDKAQAEIDRVIGTSRLPE

LADREFLPYLGCIVQEVLRWNPITPLGVPHCLQEDDSYNGYGLPGGSMFIINVWAISRNPALYPNPEVFR

PERFEEMDAETASARDPRKYLFGFGRRICPGRYLADSSVWLVAANVLATMDIRRARDSAGREIIPTPSFK

GGIVSHVEPFECDIRPRSQKTIDLIAERHYETTD

//

>CYP5348K1v1 PpCYP194

97% to PpCYP159

scaffold 15 305000 - 302780

MDHQIIVSTLALCLAFILVYLSIFERHDRLPPGPKPLPFLGNILQLPAKYKERTFVKWGNIYGDIVYAHF

LRTPIIIINAHCVAQDILDKKSSIYSDRPNVAVLSDMTGMNISLPALPYGEQARKQRKWFQHAIASKSTL

KQYQPIQRRETLTLLSGICENAGSLRLHINRFAAGILMEISYGYTIRSLDDIYVHLANQAMAGTLECGYP

GLMLVDFVPLSLLKLLPTRIPGYLGWFIRTASMIKGASVLLHDTPYNMVKSAIASGNARPSLVSSLLSDN

DSDSDELDAQHEIDIKATAASIYSAGIETMLSVLSSFLLALLLHPRVLQKAREELDQVVGTERLPDFDDR

KHLAYMECVLQEVYRWACPAPVTMLHKLAVDDEYQGYHIPAGASVVANAWAMTRDVRTYVDPEVFRPERF

QDLPVGAKDTMDPRCYMFGFGRRVCPGKLLADSSLWLAMASIISTFDVVPSRDARGRQIIPEATWESGII

RQPVKFEVDIHPRSQKSLELIKQLAAHSMF

//

>CYP5348K1v2 PpCYP159

scaffold 171 45676 - 47854

MDHQIIVSTLALCLAFILVYFSIFERHDRLPPGPKPLPFLGNILQFPAKYKERTFVKWGNIYGDIVYAHF

LRTPIIIINAHCVAQDILDKKSSIYSDRPNVAVLSDMTGMNISLPALPYGEQARKQRKWFQHAVASKSTL

KQYQPIQRRETLTLLSGLCENAGSLRLHINRFAAGILMEISYGYTIRSLDDVYVHLANQAMAGTLECGYP

GLMLVDFIPLSLLKLLPTRIPGYLGWFIRTASVIKGASVLLHDTPYNMVKSAIASGNARPSLVSSLLSDN

DSDSDELDAQDEIDIKATAASIYSAGIETMLSVLSSFLLALLLHPRVLQKAREELDQVVGTERLPDFDDR

KHLAYMECVLQEVYRWACPAPVTMLHKLAVDDEYQGYHIPAGASVVANAWAMTRDVRTYVDPEVFRPERF

QDLPVGAKDTMDPRCYMFGFGRRVCPGKLLADSSLWLAMASIISTFDVVPSRDARGRQIIPEATWESGII

RQPVKISTHGRRRVLS

//

>CYP5348L1v1 PpCYP245

METLVAAAFVVLTLSHVLYTRWHRAHRSKLPPGPVGLPWIGNLFQLPTDHRERTLSRWRKDFGNLIYVSF

FNKPVIAINSLEIAQDLMEKRSVRYSDRPRFVHIEEMMGWMSHLGRTAADDEFRRHRRWVQNAFLDKATL

AHYHPVQHRELYILLGKLVESPDKYWKHFRRYVGAVLMELEYGYTVTSENDEFVTFAADALVRLGYCDYP

GMALLDFLPIFRNLPSWLAKFRKESADYTQVVRRMRDAPYNFVRAGMTTGTASPSFVSAIIEEASSKGPL

TPDVEEDIKIVATLVYGAGIDTTYATLSTFLLAMVRYPRVFKKAQEEIDRVVGSRFPDYADRDSLPYLEC

VLKEVHRWQVVVPLGVPHKLTTDDEYQKYNLPGGAAVVPNLWGMSRDPEYYHDPEEFYPERFEERPDLPD

PRKFVFGFGRRICPGRLLADSSFYLVAANVIAMLNIRKARDSVGNEIEPVVDYNSGFLSHPKQFACSIE

PRSDKVAQMVKEMAAANEPKMGHSLQGLKG

//

>CYP5348L1v2 PpCYP171 
40% to CYP5037B1 Lentinula edodes

METLVAAVFVVLTLSHVLYTRWDRAYRSKLPPGPVGLPWIGNLFQLPTDHRERTLSRWRKDFGNLIYVSF

FNKPVIAINSLEIAQDLMEKRSVRYSDRPRFVHIEEMMGWMSHLGRTAADDEFRRHRRWVQNAFLDKATL

AHYHPVQHRELYILLGKLVESPDKYWKHFRRYVGAVLMELEYGYTVTSENDEFVTFAADALVRLGYCDYP

GMALLDFLPIFRNLPSWLAKFRKESADYTQVVRRMRDAPYNFVRAGMTTGTASPSFVSAIIEEASSKGPL

TPDVEEDIKIVATLVYGAGIDTTYATLSTFLLAMVRYPRVFKKAQEEIDRVVGSRFPDYADRDSLPYLEC

VLKEVHRWQVVVPLGVPHKLTTDDEYQKYNLPGGAAVVPNLWGMSRDPEYYHDPEEFYPERFEERPDLPD

PRKFVFGFGRRICPGRLLADSSFYLVAANVIAMLNIRKARDSVGNEIEPVVDYNSGFLSHPKQFACSIEP

RSDKVAQMVKEMAAANEPKMGHSLQGLKG

//

>CYP5348M1v1 PpCYP165

MLTVSLAERALYAFVFVSIVSHFVYARWIRCWSRVHHPPGPSPLPLLGNVYQLPDGHKEKTMSDWAVVFG

KLVYVSFFRTRVLIVSSLDVAQEIMEKRSMHYSDRPRLVHMQEMMQWTSHLGYAASSEDFRKHRKWLQSA

FLAHNSLVKYRPIQLREVRVLLDGMSGSSSQFEQHLNRFIGAILMEVVYGYTVTSADDKFLKYGSEVMEE

VAHAGYPSLSPPDWLPFLKYVPTWLPFGKYRKESERFKDLVRKMRADPYDYVRKTMAAGTAPSSFTSTLV

EEAVRTNLLTLQEEEDIKDMATLVYGGGMDTVISTLSAFVLAMVLNPRVLKKAQEEMDYVVNQDRLPDFS

DRNSLPYLECIIKEVYRWHVVAPLGVPHQSTIDDKVRGFDIPGKTVIIPNLWAISRDPERYPDPETFYPE

RFEHARAGSIPQTDPRKFIFGFGRRICPGRLLADANIWLAIANMVATLDIGKARDSAGSEIEPRVESTSG

FISHFEDYMSDIKPRSENAAQLIAAAAV

//

>CYP5348M1v2 PpCYP250

MLTVSLAERALYAFVFVSIASHFVYARWIRRWSRIHHPPGPSPLPLLGNVYQLPDGHKEKTMSDWAVVFG

KLVYVSFFRTRVLIVSSLDVAREIMEKRSMHYSDRPRLVHMQEMMQWTSHLGYAASGEDFRKHRKWLQSA

FLAHNSLVKYRPIQLREVRVLLDGMSGSSSQFEQHLNRFIGAILMEVVYGYTVTSADDKFLKYGSEVMEE

VAHAGYPSLSPPDWLPFLKYVPTWLPFGKYRKESERFKNLVRKMRADPYDYVRKTMAAGTAPSSFTSTLV

EEAVRTSLLTLQEEEDIKDMATLVYGGGMDTTVSTLSAFVLAMVLNPRVLKKAQEEMDYVVNQDRLPDFS

DRNSLPYLECIIKEVYRWHVVAPLGVPHQSTIDDKVRGYDILGKTVIIPNLWAISRDPERYPDPETFYPE

RFEHARAGSIPQTDPRKFIFGFGRRICPGRLLADANIWLAIANMVATLDIGKARDSAGSEIEPRVESTSG

FISHFEDYMSDIKPRSENAAQLIAAAAV

//

>CYP5348M1v3 PpCYP021

39% to CYP620H6   Aspergillus niger 
37% to CYP5037B3   Phanerochaete chrysosporium 

