Ricinus communis (castor bean) P450s

 

261 sequences

Dowloaded from the Protein section of GenBank by the search

Ricinus communis[orgn] AND P450 to get 582 sequences.

Duplicates from ref seq have been combined giving two accessions for

most sequences (an XP_ number and a EEF number).

P450 reductases and some other non-P450s have been removed

 

197 complete genes (may have a short missing segment)

17 fragments that are incomplete but do not look like pseudogenes

47 pseudogenes

 

May 25, 2012

Revised June 4, 2012

D. Nelson

 

For a spreadsheet with all the sequences sorted by contig order see

Ricinus.communis.xlsx

 

CYP51 CLAN

 

>CYP51G1 Ricinus communis

gi|223548641|gb|EEF50132.1 

gi|255543234|ref|XP_002512680.1  Ricinus communis

MDSDNNLMNVLLVIAATLLVAKLISAFVLPRSRKRLPPVVKGLPLVGGLFRFLKGPIIMLRDEYPKLGSV

FTVNLAQKKITFFIGPEVSAHFFKAPESDLSQQEVYQFNVPTFGPGVVFDVDYSIRQEQFRFFTEALRVH

KLKGYVDQMVMEAQDYFSKWGDSGEVDLKYELEHLIILTASRCLLGREVRDKLFDDVSALFHDLDNGMLP

ISVLFPYLPIPAHRRRDRARKKLAEIFANIIASRKLAGKTENDMLQCFIDSKYKDGRPTTEAEVTGLLIA

ALFAGQHTSSITSTWTGAYLLRYKEYLSAVLEEQKTLMEKHGNKVDHDILSEMDVLYRCIKEALRLHPPL

IMLLRSSHSDFSVKTRDGKEYDIPKGHIVATSPAFANRLPHIYKNPDRYDPDRYSAGREEDKVAGAFSYI

SFGGGRHGCLGEPFAFLQIKAIWSHLLRNFEFELVSPFPETDWNAMVVGVKGKVMVRYKRRELSVN

 

CYP71 clan

 

CYP71B

 

>CYP71B64 gi|255564478|ref|XP_002523235.1  Ricinus communis

gi|223537531|gb|EEF39156.1  Ricinus communis

58% to CYP71B40v1 cottonwood, 53% to CYP83F5 cottonwood

MASLWQLSLLLLFPLLFFFLKRKLQAKTRIKNHPPGPPSLPIIGNFHQLGVLPHQSLWQHSKKYGPVMLV

KLGRVPTVIISSSGAAKELFKTHDLNSCSRPLLTGSGKLSYNYLDIAFTPYGDYWRDMRKLCVLELFSAK

RVQSFQFIREQEVSLLIDSISKSSSSCPVDLSEKAMTLTANIICRAAFGKSFQERGLNHERFQEAIHEGL

AMLGSFSAADFFPYVGWIVDRITGLHARLERNFQEFDTFYQKIIDDHIQKGRKDGSQQVEDIIDVLLELE

KSHREEFGAFQFSKDHIKAILMNIFLAGVDTGAITLVWAMTELIRNPRVMKKAQEEIRSCIGDKRKVSEI

DIEKFGYLKIVLKETLRIHPPSVLLIPRETMAQFSINGYDIYPKTRIQVNVWAMGRDPKIWKNPQEFYPE

RFLDSSIDYKGMNYELLPFGGGRRGCPGITMGMTTVELALANLLFYFDWKLPYNMKIEDINMEEAPGLTI

HKKEPLLLVPTIYQPVSKN

 

>CYP71B64 gi|255622282|ref|XP_002540268.1  Ricinus communis (TOP PART ONLY)

gi|223497412|gb|EEF22115.1  Ricinus communis

60% to CYP71AS1 Citrus sinensis

59% to CYP71B41 cottonwood

same seq as XP_002523235 (WHOLE SEQ)

AASG02004380.1

MASLWQLSLLLLFPLLFFFLKRKLQAKTRIKNHPPGPPSLPIIGNFHQLGVLPHQSLWQHSKKYGPVMLV

KLGRVPTVIISSSGAAKELFKTHDLNSCSRPLLTGSGKLSYNYLDIAFTPYGDYWRDMRKLCVLELFSAK

RVQSFQFIREQEVSLLIDSISKSSSSCPVDLSEKAMTLTANIICRAAFGKSFQERGLNHERFQEAIHEGL

AMLGSFSAADFFPYVGWIVDRITGLHARLERNFQEFDTFYQKIIDDHIQKGRKDGSQQ

VEDIIDVLLELEKSHREEFGAFQFSKDHIKAILM (0)

NIFLAGVDTGAITLVWAMTELIRNPRVMKKAQEEIRSCIGDKRKVSEIDIEKFGYLKIVLKETLRIHPP

SVLLIPRETMAQFSINGYDIYPKTRIQVNVWAMGRDPKIWKNPQEFYPERFLDSSIDYKG

MNYELLPFGGGRRGCPGITMGMTTVELALANLLFYFDWKLPYNMKIEDINMEEAPGLTIH

KKEPLLLVPTIYQPVSKN*

 

>CYP71B65 gi|255564484|ref|XP_002523238.1  Ricinus communis

gi|223537534|gb|EEF39159.1  Ricinus communis

59% to CYP71B40v1 cottonwood, 52% to CYP83F5 cottonwood

MASLWQLSLLLLLPLLFFFLKRKLQAKTRIKNHPPGPPSLPIIGNFHQLGVLPHQSLCQYSKKYGSVMLV

KLGRVPTVIISSSGAAKELFKTHDLNSCSRPLLTGSGKLSYNYLDIAFTPYGDYWRDMRKLCVLELFSAK

RVQSFQFIREQEVSLLIDSISKSSSSCPVDLSEKAMTLTANIICRAAFGKSFQERGLGHERFQEVIHEGL

ATLGSFCAADFFPYVGWIVDRITGLHARLERNFQEFDTFYQKIIDDHIQKGRKDGSQQVEDIIDVLLELE

KSHREEFGAFQFSKDHIKAILMNIFLAGVDTGAITLVWAMTELIRNPRVMKKAQEEIRSCIGDKRKVSEI

DIEKLGYLKIVLKETLRIHPPGVLLIPRETMAQFSINGYDIYPKTRIQVNVWAMGRDPKIWKNPQEFYPE

RFLDSSIDYKGMNYELLPFGGGRRGCPGITMGMTTVELALANLLFYFDWKLPYNMKIEDINMEEAPGLTI

HKKEPLLLVPTIYQPVSKN

 

>CYP71B66P gi|255564486|ref|XP_002523239.1  Ricinus communis

pseudogene

gi|223537535|gb|EEF39160.1  Ricinus communis

56% to CYP71BC1 Vitis vinifera

88% to XP_002523241.1 C-term, 58%  to CYP71B39P cottonwood

AASG02002544.1

NIFLAGVETGASVLEWTMAELIKNPRVMKKAQEEVRNCIRCERRVYENKIEKLEYLKMVL

KEALRLHPSCSLLGPRETISQFSING &

GYDIYPKTRIQVNVWATGKDPSIWKDLENFYPERFIDGPINYKG

MNYELLPFGSGRRGYSAITTGMAIVELALANLLFCFDWDLPCNMKVEDINMEEAGGISIHKKEPLLLVPT

AYEPVLRN

 

>CYP71B67P gi|255564488|ref|XP_002523240.1  Ricinus communis

pseudogene

gi|223537536|gb|EEF39161.1  Ricinus communis

62% to CYP71AS1 Citrus sinensis, 61% to CYP71B41 cottonwood

95% to XP_002523242.1

AASG02002544.1

MASLWLLSVLLLFPLCFFFLKKKLQAKTHTKNHPPGPPCLPIIGNLHQLGVLPHQPLWQYSKKYGPVM

 

>CYP71B68 gi|255564490|ref|XP_002523241.1  Ricinus communis

gi|223537537|gb|EEF39162.1  Ricinus communis

AASG02002544.1

Frameshift at &

58% to CYP71B40v1 cottonwood, 50% to CYP83F5 cottonwood

MASLWLFSLLLLFPLFFFSLKKKRAKTHTKNHPPGPPSLPFIGNFHQLGVLPHQSLWQYSKKYGPVMLVK

FGSVPTVIISSAEAAKELLKTHDLNSCSRPYLTSTGKLSYNHLDIAFAPYGDYWRDMRKLCVLELFSAKR

VQSFEFIREEEVSLLIDSISKSSSSPVDMKEKIMTLTANITCRAAFGKNFHQGGLGHERFQEVIYEGIAL

MGSFFAADYFPGVGWILDRITGLHARLERNFEEL &

DTFYQKIIDDHIQKGRRDETQQEQDIIDVLLQLETSHREQSGAFQFSKDNIKGILMNIFLAGV

ETGASVLEWTMAELIKNPRVMKKAQEEVRNCIGCERRVSENKIKKLEYLKMVLKEALRLHPPGPLLAPRE

TTSQFSINGYDIYPKTRIQVNVSAIGRDPRIWKDPENFYPERFIDSPINYKGMNYELLPFGSGRRGCPGI

TMGMAIVELALANLLFCFDWDLPCNMKVEDINMEEAAGMSIHKKEPLLLLPIAYEPVLRN

 

>CYP71B69 gi|255564492|ref|XP_002523242.1  Ricinus communis

gi|223537538|gb|EEF39163.1  Ricinus communis

57% to CYP71B40v1 cottonwood, 52% to CYP83F5 cottonwood

MASLWLLSLLLLFPLCLFFLKKKLQVKTHTKNHPPGPPCLPIIGNLHQLGVLPHQPLWQYSKKYGPVMLV

KLGRVPTVIISSSEAAKELLKTHDLSSCSRPLLTGAGKLSYNYLDIAFTPYGDYWRDMRKLCVLELFSIK

RVQSFKFAREEEVSLLIDSVLKSSSSPVDLSEKAMTLTANIICRVAFGKSFQERGFGHERFQEVIREAVA

LLGSFYAADYFPYVGWIVDRITGLHARLERSFQEFDTFYQKVIDDHIQKGTRDETQQEEDIIDVLLELEK

SHRERSGGFQFSKDNIKAILMNIFLAGVHSTATTLVWAMSELIRNPRVIEKAQTEIRNCIGDKRKVCESK

IEKFEYLKLILKETLRLHPPGPLVVPRETMTQFSINGYDVHPKTRIQVNVWAIGRDPTKWRNPEEFYPER

FIDSSVDYRGMHYELLPFGGGRRGCPGISMGIAIVELALANLLFCFNWRLPYLWKNGNIFTIFVNYKADI

NRNDAFYVI

 

>CYP71B70P gi|255578377|ref|XP_002530055.1  Ricinus communis

pseudogene 100% to CYP71B72

MIQVNAWAIGRDPKYWKDPEEFFPERFADGSPDFKGKDYEFLPFGAGRRMCVGMNLGTITVEFVLANLVY

CFDWKLPDGMQKEDINMEEQAGVSLTVSKKTPLCLVPVKYLQ

 

>CYP71B71 gi|255578379|ref|XP_002530056.1  Ricinus communis

gi|223530472|gb|EEF32356.1  Ricinus communis

69% to CYP71B41 cottonwood, 46% to CYP83F4 cottonwood

gi|255578377|ref|XP_002530055.1  Ricinus communis

SAME SEQ AS XP_002530056.1 C-TERM BUT TWO ADJACENT LOCATIONS

gi|223530471|gb|EEF32355.1  Ricinus communis

67% to CYP71AS1   Citrus sinensis

MTFYTLIMLPLLLLLLPLLFLFSKKKKAEEGNKRIPPSPPKLPILGNLHQLSELLHQSYCELSKKYGPVM

LLHLGHLPTVVISSAEAAQEALKVHDLACCSRPLLAGSGRLSYNYLDVAFAPYGELWRKMRQLIVLELFS

MKRVHSFRPLREAEVEMLINSISESASSATPINLTDKLFALTANITFKMSFGFDYRGTDFDRDRFHEVVH

NAEAVAGSFSTGEFFPFYGWIIDRISGHHARTERVFYELDKFFQHVIDDHLKPGRKKDQDDMIDVLLRIE

KEQAQVGEGAHFTKDNIKGVLLNLFLGGVDTSAITLNWAMAEFVRNPRVMKKLQEEVRNSVGKKGRVTEA

DINKLEYLKMVVKETFRLHPAAPLLIPRETLSHIKVNGYDIKPKT

MIQVNAWAIGRDPKYWKDPEEFFPERFADGSPDFKGKDYEFLPFGAGRRMCVGMNLGTITVEFVLANLVY

CFDWKLPDGMQKEDINMEEQAGVSLTVSKKTPLCLVPVKYLQ

 

