Rhizopus oryzae P450s

 

D. Nelson

 

August 7, 2009

 

53 sequences

 

>CYP51F1 P450-40 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

46% to CYP51F1  Aspergillus fumigatus = CYP51F1

RO3G_11790.1

MAVISTLLPTLESIPLYAVLALGVFVIINILSQWFGPKNPKEPPVVFSWIPFMGNAIEFGINPIAFLQKCQKKYGDVFTFYMVGKRVTVFLNADGNQFVFNAKQNLTSAADAYNHMTKHVFGPEVVYDAPHSVFMEQKRFIKAGLNSESFRQHVPMIVEEVEGFFKNYKKPTGAFDAYHTLGELIICTASRCLMGKEIRASLDDSVAGLYYDLDQGFKPINFIFPNLPLPSYRKRDVARQKMTDLYSSIIARRKAENDFSNADLLQALMDANYKDGSNVPDHHIAGMMIAVLFGGQHTSATTSAWTLLELAARPDLIRDLREEQITKLGSLKADLTFDNLKELTLLDSCVRETLRLHPPIFQMMRRVTANKVVFEKTGHEIPKGNFLCAVPGVTQVDSQYFNEPLKYDPLRWINLTDPVHSMEAGDDSNIDYGFGAVGISSKNPFLPFGAGRHRCIGEQFGYLQIKTIIATIIRLFDIELEDGKGVPKSDYTSMVVVPERPSNIKYTWRE

 

>CYP51F1P Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

60% TO CYP51F1 Rhizopus oryzae

RO3G_08504.1 revised

NSIALYKNAKKKKSNVFTFHLVGKRVTLFLKAEDNQFVFNAKQNLISAANTHNYMTKHVFGPENVYSVPQCVFMEQK ()

XXXXXXXXXXNYSQHVL

MIVEEVESFFKDFKKPTSASDAYHILEKLIICTASRCLTDKETRVYLDDSAASLYYVLGQRFKSISFIFPNLPSHSYGKH

DVVRQKMADFYSNIIACRKVENDF (0)

SNADLLQSLMDAIYKNRIHISDHDITSMVIAILL &

E*YTFTTTSAWTLLELANRTSL &

IHGLRKEQITRLGSLKSSLTLDKFKKSTSLDDCIHKTLRLHPSIF*IRATADKIIYEK

TGHEISKDNLLCAVSSVTQINDQYYNSPLKYSRL**INLINPFHLREVGDDNDVDDNFDAVSVFSSNLFLPVGVVR &

HKCAGEQFGYQLLPL*PRLFDTKLEASRGVPKTNYTLMVVAPKRSSTIKYMERE

 

>CYP51F5 P450-46 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

62% to P450-40

42% to CYP51F1 Ustilago maydis in the CYP51 family

45% to CYP51F1   S. pombe

RO3G_16595.1

MAIISTLLSETSLSSLLYKAIVFLATYYVIHLLSQFQPKDPKAVPLVPSWIPFFGNAIEFGKNPIEFLQTCQKKYGDVFTFRLLNKRVTACLGPDGNQFVFNAKQEVASAAAAYNHMTKYVFGNDIVFDTAHSVFMEQKRMIKSGLNIEAFRKDVPLIIEECDAFFDGLEPQGEMDLYKMFGTLIIYTASRTLLGPEIRQALDSGVSELYYDLDQGFRPINFMFPNLPLPSYRRRDEAREKLAKIYAGIIQKRRQSEHGESDLLQTLIEARYKDGSAVPDAQICGILTAALFGGQHTSSTTAAWTILELAQRPDIIQALRQEMITQCGSLEVDFTYDHLERLTLLEHVVKETLRLHPPIFNMMRRVVAPKCVFSGREIPQGDYLLAAPGVTQLDPHYFHQPTVWDPYRWSQLKDPVHQLEQGEDANADYGFGVVGISSKSPFLPFGAGRHRCIGEKFGYLQLKTIIGTFVKRFDVEPLSHTVPKPDYTSMVVVPENSHIRYRARKQ

 

>CYP61A1 P450-10_var1 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

65% to P450-8 = CYP61 C-22 sterol desaturase

53% to CYP61A3   S. pombe

RO3G_04913.1

MSTSPSLFNPRSIESAKNAINSFVKSALNTQPSTTVLVCSALVGLFAYEQYVYLKKKKSLPGPFFKIPIIGAFMDSLYPTFEGYMSKWKSGELSCVSVFDRFVVIASTCELSRKILNAPAYAEPAVVDSMRHILCADNWVFLSGKAHVDYRKGLNVLFT RKALGIYIPIQERVYQKHFDEWLSLDGKSEQYQLRFREINMEASLRVFLGDYMSDQVAQQISEEYFNITAALELVNFPIPLPGTKVYKAIQSRKFIVKHFIECIKDCRIRMAQGGEVKSMMDAWISSMAEYEVECEKAGKPAPRKFDDREVALTILTFLFASQDATSSALTWAFQLLADHPDVLEKVYQEQLRLRKDNLQQELSLELMEESTYLRQVVKEILRLRPPVLMVPYQTVREWPITPSYTIPKKAMVIPTTYPALHDPVAYPNPDAFDPDRWGPEGIAEKHPKNFMVFGNGPHHCLGKEYAVMHLMAVIAQATLQMEWTHTRTEKSDDISIFATIYPQDGCIMSFKPRTITN

 

>CYP61A8 P450-49 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

93% to P450-10_var1

53% to CYP61A3 S. pombe in CYP61 family

RO3G_16941.1

MSASSTSLFNPRSIESAKNAINSFVRSALNTQPSTTVLVCSALVGLFAYEQYVYLKKKRSLPGPLLKIPIIGAFMDSLYPTFEGYMSKWRSGELSCVSVFDRFVVIASTCELSRKILNAPAYAEPAVVNSMRHILCADNWVFLSGKAHVDYRKGLNVLFTRKALGIYIPIQEKVYQKHFDEWLSLDGRSEQYQLRFREINMEASLRVFLGEYMSDAVATQISQEYFNITAALELVNFPIPLPGTKVYKAIQSRKFIVKHFIECIKDSRIRMAQGGEVKSMMDAWISSMNEYEVECEKAGKPAPRKFDDREVALTILTFLFASQDATSSALTWAFQLLADHPDVLEKVYQEQLRLRKDNLQQELSLELMDASTYLRQVIKEILRLRPPVLMVPYQTVREWPITPNYTIPKKSMVIPTTYPALHDPVAYPNPDAFDPERWGPEGIAEKYPKNFMVFGNGPHHCLGKEYAMMHLMAVISQATLQMKWTHTRTEKSDDISIFATIYPQDGCIMSFKPRN

 

>CYP61A9 P450-8 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

50% to CYP61A3 S. pombe = CYP61 C-22 sterol desaturase

RO3G_04483.1

MDSVFIEKARKLFEKTVEQIKEVIAEGLAADKAYFTPIGLASAAVAGFLVWEQVDYHRKKRHLPGPSFKMPLIGSLMDSMEPTFDKYNSKWKSGNLSCVSVFNRFIVIASNCELSRKILNSPGFVQPAVVDSMRYILTDDNWVFMDGKEHLNYRKGLHSLFQRSSLGGYLTIMDKCYQKFFDEWLSHEGKTRRYQWDFRELNMQSSLRVFLGDFMPESVAKKCSEEYFNITAALELVNFPYPLPGTKIYKAMKSRQYIYDAFVESIKDARIRMSQGSQTTCLLDNWLVTMKENERECLEAGKPAPHVFTNHEIALTILTFLFASQDATSSALTWTFQLLADHPETLKKVYDEQDKLRADDPNQPLTLELMEKSVYLRQVVKESLRLRPPVLMVPYQTHRDFPISDGYTVPANSMLIPTTYPALHDPVAYPNPDAFDPDRWGPEGVAERHPKNFMVFGNGPHHCIGKEYAILHVMSTVAQATRRLEFKHYPTSESDTIWLFATTYPKDECSMSFHPRTKFPYH*

 

>CYP509B1 Rhizopus oryzae RA 99-880 (Zygomycete fungus, Mucoromycotina)

AACW02000089.1 cont3.89

P450-15 in CYP56 clan

43% to CYP509A1

RO3G_05802.1 revised

        MIFEVIQEIIQPWIESNVRILIVFGIVLAFYALVQRYNRPPAALAHLPYVSFFSFLK

        YGFKDEVYDTYAKEKLLPLLKAKG (1)

291331  GWVVRLADPVAIKQFTLKQGK (2)

        GLFASPTIQGWVSIHLNSNHEIPSIEHT (instead of the third exon above)

     (?)FPKAMSNAGEEGTLIHRF  291158

291157  IGGPNIVFLSGPDWKRHRK (0)

        IANLAFQRSMPVQLFGDLAKRML  290978

290977  RSMEKTEEDAIDVNDLFRRFTLDAIGNGGF (1)

        GFDFHAIEDKE  290807

290806  SKWVEYYESVMQGMASPFYIVFPAFDTKYVHWFRKRKQLHDNLSKLMENMDEIIEKKRKL  290627

290626  VYENGQGESKEKDLLTLMIESEMKSEGESLSNEELR (0)  290522

290469  SNLCIFFLAGHDTTANTLAAIIYELAKNKEIQEKARKEAIRILGDGPEDTAPTAEQL  290299

290298  KELDYINMIIKE (0) 290263

290192  TLRRHPPAYVTTDRVVQNDLVLGDVHIPKGSDLCLDIYSLHHNADIWSNPFEFNPERFAPGGEADS    290019

290018  QRGIAWAPFSSGGRMCVGMNFSLTEQRVLIPML (1) 289923

289869  LKKYTWSLPNDSSHQHELQKRGIAWGLVTFKDKVKIEFKKRN*  289741

 