MLTVSLAERALYAFVFVSIASHFVYARWIRRWSRIHHPPGPSPLPLLGNVYQLPDGHKEKTMSDWAVVFG

KLVYVSFFRTRVLIVSSLDVAREIMEKRSMHYSDRPRLVHMQEMMQWTSHLGYAASGEDFRKHRKWLQSA

FLAHNSLVKYRPIQLREVRVLLDGMSGSSSQFEQHLNRFIGAILMEVVYGYTVTSADDKFLKYGSEVMEE

VAHAGYPSLSPPDWLPFLKYVPTWLPFGKYRKESERFKNLVRKMRADPYDYVRKTMAAGTAPSSFTSTLV

EEAVRTSLLTLQEEEDIKDMATLVYGGGMDTTVSTLSAFVLAMVLNPRVLKKAQEEMDYVVNQDRLPDFS

DRNSLPYLECIIKEVYRWHVVAPLGVPHQSTIDDKVRGYDILGKTVIIPNLWAISRDPERYPGPETFYPE

RFEHARAGSISQTDPRKFIFGFGRRICPGRLLADANIWLAIANMVATLDIGKARDSAGSEIEPRVESTSG

FISHFEDYMCDIKPRSENAAQLIAAAAV

//

>CYP5348N1 PpCYP054

scazffold 15 86835 - 89030

MNSSLHVAACASAALFAISLAVFLRWLKADSHLRLPPGPNRVPLLGNVHQLPMQSQEKKFTKWGAEYGDI

VFARFFRTPTLVINSLQAAHDLLGKKSSIYSYRPDFVLLSELMGWDCVVTHMTYGNRFRKHRRWILDAFQ

DKHSLESYRPLQRREAYILLSGLIQNPELFRSHIKRFAAAMIMQIAYGHSVTSLDDKFVHLAERAGKETV

EYGNAGVMLVDFFPLLKHIPLWMPGSGFKRRAFEIRDVVRKMLDTPYEMVKDAMKSGTASPCLTATLLEE

VLSERAPTREDEDDIKGTAGVLYGAATDTTSAVLSTFVLAMVLYPEVYKKAQAEVDRVVGQDRLPDFEDR

ESLPYLECVVKEVYRWNCPVPLGIPHKLISNDQYQGFDIPGGSMVIPNIWGMTRNDSFYPEPEMFRPERF

EQMDRYTAEARDPRNMVFGFGRRVCPGQDFADASVWIAVANMVATLDIAVATDEAGKQAPPTGSFVPGFV

SHPEEFTCRITPRSEQVKTVVFETSANIVL

//

>CYP5348N2v1 PpCYP109

scaffold 15 336374 - 334182

MNSSLHVTACASAVLFVISIAMFLRWMKAESHLRLPPGPNRIPLLSNVHQLPMQSPERKYGDIVFAKLFK

TPTLVINSLQVAQELLDKRSSKYSYRPDFILLSDLMGWDCVITHMTYGDRFRKHRRWISNAFQDKHSLGS

YRPLQRREAYMLLSGLLQSPELFRSHIKRFAAAMILQIAYGHSVTSLDDKFIHLAERAGKETVEYGSAGV

MLVDLFPFLKHIPLWMPGSGFKSRAFEIRDLVRKMLDTPFEMVKDAMKSGTASPCLTATLLEEVLSKRAP

TAEDEDDIKGTAGVLYGAATDTVTVAVLSTFILAMVLHPEVYEKAQAEVDRVVGQDRLPEFEDRESLPYL

ECVVKEVFRWNCPVPLGLPHKLISNDQYQGFDIPGGSMVIPNIWGMTRNDSFYPEPEMFRPERFEQMDRE

TAEARDPRKMVFGFGRRICPGQDFADASIWIAIASIVATLDIGVTTDEAGKQAPPTGSFVPGLVSHPEEF

SCKITPRSEQVKTVVFEMGEYLCHSYVLGSLRAF

//

>CYP5348N2v2 PpCYP252

MNSSLHVTACASAVLFVISIAMFLRWMKAESHLRLPPGPNRIPLLGNVHQLPMQSQERKFTQWGAEYGDI

VFAKLFKTPTLVINSLQVAQELLDKRSSKYSYRPDFILLSDLMGWDCVITHMTYGDRFRKHRRWISNAFQ

DKHSLGSYRPLQRREAYMLLSGLLQSPELFRSHIKRFAAAMILQIAYGHSVTSLDDKFIHLAERAGKETV

EYGSAGVMLVDLFPFLKHIPLWMPGSGFKSRAFEIRDLVRKMLDTPFEMVKDAMKSGTASPCLTATLLEE

VLSKRAPTAEDEDDIKGTAGVLYGAATDTTVAVLSTFILAMVLHPEVYEKAQAEVDRVVGQDRLPEFEDR

ESLPYLECVVKEVFRWNCPVPLGLPHKLISNDQYQGFDIPGGSMVIPNIWGMTRNDSFYPEPEMFRPERF

EQMDRETAEARDPRKMVFGFGRRICPGQDFADASIWIAIASIVATLDIGVTTDEAGKQAPPTGSFVPGLV

\SHPEEFSCKITPRSEQVKTVVFEMGANVVL

//

>CYP5348N3 PpCYP083

scaffold 70 347224 - 349500

MFASRLPFREHSSAVLFAISIAMFLRWMKAESHLRLPPGPNRIPLLGNVHQLPMQSQERKFTQWGAEYGD

IVFAKLHKTPTLVINSLQVAQELLDKRSSKYSYRPDFILLSDLMGRDCVITHMTYGDRFRKHRRWISNAF

QDKHSLGSYRPLQRREAYMLLSGLLQSPELFRSHIKRFAAAMIMQIAYGHSVTSLDDKFIHLAERAGKET

VEYGSAGVMLVDLFPFLKHIPLWMPGSGFKSRAFEIRDLVRKMLDTPFEMVKDAMKSGTASPCLTATLLE

EVLSKRAPTPEDEDDIKGTAGVLYGAATDTTVAVLSTFILAMVLHPEVYEKAQAEVDRVVGQDRLPEFED

RESLPYLECVVKEVFRWNCPVPLGLSHKLISNDQYQGFHIPGGSMVIPNIWGMTRNDSFYPEPEMFRPER

FEQMDRETAEARDPRKMVFGFGRRVCPGQDFADASIWIAVASIVATLDIGVTTDEAGKQAPPTGSFVPGL

VSHPEEFSCRITLRSEQVKTVVFEMSANVVL

//

>CYP5348P1 PpCYP162

MVDYIYFYLVLIFLSYIWCSMRRKTASIQRLPSGPWSLPIIGNVHQLNAGHQHHTMAQWGGVYGDLVYAR

IFRTPVLVLNSVKVARELLDRKSSATSGRPRMMFLTEMLGWDSGIAFMQYGKRWKRHRTWICAAFESKES

SSKYQPLQRREARNLLLNIIQAPTLFERHLSRFTAAIIMEIVYGHTMTSADDVFVKRADRAIQGTVDAGQ