>CYP71B72P gi|255578381|ref|XP_002530057.1  Ricinus communis

gi|223530473|gb|EEF32357.1  Ricinus communis

58% to CYP71B38 cottonwood

56% to CYP71AS1 Citrus sinensis

AASG02005334.1

Probable pseudogene, bad boundary at GFII, small deletion

MFMNPLSSWVLICLLSLVFLIKRKIKVGKGNKQLPPGPPKLPIIGNLHQLGRQPHRSLCQFSKRYGVV

xxxxxxxx

PTVVISSAEAAEEVLKIHDIHCCSRPALAGARKLSYNSSDISFSPYGEYWRHIRKISVIELFSIKRVQSFRF

IREEEVTSLIDSISRASASATPISLTQNLMTLLANIAFRMAFATNFEATAFAKDRFKILIDDAVTLLGSF

SASDYFHRVGWIIDRITGYHARSERVFQELNTFYEQIIDEHLKLGGKLNKGHEDIVDVLLRIERDQAEIG

SLQLTKDRIKAVLM (0)

GFIIGWITTVSDTLVWAMAELARKPRTMEKAQEEVRNLIGNK

RRVRKSDIHKLHYLKMVIKETLRLHPPLPLLVPGETMSKFKINGYEIYPKILIQVNVWAIGRDPNYWKNP

EEFLHERFMDSSIDFKEQNFEFLPFGGGRRTCPAQYMGTISLELVLANLLYFFDWKLPNDVTDINMEERD

GPSLTVSKMEDLKLVPLNYMEF

 

>CYP71B73 gi|255578383|ref|XP_002530058.1  Ricinus communis

gi|223530474|gb|EEF32358.1  Ricinus communis

61% to CYP71B40v1 cottonwood, 48% to CYP83F5 cottonwood

MSMNPLSLWVLIFLLSLVFLIKRKIEVGKGNKQLPPGPPKLPIIGNLHQLGRQPHRSLWQLSKRYGPVMF

LQYGAVPTVVISSAEAAEEVLKIHDIHCCSRPALAGAGKLSYNFSDISFSPYGEYWRQIRKICVLELFSI

KRVQSFRFIREEEVTSLINSISQASASATPVSLTEKLTTLVTNITFRMAFATNFEATDFAKDRFRILIDD

AMSLLGSFSANDYFQHVGWIIDRITGYHARAEKVFQDLDTFYQQIIDEHLERGGTINKGQDDIVDVLLKI

ERDQARIGSIQFTKNHIKAVLMDLFFAGVTTGSDTLTWAMAELVRKPKVMARAQEEVRNVIGKKERVTES

DINELHYLEMVIKETLRLHPPAPLLLPRETMSKFKINDYEIYPKMLIQVNVWAIGRDPKYWKNPEEFLPE

RFMDSSIDFKGQNFEFLPFGGGRRSCPGQYMGTILLELVLANLLYFFDWRLPNDVTDINMEEKDGPSLTV

SKMEALELVPLKYL

 

>CYP71B74 gi|255548016|ref|XP_002515065.1  Ricinus communis

gi|223546116|gb|EEF47619.1  Ricinus communis

59% to CYP71AS1 Citrus sinensis

62% to CYP71B40v2 cottonwood, end of exon 1 and exon 2

67% to XP_002530056.1

AASG02021236

GGQVEFTKVNIKGVLM (0)

NLFVGGVDTSAITLNWAMAELMKNPRVMKKAQDEVRKAIGDKGKVTEADLGKLGYINMIIKETFRKH

PPVPLLIPRETISEIKLDGYVVPANTMLQVNVWAIGHDPKYFKDPEEFYPERFAESPIDYKGSHFELL

PFGAGRRMCVGMHVGEMNIGIVLSNLLYCFDWKLPDGMTRENLNMDEMDHVALTVTKKVPLSLVPVKYNP

 

>CYP71B75P gi|255548014|ref|XP_002515064.1  Ricinus communis

pseudogene

gi|223546115|gb|EEF47618.1  Ricinus communis

gi|255548012|ref|XP_002515063.1  Ricinus communis

probably joins with XP_002515064.1

gi|223546114|gb|EEF47617.1  Ricinus communis

52% to CYP71B41 cottonwood

48% to XP_002530056.1

AASG02010815.1

LHGPQRLTRNYPDMAFSTVGRRKICALELFSLKRVQSFRLITEEISLLMNSNSQ LQELSLILLKSYIFLLQALYLG*QDAGSGLDKKRL*DLIHKADSIVGCLFAEEY

IPNVGWILTVLTGHHAKTEQVFFKLDAF

QQAIDDHLKPERTKEQEDIVDVLLKLKREQT*TGVAWLRKDNIKVIFL

NLILGGVDTTAINVEWAMAELTKNPGITR

KKAQGAVRNSMDKKRRVTEADLDQLQYLRLV

RLHPPAPLLLLRET

SHFKINNYNIHPNMLIHVN

FWATA*DPNYRKDPEKFFPEIFVDSSIDLRGQHFQYLPLGS

GINMGMVMMEIALANLLYCFNWKLPSDTKGEFNMEEKAGLTVAKKIALRLVPINYLCWEPKDDLS

 

>CYP71B76 gi|255570189|ref|XP_002526055.1  Ricinus communis

gi|223534636|gb|EEF36332.1  Ricinus communis

60% to CYP71AS1 Citrus sinensis, 62% TO CYP71B41 COTTONWOOD

69% TO XP_002530058.1,

AASG02018987.1 runs off the contig

EST = EE257592.1

MFLYPIPLWVLLLLLLLLLPLLLPKRGNKHLPPGPPKLPIIGNLHQLAGLPHRSLWQLSKKYGPVMLLHF

GGVPAVVISSAEAAEEVLKNHDLSCCSRPSLVGARRLSYNYLDLAFSPYGDYWREIRKICVHELFSIKRV

QSFQFIRDEEVAALIDSISQSSSAATPVDLTEKFFSLTANITFRLAFGTSFEATDLEKDRFKNLLDDVEA

LLGSFSANEYFQHVGWIIDRFTGYYAKTESVFHKLDTFFQQIIDDHLKPGKMDKELEDIVDVLLRLEREQ

TEVGSVQLTKDHIKAVLMDLFVAGVYTGAVTLIWAMAELARNPEIMKNAQEEVRNVAGNRERVAESDIDD

LHYLKMVIKETLRLHPPAPLLLPREVISNFKINGCDIYPKSLIHVNVWAIGRDPNYWK

DPEDFFPERFIDSFIDFKGQH &

FELLPFGAGRRGCPALHMGTVLIELALINLLYCFDWKLPNGVQDINMEEQARPSLTIFKMDPLKLGPVRYLVQ*

 

>CYP71B77P gi|255570185|ref|XP_002526053.1  Ricinus communis

pseudogene

gi|223534634|gb|EEF36330.1  Ricinus communis

59% to CYP71AS1   Citrus sinensis

89% to XP_002526055.1, 62% to CYP71B40v1 cottonwood

AASG02006170

(0) NLFMAEVYTGAVTLIWAMAELARNPEIMKNAQEEV*NVVRNRERVAESD* &

DDLHYLKMVIKETLRLHP &

PTPLLLPREVISSFKINGCDIYPKSLIHVNVWAIGREPNYWKDPEDFFPERF

IDSFIDLKGQHFELLPFGAGRRGCPALHMRTVLIELAIVNLLHCFDSKLPNGVQDINMEE

QARLSLTISKMEPLKLVPVRYLAQ*

 

>CYP71B78 gi|255562415|ref|XP_002522214.1  Ricinus communis

gi|223538585|gb|EEF40189.1  Ricinus communis

55% to CYP71B40v1 cottonwood

51% to CYP71AS1 Citrus sinensis N-term exon one only

87% to XP_002523242.1

AASG02017343.1

MASLWLLSLLLLFPLFFFSLRKKLQAKTHTKNHLPGPPSLPIIGNFHQLGVLPHQSLWQYSKRYGPVMLV

KLGRVPTVIISSSEAAKELLKTHDLSSCSRPLLTSTGKLSYNYLDIAFTPYGDYWRNMRKLCVLELFSTK

RVESFQFVREEEVSLLIDSISKSSCSPVDLSEKAIFLTANITCRVAFGKSFQERGFGHERFQEVIREAFA

LMGSFYAADFFPYVGWFVDRITGLHARLERNFQEFDTFYQKIIDDHIQKGTRDKPEQEEDITDILLELER

SHREESGAFQFSKNHIKAILM (0)

 

CYP71D

 

>CYP71D321 gi|255587918|ref|XP_002534439.1  Ricinus communis

gi|223525285|gb|EEF27942.1  Ricinus communis

63% to CYP71D97 Ammi majus

77% to XP_002534441.1, 65% to CYP71D26 cottonwood

62% to XP_002522762.1

AASG02023816 runs off the end

CTYNLQDVAGAPYGEHWRQLRKICTLELLTVKRVQSFRSIREEEVSKAIESIASSAGSAVN

ISKTVTCLTYGIISRAAFGKVWKGEDVFVPNVQKLIQAASGFNLADTYPSIRFLHVISGI

KSKIESLHKGIDVILEDIMNEHKTKKATAKTEETEEVEDLVDVLLKLQDNGDLQFSLTDN

NIKAVIM (0)

DMFTAGSETSAMTVEWAMAEVMRKPVVLKKAQEEVRQKLGTKGGIHEEGLQELNYLKLVIKETLRLHPP

LPLLLPRECRKSCVIGGYDIPTKSRLMVNVWAIGRDPNYWIDPEKFFPERFLDSAIDYKGNNFEFLPFGA

GRRMCPGVSFGIADVEFPLAMLLYHFDWTLPSGKKPEDLDMTECLGGGARKKEDLCLIPTPWHPPSVN

 

>CYP71D322 gi|255587922|ref|XP_002534441.1  Ricinus communis

gi|223525287|gb|EEF27944.1  Ricinus communis

62% to CYP71BE1 Vitis vinifera, 77% to XP_002534439.1

70% to CYP71D26 cottonwood, 71% to XP_002522762.1

AASG02015230.1

DVFSAGSETSSTTVEWAMSELMKNPRVLEKAQAEVRQVFCRKRSINEESLQELNYLKLVIKETLRLHPPV

PLLLPRECREDCVINGYDIPAKSRVMVNVWAIGRDPNWWIDAEKFFPERFLDNAIDYKGNNFEFLSFGAG

RRMCPGMSFGVANVELPLAMLLYHFDWKLPYGLKPENLDMSECLGAGVRKKEELCLIPIPYIPLPIN

 

>CYP71D323P gi|255575627|ref|XP_002528713.1  Ricinus communis

gi|223531807|gb|EEF33625.1  Ricinus communis

pseudogene

AASG02006430.1

72% to XP_002513337.1

47% to CYP726A1 Euphorbia lagascae, 50% to CYP71D41 cottonwood

MEYQTLSYPVLLSFLLFIFIVLRVWKTKKDRPNSPPGPRKLAFIGNLHQVAGTDLPHHRI

TELAETYGPIIVCKLAKFQLLCFLHLKEPKKC*KTRASCSRPLLLAAEIVFYYG

MDIIFGTYGDHWRQLRKLCTLELLSAKRIESFSSVRGEELSNFLMFLHSKAGTPVNLSKKLFALTNNIIA

RIAVRKSKNQEALLNLIEDVIEAAGGFRIADVFPSLQFLR &

IISGTKSKVEKLHRIAD*ILEDIINEHKATWAASKDGDDGD*KEAKNLLDVLLDLQKDGDL &

KIPLTNDSIKAAIL (0)

EMLGDGSDTSAKATKWAMSE &

MRYPEAMEQAQEEVRQVFGETGKIEEARVHELKYLRAVFKETLSLHLPLAMIPREFKVKT

AVFKETLSLHLPLAMIPREFKVKTKIDGYDIYPKTKALVNVWAIGRDPTVWGEPEKFCPER &

LDSSISFRGNNFELIPFGSGKRICPGMTLAITTVEPFMANTLFYFDWKFGDGVTADTFDMSECFGASIKRKTDLILAKP*

 