>CYP509C1 P450-32 in CYP56 clan Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

93% to P450-33, 90% to P450-30var1, 89% to P450-31, 87% to P450-34_var1

87% to P450-29, 84% to P450-7_var1, 65% to P450-39, 59% to P450-36

56% to P450-42, 53% to P450-20a, 53% to P450-12, 40% to 509B1 =P450-15, 38% to CYP509A1

RO3G_10680.1

MEDLVTKYNMALEGALPLFQKRSKSSYIVAAILLITVKQIYSFFRVPTNLRHLPCVSFFAMAKSLLTCEPPYNRFKRITFPAIQEGNGFYVSKIPTGWTVYVANPVAAKQLLLKSNNFPKSHYGLDTIGEKSTAVQFVGRDNVVLSNGEIWKKQRKIMNPVFHRSMPIKTVASLVPLLFSAIEEANGRIMITPKMKDFTLDALGLTIFDFDFKALQGDPDNWTSIYRLITRSIFDPISYVFCALEPLLVYVYPKRRRSVDAVAKINAKFDQVISKKREELQNGIFSNKPDNEKDLVTLMLEAGMQEDVSITNEELRHNMAVLFLAGHDSTSNTLSFCLYHLAKNKRAQQKLREEIINILGDDDIDIVPSLEELKQMKYMNMVIKETLRLGMPLDLLTPRKTVEDTFVADTFIPKDTVIAVDAGALHRDPRSWKDPDEFVPERFEDDGEQNSHEGLTWVPFSNGTRQCIGMNFSLMEQRLTLTMLLRKYEVDLPKDSIHYDHIIYEQPSYVCPESLELIFTKRY

 

>CYP509C2 P450-33 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

93% to P450-32 in CYP56 clan

RO3G_10685.1 revised

MEDLVTKYNMTLEGVLPLFQKRSKSSYIVAAILLITVKQIYSFFRVPTNLRHFPCVSFFAMAKSLLTCEPPYNRFKRITFPAIQEGNGFYVSKIPTGWTVYVANPVAAKQLLLKSDNFPKSHRRFDTIGEKSTGVQFVGRDNVVLSNGEIWKKQRKIMNPVFHRSMPIKTVASLVPLLFSAIEEANGKIPINPRMKDFTLDALGLTIFDFDFKALQGDPDHWTSTYRLVIQSISDPISNVFSALEPLLVYVYPKRRRSVDAVAKINAKFDQVISKKREELQNGIFSNKPDNEKDLVTLMLEAGMQEDVSITNEELRHNMAVLFLAGHDSTSNTLSFCLYHLAKNKRAQQKLREEIINILGDDDIDIVPSLEELKQMKYMNMVIKENLRINTPLDLLLPRKTAEDTFLADTFIPKDTIIVIDVGALQRDPRSWKDPDEFVPERFEDDGEQNSHEGLTWVPFSNGTRQCIGMNFSLMEQRLTLTMLLRKYEVDLPKDSIHYDHIIYEQPSYVCPESLELIFTKRY

 

>CYP509C3 P450-30var1 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

87% to P450-29 in the CYP56 clan

RO3G_10670.1 revised

MDDLVTKYNMTLEGVLPLFQKRSKSSYIVAAILLITVKQIYSFFRVPTNLRHLPIVSFFAMAKSFLTCEPPYSRFKRITFPAIQEGNGFYVSKIPTGWTVYVANPVAAKQLLLKSDNFPKSHRRFDTIGEKSTGVQFVGRDNVVLSNGEIWKKQRKIMNPVFHRSMPIKTVASLVPLLFSAIEEANGRIPINPRMKDFTLDALGLTIFGFDFKALQGDPDHWTSIYRLVIQSISDPISNVFSALEPLLAYVYPKRRRSVDAVAKINAKFDQVISKKREELQNGICSNKPDNEKDLVTLMLEAGMQEDVSITNEELRHNMAALFLAGHASTSSAVSFCLYHLAKNKRVQQKLREEIINILGNGDMDIVPSLEELKQMKYMNMVIKENLRLNMVLDLLLPRKTAEDIFLAGTFIPKDTNIAVDVGALQRDPRSWKDPDEFVPERFEDDGEQNSHEGLTWVPFSNGTRQCIGMNFSLMEQRLTLTMLLRKYEVDLPKDSIHYDHIIFEKPTYSCPESLELIFTKRY

 

>CYP509C4 P450-31 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

89% to P450-30var1 in the CYP56 clan

RO3G_10674.1 revised

MDDLVTKYNMTLEGVLPLFQKRSKSSYIVAAILLITVKQIYSFFRVPTNLRHFPCVSFFAMAKSLLTCEPPYSRFKRITFPAIQEGNGFYVSKIPTGWTIYVANPVAAKQLLLKSDNFPKSHSRIDTLGEKYMGVQFMGRDNVAISNGEVWKKQRKIMNPVFHRSMPIKTVASLVPLLFSAIEEANGRIPITPKMKDFTLDALGLTIFDFDFKALQGDPDHWTSAYRLMMQSLFHPISYVFSALEPLLVYVYPKRRRSANAVAKLNAMFDRLIEKKREELQNGICSNKPDNEKDLVTLMLEAGMQEDVSITNEELRHNMAVLFLAGHDSTSNTLSFCLYHLAKNKRAQQKLREEIINILGDDDIDIVPSLEELKQMKYINMVIKETLRLNTPLDLLTPRKTVEDIFLADTFIPKDTNIAVDVGALHRDLRNWKDPDEFIPERFEDDGEQKDHEGLTWAPFSNGTRQCIGMNFSLMEQRLVLTMLLRKYEVDLPKDSIHYDHIIFEKPTYSCPESLELIFTKRY

 

>CYP509C5 P450-34_var1 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

87% to P450-32 in CYP56 clan

RO3G_10705.1 revised

MEGLVTKYNMAFEGLLPLFQKRSKSSYIVAAILLITVKQIYSFFRVPTNLRHLPSVPFFAMAKSFLTCEPPYSRFKRITYPAIQEGNGFYVSKIPTGWTIYVANPVAAKQLLMKSNNFPKSHYGLDSIGEKSTVVQFVGHDNVALSNGEVWKKQRKVMNPVFHRSMPIKTVASLVPLFFSIIEEANGRIPINPKMKDFTLDALGLTIFDFEFKALQGDPDNWTSVYRLVTRSIFDPLSFVCNTIESLLTYVYPKKRKGAYAVVKLNAKFDQLIDKKREKLRNGIFSNKPDNEKDLVTLMLE

EDISITNEELRHHMALLFLAGDDSVSNTISFCLYNLAKNKRAQQKLREEIINILGDDDMDIVPSLEELKQMKYMNMVIKETLRLDMPLDLLLPRKTVEDMFLADTFIPKDTDIAVDAGALHRDPRSWKDPDEFVPERFEDDGEQKDHEGLTWVPFSNGTRQCIGMNFSLMEQRLVLTMLLRKYEVDVPKDSIHYDHIMYEQPTYICPESLELIFTKRY

 

>CYP509C6 P450-29 in the CYP56 clan Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

83% to P450-7_var1

RO3G_10668.1

MESLVTRYNMALEGLLPLFQKRSKSSYIVAAILLITVKQIYSFFRVPTNLRHLPIVSFFAMVKSFLTSEPPYSRFKRITFPAIQKGNGFYVSKIPVGWTVYVANPVAAKQLLLKSDNFPKSHFGLDAIGEKSTAVQFVGRDNIFLSNGEVWKKQRKIMNPVFHRSMPIKTVASLVPLLFSAIEEANGRIMITPKMKDFTLDALGLTIFDFDFKALQGDPDHWTSIYRLVTRSIFDPISYVCSAMENFLTYTYPTKRKGFNAVVKLNAKFDRLIEKKREELQNGIFSNKPDNEKDLVTLMLEAGMQEDISITNEELRHNMAALFLAGDDSISNALSLCLYHLAKNKRVQQKLREEIINILGNGDMDIVPSLEELKQMKYMNMVIKENLRLNMPVDVLLPRKTAEDIFLAGTFIPKDTIIVIDVGALHRDPRSWKDPDEFVPERFEDDGEQNSHEGLTWIPFGNGTRQCIGMNFSLMEQRLILTMLLRKYEVDLPKNSIHYDHIVYEHPTYICPESLELIFTKRY

 

>CYP509C7P P450-7_var1 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

37% to CYP509B1 Rhizopus oryzae, in the CYP56 clan

P450-7_var1 has a stop codon in the I-helix

86% to P450-33, 85% to P450-32, 84% to P450-30var1, 84% to P450-31

84% to P450-29, 83% TO P450-34_var1, 62% TO P450-39,

58% TO P450-36, 53% TO P450-20a, 55% TO P450-42, 53% TO P450-12

RO3G_04442.1 revised

MEGLVTRYNIALEGLLPLFQKRSKSSYIVAAILLITVKQVYSFFRVPTNLRHLPNVSFFAMAKSFLTCELPYSRFKRITFPAIQEGNGFYVSKIPIDWTVYVANPVAAKQLLMKSNNFPKSHRGFDIVGEKSPAAQFVGRDSVVLSNGEVWKK*RK