IPATLIDLFPFLWSLPSWLPGMGFKARALELRKLIQETLDAPYVIATEAMSTGIAKSSFVADIIHDHFPH

GMTEVDERDIKGAATAIYIAAAETTTTVLSTFILAMVLYPEIYKKAQDEIDRVVGDSRLPDFDDRPCLPY

LNCIVKELYRWNSPAPLGVAHATTRKESYAGYDIPGDTILIPNIWAMTQNTIVYRQPDQFCPERFLAVQD

ADSDDHDPRKYIFGFGRRICPGRHFADSEIWLVVACIAATFDITKARDINGSEITPEVAFTQSFTSRPKA

YACQIHPRTTRATLVAQLHLS

//

>CYP5348Q1 PpCYP156

scaffold 9 651267 - 649052

MAAYFTSLTLLFILLSSLAYVWCRGRTRSYKLPPGPRPLPLIGNVHQLPLKDQHKTFAEWGRKYGDLIYL

RIFATPVLVVHSLSAARELLDGKNSVTSDRPHMVFLREYLGYDSCFPFIPYGETWRQQRKWVHTALETKE

SLASYSQSQRRAVHALLSDLLDEPERYPQPYIKRFMAVMMMEIVYGHTMTSEDDAFVRTADKAIDETVKV

GAIASLVDFLPILRRLPSWLPGMGFKKKTLRIRQLVQKTMDEPFEMARKAMINDHRQSYFVARIISSQSE

GRSLLLDQPLLKYAAGALYMGAVDTTATVLSTFLLVMILHPEVLQKAQAEIDRVVGGARLPNVEDRASLP

YIDCIIKEVYRWNCPAPSGIPHAMSRDEVLRGYHIPRGTVIVPNMWAMTQDSTVYPEPGTFRPERFQEMD

SHTAEQADPRKFIFGFGRRICPGRHFADVIIWLTIASIIAAFDISKARDAEGNEIMPRMSFTSGLVSFPE

PFECDIRPRTTKTQRLISQLRENLA

//

>CYP5348Q2 PpCYP118

scaffold 75 172725 - 174942

MTVHITSLTLLFILLSSLAYVWYRGRIRSSKLPPGPRPLPLIGNVHQLPLKDQHKTFAEWGREYGDLIYL

RIFATPVLVVHSLSAARELLEGKNSVTSDRPHMVFVREFLGYDSCFPFIPYGEVWRRQRKWVHTALETKE

SLASYSRSQRRAVHALLSDLLNEPERYSQHLIRYMAAMMMVIVYGHTMTSKDDAFVRTAEEAMGGTAKLG

DIASSLVDFLPILRHLPSWIPGMGFKRKIPQVRQLVQKTMDEPFEMARKAMIDGHDQSYFVAKIISSQSE

GRLLQPDQLLLKYAAGALYIAAVDTTATTLSTFLLAMVLHPEVLRKAQAEIDRVVGGTRLPNVEDRASLP

YVDCIIKEVYRWNCPAPSGIPHAMSRDEVLRGHNIARGTVIVANLWAMTQDSTLYPEPETFRPERFQEMD

SHTAEQADPRKFIFGFGRRICPGRHFADMNIWLTISSIIAAFDISKARDAEGNEIMPQMSFTSGLVSFPD

PFECDIRPRTARTRHLISQLSENPA

//

>CYP5348R1 PpCYP056

MIFYYSHAWQIATPLLLVVFYTVLKKFTGGGGRKLPPGPRPVPLLGNVHQLPLLYQQRAFAQWGRVYGDL

IYARLFQKPALVLNSVQVAQDLMDKRSSKYSDRPNFILLTELIGWHPVSAFMPYGKRRRKHRQWIQSAYV

DQNSLLSYRPVQRRESYALVAALLESPDQFLAHTRRFAAAVVMETVFGQPIPSGANEEHLQAALQATMAT

NDAATLTASLVDFFPFMRHIPTWMPGAGFKHNALLVRTYVSAIMDKPYDVVKAAITSGTAKPSFMTKCMD

KPIEGDPKEHEEYIKGAAGVLYAAGIDTTMIALSTLILAMALYPECLKKAQEEIGRVVGSHRLPEFEDRD

SLPYLECIIKEVYRWNPPVPLGITHSLSEDDVYQGYHMPKGAIVVSNMWGMANKSDVYAEPDAFRPERFA

GMEPDIADLKDPRKYVFGFGRRICPGRYFADTSIWLAAASMIATLDVYKARNSQGQEIIPPAAFRPGFIS

IPEEFPCEIRPRSEKVSKMIFEMLNATHDSAPAASSVSSYEDTMA

//

>CYP5348S1 PpCYP222

MATALNTPLLLALTGLLAVCGLLRSRSTSKGTSPLPPGPRAIPLLGNILQLPLEHQHKTFAKWGQKFGDF

IFAKFFTTPVLILNSLAVAQDLLENRSSVYSDRPYFALLTDIVGWYPATPFLTYGDQWRRHRRWIHMWYS

EKASLLKLRPILRKETLTLLLQLIETPQDLSQHIRRYAAALVTSSVYGRTITSWDDEYFQMTERAIHATT

EAGSPAATLVDFVPFLKYLPSWFPGSAPIHKARSVRGIVRNMIDTPYENVKSAMRQGSVKPSLVASLLDS

NAHHISREDEEDIKGVAATIYSAGVDTTAVVLNTFILAMVLHPHVYKKSQEEIDRIVGPSCLPSLEHRHL

LRYLDCIIQEVYRWNPPVPLGVPHRLTQEDSYRGYRVPTGTMIIPNIWRMGHQEEVYSDPKAFDPSRFES

LDAQSGASKDPRQFVFGFGRRICPGRHFADEAVWLAIAHIVATVDIAKGRDASGKLITPMARFCSGFTSP

PLDFTCSISPRSTAAVKLVADERGSMDNEEPGNSDS

//

>CYP5348T1 PpCYP239

scaffold 133 115016 - 117211

MEPGYLTLVFGLIS

MLCVVLVSASDCCPVFFRLSSALPPGPRRLFFLGNVLQIPMEYQYRRFGEWGEKYGDIIHIRLFRTPAIV

LNSVKAAQDLMAKKSPKYSDRPPLVFMKQILGWDPATPFMCYGDRWRKHRKWIQTAYGERTSLVGHRTLL

KRECMVLVQNLMVSPEMFLIHLRRFPASLVMTSLYGQPIQSTEDEHFRMAESALHATVKAGESAGSLIDF

FPFLQYVPDWLPGAASLREARQVRQSIRRLFDDPYHMIKRQLDNNEEVRDCLIAALYRESARNGSLADDE

DDIKGVGASVYSGNVLVFIAVSPLF

MLAMVLHPRVYVKARDEIERIVGMSNLPTLEHKDSLPYINCIIQELYRW

NPPLPLGLPHHLQSVDEYRNFHIPRGSMIFANI

WYVCSRQCVQF

RFVLSDPERFEDANVDVLSDPRNYVFGFGRRICPGRHFAEDAIWLAITHIVSIFDIEKAYNADGGEITPA