>CYP71D324 gi|255563520|ref|XP_002522762.1  Ricinus communis

gi|223538000|gb|EEF39613.1  Ricinus communis

65% to CYP71D26 cottonwood, 67% to XP_002522721.1

58% to CYP71BE1   Vitis vinifera

48% to CYP726A1   Euphorbia lagascae

MEYQFPFFPILFTFLLFIFMVFRIWKKSKTNHPAPHLPPGPWKLPLIGSMHHLVGSQPHHRLKDLAKKYG

PLMHLQLGELTNIVISSPEIAKEVMKTHDVVFAQRPHLLAASVTSYNYTDIAFAPYGDYWRQMRKLCTLE

LLTAKRVQSFRSIREEEVSRLMRSLSSSAGSPINFSRMFNSLTYSIISRASFGKIWKGEEIFIPIVKKLI

VAAGGFTLADVYPSVKLLHWISGMAPRLKRIHHIVDNIFQNIIDDHRTKRAAANSSVEGEGDLVDVLLNF

QAQEDLAVPITNDNIKGIILDTFVAGSETSSTTAEWAMSELLKNPRVMEKAQEEVRRVFGEEGNVHEGRL

HELNYLKWVINETLRLHPPIPLLLPRECRESCVINGYDIPVKSKVIVNVWAIGRDPNCWMDAEKFYPERF

QDCPIDYKGTHFEFLPFGAGRRMCPGILFGIINVEFPLAQLLYHFDWKLPTGVKPETFDMTEDFGAVVKR

KSDLYVIPMPFLPPPVK

 

>CYP71D325P gi|255563440|ref|XP_002522722.1  Ricinus communis

pseudogene

gi|223537960|gb|EEF39573.1  Ricinus communis

60% to CYP71BE1 Vitis vinifera, 72% to XP_002522721.1,

62% to CYP71D43 cottonwood

AASG02012862.1

DIFVAGSETSSTTVEWAVSEMLKNPRLLEKAQAEVRKVYSKKRNLDETDFHELDCLKLVI

KETLRLHPPASLLIPRECNET &

EINGYEIPEKSKVIVNAWALGRDPNHWAEAEAFNPERFIGSSVDYKGNSFEYI &

TFGAGRRICPGMLFGIANVELPLAQFLYHFDWKLPDGQKLELLDMPE &

SVGRKNDLQLIPVPYHPPSL*

 

>CYP71D326 gi|255563438|ref|XP_002522721.1  Ricinus communis

gi|223537959|gb|EEF39572.1  Ricinus communis

64% to CYP71D26 cottonwood, 67% to XP_002522762.1

60% to CYP71BE1   Vitis vinifera,

48% to CYP726A1   Euphorbia lagascae

MSLSFLILSLIFIYMVLKLWKRSNSKHSTLKNLPPGPTKLPLIGNMHQLLGSLPHHRLRDLAKKYGSIMH

LQLGEVPHVVVSSPEAAKEVMKTHDIVFAQRPFLLAASVITYNFTDIAFSPYSDYWRQLRKICVLELLSA

KRVQSFRSIREEEVSNLINTLTSFSGKPFNFSRKLFSSTYGIAARASFGKKYKDQEEFIKVAQQMTEVAG

GFSLADLFPSIAFLHVISGMKSRLLRLRDDGDNILENIIDDHRARNMTGKTSGEGEDDDLVDVLLRFQKG

GQLEFPLTTNNIKAVILDIFIAGSETSSTTVEWAMSEMLRNPRVMEKAQEEVRRVFGKKGNVDEAELHEL

NYLKLVIKETLRLHPPAPLLLPRESRESCEINGYYIPVNSKVIVNAWAIGRDPNNWTEAETFYPERFLDS

AIDYKGNYFEFIPFGAGRRMCPGILFGMANVELPLAQFLYHFDWKLPDGLEAESLDMMEGFGATVRRKND

LHLIAIPHH

 

>CYP71D327P gi|255559060|ref|XP_002520552.1  Ricinus communis

gi|223540212|gb|EEF41785.1  Ricinus communis

pseudogene

72% to XP_002513339.1

55% to CYP726A1 Euphorbia lagascae, 56% to CYP71D43 cottonwood

AASG02001746.1

MEKHILPFRVLLSFLLLIFLVLKIWKKTDSSIPPPGPWKLPLVGNIH*LVNALPHHRLREFAKSYGSV

MSIKLGQVSAVIISSAEGAKEALKTQDVQFADRPLVLAAKIVLYSPMDI

IFGPYGDHWRQMRKICTLELLSAKRVQSFR*VRKEELSDFVRFLHCRAGTPVNLTKTLFA

LTNSIMAITSIGEKCRNQEALLSIIDEIIEIGGGFSVLDVFPSLKILHVITGMKFRLERLHQLTDRILKG

VITEHKAAKAVTKINDGDDDDDQSKAHNLLDVLLDLQEHGNLQVPLT &

NDSIKAAIL (0)

EMFAAGSDTSSSTKEWAI

SELMRNPKAMKKAQQEVRFGEAGKVDEARLHDLKFLKLVIKETLRLHPSGALIPRECRERTKIDGYDIYP

KIKALVNVWAIGGDPNIWIEAEKFCPERFLNSWID*K &

TNFELIPLGAGKRMCPGITLSMTSVELVLAHLLYHFDRKLIDGVTTLGMT

 

>CYP71D328 gi|255563798|ref|XP_002522900.1  Ricinus communis

gi|223537885|gb|EEF39500.1  Ricinus communis

63% to CYP71D97 Ammi majus, 98% to XP_002522903.1

58% to CYP71D26

AASG02010911.1

DFFIAGTETSSNTIEWAMSELMRNPRVLKKAQAEVREAFKGKKTIRDADVKDLKYLELVIKETLRL

HPPLPLLLPRENKQSCAIGGYQIPAKARMIVNAYAIGRDPKTWRDADKFIPERFLDAAVDFIGMDFEYIP

FGGGRRICPGMNLGMANMQLPLAQLLYHFDWKLPDGVAPEDLDMTETFGATITRKNKLHVIPTRYQPLQG

NQQREAIEFVN

 

>CYP71D329 gi|255563804|ref|XP_002522903.1  Ricinus communis

gi|223537888|gb|EEF39503.1  Ricinus communis

54% to XP_002522721.1, 51% to CYP71D26, 51% to CYP71BE1

53% to CYP71D16 Nicotiana tabacum, 43% to CYP726A1   Euphorbia lagascae

MGALTLHPTTMVGFPTSTSVSLHFHPSPHPHRLKVRCQKTEADQKVVKKLPPGPMKLPIIGNLHNLAGKL

PHHALQELAKEYGPILHLQLGEVSTMVVSDGKMAKEVLKTHDLNFAQRPRLLAADIVLYDGKDIAFSPYG

EYYKQMKKVGAEELLGPKRVQSYSSLREEEVQKLVESVRLSLGKPINFGDRICRLTNVIVFKAAFGEECK

EQDTAIAVCVTATTLAGGFQIADVFPSLTFLHDINGFKTKVKEVAKEIDRMLSDIVEEHSKKLTSREINN

DGTEREDLVDVLLKLQRSGRFQCEVTTDHIKAVIFDFFIAGTETSSNTIEWAMSELMRNPRVLKKAQAEV

REAFKGKKTIRDADVKDLKYLELVIKETLRLHPPLPLLLPRENKQSCAIGGYQIPAKTRMIVNAYAIGRD

PKTWRDADKFIPERFLDAAVDFIGMDFEYIPFGGGRRICPGMNLGMANMQLPLAQLLYHFDWKLPDGIAP

EDLDMTETFGATITRKNKLHVIPTRYQPLQGNQQREAIKVVN

 

>CYP71D330 gi|255580182|ref|XP_002530922.1  Ricinus communis

gi|223529516|gb|EEF31471.1  Ricinus communis

61% to XP_002522721.1

AASG02003311 frameshift at &

MEHLHQFPFFPAFFCFLLFIFVIQSKRTKSEVSNSSSKLPPGPRKLPIIGNMLQLIGSLLHHRLRDLATQ

YGPVMHLQLGEVSNFVISSPEAAREVMKTHDISFAQRPFVLAASIVMYNFKDIVFAPYGDQWRQLRKICI

LELLSLKRVQSFRSVREEEVLFLVNSISSNAGSPINLGKMVLSL

SSTLTLRNAFGKFCKQKDEFVPLVKKILLMLEGFSVADTFPSFK &

ILHGLTGIRRKLERLHQEADTILENIIKEHRDNKASGRSDMKSEAVDLVDV

LLNLHDHGNLEFPFTTDNIKAVML (0)

DLFIAGTESSSGIIEWAMAEMIKNSRVLGKAQEEVRQIFNKKQCII

DETGLQELKYLKLVIKETLRLHPPAPLLLPRECREKVEVCGYEIPVNAKVIVNAWAIGRDPRYWNEAEKF

FPERFLDNSIDYKGNDFEFIPFGAGRRMCPGISYGMAVIELSLANLLYHFDWKLPDGMEPKDFDMSESFG

VTARKKNELFLIPIPYQS

 

>CYP71D331 gi|255583069|ref|XP_002532302.1  Ricinus communis

gi|223528004|gb|EEF30086.1  Ricinus communis

52% to CYP726A1 Euphorbia lagascae, 53% to CYP71D41 cottonwood

MELQIFSFPVLLSFFLFIFMVLRIWKNSNKKLNPPPGPWKLPLLGNIHQLATPLPHQRLRDLAKSFGPVM

SIKLGEISAVIISSAEAAQEVLKSQDVTFAERPASLASKLVLYNRNDIVFGAYGPQWRQTRKLCVLELLS

AKRIQSFKSVREEEVDEFAKFVYSKGGTPVNLTDKLFALTNTIMARTTIGKKCRSEKDLLRCIDGIFEEA

GVFNLADAFPSFTLLPVITGAKFRLEKLHRETDKILEDILREHIASKAASDKDTRNLLHVLLDLQESGNL

EVPITNDSIKATILDIFIAGSDTSAKTVEWAMSELMRNPKLMKRAQEEVRQVFGEKGFVDEAGLQDLKFM

KLIVKETLRLHPVFAMFPRECREKTKVNGYDISPKTTMLINVWAIGRDPNVWPDAEKFNPERFLDSSIDY

KGNNAEMIPFGAGKRICLGMTLGTLILEHFLAKLLYHFDWKFPDGVTPENFDMTEHYSASMRRETDLILI

PIPVHPLPTH

 

>CYP71D332 gi|255583071|ref|XP_002532303.1  Ricinus communis

gi|223528005|gb|EEF30087.1  Ricinus communis

54% to CYP726A1 Euphorbia lagascae, 54% to CYP71D38 cottonwood

MEQQILSFSVLSCLILFLLMVINILKNYSKDFTPPPGPWKLPFLGNIHQLATALPHRRLRDLAKTYGPVM

SIKLGEISSIVISSAEAAQEVLKTQDVIFAERPIALAAKMVLYNRDGIVFGSYGEQLRQSRKICILELLS

AKRIQSFKSVREEEVSNFISFLNSKAGTPVNLTDKLFALTNSIMARTSIGKKCKNQEDLLRCIDNIFEEA

TVFSPADAFPSFTLLHVITGVKSRLERLHQQTDKILEDIVSEHKATMAATENGDRNLLHVLLDLQKNGNL

QVPLTNNIIKAIILTIFIGGSDTSAKTVEWVMSELMHNPELMKKAQEEVRQVFGEKGFVDETGLHELKFL

KSVVKETLRLHPVFPLVPRECREVTKVNGYDIYPKTKVLINVWAIGRDPDIWSDAEKFNPERFLESSIDY

KDTSSEMIPFGAGKRVCPGMSLGLLILELFLAQLLYHFDWKLPDRVTPENFDMSEYYSSSLRRKHDLILI

PIPVLPLPIE

 