IMNPVFHRSMPIKTVASLVPLLFSAIEEANGRIHITPRMKDFTLDALGLTIL

DFEFKALQGDPDHWISTYRMVMLTLFDPILNVFSALERLLVYVYPKRRRSANAVAKLNAKFDRLIDKKREELQNGVFSNKPDNEKDLVTLMLEAGMQEDISITNEELRHHMSFLSLAGYDSTSNTLSFCLYHLAKNKRVQQKLREEIINILGDDDMDIVPSLEELKQMKYMNMVIKENLRLNMPVDLSLPRKTAEDTFLADTFIPKDTTISVDVGALHRDPKSWKDPDEFVPERFEADGEQKDHEGLTWVPFSNGTRQCIGMNFSLMKQRLTLTMLCKSILSPFFFCIIRVAKPYLFIYNEKV*

 

>CYP509C8 P450-39 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

66% to P450-33 in CYP56 clan

RO3G_11470.1 revised

MDVLIKKYNATFHSIISLLQKRSKASYIAAIIFLIVLKKIYSFFRVPKYLRHLPCVSYFAMAKSFLKSEPPYSRLKRITRPAIEEGRGFYVSKVPFGWALYVADPVVAKQILLKSDIFPKSTRRIETLGKNSPLFKYFGFDNVVLSNGEQWKDQRRIMNPVFHRAMPIKTMARVIPSLFSVIEDADGRIPISLRMKDFTLDVLGLAIFDFDFKALKGDPENWTSTYTQLTEALFDPIINVFASMENLLIYVVPKRRKAAKAVVRLNEKFDQLVSTKRQELQNGRFSNKPDNEKDLLTLMLEAELQGEALETSEQLRHNIAVFFLAGHETTAHSLSFCLYQIAKDKHIQQKLREEIISVLGDNHMDVEPTLEQLKQMKYLNMVIKENLRLNGPLDLLPSRKAAKDTYLKDIFVSADTEVVIDACAIHRDPKNWKNPDDFMPERFGEGGGQEDHEGLTWVPFGNGSRQCLGMNFSLMEQRLVLTMLLRKYEIDVPKDSIHYDRIQYEKPLSIAPNTLELTFTKRY

 

>CYP509C9 P450-36 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

60% to P450-33 in CYP56 clan

RO3G_11017.1 revised

MENQIESYRLAIEKLLPAIQKRSKLSCITFAIALIAAQQLYSFFRVPKNLRQFPRVPYFSMVKSFLKAESPTDRYKRIIHPVASKGNGFYVSKVPFLWAVYVTNPVVAKQVLLKSDIFPKNHAVFHQIGKDSPFTQFLGLDNVALSNGDVWKKQRKVMNPAFHRSLPIKTMASVVNTLFSVIDNSDGPVLITSAMQNFTLDVLGLAIFGFEFKALQGDPDNWTKTYKTVIESLFDPVMNVFATFDTLLTWVYPKRRECSVAISKMNLKFDELAKQKRAEVKSGAYANVPDHDKDLLTLMLEAMEKGEALTSQDELRHNIAVFFLAGHGTTAHTLSFCFYHLAKNKHIQRKLREEIISVLGDEPVDIVPSLEQMKHMKYMNLVIKENLRMNTPADTLFTRDTVEDINLAGHIIPKDTAISIDINAIHHDPKYWHNPEHFIPERFAEGGEQESHEGLTWLPFSNGSRQCIGMNFSLAEQRLVLAMLVRKYEIDIPKDSIHYERILFDRPGNIAPLSLGLTFTKRY

 

>CYP509C10 P450-42 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

60% to P450-36 in the CYP56 clan

RO3G_12495.1 revised

MELVQFVDKSYREILEKLLPVLQKKSKWSYISAAALLITIQQIYSYLHVPKKFRHIPSVSSLAMAMSFLRHESQADRFKRIIQPVMNKGNGVYVSKIPISWTVYVANPVIAKHILLKSDMYPKSHNGFKIIGPNSPFLQFIGLNNLALSNGHTWKKQRKLMNPVFHRSMPVKMMSSVLLTLFSAIEKADGTIPIAEAMKHFTLDVLGYTIFDFDFKALKGDPDDWTKTYHLVNEALADPVLNVFPSMGALLLVLLPVKRRRMAAIDKLNRKLDEMAQKKRREIQKGSYSNKLDSEKDLLTLMLEAENNGEGLLSDTELRHNLATFFLAGHETTANSLSFAFYYLAQNKHVQQKLREEVISIFGDEPTDIAPTLEQLKQLSYLDLVIKETLRIAGPIDRIVPRVVSEDIVVGGAFIPKGTSANIDLYAIHHNTNIWKNPDQFIPERFAEGGEQESHEGLTWVPFGNGARQCIGMNFSLAEQRIVLALMVRKYIIDIPKDSIHYDHVVFDSTETKAPESLKLKFTKRH

 

>CYP509C11 P450-20a Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

62% to P450-12, in the CYP56 clan 35% to 509B1

RO3G_06942.1 revised

MEIVESVFKLYHIALENLLPILHKKHKKSYIGAAISLVFLQRVYSYFRAPKHLRHMPIIPYFSMVKSLLNHELAYSRFKRLILPAIGENNGIYVSKVPLDWTVYIANPMIAKYVLFHTDTYPKSHDMLTKLGSDSPLVQLIGYDNILISNGHLWKNQRKLVNPAFHRSMPIKTVSSVIFDLFSAIEKENGTISIAPKMKDFTLDALGLTLFGFDFKALKGDPDEWTKVFRQGIQVAMDPFLNVLSPLYSVLSFIFPEKRRQMKAVIKLNGKMDQMIKQKHTEVLSGAYSDIPENEKDLVVLMLEAERRGEGITNDLQLRNNMALLLLAGHDTTATALSFCFYNIAKNKHVQQKLREEIIGVLGDEPVDIVPTLEQLKEMPYLNLVIQENLRLNEPLNYLIPRVAKKDMIVDDILIPKGTTINFDIYGIHHNPKYWRNPNQFIPERFAKGGEHETHEGLTWLPFGDGSRRCIGMNFSMFQQRLVLAMIIRKYEIDISKDANDHRHIAGFKTKSRGSPKLTFTKRY

 

>CYP509C12 P450-12 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

52% to P450-7_var1 in the CYP56 clan, 36% to 509B1

RO3G_05077.1

MMEIAEFALESYRSTLEKILPVLQKKSKKSYIGAAITLIVLHRIYSYFKVPKRFQHLPKLSYFPSAKSIFNNEPIYDRYKRLVFPVIKENNGIYVSKISFDWTVYIANPVAAKHVLLKADLYPKSHDFLKMLGSNSPVVQFLGYDSVGLTNGHVWKNQRKLMNPAFHRSMPINTMSTVIPDLFFVIEKEN

GTIAVPSVMRDFTLDVLGLTVF

GFDFKALKGDPDEWTKTFTLANEGLFDPILNIFGPFSFILTAIFPKRREQLKAVAKLNGKLEQLIHQKRMEIENGAYSNTPENEKDLVALMLEAEKRGEGLTNDLELRHNIAGFFLAGHDTTANALSFCFYNLAKNKHVQNKLRQEIISVLGDDPKDVVPTLDQLKEMPYLNLVLKENLRLNGPADNILPRVAAKDMVVDGTFIPKGATVNIDIYGIHHNPKFWNNPDDFIPERLDENGEQDSHDGLTWLPFGNGARQCLGMNFSLTEQRLLLVMMIRKYEIDVPKDSIHYERVIFGSETTPPNSLELTFKKRY

 

>CYP509C13P P450-22 pseudogene Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

53% to CYP509C10

45% to CYP509C9 in the CYP56 clan

AACW02000137.1 (-) strand

52294  SKIPLNWTIFITNPMIAKYILLK  52226

KDRYSKSHDVLNMLSPNS 52122

FVRFMDLQNVAFAIEQNWKKQQKILN ()

NTVFNRSMPAKTISNVLSTLYSDIEKEDGTDHIIEAMKNVALDVLG ()

HSYHNFEFKALQENPDE*TKTYEFVNNVLFNPVLNFFNTLSRLLSIVSPTRRKTMAAIDK

FNGMARQNRV*LQNG &

SMFN*PDTEKHLLTLISEAEESGEGLLSNTELRIRVPSPPSFFLRK*YKLVNN*QN

LATFFFA (1)

GHETT (0)

QTLIEEIISTLNDKPVEVLSTFEQLK*MEYLDLVIMEI (0)

TLCLAGPFDTIVPIFATEDIVLSSNLIPKGT &

50948 RNNIDVYAHHNPDYWKDHDQFILERFLKGEECGSYGGLTWLPFGNGVRQCIGMNFSLPEWRIALTLMSK 50742

 

>CYP5203A1 P450-16_var1 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

36% to CYP5025A1, 35% to 544A1 in the CYP52 clan

70% to CYP5203A2

RO3G_06009.1 revised

MNSKQSNPLVRYLGGAAATGLLVLSVIYHDRAVFDEHRKDIKTQKGWPLVGNLPLIIQWKDRIHDFLLTGFNQLDEQTLTLSALGIPRHIATLDPQNVEHILKHNFENYIKGPEFHGSMNDLFGNGIFNANGEDWKFQRKTASHIFNVKNFRDHFTDVFIQEIDMMSKHIWDKAVEEHSIVDFHDIMFKFTLDSFILLGFGVQLNALGSIEKVPFAEAFDEAQKNTFQRFVNPIWPVTERLTRFTMPWKKTMRDHLAVVDGFARGVIYQRREEMARGEVHGDLLSRFMQAQKQGAALDTDALRDIVLNFVIAGRDTTAQALSWTFYMLMCHPRVEQRLLEEINQHIKEDINIYESIKNMNYAHAVFYEVLRLYPSVPLNQKFALEDDIWPDGTRIKKGDYVLWCPYAQGRSEKVWKNATEFIPERWIDAEGQLKRESQGQWPAFHAGPRVCLGQNLATLEALVAISLLLKRYKFTLVPQQEITYQVSLTLPMLHGMKVTVQKRN