VHFRPGLTSPPAEFKCRIYPRSSELASPILAGHLHE

//

>CYP5348T2v1 PpCYP036 Cyan needs correction

scaffold 133 221176 - 218987

MEPGYLTLVFGLISMLCIILVNASDYCWVFFRLSSGLPPGPRRLLFVGNVLQIPMEYQSRTFGEWGQKYG

DIIYIKLFHTPAIVLNSVKVAQDLLAKRSSKYSDRPSLLFMKKILGWDPATPFMCYGDRWRKHRKWIQTA

YGERTSLVGHRTLLKRECMVLVQNLMVSPEMFLIHLRRFPASLVMTSLYGQPIQSMEDEHFGMAEFAIHV

TAKAGESAGSLIDFFPFLQYVPDWLPGAASLGEARQVRQSTRRLFDDPYNIIKRQVDNNEEVCDCLIAAL

YRESVRNGSLADDEDDIKGVGASVYSGNVLMFMVASPLFILAMVLHPRVYVKARDEIEHIVGINNLPTLE

HRGSLPYVNCIIQELYRWNPPLPLGLPHHLQSRDEYRDFHIPEGSMVFANIWYVCSRQCVQLYYNSFRPE

RFEDLDANVDVLSDSRNYVFGFGRRICPGRYFAEDAIWSAITHIIAIFDIEKAYNADGGEITPAVHFRPG

LTSPPAEFRCKIYPRSSELASLMLAGHLHE

//

>CYP5348T2v2 PpCYP157

95% to PpCYP036, higher if seq is corrected

scaffold 5 133563 - 135732

MEPGYLTLVFGLISMLCIILVNASDYCWVFFRLSSGLPPGPRRLLFVGNVLQIPMEYQSRTFGEWGQKYG

DIIYIKLFHTPAIVLNSVKVAQDLLAKRSSKYSDRPSLLFMKKILGWDPATPFMCYGDRWRKHRKWIQTA

YGERTSLVGHRTLLKRECMVLVQNLMVSPEMFLIHLRRFPASLVMTSLYGQPIQSMEDEHFGMAEFAIHV

TAKAGESAGSLIDFFPFLQYVPDWLPGAASLGEARQVRQSTRRLFDDPYNIIKRQVDNNEEVCDCLIAAL

YRESVRNGSLADDEDDIKGVGASVYSAGVDTTSIVLSTFILAMVLHPRVYVKARDEIEHIVGINNLPTLE

HRGSLPYVNCIIQELYRWNPPLPLGLPHHLQSRDEYRDFHIPEGSMVFANIWQMSRSAEFYRDAESFRPE

RFEDLDANVDVLSDSRNYVFGFGRRICPGRYFAEDAIWSAITHIIAIFDIEKAYNADGGEITPAVHFRPG

LTSPPAEFRCKIYPRSSELASLMLAGHLHE

//

>CYP5348T3P PpCYP080 errors in assembly compare to PpCYP239

scaffold 133 159380 - 157228

MLCVVLVSASDCCPVFFRLSSALPPGPRRLFFLGNVLQIPMEYQYRRFGEWGEKYGDIIHIRLFRTPAIV

LNSVKAAQDLMAKKSPKYSDRPPLVFMKQILGWDPATPFMCYGDRWRKHRKWIQTAYGERTSLVGHRTLL

KRECMVLVQNLMVSPEIFLIHLRRFPASLVMTSLYGQPIQSTEDEHFRMAESALHATVKAGESAGSLIDF

FPFLQYVPDWLPGAASLREARQVRQSIRRLFDDPYHMIKRQLDNNEEVRDCLIAALYRESARNGSLADDE

DDIKGVGASVYSGNVLVFIAVSPLF

TYSSKAGVDTVNTHPGFPSVLTYFQTSIVLST

FMLAMVLHPRVYVKARDEIERIVGMSNLPTLEHKDSLPYINCIIQELYRY

VAVFRQSIVYYTLQDISW

NPPLPLGLPHHLQSVDEYRNFHIPRGSMIFANI

CKCPARPNYIAMQS

RFVLSDPERFEDANVDVLSDPRNYVFGFGRRICPGRHFAEDAIWLAITHIVSIFDIEKAYNADGGEITPA

VHFRPGLTSPPAEFKGKIYPRSSELVSLILAGHLHE

//

 

CYP5349 family (2 sequences)

 

>CYP5349A1 PpCYP183

scaffold 142 140274 - 142256

MFDFWLCVAIVVAAYALLLRARKKLLPLPPASRPGPGSYLAGEHEPPWKTYQRWSLKIGPLVTVSKLGHP

IIVINSAKDATELLDKRSTFASKPRWPMAELLGRQNNVGFQYYGERLKRSRKVLHAALNPDAIANKWSEL

LDTQSIKLMRQLASDPSAFYSHIQNNIEELVVLFAYGREPEPEYTRIAKAVMEQTSIALQPGRWAVNRIP

IFPLQVKYLPTWLPGAGFQRWAKSARTLFYQMTRGPFLEVKAEMELGTATDSFVKHSLVNLGQNRTVDSE

DIIMCAAGSLYSAGIETLTSTILTFILFMARHPEVQDRAYKEIMQVVGNHHLPDITDQRALVYVDCVIRE

VHRMNPAIPLVTHSNTEDADYSGCHIPKQSWIMGNIWSMLHDETAYPRAEEFLPDRYLHAGDGSAPRDPR

TLVYGFGRRLCPGLHFANTVVYLVVARTLALYKITPEIVNGEPRNSDLILVPLYDLNAA

//

>CYP5349A2 PpCYP108

scaffold 21 264299 - 268140

MREVTELDACRFTMLDVWLCVAIVVVVYVFLVRARNRQLPLPPGPGSYLAGEREPPWKTYQRWSRNIGPL

VTVSKLGHPIIVINSTKDATELLDKRSTFASKPRWPMAELLGRQNNVGFQYYGERLKRSRKVLHAALNPD

AIANNWSELLDTQSIKLMRQLASDPSAFYSHVQNNIEELVVLFAYGREPEPEYTRLAKAVMEQTSIALQP

GRWTVNRIPILKYLPTWLPGAGFQRWAKSARTLFYQMTRGPFLEVKAEMERGIATDSFVRHSLVNLGQNR

TVDSEDIIMCAAGSLYSGDRSAGIETLTSTILTFILFMARHPEVQDRAYKEIMQVVGDHRLPDVTDQRAL

VYVDCVIQEVHRMNPAIPLVTHSNTEDADYSGCHIPKQSWIMGNIWAMLHDETAYPRAEEFLPDRYLHAG

DGSAPRDPRTLVYGFGRRLCPGLHFANTVVYLVVSRTLALYKISPEIVNGESRVCPLEFLEGLVPTPVRF

KCSIVSRGEECDDTEVRCGVPAELPDIHTRQR

//

 