>CYP71D333 gi|255583073|ref|XP_002532304.1  Ricinus communis

gi|223528006|gb|EEF30088.1  Ricinus communis

56% to CYP726A1 Euphorbia lagascae, 58% to CYP71D43 cottonwood

MEQQILSFPVLLSFFLFIFMVLKIRKKYNKNISPPPGPWKLPILGNIHQLISPLPHHRLRDLAKIYGPVM

SIKLGEVSAVVISSAEAAKEVLRTQDVSFADRPLGLSAKMVLYNGNDVVFGSYGEQWRQLRKICILELLS

AKRVQSFKSLREAEVSNFIRFLYSKAGKPVNLTRKLFALTNTIMARTSVGKQCENQEVLLTVIDRIFEVS

GGFTVADVFPSFTLLHLITGIKSRLERLHQDTDQILEDIINEHRACKAVSKNGDQNEADNLLDVLLDLQE

DGNLRVPLTNDSIKGTILDMFAGGSDTTSKTAEWAVSELMFNPKAMKKAQEEVRRVFGQKGIVDESGFHE

LKFLKLVIKETLRLHPALPLIPRECMNKSKINGYNIDPKTKVLINVWAIGRDSNIWPEAEKFYPERFLDS

SIDYKGTSYEFIPFGAGKRICPGMMLGTTNLELFLAQLLYHFDWQFPDGVTPETFDMTEAFSGSINRKYD

LNLIPIPFHPLRVE

 

>CYP71D334 gi|255564948|ref|XP_002523467.1  Ricinus communis

gi|223537295|gb|EEF38926.1  Ricinus communis

59% to CYP71D34 cottonwood, 54% to CYP71BE1   Vitis vinifera

46% to CYP726A1   Euphorbia lagascae

59% to XP_002522721.1, 57% to XP_002522762.1

59% to XP_002530922.1

MELPFPSLPLFFPLLFIFTVFLIMKKSNIHKLPLPPGPWKLPIIGNIHNVLGSLPHHSLHNLAKKFGPIM

HLQLGEVNAIIVSSPEIAKEIMKTHDVIFASRPFVVALKIIFGNTTDVAFAPYGEFWRQMRKICVVEILS

AKRVQSFRPIREEE

ILNAIKEITCSEGSMVNISKVLLSYAYNVILRAAFGKITEEQEALIPLIKDAAEVS

AGFSIADLFPSIKLIHNLDGMRSRTERAY

QEADKIIDTVINYHKLRRKASSNKISDQESNDLIDVLLNIQ

EQENLDFTLTTENLKGVILDVFLGGTETSSTVIEWALSEMMKNPRVMEKAQVEVRRAFGKKEYVDEESLG

ELNYLKLVIKETLRLHPPLALLLPRESREECEINGFPIPNKSKVIVNAWAIGRDPKYWSEAESFIPERFS

DGTVDYRGANFEFIPFGSGRRMCPGITFGMVNIEVPLANLLYYFDWKLPDGMKPEDIDMTEAAGTSVRRK

NSLNLVPIVRHPLPSVV

 

>CYP71D335 gi|255547540|ref|XP_002514827.1  Ricinus communis

gi|223545878|gb|EEF47381.1  Ricinus communis

57% to CYP71D26, 53% to CYP71BE1   Vitis vinifera,

44% to CYP726A1 Euphorbia lagascae, 67% to XP_002514826.1

57% to XP_002522762.1, 61% to XP_002513345.1

MSLSPEFQSPFMDFHFPIVFITLLLMFAVLKIWIKQSKTSNSAALNLPPGPFQLPIIGNIHQLAGHVTHH

RMRDLAEKYGPVMLLQVGDLTTIVISSAETAKQVLKTHDLFFAQRPNILAAQIITYNNQDIGFAPNGPYW

RQLRKLCSLQLLHVKRVQSFRPIREEEVSNIISVISSTGGSPINLSELIRTFTYRLISRTAFGKIWDGEE

EYLTAMKKILMELGKCATLADVFPSIKLLRMINRGSRIKVEKHFEKVDKKFQNILNEHRARKGFANSAGA

ESEKVEDEDLVDVLLDLQKKGELEFPLMDENIKAVIMDMFFGGTDTSSATIEWTMSELIKNQRVMEKAQA

EVRQIFGAKGDVDEAGLHQLIYLKLVINETLRLHPPAPMLLPRECIANCVINGYDIPTMSKVIINAWAIG

RDPRYWVEPEKYNPERFLCDSIDHKKTNFEFLPFGGGRRMCPGISFGMATVELPLARMLYHFDWKLPEGQ

NPENLDMTEYLGVAGRRKNDLYLIPSPCIPPTFK

 

>CYP71D336 gi|255547538|ref|XP_002514826.1  Ricinus communis

gi|223545877|gb|EEF47380.1  Ricinus communis

MNLPMIYISTLLFIFMILRIIWKKSKTRNSTTLNLPPGPFQLPIIGNIHQLVGYVPHLRVTDLAKKYGPV

MRLQLGEFTITVLSSAETAREVLKTHDLNFSQRPNLIGTDLISYNNKDIGYSPEGPYWRQLRKLCMLQLL

SAKRVQSFRTIREEEVSKLISSISSNAGSPIHLRKLINALTFRIISRAAIGKIWKTEEEYVTSMEKLLIE

LAKGPSLADVFPSIKFFKVISRVMMKVKLEKHFKQVDKIFQDILEEHRATRGLGSVESEKEDDLIHVLLD

LQNKGELEFPLMDENIKAVIMDMFIGGTSTSVEVIEWTMSELIKNPRVMEKAQAEVREMFGAKGNVDEEG

VHNLNYLKLVIYETMRLHPPAPLVPPRECKENCVINGYDIPAKSNVILNLWALGRDPRYWNEADKFNPER

FLDDSVDNKKNNFEYLPFGGGRRICPGNLFAMAIVELPLAQLLYHFNWRLPAGQSPENLDMTDQQSLAGC

RKNRLCLVPNPYFP

 

>CYP71D337 gi|255544540|ref|XP_002513331.1  Ricinus communis

gi|223547239|gb|EEF48734.1  Ricinus communis

54% to CYP71D38, 54% to CYP726A1 Euphorbia lagascae

MDKQILSYPVLLLSFLLFILMVLRIWKKSKGSFNSPPGPWKLPLIGNMHQLITPLPHHRLRELAKTHGPV

MSIQLGQVSAVVISSVEAAKQVLKTQGELFAERPSILASKIVLYNGMDIIFGSYGDHWRQMRKICTFELL

SPKRVQSFSSVRQEELSNYVRFLHSNAGSPVNLSKTLFALTNSVIAKIAVGKECKNQEALLNLIEEVLVA

AGGFTVADSFPSYNFLHVITGMKSNLERLHRITDKILEDIITEHKAPRALFKRGGDEDKKEAENLLDVLL

GLQEHGNLKVPLTNESVKSAILEMLSGGSDTSAKTIEWAMSELMRSPEAMEKAQEEVRRVFGELGKIEES

RLHELKYLKLVIKETLRLHPALALIPRECMKRTKIDGYDISPKTKALVNVWAIGRDPSVWNEPEKFFPER

FVDSSIDFRGNNFELLPFGSGKRICPGMTLGLATVELFLSYLLYYFDWKLVGGVPLDMTEAFAASLKRKI

DLVLIPISVGPSPTTD

 

>CYP71D338 gi|255544544|ref|XP_002513333.1  Ricinus communis

gi|223547241|gb|EEF48736.1  Ricinus communis

73% to XP_002513339.1, 70% to XP_002513337.1, 70% to XP_002532304.1

73% to XP_002513335.1, 69% to XP_002513342.1, 68% to XP_002513331.1

65% to XP_002532302.1, 64% to XP_002532303.1

56% to CYP726A1 Euphorbia lagascae, 58% to CYP71D41 cottonwood

MEQQLLSFPALLSFLLLIFVVLRIWKQYTYKGKSTPPPGPWRLPLLGNFHQLVGALPHHRLTELAKIYGP

VMGIQLGQISVVIISSVETAKEVLKTQGEQFADRTLVLAAKMVLYNRNDIVFGLYGDHWRQLRKLCTLEL

LSAKRVQSFKSVREEELSNFVKFLHSKAGMPVNLTHTLFALTNNIMARTSVGKKCKNQEALLSIIDGIID

ASGGFTIADVFPSVPFLHNISNMKSRLEKLHQQADDILEDIINEHRATRNRDDLEEAENLLDVLLDLQEN

GNLEVPLTNDSIKGAILDMFGAGSDTSSKTAEWALSELMRHPEEMKKAQEEVRRIFGEDGRIDEARFQEL

KFLNLVIKETLRLHPPVALIPRECREKTKVNGYDIYPKTRTLINVWSMGRDPSVWTEAEKFYPERFLDGT

IDYRGTNFELIPFGAGKRICPGMTLGIVNLELFLAHLLYHFDWKLVDGVAPDTLDMSEGFGGALKRKMDL

NLVPIPFTTLP

 

Note XP_002513332.1 is a short chain dehydrogenase

XP_002513334.1 is a terpene cyclase

XP_002513338.1 is an Omega-hydroxypalmitate O-feruloyl transferase

XP_002513340.1 is a terpene cyclase

XP_002513341.1 is called: Isoprenoid Biosynthesis enzymes, Class 1

This looks like a biosynthetic gene cluster with 6 P450s

 

>CYP71D339 gi|255544548|ref|XP_002513335.1  Ricinus communis

gi|223547243|gb|EEF48738.1  Ricinus communis

59% to CYP71D41 cottonwood, 58% to CYP726A1 Euphorbia lagascae

MSLQPAPVSQSNFLYKKVPPILRAPTTKSSGSSRSSFFSSSVKLAARPPQPQACLSLNKNDDSNTSASSL

PPGPWKLPLLGNIHQLVGALPHHRLRDLAKAYGPVMSVKLGEVSAVVISSVDAAKEVLRTQDVNFADRPL

VLAAEIVLYNRQDIVFGSYGEQWRQMRKICTLELLSIKRVQSFKSVREEELSNFIRYLHSKAGTPVNLTH

HLFSLTNSIMFRISIGKKYKNQDALLRVIDGVIEAGGGFSTADVFPSFKFLHHISGEKSSLEDLHREADY

ILEDIINERRASKINGDDRNQADNLLDVLLDLQENGNLEIALTNDSIKAAILEMFGAGSDTSSKTAEWAL

SELMRHPEEMEKAQTEVRQVFGKDGNLDETRLHELKFLKLVIKETLRLHPPVALIPRECRQRTKVNGYDI

DPKTKVLVNVWAISRDPNIWTEAEKFYPERFLHSSIDYKGNHCEFAPFGSGKRICPGMNLGLTNLELFLA

QLLYHFNWEFPDGITPKTLDMTESVGAAIKRKIDLKLIPVLFHP

 

>CYP71D340 gi|255544552|ref|XP_002513337.1  Ricinus communis

gi|223547245|gb|EEF48740.1  Ricinus communis

52% to CYP726A1 Euphorbia lagascae, 55% to CYP71D41 cottonwood

MESAAHQSYFHMFLAMEQQILSFPVLLSFLLFIFMVLKVWKKNKDNPNSPPGPRKLPIIGNMHQLAGSDL

PHHPVTELSKTYGPIMSIQLGQISAIVISSVEGAKEVLKTQGELFAERPLLLAAEAVLYNRMDIIFGAYG

DHWRQLRKLCTLEVLSAKRIQSFSSLRQEELSHFVRFVHSKAGSPINLSKVLFALTNSIIARIATGKKCK

NQDALLDLIEDVIEVSGGFSIADLFPSLKFIHVITGMKSRLEKLHRITDQVLEDIVNEHKATRAASKNGG

GDDDKKEAKNLLDVLLDLQEDGSLLQVPLTDDSIKAAILEMLGGGSDTSAKTTEWAMSEMMRYPETMKKA

QEEVRQAFGNAGKIDEARIHELKYLRAVFKETLRLHPPLAMIPRECRQKTKINGYDIYPKTKTLINVYAI

GRDPNVWSEPEKFYPERHLDSPIDFRGSNFELIPFGAGKRICPGMTLAITTVELFLAHLLYYFDWKFVDG

MTADTLDMTESFGASIKRKIDLALVPIPVSPLP

 

>CYP71D341 gi|255544556|ref|XP_002513339.1  Ricinus communis

gi|223547247|gb|EEF48742.1  Ricinus communis

60% to CYP726A1 Euphorbia lagascae, 58% to CYP71D41 cottonwood

MEKQILSFPVLLSFVLFILMILRIWKKSNPPPGPWKLPLLGNIHQLAGGALPHHRLRDLAKTYGPVMSIQ

LGQISAVVISSVQGAKEVLKTQGEVFAERPLIIAAKIVLYNRKDIVFGSYGDHWRQMRKICTLELLSAKR

VQSFRSVREEEVSEFVRFLQSKAGTPVNLTKTLFALTNSIMARTSIGKKCEKQETFSSVIDGVTEVSGGF

TVADVFPSLGFLHVITGMKSRLERLHRVADQIFEDIIAEHKATRALSKNDDPKEAANLLDVLLDLQEHGN

LQVPLTNDSIKAAILEMFGAGSDTSSKTTEWAMSELMRNPTEMRKAQEEVRRVFGETGKVDETRLHELKF

LKLVVKETLRLHPAIALIPRECRERTKVDGYDIKPTARVLVNVWAIGRDPNVWSEPERFHPERFVNSSVD

FKGTDFELLPFGAGKRICPGILVGITNLELVLAHLLYHFDWKFVDGVTSDSFDMREGFGGALHRKSDLIL

IPIPFTP

 