 

>CYP5203A2 P450-17_var1 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

70% to CYP5203A1 in the CYP52 clan

RO3G_06495.1 revised

MPRYIGTGITAALTLLTCIYHDRAIFDSKRPDIKTQPGWPLVGNLPVLLQYLMHIHEFLLEGFTRLDSLTLTMSALGIPRHVGTIDPRNVEYILKTKFENYIKGPEFHGSMNDLFGGGIFNANGEEWKYQRKTASIIFNVRNFRDQFTDVFVKELEIMKEKIWDVSADNCQVIDFHEVMYKFTLDSFILLGFGVDLNSLSTQGKVPFAVAFDEAQKNTFLRFVNPFWSVTERIAGLLMPWKTSMNEHLAVVDGFARKVTEKRRAQLAAGEIHTDLLSRFMDARNNKGDPLSNDELRDIVLNFVIAGRDTTAQALSWSFYMLMCHPRVEKKLLEEIDQNIAVDEDLHNSASLYEKIKGMNYAHAIFYEVLRLYPSVPLNQKYALADDIWPDGTHIKKGDYVLWCPYAQGRAEKVWGHDAKQFRPERWLTSEGELRRESQGQWPAFHAGPRVCLGQHLATLEALIAIVFLVKRYKFTLVPNQDITYQVSLTLPMRYGMKVMVEKRV

 

>CYP5203A3 P450-41_var1 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

70% to CYP5203A4 in the CYP52 clan

RO3G_12103.1 revised

MSIKDTSLRQQIALAGAALSSLVVFLSLKYHDRPLFRKRIEGIPNVKGYPLVGNLPSILKHGERFYDYNVELFESHDTLTLAYPAAGIPETITTIDPQNIEYILKTNFYNYVKGPQAKAFLYDLLGYGIFNANGDKWKYQRKTASHIFNVKNFRDQFTDVFVKEMHVMFDNILEKASIEGTVIDFHDVMFRFTLDSFVYLGFGIQLDTLLNKEKAPFAVSFDFLQRLSAERFIDPLMGIKEGLVNLFCSKEKTTRYNVSRVDSFAQQVIEQRRKEMKEGKTDHKDLLSRFMNATNECGEMLSDRELRDNVLNFIIAGRDTTAQAVSWLFYCISQHPQVEQKMLQEIEKNITDEIERDSPALYEAASEMSYVHAVFYETLRLYPVVSSNQKYAVHDDVLPDGTHVKAGTYVGWLSYAQGRSKRIWGEDAKEFIPERWIDENGKLRREPAAKWSAFHVGPRVCLGQNLATLEALVCIIMILRRYSFKLVENQTITYSLALTLPMKHGLKMTIGKR

 

>CYP5203A4 P450-21 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

56% to CYP5203A2 in the CYP52 clan, 35% to CYP5025A1

RO3G_07774.1 revised

MSLKDLPVQQKIALTGAAASSLLALITLKYHDRPVFSEHQKDIPHVKGYPLIGNLPTLLHNIPRIYDYQLELFERLDTLTLTAPSAGMPNMIFTIDPRNVEHILKTNFQNYLKGPKFNKNLAELLGHGIFNANGEQWKYQRKTASHIFNVKNFRDQFTDVFVKEMHVMFDNILEKTCKQGTIFDFHDTMFRFTLDSFVYLGFGVQLDALVKEGKVPFAESFDFLQRRSAERFVDPLMGIKETFYNAFLTKENTTKYNIKVIDTFAQDVIEKRRKEIAAGKEDQKDLLSRFMAASNEKGEKLSDKELRDAVLNFIIAGRDTTAQALSWLFYSISLQPRIEKKMLEEIEKYITDEVENDSPALYEVISNMPYIHAVFYETLRLFPSVPTNQKYAFEDDVWPDGTHVKAGTYIAMSSYSQGRCKKLWGENAKEFYPERWIDEEGNVKREPAGKWSAFHAGPRICLGQNLATLEALVCVIMLLRRYSFKLMENQTVTYDVSLTLPMKYGMKMFVEKRK*

 

>CYP5203A5 P450-43_var1 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

65% to CYP5203A2 in the CYP52 clan

RO3G_14322.1 revised

MPDPIFTHALGLSTALLTALSIKYPDRAIFDEHREGIAYKKGWPLVGQLPAIISNAELMHEFFMNGFNELDSLTTTASAFGIPRSITTIDPRNIEHILKNNFENYVKGPNFNDATKDLLGHGIFNANGEQWKYQRKTASHIFNVKNFKDMFTEVFIKELGIMFSGTFDKAANTGQIIDFHDIMFKYTLDSFILLGFGVQLNALSNKEKVPFAASFDECQLNSFQRFVNPYWKLTEPITAFFQPTKKSTRQHLKTINEFADQVIQKRRKEIANGEIHQRDLLSRFMNTHNEKGELLNNKELRDIILNFVIAGRDTTAQALSWTFYNLLLHPRIEKKLLEEIECYVTDDLMKTPAELYDTIKKMIYAHAVFYEVLRLHPSVPNNQKYALDNDIWPDGTSIKKGDYVIWCPWAQGRSTKVWGSDAHEFKPERWITGKGELRRESQGQWPAFHAGPRVCLGQNLATLEALIAMIFIIKKYKLRLLPNQNITYQVSLTLPMKEGMKVQVEKR

 

>CYP5203A7 Phycomyces blakesleeanus (Zygomycete fungus, Mucoromycotina)

57% to CYP5203A5 Rhizopus oryzae

57% to CYP5203A6

estExt_fgeneshPB_pg.C_550057

MDVVSNFISELRNKNLLSSNLGVVSTATIGVLLLLALKYPDRAIFTEHRDGVPHEKGLPLVGHLFGLLKNKYRIHDFQTD

KFVKLDTMTMTMSVLGIPRTIFTIDPRNVEHVLKTNFENYVKSTWFSECTVHLFGHGILNSNGAQWRWQRKAASLIFNVK

NFRDQFTDVFVDEVEILCNEILEKAVVSGEAVDLHEHIFRFTLDSFVYLGFGIQLNSLKTKEEVDFAASFDACQLYSLEK

FMNPMIEYTAIIDRILHPRKKTIKQHIETIDNFSSAVISKRRTELANGGTPNDLLSRFMGAKNEKDEPLSDKELKDISLN

FIIAGRDTTAVALTWVFYCLFNAPEVEKKLLEEITNCIKDEKKMDSAEIYETIKNMTYAHAVFYEVLRLYPPVPNNQKYA

LNDDILPDGTHVLKGDNVAWSPYGSSRNKKIWGPDAANFDPERWITLEGNLRRETQGRWSVFNGGPRVCLGQSFATLEAL

VVIIFLFKRYKFTMLPNQDITYETSLTLPMKNGLRVKVEKRV*

 

>CYP5204A1 P450-2 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

26% to 512G2, 26% to 512B1, 27% to 512G1, 24% to 54A1

possibly in CYP54 clan

RO3G_00859.1 revised at C-term

MTHNKYLTLSAVAAATFLLWKLLPKNSDKSNLPPLVKGSLPFLGHLLQLQHNPREFIQHAKDKYGPCFRLKLPGQGTLVVVTGELIPEVMKATKDFNFPKGVENLVPTSRIVELSYGHKFIPEKISPRAKNPVTYPIKHNFKEHQIDIFSKRIQTALKRGIGEVLSIPKGEKRTVNMLETLSYVVSCISCPCFAVSHIGHDKEFIKGMAAFTRKIIRAGIALTLLPGWLGRFLLRSYFSVEHEMDLIMTRLVPELEKVRAGAEIEPTFATMSLNVPKEDGTLRPVADVAYHFKDIALASIHTTSHFATLSLHELACRPELMQALRDELKTLHGDLTPENVATLTLMDSFLREVFRCNADYLGLHHLTMRDTLLSSGHIVPEGAMVVLALDQAHHDPTYIQSADLNTFDPYRFTKENISLKSTTIGLNHLSFGIGAHACPGRYFAVNEIKYMIAELITRYDVSTKTGKRAKDFVLLGMTKFPPNEPLIFCNKEDDI*

 