CYP5350 family (13 sequences)

 

>CYP5350A1 PpCYP062 41% to CYP5037B3 Phanerochaete chrysosporium

MSSAMLNMGIPRNVIANPCTLAAAAFVVFIVVRTVAARIARPPYPPGPSGLPILGNTLHIPQIRPWSAYS

EWAAKYGDTIHLEALGEHIIVLNSSRVARDLLDKQSAIYSDRPHFVMAGELNSGYGAELPLQNYNNAFRA

QRKIVAQTFNPSMVSRYYHIQEAEARKLAKSILDDPSALISQTKFRIASIIMRVTYGYTVKGEDDPMITI

PFTSMDNFSKATEPGMWMVDLIPQLKYLPEWTPGATFLRTAKKWKQLEWSASWNPYRWCKDNLETGAALT

PSLCATALSQAGGKLSKEDEETLVWAASSGLGGGLDTNMSTIFTFILAMLHYPDVQAKAQKEIDVVVGTD

RLPSIKDKPALPYVRSLIAEVYRWNPAVPLGLPHALSQDDVYEGMSFPKGAVVMPNVWHMLHDAAVYPDP

MVFRPERFENSDAEMRKVADLAFGFGRRACPGYDFAEGTVFAVVATILATSTVKRAVDERGKDILPEVTY

TSGTIVFPENVICSLESRSPRTRDLLSQAVSLA

//

>CYP5350B1 PpCYP135

scaffold 26 49658 - 47489

MHSVLTASEALSFWSRWGQNSISTIFISSILILLIREVVLYIMRRPMPPGPFCWPILGNALQIPQHHPWL

KFTEWAKIYGPLVHLDVLRQHILVINSSQMARDLMEKRSPIYSDRPHLVMAGDLVGYKDLLVLQSYGHEL

RYQRKLVSHNFTSSNVPRYYGLQEVAAQRFVLSIIDNPVLLESHTKLHFASIIMRVTYGYIVKGPDDPFF

VAGIAADNQFSEATRPGVWPVDFVPLLKYIPYWVPGFTFAKKAREWRQVFQHASWAPYNWCKENWANDSK

RTISLCGSVLAAADGDLSSAQERSLVNAAVTVFGGGLDTNISTILSFLLAMLRFPEVQKKAQAEIDAVIG

TNRLPRVSDRPSLPYIRSVVTEVYRWLPAVPLGIPHSLRQDDLYDGLFLPKGSVIMPNVWGMLHDPTIYP

EAHEFRPERYGGLDAEMTKVTDIAFGFGRRACPGYHFAEGTIFAIVVTVLATCDVVPAVDEYGQEIIPEV

SLTSGTVVFPENVKCTFRPRSGRVKESLLESVGSKE

//

>CYP5350B2v1 PpCYP105

scaffold 26 54599 - 56723

MQTSGLTLEPPGVASPATLAVAAVTFLTALVLYELFTYRKRRSMPPGPFRWPFIGNTLQIPQVHPWLTYS

RWAQVYGDILHLDALGQHIIVINSAKIARELLDKRSAIYSGRPHLVMAGDLAGQDRLLILQPYGDEFRQQ

RRFISQDLSVAAVRRYYDIQEAAARRLVLGVINDPGSLESQIKVNIASIIMLVTYGYTVKGTDDPFITRP

FEVMDNFNASMTPGVWIVDMIPQLKYLPLWTPGATFLKTAKVWRKHLFTTNWMVYSWSKESSENGTARVP

NLCASVLTEMEGKVTPQLEESLMWAAGTVLGGGLDTNISTILSFILAMLRFPDVQRKAQVEIDAVVGSER

LPEISDRPSLPYIRSVVTEVYRWLPAIPLCIPHALTEDDVYNGVFLPKGSVVMPNVWHMLHDPTIYPDPD

AFKPERYGGLDSEMKKVTDLAFGFGRRACPGYQFAQGTIFTIVATMLATCDIVPVVDEHGQNSIPDVGYT

TGTIIFPVDVKCTFRPRTEQARAALVEASVL

//

>CYP5350B2v2 PpCYP154

92% to PpCYP105  ~96% if seq is corrected

scaffold 44 78274 - 82781

MQTSGLTLEPPGVASPATLAVAAVTLFIAFVLYELSMYYRRRSLPPGPFRWPFIGNTPDPASPSVAHIFT

LGTGDILHLDALGQHIIVINSAKVARELLDKRSAIYSGRPHLVMAGDLAGQDRLLILQPHGDEFRQQRRF

ISQDLSVAAVRRYYDIQEAAARRLVLGVINDPGSLESQIKVNIASIIMLVTYGYTVKGTDDPFITRPFEV

MDNFNASMTPGVWIVDMVPQLKYLPSWTPGATFLKTAKVWRKHLFTTNWMVYSWSKESSENGTARVPNLC

ASVLAEMEGKMTPQLEESLMWAAATVLGGGLDTNISTILSFILAMLRFPDVQRKAQVEIDAVVGSERLPE

ISDRPSLPYIRSVVTEVYRWLPAIPLCIPHALTEDDVYNGVFLPKGSVVMPNVWHMLHDPAIYADPDAFK

PERYGGLDSEMKKVTDLAFGFGRRACPGYQFAQGTIFSIVATMLATCDIVPVVDEHGQNSIPDVRYTTGT

IIFPVDVKCTFRPRTEQAKAALVDSAATLL

//

>CYP5350B3v1 PpCYP045

scaffold 44 85149 - 82985

MHSVLAQAASGALSFELRLGQSSVLTICILALLTFVLREIVLYFTRHSMPPGPFRWPLIGNALQLPQDHP

WVKYTEWAKMYGPLMQLDVLGQHMLVITSAQTARDLMEKRSSIYSDRPHLVMAGDLAGFGDTLILQNYGE

EFRYQRKLVSHSFSPSVIHRYYDLQEAAARRLVLAIIEDPDSLENSTRLHIASIILRMTYGYTVKGVDDP

LFTTGIAVINGFSEATRPGAWPVDFVPILQYVPHWVPGFVFTRKAREWRGVLERAMWAPYHWCKENYARD

AAHGLCLCGSILAAEGSQLSSDQEWLFVNAAVTVMGGGLDTNISTILSFVLAMLRFPEVQKKAQAEIDAV

IGPNRLPLISDRHSLPYVRSVVTEVYRWIPAVPLGIPHALRQDDHYDGLFLSKGSVVVPNVWGMLHDPSI

YPAPHEFKPERYGGLDAEMTKVTDIAFGFGRRACPGFYFAEGTIFAIVATVLAICDVVPTVDEHGQEVIP

EVSLTSGAIVSPENVKCAFRPRSGRVKDILVEAVETEQE

//

>CYP5350B3v2 PpCYP251

100% to PpCYP045

MHSVLAQAASGALSFELRLGQSSVLTICILALLTFVLREIVLYFTRHSMPPGPFRWPLIGNALQLPQDHP

WVKYTEWAKMYGPLMQLDVLGQHMLVITSAQTARDLMEKRSSIYSDRPHLVMAGDLAGFGDTLILQNYGE