>CYP71D342 gi|255544562|ref|XP_002513342.1  Ricinus communis

gi|223547250|gb|EEF48745.1  Ricinus communis

56% to CYP726A1 Euphorbia lagascae, 58% to CYP71D41 cottonwood

MSSQPAVLQSNFLNRNVQPFLTIPSASTKYSGTACFSSFPSVKLNARPPQACFSLNKNNDHSTPTSILPP

GPWQLPLIGNIHQLVGHLPHSRLRDLGKIYGPVMSVQLGEVSAVVVSSVEAAKEVLRIQDVIFAERPPVL

MAEIVLYNRHDIVFGSYGDHWRQLRKICTLELLSLKRVQSFKSVREDEFSNFIKYLSSKAGTPVNLTHDL

FSLTNSVMLRTSIGKKCKNQEAILRIIDSVVAAGGGFSVADVFPSFKLLHMISGDRSSLEALRRDTDEIL

DEIINEHKAGRKAGDDHDEAENLLDVLLDLQENGDLEVPLTNDSIKATILDMFGAGSDTSSKTAEWALSE

LMRHPEIMKKAQEEVRGVFGDSGEVDETRLHELKYLKLVIKETLRLHPAIPLIPRECRERTKINGYDVYP

KTKVLVNIWAISRDPNIWSEADKFKPERFLNSSLDYKGNYLEFAPFGSGKRVCPGMTLGITNLELILAKL

LYHFDWKLPDGITPETLDMTESVGGAIKRRTDLNLIPVLYPTH

 

>CYP71D343P gi|255544568|ref|XP_002513345.1  Ricinus communis

pseudogene

gi|223547253|gb|EEF48748.1  Ricinus communis

59% to CYP71D26, 55% to CYP71BE1 Vitis vinifera,

44% to CYP726A1 Euphorbia lagascae, 61% to XP_002514827.1

AASG02001763

ELQLPSLDFPVIFISIFFIFIVFKIWKESKSKSSTLNLPPGPLQLPIIGSMLHLAG

YLPHRRLAELAKKHGPVMLVQVGELSNV &

VITSAEAAKEVMKTHDVVFAQRPT

VFAASIIAYDNKDIAFAPNGPYWRQLRKMCAMELLSAKRVQSFRSIREEEVSAMIQSIYSSAGSPVNITK

FINALTYRVISRAAFGKVWNGEEEFLSAVEQIMLEVGKGVSLADVFPSIKLLRAMSGMKGRVEKLFKQVD

FVFQSILTEHKVSRKELGAEREKEGEDLIHVLLDLQKQEDLEFPLTDENIKAVIMDIFVAGTDTSATTIE

WTISELMRNPRVLQKAQEEVRRVFGEKGNVDEAGLHHLSYVKMVLSEALRMHPPAPLVLPRESKEHCVVQ

GYDIPAKSKVMVNAWAIGRDPKSWTEPDEFYPERFINSSVDFKGANYEFIPFGAGRRICPGLLFGVAAVE

LPIAQLLYHFDWIIPGGVKPENLDMTEDFGAAVRRKNDLILIPNPYINSAFHG

 

CYP71AN

 

>CYP71AN23 gi|255582142|ref|XP_002531865.1  Ricinus communis

gi|223528473|gb|EEF30502.1  Ricinus communis

58% to CYP71AN5 cottonwood

MNPITFLQERWQQQGKTALSNPFFFCSLILISILILSKPKKSSSKLNPPPSPPKLPIIGNLHQLSALPYR

SFRTLSKKYGPLMLLHLGQVPTLVVSSMEMAKEITKNHDVTFADRPSLTGVGIVFKGCPDMAFGPYCDHS

REAKKLCVLQLLSQRRVQEFHFIREEEVAKIVEKIRSSSINGDAINISDMFMSLAHNILSRSAFGPIYEG

ENGRYKSIGELARRTMDILSAFCFKDLFPFLGWVDHLTGLIRNLKMTSTELSDFFDRVIQDRQALMNDNE

KAENKKYLVDILLQLQKEGLELDLSRDNLKAILMDMFVGGTDTTAATMEWMMAELMKNPRIRKKAQEETR

RVVGKKSQITQADINQMRYLRCIMKEIVRFHASAMMPRQTSASVKLQGYDIPAKTRVLINTWAIQRDHNL

WDRPEEFLPERFLNSPDDDSGNDEHKQILFSFGTGRRVCPGMSYAYAEVEYALASLLYWFDWELPDGQSG

ENLDMSEVYTFVIFKKTPLWVVAHPPSP

 

CYP71AP

 

>CYP71AP11P gi|223550411|gb|EEF51898.1  Ricinus communis

gi|255540463|ref|XP_002511296.1  Ricinus communis

pseudogene

81% to CYP71AP4 cottonwood

note: inside the CYP71BF cluster

AASG02000746.1

gi|223550410|gb|EEF51897.1  Ricinus communis (red part)

gi|255540461|ref|XP_002511295.1  Ricinus communis

VQSFSYVREEEVARLVSRITESSPGTVNFSKMVGLYAN

DVLCRVALGRDFSQGGEYDQHGFHKMLEDYQELLGGFSLGDYFPSMEFVHSLTGMKSKLVNTFRRFDQFF

DEVISEHLNSEEKQEEQKDLVDVLLDLQKNGSADMPLTMDNIKAAIL (0)

*YIVAGTGTTFTTLDWAMTELIMSPRV

MEKAQAEIRRIVGERRVVQEGDLPRLHYMKAVIKEIFRLDPAVPVLIPRESMEEVIVDGYKIPTKSRIYV

NAWAMGRDPEVWVNP*TFKPERCMG

SSIDFKGQDFELIPFGAGRRSCPAITFATANVELALTQLLHSFDWELPPGVKAHDIDNTE

AFGISMHRMVPLHAIA

 

CYP71BF

 

>CYP71BF3P gi|255567289|ref|XP_002524625.1  Ricinus communis

pseudogene

gi|223536094|gb|EEF37750.1  Ricinus communis

50% to CYP71AU2 Lycopersicon esculentum, 46% to CYP71AQ1 cottonwood

88% to CYP71BF gi|223550412|gb|EEF51899.1

AASG02017726.1

STRIGRMLLYDSKDVATTPYGEYWRQTESVCVLHLLSNIRVQSYTKIRKEETPLIIETVKSYCTSSTPLNISDVII

KVTNHVVSRIALGRKYSPIEGGRTFKELLGEFLSLLG GFDV &

GDYIPWLEWVNRVNGLYGKVEKVAKELDNFLEEVVKEHIASGSHN*DN

NSKNFVDVLLWIQKENLAGFHIN

 

>CYP71BF4P pseudogene EEF51902.1

AASG02000746 ~43 kb region, 53% to EEF51895.1

SSIDYKAHDFQLIQFGAGRRGCLGITFAAAAVIEISLASFLHKLDWKMHGGAKVEHLNVK

ETPSMSVHRKLPLVAVATPYS

 

>CYP71BF5 gi|223550414|gb|EEF51901.1  Ricinus communis

gi|255540469|ref|XP_002511299.1  Ricinus communis

52% to CYP71BF1 Carica papaya, 51% to CYP71AQ1 cottonwood

67% to EEF51900.1, 55% to EEF51895.1, 53% to EEF51896.1, 52% to EEF51899.1

MSSIIQSLEQQVTSIDPFYVSIFSFVFFTYFLIKWLICPASTHKNLPPSPPKLPILGNLHQVGGYLHRSL

LSLARRYGPDLMLLHFGIKPALVVSSSDAAREIMKTHDLAFSNRPKFGSIGKLLYNHKDVAGGLYGDHWK

QMKSVLVHHVLSNRRVQTYRSVREEEVACLIEKIQDLCSSSSPVNLSKMFSSFTYDVICRISFGRKYDSG

DRGESGKIFQKLLGDLMILLGSFDLREFIPWLGWVISWVNGFDAYVDRTAKGLDKFIDGIVEEHINSLER

KAHSDVSKEYVKDFVQVLVELQKDTNMGANLDRESIKALILDIFAGGSDTTYTVLEWTMTEIIRHPRVMK

ELQNEVKRISDENSVITRITEADLNKMHYLKLVIKESLRLHTPFPLLAARETIQDVKIMGYDIAAGTMVL

TNAWAMARDPKTWTKPEEFWPERFLNSCVDFKGHDHEFIPFGSGRRGCPGISFSMSIIELVLANLVKNFE

WVLPEGTNVEDLDMTESIGMTTSRKNPLIAVAIPISK

 

>CYP71BF6 gi|223550413|gb|EEF51900.1  Ricinus communis

gi|255540467|ref|XP_002511298.1  Ricinus communis

54% to CYP71BF1 Carica papaya

MLDIIQFINQQISFLNPLYLTIAVLSFLFFAYFLIKWLTSSPHRNPPPSPPKLPILGNLHQLGKNIHRSL

SSLAQRYGPDLMLLHFGSKPVVVVSSSDAAREIVKTHDIAFSSRPTTAVYRRLLYNNKDVAGAPYGEYWR

QMRSICVLHLLSNRRVQSYRSVREEEVGVLIEKIKQFSSKSLPVNLSQMLSCLTNDVISRIAFGRKYSGD

DGEDGIKFQRLLGDFMRLLGSFSVGEYIPFLGWINWINGLNKSVDRTAKELDEFIDAIVEEHMDGFSSEG

SEEDVKDFVHVLLELQKEYGVGGSLDRESIKALILDVFAGGTDTSSTVLEWIMTELIRHPRVMKELQNEV

KRVAREKASTSHITEADLDKMHYTKLVIKEALRLYSPLPLLGPRETIQDVKVMGYHIAAGTMVLTNGWAI

SRDPKTWTKPEEFWPERFLNNSIDFRGHDFEFIPFGTGRRGCPGVSFALPVVELVLANLVKNFEWALPDG

AKGEDLDLAETFGVTIHRKNPLLALATPTSD

 

>CYP71BF7 gi|223550412|gb|EEF51899.1  Ricinus communis

gi|255540465|ref|XP_002511297.1  Ricinus communis

56% to CYP71BF1 Carica papaya

MSSYRGTFSLLLPLFLTISALSFIIILLKKLSQLNKSLSVPPSPPKFPIVGNLHQIGLHPHRSLRSLAQT

HGPIMLLHLGSVPVLVISSANMAREIMKTHDLVFADRPSTRISRMLLYDNKDVAAAPYGEYWRQTKSVCV

LHLLSNRRVQSYTKIREEETALMIETVKSYCSSSTPLNISDLIIRVTNHVVSRIALGRKYSPIEGGRTFK

ELLGEFLSLLGGFDVGDYIPWLEWVNRVNGLYGKVEKVAKELDNFLEKVVEEHIASGSLDKDNNSRDFVD

VLLWIQKENLAGFPIDRTCIKAIILDVFAAGTDTTYTVVEWALTELLRHPEIMKRVQNELREIARDKSFI

TENDLSKMQYLKAVIKETLRLHPPIPLLVPRISMQDVKLKGYDIPARTQVIVNAFAIGRDPELWERAEEF

WPDRFLNSSIDFKGQDFELIPFGSGRRICPGVQFAMSTDELALANLLYKFDWALHGVAKGENLDTAECTG

LTIHRKFPLFAVATPYDC

 