>CYP5205A1 P450-27 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

33% to CYP505A15 A. niger, 31% to CYP505D6 in the CYP505 clan

RO3G_10498.1

MSTENLTTLIVALKNATNIEKEGCIIQFGNGANLDTIRALAAEKLNITDGYANIRLLNSKGELFDGIDKVRNQQIVYVDTKTKIQETIPGPMKLPFVGNLYDMVPNLIEGWIRQFEKYGPVVEISLLGKILVGTNSPAVAEVFARESEYFTKKITKSGLGEVKEFAGQGLFTTDTDEMDWQLAHKLLMPAFSPRAIKAYQVEMAIIAQQTVKVFEQFKPHEPVEIIEWTTNLTFETIGRIGFGYNFNLLVGRGQEQNPFIEAMGYCLSLALKRMQQAQFVKQLPIEANRRFDRSVRLMHEIVENVIRERKESPDATNKEKDLLGYMLNARDEHNLGLSDDNIRDQVVTFLIAGHDTTANTLAWALYELAKHPEVQAKVLQEIADNHITHEKAPTPEQISNLKYMHQVFKEVLRKYPPVRNLSKYCKKDCILPGGYKIKAGTPCTVQVYAMHHNKDVYPDPERFDPDRWIPEEEQKRSRFAWLPFSTGPRACIGMAFALQEAKTVLSMLLHRFDFRHDGPNVRWDPKMATTKPLDLFMTIHPRENFPEPNGKAASKKSATMTERDGKQTAMPVISDNIGTKVELPPITFLYGTQTGTAQDYATILSEQARSFGFTQVTLCEMDRWNVLADGKFISNDDDDKKLDKQLVVICTATYNGQPPDNAENFDKFLDKKMRETDHENIFTGLSYAVFGLGNKNWRTYQRFPNKINQCLSEFGAERFFTSGEGDSDKDMDATFNDWCARFWSHLLGTYGIAASESNSVVPSAAAAKESIVKVKFIQPSNKEAWEKAANDFYGSPNAVILANKELQKDGSPRSTRHIEIDISKLLGVGEQGHLYHAGDHLEVMPENSKVIVEAIALKFGWVLDSVFEIDQETLLNVSPRSVASNVKGPCTIRNMLTYYADVTSPPSRAVLGYFATQLKLTAPETASEFEKLIMPDSNNQDQYPNFIKQHRTLLDLISAYPQVNRLDLGQFLAAVPVIQPRRYSIACSPLVYPQHAHLTVGVVDDVINDRHYPGLCSSFLKGAYDLSIRATLKSCKNTFSLPQDPSTPLIMISAGTGLAPFRGFLQERKAQIDILGQDKVASSVLFFGCRRADQDYIYEEELEAYSKNGVLSKLYAVFSRNLEKSPIKYVQHQILANAAQVWNMLYPTDNNTKPAAVYICGSGAMSRDVRRTFYNLAVSFGVAATEEEAEALILKLIDEKRYNEDVWG*

 

>CYP5205A2 P450-50 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

79% to P450-27 in CYP505 clan

RO3G_17132.1

MSTDNTTSLIVVLRNTSDVEKDGRIIRFGNGANLDTIRSLAAEKLAITGGYANIQLFNSNGELLGGIDDLRQQQVVYVDIKELIRETVPGPTKLPFVGSLYEMLPNIAEGWMRQFDRFGPLVEISLLGKIIVGTNDPNIAEIFAKESEYFTKKITKSGLGEVKEFAGQGLFTTDTDEMDWQLAHKLLMPAFSPRAIKAYQGEMGIIAQQTMKIFEQYRPDEPVEILDWTTNLTFETIGRIGFGYEFNLLVDRDQEQNAFIEAMGYCLKQAVQRIQQAAFVKQLPIEANRRFDRSVRLMHEVVENVIRERKASPDAKNKEKDLLGFMLNACDEHNLGLSDENIRDQVVTFLIAGHDTTANTLAWTLYELSRHPDIQAKVLQEIADNHIRHDELPNTEQINNLKYMHQVLKEVLRKYPPVRVLSKYCKNDCILPGGYKIKGNTPCSIQVYAMHHNKDVYPDPERFDPDRWTPEEEQKRSRFAWLPFSTGPRGCIGMAFALQEAKTVLAMFLNRFDFKYNGPDVQWDFKTATTKPVDLFMTIHPRENFPKPNGDSVPPQKSDASSNQAESKTATAMPVISAQKNADVELPPITFLYGTQTGTAQDYATVLASQAKGFGFKNTTLCEMDKWKVLADGKFISDNKDKKKLDKELVVICTATYNGQPPDSAEKFDSFLDNKMREDDHENILTGLSYAVFGLGNKNWRTYQHFPIKVSQCLSELGAERLFASGEGDNDKDMDAAFNDWCARFWSHLLEIHGIAACESKPVVPTAAIKESSVDIKFVQPSDKEAWNSAINNHYGNPNAIIVANSELQKDQSPRSTRHIEVDISKLSGVGEQGQLYSAGDHLEVMPENSKASVESIALSFGWILDSVFEINQETLSDVSPRSLAANIKGPCTIRNMLTYYADVTSPPSRAVLGCFAAQLKLVAPETASEFEKLIMPDANNQDQYPDFIKQYRTLLDLIHAYPQVNRLDLRQFLAAVPVIQPRRYSIASSPLSYPKHAHLAVGVVDDVVNNRHYPGLSSSFLKGAHELPIRAILKSSKSTFSLPQDLATPLIMISAGTGFAPFRGFLQERKAQIDNLGADKVAPSVLFFGCRRADQDYIYQEELETYAKNGVLSDLHVAFSRSDDKSPIRYVQHQILANAAKIWNLLYPAADDNSRPAAIYICGSGAMSRDVRRTFYSMAISFGAATNDKEAEALIIKLMDEKRYNEDVWG

 

>CYP5206A1 P450-3 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

27% to CYP5148A2, 28% to CYP5050A1, 28% to CYP5046A2

24% to CYP504C1, in the CYP64 clan

60% to P450-38, 60% to P450-19, 60% to P450-18_var1,

53% to P450-48, 49% to P450-47, 56% to P450-5

cyan YSKGIVVGSYLFKNLSR is missing from closely related EST EC997850.1 (remove)

added green seq

RO3G_00866.1 revised

MNFSKQNISNMGVGILKQNTYILLPACAALLSCYYLLTKEISIEKKGNKEIPYPPQAIKLPIFSLGSTPAKQITKWHKETGPIYKINVGTQLWILISDPNLAHDVFVKAGSSTSSRPYHRFNVDIYGKNNR(2?)

GIAFSQYGPEWKNKRKA (1)

VASLLSSSSIDKFCDLAEAEA

DSLMNRLIKVSQKGEMVSIDKQAELMSMNVVLTMGVGIRYDDINDPKFQMLINFPSDASTLVGAAGDIGSFFPYFGWIDMFMGTEKKLQKFVKQFRDDVYNKLIQDALKREEDTLVKSMYKMKKEGLIDEDDILVFMSDFIAAGTETLATTLYWSFAILSQKPDVQSRIVAELDMWKSKNPLGAVPHFHQDRDEFPYAICVQKEIMRFRPVLNFGLPHMASEDVVVNDYFIPKGAVLISSMAAMHENPDVYDDPEVFKPERFMMNTKRMGAAANAKIEDRDHFGFGWGRRICPGIHLVSIRTQKEKLFFVLISKTLLLRQKWSCSIFTFVSFPSSRLSLKSIHMVIPSMLI

 

>CYP5206A2 P450-23 Rhizopus oryzae

94% to P450-3 with some variations in the CYP64 clan

RO3G_08351.1 revised

MDVGILKQNTYILLPVCAALLSCNLLLNWLFIVGHIFSLGSTPAKQITKWHKETGPIYKINIGTQLWILISDPNLAHDVFVKAGSSTSSRPYHRFSVDIYGKNNRHSKGIVVSSYLFNNLSRGIAFSQYGPEWKNKRKAEAEADSLMDRLIKASQKGDMVSIDKQAELMSMNVVLTMGVGI

C

AAGDIGSFFLYFGWIDMFMGTEKKLQKFVKQFHDDVYNKFIQDALNREEVTLVKSMYKMKKEGLIDEDDILVFMSDFIAAGTETLATTLYWSFAILSQKPDVQSRIVAELDIWKFKNPLGGVPYFHQDRDEFPYAICVQKEIMQFRLVLNFGLPHMASEDVVVNDYFIPKGAVLISSMAAMHENPDVYDDPEVFKPERFMMNTKRMGAAANAKIEDRDHFGFGWGRRICPGIHLAEMELFNFCVCFFPKFKIEHEIGSHGNPIYVDLNCSEELGVTNKPVPCKFRITSHNL*

 

>CYP5206A3 P450-18_var1 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

83% to P450-5, but P450-5 has an insert before I-helix

RO3G_06830.1 revised

MDTNKLKETAFIIVPASAALLSIAYLSRKGKSEEKKGLIEIPFPPNATNLPIFGHMFGLGKCPSKQITQWHKEICPIYKLRMGNQLWFMISDPLLAHDIFVKAGSSTSSRPYHRFLIEIYSKNNRGISMAQTNHLWKNKRKAATTILSPGSVDKFSDILEAEVDQLVDRFAKYSESGEALDPFKELQLSSLNVILALVLATRFESTDTPDFKTMHRCINDIMIFGGPAGDIGSFLPMLAWIDMFTGVENKMRNFVNIYRDDFFMKLIDNALKKNQRSLVKDLYQMKEEGLIDEDDILVFTSDLIGAGADTVATTIYWAFAILSQMPEVQSKLMEELDEWKSKHAPGAIPSFNKDRDDLPYSICVQKEIMRFRPATNFGVVHMASEDVIVNKYFIPKDTILVSSMAAMHKNPEFYEDPDEFKPERFLNNTNRMGAASNAKIEDRDHFGFGWGRRICPGIHLAEKELFNFFVRFFSKFTIETELDSQGQNVKLNLDDYVEEGIMCKPLPCKYRIISRKV*

 

>CYP5206A4 P450-5 EST = EE007880.1 in CYP64 clan Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

59% to C-term part of P450-3, 54% if yellow is deleted (missing in EST EE008707.1 from P450-38

remove MQNRNLIFCEPNTILFQSG it is intron seq not found in EST EE007880.1

83% to CYP5206A3

RO3G_01667.1 revised

MDINKWKENAFIIIPASAALLSIIYLSKRARSDEKKGIIEVPFPHNATNWPIFGHMLGLGKSPSKQITRWHKETGPIYKLRMGNQLWFMISDPLLAHEIFVKAGSSTSSRPYHRFLIEMYSRHNR