EFRYQRKLVSHSFSPSVIHRYYDLQEAAARRLVLAIIEDPDSLENSTRLHIASIILRMTYGYTVKGVDDP

LFTTGIAVINGFSEATRPGAWPVDFVPILQYVPHWVPGFVFTRKAREWRGVLERAMWAPYHWCKENYARD

AAHGLCLCGSILAAEGSQLSSDQEWLFVNAAVTVMGGGLDTNISTILSFVLAMLRFPEVQKKAQAEIDAV

IGPNRLPLISDRHSLPYVRSVVTEVYRWIPAVPLGIPHALRQDDHYDGLFLSKGSVVVPNVWGMLHDPSI

YPAPHEFKPERYGGLDAEMTKVTDIAFGFGRRACPGFYFAEGTIFAIVATVLAICDVVPTVDEHGQEVIP

EVSLTSGAIVSPENVKCAFRPRSGRVKDILVEAVETEQE

//

>CYP5350B4 PpCYP238

scaffold 119 137773 - 139901

MSYAGLTTAAVTLLAALLIHELSAYSKRRCMPPGPFRWPLIGNALQVPQVHPWLTYSRWARAYGDIFHLD

ALGQHIIVINSAKVARELLDKRSAIYSGRPHLIMAGELTGSDRMLIMQPYGDELRRQRRLISQTLSISTI

GQYYDIQEAAARRLVLGVIDDPSSLEGQIKTNIASIIMLVVYGYTVKGTEDVFAERAIQVVDNLSLAAMP

GVWLVDMIPQFKYFPSWMPGLSSLKTAIAWRKLHYMTNGMLYKWCKENSENGTAHVPNLCASVLAEAETE

AEGKAAPQLEESLMWAAANVLAGGLDTNISTIISFILAMLRSPDVQKKAQAEIDAVVGRERLPQMSDKSS

LPYIRSVIAETYRWLPATPLCIPHALDEDDVYDGSFLPKGSIIIPNVWHMLHDPDVYPEPDVFKPERYGG

SDIEMKKVTDVAFGFGRRACPGFDFAQGTIFSIVVTVLATCDIVPIVDDHGQEIIPDIRYSTKVVLCPED

VKCTFRPRSGQAKSALIDSITNVL

//

>CYP5350B5 PpCYP097

87% to PpCYP017

scaffold 119 141820 - 143997

MQAPHPTSGQPGVPFSTSYAALALAVVTLLAALLAHELSAYSKRRAMPPGPFRWPLIGNALQVPQVHPWL

TYSRWAHVYGDIYYLDALGQHIIVINSAKVARELLDRRSSIYSGRPHLTMLGDLAGYDRMLLLQPYGDEL

RQQRRLISQTLSISTIGQYYDIQEAAARRLVLGVIDNPSPLEGQIKTHIASIIMLVTYGYTVKGTEDVLT

ERAIKVMENLSLGETPGTWLVDIIPQLKYLPSCMPGSTFLNTAKAWRKLLYTTSRTLYQWSKEHSENGTA

HLPNLCASVLANADGKATLQLEESLMWAALTVLAGGLESNISTILSFILAMLHYPDVQKKAQAEIDAVVG

SGRLPQISDRSSLPYIRSVIAEVYRWLPAGPLGAPHALDEDDVYDSVFLPRGSLIIPNVWHMLHDPDVYP

EPDVFKPERYGGSDIEMKKVTDVAFGFGRRACPGFHFAQGTIFSIVVTVLATCDIVPVVDDHGREIIPDI

RYPTKAALCPEDVKCVFRPRSEKAKSALIHSTTSIL

//

>CYP5350B6 PpCYP121

scaffold 119 152438 - 150263

MQASGPAPGQPSVPSATSHAALAVVAVMLLAALLVHELSAYSKRRSMPPGPFRWPLVGNILQVPQVHPWL

MYSHWVRVYGDILYLDALGQHIIVINSAKVARELLDRRSSIYSGRPHLTMLGDLAGYDRMLLLQPYGDEL

RQQRRLISQTLSISTIGQYYDIQEAAARRLVLGVVDDPSSLEGQLKTSIASIIMLVTYGYTVTGAEDVFV

ERAIKVMENFTLAETPGTWLVDMIPQLKYLPSCMPGSTFLNTAKAWRKLLYTTNRMLYQWSKEHSENGTA

RVPNLCASILANAEGKATLQLEESLIWAAFTVLLGGLDTNIATILSFILAMLRFPDVQKKAQAEIDAVVG

SERLPQISDRPSLPYIRSVIAEVYRWLPAGPLGAPHALDEDDVYDGVFLPKGSIVIPNVWHMLHDPDVYP

EPDVFKPERYGGSDIEMKKVTDIAFGFGRRVCPGFHFAEGTIFSVVVTVLATCDIVPVVDDHGQEIIPDI

RYPTRSVICPEDVKCTFRPRSGQAQSALIDSIASGL

//

>CYP5350B7 PpCYP155

87% to PpCYP226 

scaffold 5 133563 - 135732

MQASDPTQGQLGVPFATSHAALAVAAVTVLAALLVHELSAYTKRRSMPPGPFRWPLIGNTLQVPQVHPWL

TYSRWARVYGDIFYLDALGQHIIVINSARVARELLDRRSSIYSGRPHLIMAGQLVGGDRMLIMQPYGDEL

RQQRRLISQTLSTSTIGQYYDIQEAAARRLVLGVIDNPSSLEGQIKTNIASIIMLVVYGYTVKGTEDMFA

ERAIQVVDNLSLAATPGIWLADMIPQLKYVPSWMPGISSLKTAKAWRKLLHTTNGMVYQWCKENSENGTA

HLPNLCASVLSDAEGKATLQLEESLKWVAFSVLTGGLDTNISTIISFILAMLRFPDVQKKAQAEIDAVVG

SERLPQISDRPSLPYIRSVIAETYRWLPATPLSVPHALDEDDIYDGSFLPKGSIIMPNVWHMLHDPNIYP

EPDAFKPERYGGSDIEMKKVTDIAFGFGRRACPGFYFAQGTIFSIVVTVLATCDIVPIVDNHGREIIPDV

RYSTKIILCPEDVKCTFRPRSEQAKLALVDTCSD

//

>CYP5350B8 PpCYP017

scaffold 5 144344 - 142193

MQAPHPTPGQPGVPFSTSYAALAVAVVMLLVSLLVHELSAYSKRRSMPPGPFRWPLIGNALQVPQVHPWL

TCSRWARVYGDIFYLDALGQHIVVINSATVARELLDRRSSIYSGRPHLIMAGDLAGYDRTLIILPYGDEF

RQQRRLISQTLSISTIGQYHNIQEAAARRLVLGVIDDSSPLEGQIKMNIASIIMLVTYGYTVKSTEDVFV

ERAIKVMENFTLAEMPGTWLVDMIPQLKYFPSWMPGLTFHKTAKAWRKLLYTTSRTLYQWSKEHSNNGTA

HLPNLCASVLANADGKATLQLEESLMWVALAVLSGGLDTNISTILSFILAMLHYPDVQKKAQAEIDAVVG