>CYP71BF8 gi|223550409|gb|EEF51896.1  Ricinus communis

gi|255540459|ref|XP_002511294.1  Ricinus communis

55% to CYP71AQ1 cottonwood, 57% to CYP71BF1 Carica papaya

MWNFLTQFFGHYNGTSFSLTVSLIFIALTLIIFLFNSSQKKSLPPSPPTLPIIGNLHQLGFHPHRSLRSM

AQTHGPIMLLHLGTLPTLVISSAEMAREVMKANDLVFSDRPTSRISKKLLYDYKDIAGAPYGEYWRQMKG

ISVVHLLSSKRVQSFNNVREEETACMIEKIQKSSDSSSPVNLSEVLAALTNDVVCRVALGRKQITTKQGR

KFEELLGDFVELMGFNFGSYIPWLSWIDQANGVNAKVERVAKELDDFLDGIIEAHMCNEPRGEDNKDFVD

VLLSIQKENMSGFPIDLTSIKAIILDVLAAGTDSTYTLLEWAMTELLKHPGMMKKVQSEVREIVNERSVI

TANDLERMLYLKAIMKETFRFHPPLPLLVPRVSTQDVRIKGYDIATGTQAIINAWAIGRDPAVWDRAEEF

WPERFLNSSVDYRGHDFQLLPFGGGRRICPGIQFATSLEELALANLLHKFDWALPDGVKEDDLDMTESVG

LTVHRKFPLLAVATPHFH

 

>CYP71BF9 gi|223550408|gb|EEF51895.1  Ricinus communis

gi|255540457|ref|XP_002511293.1  Ricinus communis

58% to CYP71BF1 Carica papaya

MSNFLQLSEQHENFTLSLAFLALSFVIFLLKWSPLSSSKKFLPPSPPKFPIIGNLHQVGLHPHRSLRYLA

QTHGPVMLLHLGSVPVLVISSAEMACEVIKTHDRVFADRPRSSISEKLLYHRKDIAAAPYGEYWRQMKGL

SVLHLLSTKRVQSFSHVREEETDYMIDRVNRFYSSSSTPLNLSEILATLTNDVVCRVALGRKHIATKGGI

NFKELLGEFVELLGFNIGTYIPWLAWINHVNGVNSRVERVAKELDNFLDGVVEEHMSSDRRDDYSKDFVD

VLLWVQKENMAGFPIDRISIKAFILDVFSAGTDSTYTVLEWTMTELLRHPKIMKRLQNEVREIANSKSRI

TPDDLNKMQYLKAVIKETLRLHPPLPLLVPRVSTQDVKLKGFDIAAGTQILINAFAIGRDPASWDRPEEF

WPDRFLDSSIDFKGHDFQLLPFGTGRRACPGIQFAISIEELALANLLYKFEWALPSGAREEDLDMTESIG

LTTHRKSPLLAVATPYSHQQ

 

>CYP71BF10P gi|223550406|gb|EEF51893.1  Ricinus communis

pseudogene ~13 kb

gi|255540453|ref|XP_002511291.1  Ricinus communis

50% to XP_002535120.1, 47% to CYP83F5 cottonwood, 54% to CYP71AH1 tobacco

AASG02000746 has 8 genes in a cluster all on the minus strand

43 kb new, 39 kb EEF51901.1, 34 kb EEF51900.1, 30 kb EEF51899.1,

25 kb EEF51898.1, EEF51897.1(part of 1898.1 pseudogene,

21 kb EEF51896.1, 18 kb EEF51895.1

IYLKSVIRESVIAYPPTLLLVP*KFL*DCEI*EYEMSKKIRVFINATSIFLDTNLWENSSEFRPERFLNN*IDFS

GQDFELIPFGVGRRGCPGMNLGVMLIELALANLLYCHDRGLPDGIRIEDMDM &

RAIGITMHKKNHLCLVA

 

CYP71BG

 

>CYP71BG7 gi|255547910|ref|XP_002515012.1  Ricinus communis

gi|223546063|gb|EEF47566.1  Ricinus communis

70% to CYP71BG1 Solanum tuberosum

MEALTPQVLISLVLFLFTIFIYYAWNAARPKPATPPSPPALPVIGHLHLLTDMPHHTFADLSNSLGPLIY

LRLGQVPTIVIHSAHLAKLVLRTHDHAFANRPQLISAQYLSFGCSDVTFSSYGAYWRQARKICVTELLSA

KRVHSFRLVRKEEVDRLLDAVLTSSGKEVDMSQMLFCLANDVLCKVAFGRRFMAEKDGKGKNLGSVLMET

QALFAGFCLGDFFPKWEWVNSMSGYRKRLLKNLKDLKEVCDEIIEEHLKKKKKKNGTENADDDDDYNEKE

DFVDVLLRVQKREDLEVPITDDNLKALVLDMFVAGTDTSSATLEWVFTELARHPRVMKKAQEEVRMIASG

NGKVDESDLQHLHYMKAVIKETMRLHPPVPLLVPRESMEKCALDGYEIPAKTRVLINTYAIGRDPKSWEN

PLDYDPERFMEDDIDFKDQDFRFLPFGGGRRGCPGYSFGLATIEITLARLLYHFDWALPHGVEADDVDLS

EVFGLATRKKTALVLVPTANKDFQFRGHDF

 

CYP73A

 

>CYP73A104 gi|255565927|ref|XP_002523952.1 cinnamate 4-hydroxylase Ricinus communis

gi|223536799|gb|EEF38439.1 cinnamate 4-hydroxylase Ricinus communis

93% to CYP73A43 cottonwood

MDPLLLEKTLLGLFAAVIVAIVISKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNQRNLADLAKKFGDILL

LRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTN

KVVQQYRYGWEDEAARVVEDVKKNPESATNGIVLRRRLQLMMYNNMYRIMFDRRFESEEDPLFVKLRALN

GERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVDERKKLGSTKSMNNEGLKCAID

HILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGNQITEPD

TYKLPYLQAVVKETLRLRMAIPLLVPHMNLHDAKLSGYDIPAESKILVNAWWLANNPANWKNPEEFRPER

FLEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTTEKGGQFSL

HILKHSTIVAKPRSF

 

>CYP73A105 gi|255589539|ref|XP_002534996.1 cinnamate 4-hydroxylase Ricinus communis

gi|223524224|gb|EEF27388.1 cinnamate 4-hydroxylase Ricinus communis

80% to CYP73A43 cottonwood

MGNLAAKSRILCSLIAIALAVLFTKFACPDLLKHVSLSPTSVIVPLLLLACLFTFSFNHPTNLPPGPFSI

PIFGNWLQVGNDLNHRLLASMSQSYGSIFLLKLGSKNLAVVSDPELATQVLHTQGVEFGSRPRNVVFDIF

TGNGQDMVFTIYGDHWRKMRRIMTLPFFTNKVVHHYSNMWKQEMDLVVRDLRDNDKVSGQGIVIRKRLQL

MLYNIVYGMMFDARFQSQDDPLFIEATRFNSERSRLAQSFEYNYGDFIPLLRPFLRGYLKKCRDLQQRRL

AFFNNNFVQRRRKIMAANGDKHKISCAIDHIIDAEMKGEINEENVLYIVENINVAAIETTLWSMEWAIAE

LVNNPTVQQKIRDEISIVLKGNRITESNLHELPYLQATVKETLRLHTPIPLLVPHMNLEEAKIGGFTIPK

ESKVVVNAWWLANNPEWWKNPEQFRPERFLEEELQTEAVAGGKVDFRYLPFGMGRRSCPGIILALPILGL

VIAKLVSNFEMKAPIGTGKIDVSEKGGQFSLHIANHSTVVFHPIHA

 

CYP75A

 

>CYP75A53P gi|255570211|ref|XP_002526066.1 flavonoid 3-hydroxylase Ricinus communis

gi|223534647|gb|EEF36343.1 flavonoid 3-hydroxylase Ricinus communis

AASG02000160.1 pseudogene

gi|223534646|gb|EEF36342.1  Ricinus communis

gi|255570209|ref|XP_002526065.1  Ricinus communis

AASG02000160.1

71% to CYP75A12 cottonwood

MALSIVILSEMAITTILFFITHFFICSLLRKPSRPLPPRPKGWPIIGALPLLGTMPHVKLAELTK &

KYGPIMHLKMGTCGMVVASTLDAARAFLKTLDLNFSKCFVDARAIHLAYNAQDMV

FNPFSLKLLRKLSNLHMLGGKALEDWAQVRAIELGHMVQAMCDTSQKGEHVVVPEMLA

YALANMIGQVILGRRVFVTKGSESNEFKDIV &

VELMTSAGFFNIGHFVPSIAWMDLQRIGTGMKKLHKKFDVSLK &

KKMMEEYMATAHHPKGKRDFLDI &

LMVNRENSNGERLSITNIKALLL (0)

NLFTAGTDASSSIIEWALSEMFKNPSILKRAHDEMDQVIG*NWRLEESNILKL &

YL*AICKETFRKHPSTPLILPRELTQACEMNGYYIPKNTKLIVNI*AIGRDPNVWKN

PLEFTPKKFLIEKYAKINLIGSDFELIPFGAGRRSCVGIRM

GIVPVEYILGTIVHFFDWKITNGVDRFNMDEAFGLALQKAVPFSARVNPRLAPSACTR*

 

CYP75B

 

>CYP75B63 gi|255547215|ref|XP_002514665.1 flavonoid 3-hydroxylase Ricinus communis

gi|223546269|gb|EEF47771.1 flavonoid 3-hydroxylase Ricinus communis

70% to CYP75B1   Arabidopsis thaliana
AASG02000095.1
MSSLILYSILFAIFLYFFHRFRSLLLPGSRPLPPGPKPWPIVGNLPHLGPKPHQT

MAALAQVYGPLMHLRMGFVDVIVAASASVAAQFLKTHDVNFSSRPTNAGAKYVAYNHQDLVFAPYGPRWR

LLRKISSVHLFSAKALDDFRHVREQEVGILTHALADACETPINLGRLLNTCTTNALGRVMIGRRVFGDGS

GGGDAKADEFKSMVVELMKLAGVFNIGDFVPAVEWLDLQGVAAKMKKLHKKFDAFLSEMVEEHKTSGSDG

SEKHTDMLSTLVSLKEEDDGEGGKLTDIEIKALLLNMFIAGTDTTSSTVEWAIAELIRHPKILTQVRQEL

DSVVGRDRLVTEVDIAQFTYLQAVVKEVLRLHPSTPLSLPRMATESCEINGFHIPKGSTLLVNVWAIARD

PKIWTNPLEFQPERFLPTGEKSNVDVKGNDFELIPFGAGRRICAGMNLGLRMVNLLIATLIHAFDWELEN

GLKAEELNMEEAYGLTLQRLVPLIVRPRPRLSPNVYGALST

 

CYP76

 

CYP76A

 

>CYP76A27 gi|255575487|ref|XP_002528645.1  Ricinus communis

gi|223531934|gb|EEF33748.1  Ricinus communis

54% to CYP76A3   Petunia

71% to CYP76A8 cottonwood

MEHPSNSFISLILLSLSILFLLHRRRNSVLNSRFPPGPPGWPILGNLLDLGSVPHSTLTDLRQKYGDILG

LRLGAINTVVILSAKAASELFKNHDLTFAERFLTITMRVHGYDQGSLALAPYGSYWRVMKRLVTVDMLVS

KKINETAFVRRKCMDDMLRWIEGESYKGCGSQVARFVFLMSTNLLGNLMLSCNLVDPESREGTQFFRSIT

GLTEASGYANVADYLPWLKWLDPQGLKSKMERELGKALEIASQFVKERIEEKKLGEDKRKDFLDVLLEHE

GNGKDEPDKISDRDLNIFILEIFIAGAETTSSSIEWAMTELLCNPEPMRKAKAELASVIGANRKVEESDI

DNLPFLQAVVKETLRLHPPIPFLVPRRATQDTKFMGYHIPENTQVLVNAWAIGRDKDVWNDPLSFKPERF

MGSNVDYKGQHYEFIPFGAGRRMCAGVSLAHRILHLTLGSLLHHFDWELEANVTPDTLDMRDRLGVTMRK

LEPLLAVPKKCV

 

>CYP76A28 gi|255575491|ref|XP_002528647.1  Ricinus communis

51% to CYP76A3   Petunia

gi|223531936|gb|EEF33750.1  Ricinus communis

61% to CYP76A9P cottonwood,

MDYVTGLLILVSVLLSVALILLNLNGNHRTKSRPPGPPGWPVIGNIFDLGTMPHQTLYKLRFKYGPVLWL

RLGSKNTMVIQSAAAAEELFKNHDSSFCDRSSLDVLTSHNYCKGSLAIGRYGPFWRVLRRICTMELMTNK

RVNETAPLRRKCIDQMIKYIEENVAAASAREEATEVDLVHLLFLTAFNVVGNLTLSRDLLDPHCKEGHDF

YKAMDKFMVWVGRPNIADFLPFFKWIDPQGLKRNMNRDLGQAIRIISGFVKERIEENKLGKERKTKDFLD

VLLDFKGDGKEAPQKIPYDKVIIIVLEMFFAGSETTSTTMEWAMAELLRSPDKMKKLKEELDEVVGENNK

VEESDIDKLPYLQAVVKETLRLHPAIPLLLPRNAMQDTNFMGYHIPKNTQVFVNAWAIGRDPDSWKDPLT

FKPERFLGSNIDYKGQDFQLIPFGSGRRICVGMLLGQRVIHLGLASLIHYFDWEMGSNSNSETIDMNERT

GITVRKLDPLKLVPKKRTKLRN

 