GLVLAQTNHLWKNKRKAATTILSPGSVDKFSDVLEAEVEQLIDRFAKYSESGEALDPFKELQLTSLNVVLTLVLATRFESVDTPDFKTMHRAINDVMIFAGPAGDIGSFLPMLTWTDLLTGIESKMRDSIKIYRDGLFTKLIKNALEKEQHSLVKDLYQMKEEGLIDDDDVLVFTS ()

DLVIAGADTVATTLYWTFAILSQMPEVQTKLARELDQWKSKHTPGAIPRFNQDRDDLPYSVCVQKEVMRFRPATNFGVVHMASEDVTVSGYLIPKGTILISSMAAMHKNPDFYKDPDEFIPERFLNNTNRMGAAANTKIEDRDHFGFGWGRRICPGIHLVNAEKEVFNFFVRFFSKFTIETELDSQGQHVKLDLDGCVEEGIMCKPLPCKYRIIPRKT

 

>CYP5206A5 P450-19 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

77% to P450-18_var1 in CYP64 clan

RO3G_06895.1

MDIKKLKDNASIIIPASAALFSILYLSRREKVEEKKGFKEIPFPPNTTNLPIFGHIFALGSCPSKQVTKWHEEMGPIYKIYMGNQLWVMISDPFLAHDIFVKAGSSTSSRPYHRFLIDIYGKNNRGIVFAQNDILWKNKRKAVTSILSPGSVDKFSDVLEIEIECLIDRFAKYSQAEETIDPFKEIQLSAMNVPLKLALATRFETTDNPTFKKLHKAIDKGMVYGGPAGDISSYLPSLAWTDTFTGMEKKMRDFIHHYRDLIYGKLISDALKSEQHSLVKDLYQMKEEGLIDEDDITVFMSDLVGAGADTVATTIYWSFAILSQMPEVQAKLTKELDEWKSKHASGAIPRFNEDRESLPYSVCVQKEIMRFRPATNFGIPHMASEDVTVNGYFIPKGTILISSMAAMHKNPNFYEDPNEFKPERFMTNINRMGAAANTKIEERDHFGFGWGRRICPGIHLAEKELFNFFVRFFSKFTIETELDSQGQNVKLNLDDYIEEGIVCKPLPCKYRIVPRGA

 

>CYP5206A6 P450-38 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

61% to P450-18_var1 in CYP64 clan

RO3G_11042.1 revised

MDAEKLKQNAHVLIPACLAVLSSLYLLNKSKLNEKKGLKEIPYPSNSISWPLFGHLLSLGDVPSKQITQWHKTTGPIYKLNMGNQLWIMISDPFLAHDIFVKAGSSTSSRPYHRFTTDLYNMNDKGLVFTAYNNKWKSKRKTAIALLSPGSVDKFTDVLEVEADSLMERFGKIAQNGTLIDPFDQLQLTSMNIILTVMAATRFDDVDHPDFVAINKYLYHAMIYAGAAGDLGSFLPSLAWTDVLTGTEKKLRKLLEEQRDPVYKKIIKNAGGSEKSSLVKDMFKMKDEGDLNDDEILVLFSDLLAAGADTVAVSLYWAFAILSQKPDVQTKIIEELDAWKAKNPPGAVPSFHKDREEFPYSICVQKEVIRFRPVTNFGIPHMTSEDVIVNDYFIPKNAILISSMCPMHANADVYENPDQFIPERFMKNTNRMGAAANTKIEDRDHFAFGWGRRICPGIHLAEIEIFNFFVRFFSKFTMAPELDSQGNPIPIDLDDYVDEGIIMKPVHYKVRIVHRT

 

>CYP5206A7 P450-47 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

52% to P450-38 in CYP64 clan added green at I-helix intron boundary

RO3G_16665.1 revised

MILKKRKTHTGQYPINTVLLSPPTSTQDKLLSLLSKNCPSRKVTQWHKENGPIFKINMGNQLWIMISDPLLAHEFFVKAGSSTSSRSYHRFNVDIYGRHGRGLSFAQYTPKWKTVRKIAVSLFAPESLRNYINILEAESNNLMDRLRDMSGDGKAFDCYQHLSLESLNFVLRVTAATRLESVEDPTFQSISNLSHYTLIYSGVSGDLVSYTPSLAWIDRLKGTREKMQAFINNQRDPIILKLIEEAMKKEDDSLIKELYEMKEKGALDEDDIYVFMT ()

DMVIAGSDPITIALYWTLAILSQQPKVQEKLIKELDAWKAKNSADAVPHFYQDIDQFPYMLCVQKEVQRFRPGTIFGLPHMTTDDVTAQGYFVPKGSMLFSSMWAMHQNKAFYGDPDRFRPERYMDGLKKISAAANARIEERDHFGFGWGRRICPGIHLSEVQFFNFYVRFFSKFTVVPDLDSEGNLMPVDLNHIVEEGIVSKPMPYKIRILPRT

 

>CYP5206A8 P450-48 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

92% to P450-47 in CYP64 clan added green at I-helix intron boundary

52% to P450-38

RO3G_16678.1 revised

MDLDRLKQNTPLLLPACLALLSTLYLLKNSRSAKEKEGMKEIPYPHGSISWPIFGHMLSLRNCPSSKVTQWHNENGPIFKINMGNQLWIMISDPLLAHEFFVKAGSSTSSRPYHRFNVDIYGRHGRGLSFAQYTPKWKTVRKTAVSLFAPESLRNYINILEAEADNLMDRLRDMSGDGKAFDCYQHLSLASLNFVLRVTAATRLESIEDPTFQSISNLSHYALIYSGVAGDLVSYTPSLAWIDRWRDTRDKMQALINNQRDPIISKLIEDAMKKEDDSLIKELYKMKEKGSMDEDDIYVFMT ()

DIIIAGSDPITVALYWTLAILSQQPKVQETLIKELDAWKAKNSADAVPHFYQDIDQFPYMLCVQKEVQRFRPGTTFGLPHMTTDDVTAQGYFVPKGSMLFSSMWAMHQNKAFYEDPDRFRPERYMDGLKKISAAANARIQERDHFGFGWGRRICPGIHLAEVQFFNFYVRFFSKFTVVPDLDSEGNLMPVDLNHVVEEGIVFKPMPHKIRILPRT

 

>CYP5207A1 P450-4_var1 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

56% to P450-20b, 55% to P450-37_var1, 52% to P450-35_var1,

47% to P450-9

35-36% to P450-3, 30% to CYP5050A1, 29% to CYP5069A1

28% to CYP665A1, in the CYP64 clan

RO3G_01533.1 revised

MDLQKLIEKLDRKQTTTILSSAILTVAATWFILKRRNKKRESTGIKEIPTPEGEYFYFGHLPLLISNPSAQITEWHRKLGPIFRIKMGVQNWMFISHPVLAHDIFVTRGTSTSGRPYVTFGNGVHGEGNRGVIFADYGKSWKNTRTAVLNILSPKSVDTLQPILERETALGVKLMMQQEEISPLSYTRLMGLNVAIATIFGLHGAQSTTDPIYREVIGNMENTFEFVGATRDIQSFLPAFAFVDFLLKSKKKMVNFVNNQSRPLYRRLIKMARENKQPCLINKLDEIKESLGIDEQNILVLT (1)

NELVVASVDTTSLAMAWTMALLCRYPEHQKKVIENLDMFVQSQNRLPLFEDRHQLPYLVAFIKESLRYRSSAHIGLPHKVTEDIVYGDYVIPKDTILFNNGHSSNHDPDFFTDPHLFQPERYLNDTRSIYASSNSAIQQRELFSFGWGRRICPGIYLAENELFNLLVRLLSQCTVEPILVDGKKVYPDLDTFVDGGGTVSPTDYKIRLVPKV

 

>CYP5207A2 P450-20b Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

56% to P450-4_var1 in the CYP64 clan

RO3G_06941.1

MDIQALIQKLDKKQTTLLSTAILTVATTWLIRRAIKKSKEFKTLGAKEIPTPKGEYFYLGHLPLLGKYPSLKVTEWHRELGPIFRIKAGVQNWVFIGDPEAAHEIFVSKGSISSGRPYLTYGNGIHGEGHRGIAFIDYDKSWKNARTASLNMLSPKSIDGLHEAIERETEYGVNLLITESHKQGSINPVDYTRLTAINFVLSTVFGIKGIQHIEDPLYKEIVHTMERHVENISAVGDISAYLPILSFLDVIFRKERNLKKFVEKEHRPLYRRLTKMARESDQPNLVKKLDEIKDSLDIDEENIVILG (1)

IEMMIGGVDTVSNALAFVLAVLCHYPEWQKKMSEEIDAFVEKYGRLPYYTEREELPVVVAVLKETIRYRPSAYLGIPHKATEDIVYKDYVIPKGTVLISNNHTTNNDPNFFPEPEKFKPERYLGDVRSIYASSNGAIQSRENFSFGWGRRICPGIYLAENEMFNWMCRLLRKCTIEPITSSTGEKIYPELDDYIDLGAIVTPVPYKVHLAERTNV*

 

>CYP5207A3 P450-35_var1 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

66% to P450-20b in the CYP64 clan 29% to CYP5069A1

RO3G_10904.1 revised

MDYQTIIKKIDRKSITILSSAVMAVVVTWMIKRAIKKSKEPKTAGLKDIPTPKGEYFYIGHLPLFGKYPSFKVTEWHRELGPLFRIKMGVQDWVFIGDPEMAHELFMSKGSVTSGRPFFTYGTGYHGEGERGIVFTDYGKPWKNTRTAALDVLSPNTVDILQETIARETGNGVELMIKDAFEAQEKNESINPLAYTRLTAMSIILATVFGIDGAKSVEDPLYKRIISGMEENAHYISLVGDLSAYFPVLSFLDVLFRKERKMKNFVENSSRPLYRHLVQLARLSDRPSLVKNLDEIKDSLKIDEQNIVALT (1)