SERLPQISDRPSLPYIRSLIAEVYRWLPAGPLGAPHALDEDDVYDGYFLPKGSIIIPNVWYMLHDPNIYP

EPDVFKPERYGGSDIEMKKVTDIAFGFGRRACPGFYFAEGTIFSIVMTVLATCDIMPIVDDHGQEIIPDI

KYPTKAVLCPEDVKCIFRPRSEKAKSALIHSTTSIL

//

>CYP5350B9 PpCYP226

scaffold 5 147881-145708

MQASDPIPPQLGVPFATSYAALTVAAVTLLAALLVHELSAYSKRRSMPPGPFRWPLIGNALQMPQIHPWL

TFSRWARVYGDIFYLDALGQHIVVINSATVARELLDRRSSIYSGRPHLTMVGDLAGYDRMIVMQPYGDEL

RQQRRLISQTLSTSTIGQYYDIQEAAARRLVLGVIDDPSSLEGQIKMNIASIIMLVTYGYTVKGTEDVFF

GRAIEIMDNLTLAARPGVWLADMIPQLKYFPSWMPGLSSLKAAEAWRKLLHTTNGMVYQWCKENSENGTA

HLPNLCASVLAQAEGKATLQLEESLMWAALTVLSGGLDTNISTILSFILAMLHYPDVQKKAQAEIDAVVG

SGRLPQISDKSSLPYIRSVIAESYRWLPATPLSVPHALDEDDIYDGSFLPKGSIIMPNVWHMLHDPKIYP

EPDAFKPERYGGSDIEMKKVTDIAFGFGRRACPGFYFAEGTIFSIVVTVLATCDIVPVVNDHGQEIIPDI

RYSTNVVLCPEDVKCTFRPRSEQAKSALIDSMTGVL

//

>CYP5350B10 PpCYP050

scaffold 20 380480 - 378298

MQASDPTPGQPGVPFAASYAALAVAAVTLLAALLVRELSAYSKRRSMPPGPFRWPLIGNALQMPQVHPWL

TYSRWARVYGDILYLDALGQHIIVINSAKVARELLDKRSSIYSGRPHLTMLGDLAGYNKILLMQPYGDEL

RQQRRLISQTLSISTIGQYYDIQEAEARRLVLRVIDNPSLLESQVRTSIASLIMLVTYGYTVKGTEDVFV

ERAIEVLENLTLAEMPGTWLVDMIPQLKYFPSWMPGFTFLKTAKAWRKLLYTTNRELYQWSKEHSENGTA

RVPNLCASVLAEAEGKATLQLEEYLMWAAITVLGGGLDTNTATILSFILAMLRFPDVQKKAQAEIDAVVG

SERLPQTSDRPSLPYIRSLIAEVYRWLPAGPLSAPHALDEDDVYDGIFLHKGSILLPNVWHMLHDPDVYP

EPDVFKPERYGGSDIEMKKVTDVAFGFGRRACPGFHLSQGTTFSMVVTMLATCDIVPVVDDHGQEIIPDV

KYPTKSILYPEDVKCTFRPRSEQAKLALIDSMTDSVI

//

 

CYP5351 family (2 sequences)

 

>CYP5351A1v1 PpCYP201

MFTLIALALFVAFIAFYRSGYRSNKLPSGPGGLPFVGNIFDLTTHESWRRAVQWGKEHGDMIYIRISGTR

FIFLNSPNAVNDLLHARSSIYSDRPYLQMACGLCGMGDLVPLTRYGGRLRYERRLMQNALGPSAVEKWKR

IVMKESYMLLQDLSASPEAYLSHIKRMAASLIFATVYGYTIKSGDDPYVQSAEEFMEVSSYAITAGWIVD

FLPFLRWIPYTNFRRTAITWRAKLHDWIERPHMMFKGLPDSAMKRTSFCGNLLMSEGESSAFSDAPLEEH

VKWIATSMYGAGSDTTVVTLCQFLLALVLNPKVQLKAQEEIDNAVGKSRLPCFEDRPRLPYVECVLKEVL

RWGTPVPLTPPHRLTKRDEYRDYTFPEGTNFIANMWAILHDETMYPDPEKFSPERFEHSLDPLSHKASHD

PMDYAFGFGRRRCPGIHFANQSIWFVMVSILACFDVKPAIDENGMEIMPPLIFAGGAFRHPKAFRCRITL

RAEVEQDLILTSLTACSA

//

>CYP5351A1v2 PpCYP202

95% to PpCYP201

MFTLIALALCVAFLAYYRSSYRSNTLPPGPGGLPFVGNIFDLTTHESWRRAVQWGEEHGDMIYIRIFGTR

FIFLNSANAVNDLLHVRSSIYSDRPYLQMACGLCGMGDLVPLTRYGGRLRYERRLMQNALGPSAVEKWQR

IVMKESYMLLQELSVSPEAYLSHIKRMAASLIFATVYGYTIKSGDDPYVQCAEEFMEVSSYAITAGWIVD

FLPFLRWIPYTNFRRTAITWRAKLHDWIERPHMMFKGLPDSAMKRTSFCGNLLMSEDETSAFSDAPLEEH

VKWIATSMYGAGSDTTVATLCQFLLALVLNPKVQLKAQEEIDNAVGKSRLSCFEDRPRLPYVECVLKEVL

RWGTPVPLTPPHRLTRRDEYRGYTFPEGTHFIANMWAILHDETMYPDPEKFSPERFEHTLDPLSHKASHD

PMDYAFGFGRRRCPGIHFANQSIWFVMVSILACFDVKPAIDENGMEILPPLIFAGGAFRHPKAFRCRITL

RAEVEQDLILTSLAACSA

//

 

CYP5352 family (1 sequence)

 

>CYP5352A1 PpCYP028 44% to CYP5037B2 Phanerochaete chrysosporium

MWGLIVSISVLCLVVVVFKISFKRLPLPPGPEAKFWTGNVHQLPTTEPWLTYAKWSQNHGPVVFFRVHGR

RMLILNTLKVALDLLESRASLYSDRPMAWMYKELVGRKLAVFNISVKHPRFKIYRKLLQSGLNQRATRTY

RAIQEEETKILLRGLARSPEQFVSHIRRNAGAVILKVAYGWTVAENDDYFVSLMEESFKVHAEIVKPGRW

LVDTYPILRFIPKWFPFASFQRQAEIYRKEFSRIDTVPHAWAKEQIESGHYVDSFTSLNLRPDDGHNPDP

EEEDMIKWCSSALYAGGADTVVGVVTAFFLLMSLHPHVQRRAQAEIDRVVGNRLPSIDDEPHLPYVSALL

KEVLRWAPVSPLGLPHRLVEDDSYNGYWIPKGTTVYANIWAIAHDPDLYPDPSRFDPERFLPPQGAEPQL

NPRKYVFGFGRRVCPGAHFAEMSAFLVISNIIATFNISKALDGTGREIEPQVAFTTAVTSHVQPFPCRIT

VRSPELLGSLDLENGTNTLT

//

 

CYP5353 family (1 sequence)

 