>CYP76A29 gi|255575495|ref|XP_002528649.1  Ricinus communis

gi|223531938|gb|EEF33752.1  Ricinus communis

49% to CYP76A3   Petunia

61% to CYP76A9P cottonwood,

MIVSHLGIPMDWRSYSNLLAWLSLAFSASALLLLLKCRQSRHHHNHSPPGPPAWPIFGNIFDLGTIPHRN

LYKFRYKYGPVLWLRLGFTNTLVIQSARAAEELFKNHDISFCDRKVPDCCTAHNYDQGAVSLGRYGSIWR

FHRRLITLDLMTNKRIKESAFLRIKCINSMIQYIEEDTAAARARGELGEVVIAHYLFVMTFNLIGNLVLS

QDLANSQSNEGLEFSHAMDKITVLSGKPNATDLWPFLKMFDPQRIKRDMEREMGKALRVVEGFVRERIEE

RKLEKERSKKDFLDALLEFESDEEAGPDKISIQTMFIIILEIFFAGTETTSSTMEWAMTELLRCPESIKR

VKEELKRVVGQKRKVEESDIDQLPYLQAVLKETMRLHPTLPLLIPRNSLEDTNFMGYLIPKDTQVFVNVW

AIGRDPESWQDPNSFKPERFLESDIDYRGKNFEYLPFGSGRRICAGILLAQRVLHLGLASLLHCFDWELS

SNYTPDSIDMKEKMGMAVRKLVPLKAIPKKRMRE

 

>CYP76A30 gi|255575497|ref|XP_002528650.1  Ricinus communis

gi|223531939|gb|EEF33753.1  Ricinus communis

47% to CYP76A3 Petunia

61% to CYP76A9P cottonwood, 88% to XP_002528653.1

missing the C-term 28 aa.

MEKEMDGSYSNFLVRFTLLFVLTIVVLLKKRRPRHNAKQRPPGPPAWPIIGNIFDLGGNPHQNLYKLRFK

YGPVLWLRLGCINTLVIQSTKAAEELFKRHDISFSDRKVPQSFTAHNFNKASLALGQYDSHWRFHRRFVT

LELMTKKRVHETAAIRQKCIDNMIRYIEDDASAARARGESGELVISHHVFVLSFNLIGNLVLSRDLLNSH

SEEGTKFFDAMGKAMEWGGKPNLADFLPLLHPFDPQRVKKNMKQYLGQTIDIVERFVKQSIEEKKLMKER

ETRDFLDALLEFKGGAKEEPDAISTHDMLIIILEIFFGGTETTSGTLEWAMTELFRSPESMRRVKEELNQ

VIGPEKKVVESDIDQLPYLQAVIKEAMRLHPVVPLLIPRNTKEDTTFMGYFIRKDTQVFVNAWAIGRDPD

AWEDPLSFKPERFLGSNIDYKGQNFELLPFGSGRRICVGIPLAHRVLHLALASLLHCFDWELGSNSTPES

 

>CYP76A31P gi|255575499|ref|XP_002528651.1  Ricinus communis

gi|223531940|gb|EEF33754.1  Ricinus communis

gi|255575501|ref|XP_002528652.1  Ricinus communis

gi|223531941|gb|EEF33755.1  Ricinus communis

41% to CYP76A3 Petunia

91% to XP_002528653.1

59% to CYP76A9P cottonwood,

AASG02013841 pseudogene

TWSYSNYSLAWFTLLFSVTI

LVLLKKRRPKHDVKQRPPGPPAWPFIGDIFDLGANPHHNLYKLGIKYGPVLWLRLGYINT

MVIQSAKAAEELFRRHDISFCDRKVPQSFTACNYSKAALGLGRYDSHWRFHR*FVS

LELMTNKRINETAVLRQKCIDKMIQYI

EEDASAARARRESGELVISHYVFVMSFNLIGNLALSRDLLNSNSEEGTEFFDAMDKTMEWGGKPNLADFF

PFLQGLDPQRVKKNMEQYLGRTIDIVERFVKERIEEKKLMKERETRDFLDALLQFKGDAKEEPDSISTHS

MLIIIL (0)

EMFFGGTETTSGTI*WIMAELFRSTESMRRVKEELNQVIGPERKVVESDINQLPYLQ

AVIKEAMRLHPVIPLLVPRNTMEDTTFMGY

FIPKDTQIFVNAWAIGRDPDAWEDPLSFKPERFLDSNIDYKGQNFELLPFGSGRRICVGIPLAHRILHPA

LASLLHCFDWELGSNSTPETIDMKERLGISVRKLVPMKAIPKKILQE

 

>CYP76A32 gi|255575503|ref|XP_002528653.1  Ricinus communis

gi|223531942|gb|EEF33756.1  Ricinus communis

48% to CYP76A3   Petunia

62% to CYP76A9P cottonwood

MALSYSNYSLAWFTLLFSVTIVVLLKKRRPRHDAKQRPPGPPAWPIIGNIFDLGANPHQNLYKLGFKYGP

VLWLRLGYINTMVIQSAKAAEELFKHHDISFCDRKVPQSFTARNYCKAALALGRYDSHWRFHRRFVTLEL

MTNKRINETAVLRQKCIDKMIRYIDEDASAARARGESGELVISHYVFVMSFNLIGNLALSRDLLNSHSEE

GTEFFDAMDKAMEWGGKPNLADFLPFLQGLDPQRVKKNMEQYLGRTIDIVERFVKERIEEKKLMKERDTS

DFLDALLEFKGDAIEEPDAISTHSMLIILLEIFFGGTETTSGTLEWVMAELFRSPESMRRVKEELNQVIG

PHRKVVESDIDQLPYLQAVIKEGMRLHPVLPLLVPRNTMEDTTFMEYFIAKDTQVFVNAWAIGRDPDAWE

DPLSFKPERFLGSNIDYKGQNFELLPFGSGRRICVGIPLAHRVLHLALASLLHCFDWELGSNSTPESIDM

NERLGITVRKLVPMKAIPKKKILQD

 

>CYP76A33 gi|255575505|ref|XP_002528654.1  Ricinus communis

gi|223531943|gb|EEF33757.1  Ricinus communis

49% to CYP76A3 Petunia

91% to XP_002528653.1, 85% to XP_002528650.1, 67% to XP_002528649.1

63% to XP_002528647.1, 53% to XP_002528645.1, 88% to XP_002528651.1

89% to XP_002528652.1

61% to CYP76A9P cottonwood

MEFRYSTYSLAWFTLLFSVTIAVLLTKRRPIHDAKQTPPAPPGWPIIGNIFDLGANPHQNLYKLGIKYGP

VLWLRLGYINTMVIQSAKAAEELFRHHDISFCDRKVPQSFTACNYSKAALALGRYDSHWRFHRRFVTLEL

MTNKRINETAVLRQKCIDKMIQYIEEDASAARARGESGELVISHYVFVMSFNLIGNLAFSRDLLNSHSEE

GTEFFDAMDKVMEWGGKPNLADFLPFLQELDPQRVKKNMEQYLGRTVDVVERFVKERIEEKKLMKERETR

DFLDALLEFKGDAKEEPDSISIHSMLIIILEIFFGGTETTSGTLEWAMAELFRSPETMRRVKEELNKVIG

PNRTVMESDIDRLPYLQAVIKEAMRLHPVLPLLIPRNTTEDTTFMGYFIPKDTQVFVNAWAIGRDPDAWE

DPLSFKPERFLGSNIDYKGQNFQLLPFGSGRRICVGIPLAHRVLHLALASLLHCFDWELGSNSTPETIDM

NERLGISVRKLVPMKAIPKKKILQ

 

CYP76F

 

>CYP76F34P gi|255537169|ref|XP_002509651.1  Ricinus communis

gi|223549550|gb|EEF51038.1  Ricinus communis

pseudogene

52% to CYP76F3 cottonwood, 48% to XP_002509653.1

AASG02014786 this seq 4 kb from XP_002509652.1 CYP76F 

PYIVPRKAGVDVDMGGFAISEAARILINVWAIRKDPSLCKDPNSFVPE &

GFLGSDVKFEGRSFELLSYGGG*IICLGLPLAFKIV

 

>CYP76F35 gi|255537171|ref|XP_002509652.1  Ricinus communis

gi|223549551|gb|EEF51039.1  Ricinus communis

50% to CYP76B4 Medicago sativa

71% to XP_002509653.1

AASG02008856.1 top part 65% to CYP76F4 cottonwood

Missing I-helix to PERF, no ESTs fill the gap

AASG02014786.1 bottom part

MDLLIVFLLVLAFAHALKFVVKGSKTTRGKLPPGPSPLPIIGNLFDLGDKPHRSLAKLAKIHGPLMSLKL

GQITTVVISSSSLAKEVLQKHDLSFSNRTVVQAIQALDHHEASMPWLPVGAPWRNLRKICSFYIFTNQKL

DANQDLRCKKIQELLADVQECCCAGAVVDIGEAAFKTMLNTLSSSVFSLDLTDSSSETVREFKEAVRGIM

DELGRPNLADYFPTLRNIDPQGIKRRMRIYVGRMLDLFDHIIDERLQSRKEPGYIPANDMLDTLLSLDEN

NKEEMDRTRIKHLFV (0)

 

RFLGSRKLMLEAEILKLIPFGAGRRICPGLSLAMRMLHMMLGSLIVSFDWKLENGVT

PESMDMEDKFGITLQKAQPLKAIPIQL

 

>CYP76F36 gi|255537173|ref|XP_002509653.1  Ricinus communis

gi|223549552|gb|EEF51040.1  Ricinus communis

66% to CYP76F3 cottonwood

52% to CYP76T1 Populus trichocarpa, 51% to CYP76B4 Medicago sativa

71% to XP_002509652.1

MMDLLVGCVLSLLFTITLAQALTSISKRSKTGPGKLPPGPTPLPLVGNLFELGDKPHQSLAKLAKIHGPL

MSLKLGQITTVVISSATLAKEVLQTLDLSFANRICVQAVHAHDHHEASMPWLPVGAPWRNLRKICNSYLF

SNQKLDGNQDIRQKKIQELIADVKESCRLGAATNISHVAFKTVLSVLSSNVFSLDLTDSNSDSVREFKEV

ARCIMDEVGKPNLADYFPVLRKIDPQGVRRRTAIYFGRMLDLFDPIIDQRLELRKEEGYISANDMLDTLL

ALIEENKTEMDINSMKHLFLDLFAAGTDTTSSTLEWAMTELLRNPKTLSKARAEIKQTIGTGSLLQESDM

ARLPYLKAIIKETFRLHPAVPLLLPRKAGGDVEMNGFTIPKDAQVLVNAWAIGRDPFLWEEPELFRPERF

LESNIDARGQYFELIPFGAGRRICPGLPLAIRMLHLLLGSLIYSFDWKLEDGVTPENMDMEDRFGISLQK

AKPLIAIPNQV

 

>CYP76G11 gi|255575483|ref|XP_002528643.1  Ricinus communis

gi|223531932|gb|EEF33746.1  Ricinus communis

65% to CYP76G1 Arabidopsis thaliana

78% to CYP76G5 cottonwood

MDITIPGLILAILIWVAWGMITKERRNHDMEEQTQLPPGPRWLPIVGNMFQLGWSPHESFAKLARIHGPI

MTIWLGSMCTVVISSDRAAHDMFKNHDMVLAGRKIYEAMKGDIGNEGSIITSQYGSHWRMLRRLCSTEFF

VTSRLDAMRGVRSRCIDGMVQFIEEASGNGTQAIDVGRFFFLMSFNLIGNLLFSKDLLDPKSEKGSKFFY

HAGKVMELAGRPNIADFLPIFRWFDPQGIRRNTQLHVRKAFEIAGGFIKERIEGMENGGDGETKKKKKDF

LDVLLDFRGDDVKEKSYRFSSTTINIIVFEMFTAGTDTTTSTLEWAMAELLRNPKELKKVQAEIRSTIGS

NKKLEEKDIDNLPYLKAVIKETLRLHPPLPFLVPHMAMESCNMLGYRIPKGTQILVNVWAIGRDPKIWDD

PLIFRPERFLEPKMVDYKGHHFEFIPFGSGRRMCPAVPLASRVLPLALGSLLNSFDWVLADGLRAENMDM

SEKMGITLRKSVPLRAIPVPYKVKGYGNDVFLGPA

 