NELMIGGIDTVSNSMAWAFAILCHHPDWQKKMSDEIDSFVHKHGRLPMFTERKEIPSLIAVIKETLRYRPSIYFGVPHKATKDVVYKDYVIPKGTILISNAHTTNNDPRLFSEPEKFKPERYLDDPKSLYASSNGSIQNRELFTFGWGRRICPGIYMAESEMFNWMAQFFQRCTIEPFISSTGEKIYPNLDDCVDKASTIAPLPYKVRLIKRHDTQL

 

>CYP5207A4 P450-37_var1 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

69% to P450-35_var1, yellow is an insertion YKIEKMTNERTRAINIKQT

in the CYP64 clan 29% to CYP5069A1

RO3G_11021.1 revised

MVYIIIVKDLFYCWIISWWHVKRTIKKSKEFTTSGLKDIPSPEGEHFYLGHLPLLGKYPAFKVTEWHRSLGPIFRIKIGVQNWVFVGEPEAAHDIFTTKGSLTSGRPYVTYGYKFHGEGNS (2)

GIVFTDYGKNWKNTRTAALSILSPKSVDDLYHILDRETKFGVNLMLKDALEVQDKEGGIDPLAYTRLTAMNIILATVFGIQGSLSVQDPLYKRVLHNLEQNSAFISIGSDISAYFPVLSFLDVIFRKEKKMRDFVENDSKPLYRHLIQLARQSEQPSLVKELDSIKDSLNIDEQNMVTLT (1)

NELMIGGVDTISLAMAWVFAILCHYPKWQKRMLDEVDLFIQNYSRLPLFTERQELPSMIAFIKETIRYRPSFLLGVPHKATEDIIYKDYLIPKGTLLIGSAHANNNDPHFFSEPEKFKPERYLNDAKSIYASSNGNIQSRELFTFGWGRRICPGIYMAESEMFNCMTRLFQKCTIEPALSSTGETNIPDIDDCIDFGSIVSPVPYKIRLVERNSVVIDE

 

>CYP5207B1 P450-9 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

~45% to P450-4 with a gap in seq, Seq 4 is longer here

in CYP64 clan

RO3G_04485.1 revised

MDYYRELLKVDRPERYTTLLGAAVATVATALFVKSVVNKSKEYKSPGGREIPSPKGDYFYLGHLPLLGKRPGLTITKWHQELGPIFRIKVGSQNWVFVGDVEAAHELLVSKGSATAGRPEMTYLTKVHSPGER (2?)

GVIFVDYGKKWKEARNAILNILSPKS

VESLSHILDREAQQVVDIMRDQAKVNEEVDPHLFTRLAGMNLMLAIAYGVPGAKSVEEPDFKKVEYFSTMAMRFSSPSEDFSVIFPSLKFLDVILRKEKRMIDFRDKEFFPYVRNTIKLARESKEDSLVKKMDEIRKEYGLDEQSILCLL (1)

SETLTAGTDTTSVGTAWAIGILCHHPEVQKKLCDEIDAFIRKHGRQPAFSDREELPYFIAFEKECLRFRAPTDLGLPHKVLKDVVYKDYIIPKGHIIYVNVHTLHNDPQVFPEPEKFMPERFLNDTRSMYASSNGAIQNRDHFAFGWGRRICPGIYLAESQIFHLLTKILATSTIEPAISSTGEKIYPDLDNVIDTGITVGPVPFKIRLVERMDRVLA*

 

>CYP5208A1 P450-44 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

35% to CYP5046A1, 32% to CYP5046A2 in the CYP64 clan

RO3G_15771.1 revised

MSFSNLTALVVLASTATCYILWRNKRSDIDSLLPPRAPGYIPIIGHILELIRPIPIHELFYKWSLQVGPVFTCHFGTQKWIVINSIEAVRDLIVERGTIYSSRNLPDTIIEDIFQGDIDKGGSFAFMTYGPRWRHLRRIDSGLIKNKIDLYQPILNERRTALLSYIYKLSEEKNEKDKGIDISYFIEHYTMTSILTIAFGDICSFEPEDPTLHKAFNLTERASKALSPGDQIREFFPILQILWPAEKARYFQLRDDIVKFYETLLNRFKAQKSTQDCFVKEIMKENELNDLQIIYFI

ALFVGAGSDTTASTIEWTIAYLANHPEVQDLAYNEIKEEVGLDRLPQSYDEPNLPFVQCIILETLRIRPPAPTAIPHATSEDDVYKGWHIPKNAVILMNLFAIHNNPLRFPNPSQFQPERHLEYVQESLRHHKFSQVIEDRPHLGFSTGRRVCVGIHLAERKLFMAISMLLACFKIERISEDLIDVNTHKDIHGVTWAIPHYKIQLVPRHDKV

 

 

>CYP5209A1 P450-6 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

24% to CYP5093A2, poor match to all P450s

25% to CYP504A5, 25% to 620B1 yellow region too long VSLMKEDKTGKK remove as intron

possible 64 clan

RO3G_03451.1 revised

MASVLSYIISMFITYVVTQLGQRFMWKNKKQDGTPKMPWPASPRGLPYLTKAYNIFQKESYHALTRWSKQVGDLFSVEIGFKRVIVMNSPELVQKFLIEKEQYNSSRSPSDTFESTLTDRAKTIYSAPFSSYWARLRRAVHVVIGKDHHLQFEQTFKSQSETLSFCIGESLKEECKLTAKELRQLVDLIAADTALTMVIGPEKRKPQTLLELVTKCRELEALQTSKYNRLGQFFPAFNSLVDVYRLFVMDSSITKARNALLDIFMPSFETIYSQKEQIEESKKKEGYVPYSKVSTIAKSLISIDPSKNDPEPVQLTKEEILINITHMTVHAQTYLASTLFSLIQRAAGEPKWQTMILEADEEEQISLAKAFVKECLRLDAPNKLIAYTPRTDYDFEAPDGYMYRIDTDTELVMNVDAIHKNTRYYPNPQEFAPERFMKSEKKM (0)

VANDHMAFGAGRRVCLGSKASEEMLTVTLLHLIKTYMLEGGNVDNKIEIGTSLWSWTGRTETQGGSISFTRRQ

 

>CYP5210A1 P450-1 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

33% to many different families CYP5070A1, CYP617D2, CYP547B2

new family in the CYP56 clan

RO3G_00211.1

MNEETLKIIRKNVINYLEKWKSSEKLDATLAAKLGLSSVAAYFLYKTVLYRLYLHPANKIPGPRVGWIPFMGNFFQILKADNDQSPFIKWAEQYGGIFTVHFYWNEPRVVVSDDRLVKQILTSQMYDFEKPMAASKMLSRIVGNGLLVAEGHAHRVQRKMLNPAFSIQSIRAMVPLMIGPCYTLRDQWIQMISTNHTEYTEIEVSRDLSLATLDIIGITAFGQDFGSVAHYGTDKMNRLSKAYLKLFSRGMSLIRILTIAFPVLGLLPTKENREDAEMLRWLKEESEALVEAGLQRDAEEKKSGKTSQYQDLLALMVNLIDKDTGKGFTKEELRHQCLTFLAAGHETTSNTLCWCLWLLAQHQDIQDKLRSEILVLFKDNKILDYNAVNALPYLDHVCCETLRLIPTVPQTARVSRMPVVLGPYVLPKNTIFYIPSVVSHHSKEIWGEDVNEFKPSRWEKTDHIGNAYEYFPFLAGGRQCIGQRFAIVELKILLSILIRDIQFFEKPGFKVQKSQFIVTRPTPNMTLWTKRVSY*

 

>CYP5210A2 P450-11 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

90% to P450-1

This seq has a frameshift near the PERF motif, in CYP56 clan

RO3G_04957.1 revised

MNEETLKIIRNNVINYLEKWKSSEKLDATLAAKLGLSSVAAYFLYKTVLYRLYLHPANKIPGPRVDWIPFMGNFFQILKANTDQSPFIKWAEQYGGIFTVHFYWNEPRVVVSDAKLVKQILTSQMYDFEKAASKSKILLKLAGNGLLVAEGHAHRAQRKMLNPAFSIQSIRAMVPLMIGPCYTLRDQWIQMISNNHTEYTEIEVSRGLSLATLDIIGITAFGQDFGSLAHYGTGKMNRLSKAYFKLFSQGMSLMSFLTLAFPVLGLLPTKENRENAEMLRWLKEESEALVEAGLQRHAEEKKSGKASQYQDLLALMVNLIDKDTGKGLTKEELRHQCLTFLAAGHETTSNTLCWCLWLLAQHQDIQDKLRSEILVLFKDNKISDYNAVNALPYLDHVCCETLRLIPTVPHPVRVSRMPVVLGPYVLPKNTFFYIPPAISHHSKEIWG &

EDVNEFKPSRWENMDHMVS

AYEYFPFLAGGRQCIGQKFAIVELKILLSILIRDIQFFEKPGFKVQKRPLIVTRPVPNMTLWTKRVSY

 