>CYP5353A1 PpCYP093

40% to PpCYP074 and PpCYP032

MLLELTFGVVLIYIVYTYLNSGISGNSNSLPLPPGPRRRWLIGNLLDLPKTIDWGILAGWKDTYGEMTFF

TAFGHSILVLNSLRVVDVLLSKRGDQYSHRPRFVMGGELVGLNKSIALMDNGRELKELRRLSHRVLTTDA

LRKHTTVHQALVEDYMRTVVQEPDNFLTNLRLALGRMVLVVAYGLTNHANDNKYIQEAEDVMELVGGSVI

PGAYMVDIVPMLRYIPTWLPFVSFHRQAQLGRKLLDDWVTRPFEHVKRQMECGNASPSFLTDILENETLK

EDNESNIVEGVKWAAATMYGAGVDTSHATVATFFLLMALHPDVQVKAQAEIDKIVYMERHVTMEDKAQLP

YVQAVIAEVMRWHAVVPLGIPHRTAEEDVYEGYRIPAGTIVVPNIWAIARGEGSHAFVPERFLGKSAPIH

SSEYVYGFGRRICPGRHMADNAIFLIVANILALFDIRPQGDAVNGKASLENVEFQRRLVSGPEKFQCSIR

PRSRGCAQLAAMRE

//

 

CYP5354 family (2 sequences)

 

>CYP5354A1 PpCYP084

77% to PpCYP131 

MSANVQLYAATVLLVVAYGIVRRLRKRRRASFPPGPRPYPLIGNLRDIPSEAPWKTFAKWSEQYGDMVYF

HTLGREVVVLNSATMAHDLLDKRSAKYSYRPFFAMASEVIGWKWALPIMDYGEKWKRHRKYLQQFFHKQN

IPKYYNIELKEVHHLLNDFLDDPENFTAHIKRLAGGVTMMLTYGHEVKSLEDPFIRVAEKGVLTIEAVGA

VGAHVVDFVPWIRHLPDWFPGAVIKRLPPGTREDLHDFLHKPFNYVKERLAQGTAVPCYTTTLLEETKGN

DDEGIRGTAAITYAGGFDTTLSALMTAMIALVADPAIQMRAQEEMDSVIGKDRLPTFEDRARLPYMHSII

TETLRWGATTPVGVPHRLSQDDEYGGYCLPANCVVIANTWAMLYDPRVYPEPHKFNPDRFFNKEGGIIQP

DPRGPAFGFGRRVCPGKDLAETHLWITIASMFYAFKITPAVDESGKEIPIDLEFSEHSIRHPKPFKCIIK

PRRANSASLIRHAKDN

//

>CYP5354A2 PpCYP131

MAATIQLYVVASLLAVSYALWYRSKARKRSLPPGPQPYPLIGNLYDVPSEAPWRTFAKWSERYGDMIYFH

TLGREVIVLNSATIAHELLDKRSAIYSYRPFFAMANEVIGWKWSLPSMDYGEKYKRHRKYLQQFFHKQNL

PKYYNVELKEVHRLLNDLLDDSEHYAAHMKRLAGGVTMMLTYGHEVTSSDDSFIRIAEKGVLTIEAAGAI

GAHIVDFVPWIRHLPDWFPGASIKHLPPGTREDLHDFLHKPFDYAKERLAKGTAVSCYTTALLEETKGED

DEGVRSTAAITYSAGFDTTMSALMTAMIALVADPVIQARAQAEMDSIIGKDRLPTFDDREKLLYMQCIIT

ESIRWGVATPVGVPHRVSQDDYYNSYYIPANTMIIANAWAMLHDPQVYPEPERFNPDRFLHGEGRNPQPD

PRGPAFGFGRRICPGKDLAENHLWITIASMFYAFKITPAVNDKGEKIPIDLEFSEHSIRHPKPFKCVITP

RRTNSVALIRQTVDI

//

 

CYP5355 family (2 sequences)

 

>CYP5355A1v1 PpCYP018

99% to PpCYP094

scaffold 10 130564 - 132872

MSVSLSWLLLVPLGILFKMWYDKNAGARRSLPPGPKGWPLLGNVNDIPEVAPWLDYADLGKIYGGIIGLK

VLSQSLVVVNDLSIAHELLDKCSNITSDRPANKLLDFLGWEFSLVILRYGQRWRDQRRLFRQAFRPEAVY

GYQPIITQKARQLLLNLLDNPEGFIDHARNYPASIVMRLVYGHEIAPRNDRLVYLADKAGEMVELLLLPG

LDLIKVFPFLRFLPEWNFLTGFPRKARISRDMVKEMRDVPWDMVRDQMTAGTAPSSMSSDLLERSSKLGG

DMSKEEATIKDTVSIAFAAGTDTTAATLKTFLLAMVLFPEVQKKAQEQIDNVVGQRLPTFDDRDSLPYVD

AIYQETQRWHPAVLLGFPHVSTEDCSYKEWFLPKGTVILPNIWAMSRNAEQYPEPEEFRPERYLTPSGDR

TEESSEFTFGFGRRICPGRHAADASLWLAISSILAMFSIEKAKDENGKEIPIPGDYGGHGLVSHVVPYKC

VFRPRFEGAEQLIRSSK

//

>CYP5355A1v2 PpCYP094

MSVSLSWLLLVPLGILFKMWYDKNAGARRSLPPGPKGWPLLGNVNDIPEVAPWLDYADLGKIYGGIIGLK

VLSQSLVVVNDLSIAHELLDKCSNITSDRPANKLLDFLGWEFSLVILRYGQRWRDQRRLFRQAFRPEAVY

GYQPIITQKARQLLLNLLDNPEGFIDHARNYPASIVMRLVYGHEIAPRNDRLVYLADKAGEMVELLLLPG

LDLIKVFPFLRFLPEWNLLTGFPRKARISREMVKEMRDVPWDMVRDHMTAGTAPSSMSSDLLERSSKLGG

DMSKEEATIKDTVSIAFAAGTDTTAATLKTFLLAMVLFPEVQKKAQEQIDNVVGQRLPTFDDRDSLPYVD

AIYQETQRWHPAVLLGFPHVSTEDCSYKEWFLPKGTVILPNIWAMSRNAEQYPEPEEFRPERYLTPSGDR

TEETSEFTFGFGRRICPGRHAADASLWLAISSILAMFSIEKAKDENGNEIPIPGDYGGHGLVSHVVPYKC

VFRPRFEGAEQLIRSSK

//

 

CYP5356 family (1 sequence)

 

>CYP5356A1 PpCYP025

some overlap with CYP5144 family

scaffold 24 451421 - 448987

MSVSAAQLLLSPLFLAAGLWAWKWLSWRRRNPAGLPMPPGPKGYPIIGNVLDMPQKATWLTFREWAKQYG

DIVSVDILGTKIVIMNTAKPAYDTFEKRGAIYSDRPRMIFLKELMGWDVSFTVMAYGDDWKTHRRVFHQH

FNPSVVSQYLPVQIKHARAMLSRLLDDPKSLYEQSKFVTASIILDVTYGKSIADPHDELVTRAEEVIQYV

ALASVPGSFLVDFLPIMKYIPEWFPGAGFQRWASKGRRMVNEMMEGPWETIKKELRLGSAQVCFATKLIE

ELPDGPERANMERISRNAAGVTYGAGNDSTSAAVRSCFLALALHPQFQKKAQEELDRVVGSSRLPDFEDR

KNLPYINALLKETIRWTGIAPLGNPHATTADDVYNGYFIPKGTIVIGNSWAMQHNEEDYPNADAFLPDRW

IKDGQIDPNVKDPIVAFGFGRRLCPGRFFSDNTLFAVISSVLHVFNIVQSVDEQGKPIPIHNQLFDSGFF

IFPEPFQVTMKPRSQEAVRLVHDSAE

//