>CYP5210A3 P450-13 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

73% to P450-1 in the CYP56 clan

RO3G_05127.1

RO3G_05134.1

MNQETLQIVQKNITNYVEKWKSSEKLDAVWAAKLGLSSVAAYFLYKTIIYRLYIHPANRLPGPRVSWIPFMGNFFEIIRTEDDQSPLRKWAKTYGSIYTIHTQLNKPEIVVTDEKLVKQILTTQVYDFEKPDIVSRELERLTGRGVLVVEGQAHRIQRKMLNPAFSVQSIRAMVPLMLGPGYTLRDQWLHKISESNTEYTEIEVSKSLSLATLDVIGITAFGQDFKSLSYYGTEKMNRLSKAYLSIFSNEMATMQILSIVFPILRYLPTKRNREEAKMLRWIKEESAALVEAGIQRDQEEKRSGKINQSKDLLALMVNLIDEDTGKGFTKEELRDQCLTFLAAGHETTSNTLCWCLWLLAQNQDIQDKLRAEILPLFKDGKISNYDAVNAIPYLDYVCRETLRLIPTVPDTNRINRVPVVLGSYVIPKDTTFHIPPVVSQRSKEIWGEDADEFNPSRWEKSENIGNAYQYFPFLAGGHQCIGHKFATVEMKVLLSILIKDIQFFEKPGFKVQKKQIITMRPIPNMTLWIKPVSSS*

 

>CYP5210A4 P450-14 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

100% to P450-13

RO3G_05127.1

RO3G_05134.1

MNQETLQIVQKNITNYVEKWKSSEKLDAVWAAKLGLSSVAAYFLYKTIIYRLYIHPANRLPGPRVSWIPFMGNFFEIIRTEDDQSPLRKWAKTYGSIYTIHTQLNKPEIVVTDEKLVKQILTTQVYDFEKPDIVSRELERLTGRGVLVVEGQAHRIQRKMLNPAFSVQSIRAMVPLMLGPGYTLRDQWLHKISESNTEYTEIEVSKSLSLATLDVIGITAFGQDFKSLSYYGTEKMNRLSKAYLSIFSNEMATMQILSIVFPILRYLPTKRNREEAKMLRWIKEESAALVEAGIQRDQEEKRSGKINQSKDLLALMVNLIDEDTGKGFTKEELRDQCLTFLAAGHETTSNTLCWCLWLLAQNQDIQDKLRAEILPLFKDGKISNYDAVNAIPYLDYVCRETLRLIPTVPDTNRINRVPVVLGSYVIPKDTTFHIPPVVSQRSKEIWGEDADEFNPSRWEKSENIGNAYQYFPFLAGGHQCIGHKFATVEMKVLLSILIKDIQFFEKPGFKVQKKQIITMRPIPNMTLWIKPVSSS*

 

>CYP5210A5 P450-26 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

60% to P450-13, 59% to P450-1, in the CYP56 clan, 34% to CYP5070A1

RO3G_10122.1

MNQSIQSIVDKVVPSLNLIQDKVNEYVEKYLARSPPSQKTVVLGLSSAVSIYCLSKYIIYNLYLHPLRHIPGPPADWIPPFGNFREIVRSESGAPHKRWAEKYGGMVLYHGEWNQPRVIVTDHKLLKQVLTTQEYDFIKTPATAKFLKRFLGNGLLVAEGEVHRFQRKILNPAFSVQSIRSMVPLMAKPGLRLRDLWLETIKSSGKEFTEIEVSSGLSLATLDVIGLAGFGQDLKSLEHVGTEKQSKLSQAYLHIFSNDLSLMRILTLLFPALRFLPTERNRKTRRDLRWLEEESKALVQAGIERAAVEKEDGKPKDLLALMVNLIDDETGKGLTAEELRNQCLTFLAAGHETTSVSLSWCLWLLAQNQKIQDSLRKEVKTLFTSDDIPTYEEINALPLLTNVCRETLRLIPPVPVTSRITRAPVVLGSYALPKGTILFLSLIVNHHSKEIWGEDAEEFNPYRWETEKIGNAYQYLPFLAGGRQCIGYKFALIEMKLLLALLIKDIQYFEKPGFKVIKKQQLTLRPAPNMTLWMKAA

 

>CYP5210A6 Phycomyces blakesleeanus (Zygomycete fungus, Mucoromycotina)

56% to CYP5210A5 Rhizopus oryzae

e_gw1.4.106.1

MQQSIEAFKAIRLQDTLQATHQHWNVLLGLAEKYINQKVLSPLGINASVQRVLTGVGLASYFGYI

ISKYFIYRLYLNPVNKIPGPPVSWFPFTGNAIEIIKLE (0)

SGAPHKI

WKDKYGGIISYHGPWNSPRVLVTDAKLLKSILTTNEYDYIKAPQTSDFLRKFIGNGLLVAEGQEHRKQRKMLNPAFSVNT

IRYMVPMMAIPGVHLYKKWQKALKETDALEANVSHELSLATLDVIAIAGFGEEFEAVKLADTPERNKLGEAYMLIFSPEK

SIMRFLSFFFPILNKLPTQRNRKVNHDLRTLGTESRYLVERGKKRTEENDSKNSKDILSLMVKEIDEDGLGMTVSELQDQ

CLTFLAAGHETTSVALSWCLWLLAKNPGIQDELREEIRPLFRNLDTDHHIVPSYDDINSLKLLNNVCKETLRVIPPVPVT

NRVTRKEVILGDYILPKGTDVFISIIANHHSKQIWGDDAETFRPSRWDEELASKVSPYEYMPFLAGGRQCIGYKFALVEM

KILLAILIMDFKFSEKPGFEPKKEQLITLRPSPNMTLILEKA*

 

>CYP5211A1 P450-25_var1 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

28% to CYP547C3, 29% to 547C1 in the CYP56 clan

RO3G_09819.1 revised

MSSDPMIPYAFTHICWLPLLSLPLAYVFIYCRRRYGSSLASVVLAPTDNFITKYLGLVPPPNHAEKTDELSRFLIRAGQD

PRYFPVSVCWSLTGKPLVIASTLKGIKDVLLDGQMKSKVRGEQQPKVQRGNMIRLIHNLVFGGKSLNNVIGEDWRWRRHV

LLPPFQPKQLVPKLLPYVASRTAELLSTFEKYAENGSPVELDNLFMDATMDIINYYLYGRNDLNYDIVGGRTNMK (0)

FIHNHLGYGFQSLEAWLPFGINKTNWAQKRFKPSRDLLKRFVEDSLKYALEDYEADLKRFEQENVPVNERS

YQSVAACAFASGFYGKDQFDLINDL

LALTFAGYDTTAHTLAFAFSELARDSDLQDKVFQQVRQVLGPPPLSPSSITAEKLAKMPLVTAVYRETLRKYPAVVFIPV

HVNRDTVVDGVIVPEGAEIWCNVRGIQMNPQIFPEPNRFDPIRWLQPDNKGDNAFDNMHGSSSAPLDQFTPETQYKFPEI

AFTLGQHSCLGKNLAILELRMVIACTINQFTFELKEGCHIDTKIVLTTKPRNGVWVHFKKRKS

 

>CYP5212A1 P450-45 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

35% to CYP509B1 in the CYP56 clan

RO3G_16456.1 revised

MGTLFNRSNYRLYVLLASILTSSILYQKLSNAIFVPKQLQHIPKVNTLQWFWSVLIGESHDVRVKRLVLPIMNKYGLCLKYVMGNWTLTVADPHYLQMLLKDMKSFPKIQVAMDPDLILTNQAPSLSNCSMNDWKRQRSIANPIFQRAMPVEIFGNVVLKLFRSVDTLNQDGVIDMADYAKRYALDCLGLGLFDFDMAAVSNPESYYSTLYKEAFSIVRDPLVYLFPAYTRIPSKWIPYRNRAHVANERLRRIFYEVIEEKKAAPSTSSDLLSLMIKANHSESDVAYLTDDELISNLSTFFVAGKIFVQRAIASFFYYLAAHPDVQKKARKEVLLILGDDPDDILPTDKQLKQMTFLNYCIKETMRINPPTSGNLPRMTSRVILIGNFLIPKDTIVHLELYCVHHLEKYWDRPQEFIPERFDTASKNYRENAVWMPFGYGPRTCIGLNFSLSEQRVLLAMMLKKFCWKLAPNSEHQHGLRNAHGGGIGLLGPESLKIQLIKRYA

 

>CYP5213A1 P450-28 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)

26% to CYP512B2, 25% to CYP512B1 in the CYP54 clan

RO3G_10623.1 revised

MNSIVLDKKVEQICLSVGVLTAAIVLFKATTSVFSNKVYRTALFHPITNSFIFFTQQSRNGIPLVPYKIPFVGSTMAYYKNMLEFTKKHSEKYGSVFHMHLHGQIITVVGADDAPEAFTHPDLSFLAGQFLGEATASKSAKKDVLPASVIKTSIVKHLTPNLDHYAPQSFEMLCKKAKSVLDAEKGPVVITNPISFLRSLVSQYSARAFVGKELCSDPNLMNAFENAVTDIGKEMTPGFFRVIFPWTLIKTALKSEIERNNGLDKKVNSAKKKQITWDAYFLLKKEPSNILEFILDQYPAEIDDDYLEALTTTILIFIFVGVHTTSMAVAQVLYRLVKHPEYTKELIEEQQEVLKSGYDSSAYSPSAYRQMVKLDSFIRESLRTRSNGIGLPHKNITNQDIVLRSGAIVHPGENVYINMWHVNTNEVNQENMKDTEQFQGFRFVGRDKPSTKPGHDFISFGLGRRSCPGRWFAIQQIKGIISFLILNYDISAASEIKIPGVDSYAGSLSGSIQFQKKI