>CYP76G12 gi|255575485|ref|XP_002528644.1  Ricinus communis

gi|223531933|gb|EEF33747.1  Ricinus communis

62% to CYP76G1 Arabidopsis thaliana

73% to CYP76G4 cottonwood

MDYQFAGLLLAIWILVAWAMVTRRHHYHSKKEQAQLPPGPRWLPIVGNMFQLGLSPQQSFAKLAGIHGPI

MTIWLGSMCTVVISSNEVARDMFKNHDAVLAGRKILEAMKGEGNNEGSMITAQYGQHWRMLRRLSTTEFF

AASRLDSFQGVRSRCIDRMVQFVEEAGRNGTQAIDVGRFVFLMAFNLLGNLMFSKDLLDPKSEKGAKFFY

HAGKVMELTGRPNIADFVPIFKWFDPQGIRRNAQFHVERAFEIASGFIRERMETMENGGSDEGKKKDFLD

VLLEFRGHNEETYRFSSKTINIIIFEMFMAGTDTTTSILEWAMAELLHNPKELENVQAEIRSTIEPNNKL

EEKDIDNLPYLKAVIKEALRLHPPLPFLVPHMAMDSCKMQGYYIPKETQILVNVWAIGRDPKIWDKPLNF

KPERFLGSKMLDYKGHHFEFIPFGSGRRMCPAVPLASRILPLALGSLLYAFDWVLADGLKVSDMDMSEKI

GITLRKSIPLRAIPLPHKFKGASQ

 

CYP77A

 

>CYP77A23 gi|255580098|ref|XP_002530881.1  Ricinus communis

gi|223529534|gb|EEF31487.1  Ricinus communis

AASG02019263 runs off the contig

No ESTs to join the two parts

MPTLTISSLASYYHLFFTLLALFISGLIFLFSFRAKSKRLNLPPGPPGWPIVGNLFQVARSGKPFFQYIE

DLIPKYGPIFTLRMGTRTLIIITEAKLVHEALIERGSLFATRPRENPTRTIFSCNKFTVNAALYGPVWRS

LRRNMVQNMLSSSRIKEFHSVRESAMDKLINRLRSEAEANDGVVWVVRNARFAVFCILLAMCFGLEMEEE

TIIKVDQVMKSVLLVLNP

AASG02009610 runs off the contig

IEKRRRALQNPGSTSQAMSFSYLDTLFDLQIEGRKSSPTDPELVTLCS

EFLNGGTDTTATAVEWGIAQLIDNPDVQEKLYNEIIKTVGNRKVNEKDVEKMEYLQAVVKELLRKHPPTF

FLLTHAVSEPTTLGGYDIPTDTNIEIFSQAIGQDPKIWSNPKKFDPDRFISGNEEADITGVTGIKMTPFG

AGRRICPGLGLATVHLHLMIARMVQEFQWSAYKSDRKVDFTGKLEFTVVMKNTLRAKIKPRA

 

CYP77B

 

>CYP77B13 gi|255554949|ref|XP_002518512.1  Ricinus communis

gi|223542357|gb|EEF43899.1  Ricinus communis

71% to CYP77B1 Arabidopsis thaliana

83% to CYP77B3 cottonwood

MDWIDFLIFCSTLIFLPIWWRYWSVTGGGPKNLPPGPPGWPLVGNLFQVILQRRPFIYIVRDLRAKYGPI

FTMQMGQRTLVIVTSSGLIHEALVQRGPTFASRPPDSPIRLVFSVGKCAINSAEYGPLWRTLRRNFVSEV

TSPMRIKQCRWIREWAFENHMKRIKREALENGSVEVMSNCRLTICSVLICICFGARISEERIKNIEAVSK

DVMLMTTPKLPDFMPVLAPFFRRQMKVAKELRKKQMECLVPLIRNRRAFVEKGENPNSEMVSPVGAAYID

SLFELKPAERGPLGEQEFVTLCSEVVSAGTDTSATTIEWALLHLVLNQEIQENLYKEIVDFVGKDGLVKE

EHVEKMPYLGAIVKETFRRHPPSHFLLSHAATKETQLGGYTIPAGVNVELYTAWVTEDPDVWKDPDEFRP

ERFLNGDGVDVDVTGTRGVKMVPFGAGRRICPAWSLGTLHVNLLLARMVHAFKWLPDPTSPPDPTETFAF

TVVMKNPLKALMLPR

 

>CYP77B14 gi|255554951|ref|XP_002518513.1  Ricinus communis

gi|223542358|gb|EEF43900.1  Ricinus communis

67% to CYP77B1   Arabidopsis thaliana

83% to CYP77B4 cottonwood

MELIDLFITSLSFIFLGLWWRRCFCSGKSKNLPPGPPGWPLVGNLFQVILQRRHFIFVIRDLRKKYGPIF

TMQMGQRTLVIVTSPELIHEALVQRGPVFASRPPDSPIRSVFSVGKCAVNSAEYGPLWRTLRRNFVTELM

NPVRIKQCSWIREWAMENHMKRLQNEAFENGCVDVMELCRFTVCSILVCICFGARIPEDWIKDIDSVTKD

VMLITSPQLPDFLPIFTPLFRRQMKRAKELRKRQMECLSPLIRNRRAYVEKGENPGSSMVSAVGAAYVDS

LFGLEAPGRGRLGEEELVTLCSELFVAGIDTSTSVLQWVFLELVLNQDIQEKLYEEIVDGVGKNGAITED

TVEKMPYLNAVVKETLRVHSPAHFTLAHAATEETELGGYKIPTNVNVEFYIEWMTEDPQMWKDPGVFRPE

RFLEGDGVDVDLTGTKGTVKMLPFGAGRRTCPGLALGLLHVNLMLARMVQAFKWVPTPNGPPDPTETFAF

TVVMKNPLKAVVLPR

 

CYP78A

 

>CYP78A95 gi|255585267|ref|XP_002533334.1  Ricinus communis

gi|223526839|gb|EEF29055.1  Ricinus communis

54% to CYP78A5   Arabidopsis thaliana

74% to EEF43444.1

83% to CYP78A24 cottonwood

AASG02015329.1 runs off the contig, no ESTs extend the seq.

Missing the N-term

FAPYGVYWRTLRRIAANHLFCPKQIKAAGVQRLIIASEMVAIFKEHHHSI

TVRGVLKRASLNNMMCSVFGREYRLDSLNNEVEQLRALVDEGYDLLGTLNWTDHLPWL

SDFDPQKIRCRCSNLLPKVNRFVSRIIAEHRLPTGAVETRDFVDVLLSLQGPDKLTDADMIAVLWEMIFR

GTDTVAVLIEWILARMALHPDVQSRVQDELNKVVGKSRDVDESDISSLVYLQAVVKEVLRLHPPGPLLSW

ARLAMTDTTIDGYHVPAGTTAMVNMWAIARDPDLWADPLEFIPERFVAKDGDMEFSVLGSDLRLAPFGSG

RRTCPGKNLGLTTVTFWVATLLHEFEWVPCDDITVDLSEILGLSCEMANPLTVKLQPRRP

 

>CYP78A96 gi|255582999|ref|XP_002532268.1  Ricinus communis

gi|223528028|gb|EEF30108.1  Ricinus communis

81% to CYP78A18 cottonwood

MEHLGAALVAKDTSWWVFTLPAFLGSRNLLDGYIFLTLFLGFLSLSLLTWVFAAGGIAWRYGRNQKGHVP

IPGPKGLPFFGSLFTLSRGLAHRSLASMAWKRANSQLMAFSLGSTPVVVSSDPHTAREILTSPHFADRPI

KESAKSLMFSRAIGFAPNGTYWRLLRKIASSHLFAPRRISAHEHLRQLECAAMLRTIANEQAHNGFVSLR

KHLQFASLNNIMGSVFGKRYDLAHDSEELEELRNMVREGFELLGAFNWCDYLPWLSYFYDPLRINERCLK

LVPRVRKLVRCIIEEHRLSESRKESDSSDFVDVLLSLDGEEKLQEEDMVAVLWEMIFRGTDTTALLTEWI

MAELVLHPAIQEKLQKDVDTAAKDGSLTDAEVAKLPYLQAVVKETLRVHPPGPLLSWARLSTSDVQLSNG

MVIPSNTTAMINMWAITHDKQVWEDPLEFRPERFIDADVDVRGGDLRLAPFGAGRRVCPGKNLGLVTVSL

WVAKLVHQFKWVQDVGNPVKLGEVLKLSCEMKHPLRAVALLRK

 

>CYP78A97 gi|255572369|ref|XP_002527123.1  Ricinus communis

gi|223533546|gb|EEF35286.1  Ricinus communis

50% to CYP78A5 Arabidopsis thaliana

70% to XP_002532268.1

80% to CYP78A20 cottonwood

MDLSPTSLDSSWWVFTLPAVLQTQNLLNPFFLFFVAISFLVISLSTWFVSTGGLAWKNGRNQMGCVPIPG

PRGLPFVGSLFSLSHGLAHRTLFCMASTLSAKQLMAFSLGYTPAIVTCDPQIAREILTSPHFADRPIKQS

AVSLMFSRAIGFAPNGAYWRLLRRISSTHLFAPKRIAAHEPSRQLDCDVMLRNIYHERSFNNGVVCLRKH

LQNASLNNIMGTVFGKRYEFEEYNEEAKELKELVREGLELLGAFNWSDYLPWLDYFYDPFCIKERCLALV

PRVKKLVKQIIDEHNQSKNPKSVFDNSDFVDVLLSLDGDEKLQEHDMVAVLWEMIFRGTDTAALLTEWVM

AELVLNPEIQAKLRKEIDLVIGDRSASSIQDVDMIKLTYLQAVIKETLRVHPPGPLLSWARLSTSDVELS

NGMVIPKKTTAMVNMWAITHDPKVWEDALVFKPERFLESDVDVRGGDLRLAPFGAGRRVCPGKNLGLVMV

SLWVAKLVQHFEWVQDMANPVDLSEVLKLSCEMKHPLCAVTVPRNNE

 

>CYP78A98 gi|255547149|ref|XP_002514632.1  Ricinus communis

gi|223546236|gb|EEF47738.1  Ricinus communis

58% to XP_002514920.1

69% to CYP78A5 Arabidopsis thaliana

56% to CYP78A23 cottonwood

MVLAFTGSLTHRVLAKTSQVLKAKTLMAFSIGLTRFIISSHPETAKEILNSSAFADRPVKESAYELLFHR

SMGFAPFGEYWRNLRRISATHLFSPKRIASFAGLRAVIGQKMVAEIKGLVERDGVVEVRKVLHFGSLNNV

MKSVFGKSYEFSDKKHNVDAFELEGLVSEGYELLGSFNWSDHFPFLGWLDLQGVRKRCRNLVAKVSVFVG

KIIEEHRIRRAESGKQRAVAGDENFGDFVDVLLDLEEENRLTDSDMIAVLWEMIFRGTDTVAILLEWILA

RMVLHPDIQAKAQSEIDTVVGTSRSVCDCDLPNLPYLRAIVKETLRMHPPGPLLSWARLAIHDTHIGSYF

IPAGTTAMVNMWSITHDQQFWSEPEKFKPERFMEEDVAIMGSDLRLAPFGSGRRVCPGKAMGLATVELWL

AQLLQNFKWVPSDCGVDLTENLKLSLEMKNSLKCKAVVRVSA

 

>CYP78A99 gi|223541898|gb|EEF43444.1  Ricinus communis

gi|255555751|ref|XP_002518911.1  Ricinus communis

54% to CYP78A5 Arabidopsis thaliana

80% to CYP78A22 cottonwood

MGTQIDSLWVIALFSKCRAISSQNTAFLLFFLCMASLAMALCYWAHPGGHAWGKYFFKRGCKSKSIPGPR

GIPILGSMSLMTNLAHHKIAAMANLFKAKRLMAFSLGETRVIVTCNPDVAKEILNSSVFADRPVKESAYG

LMFNRAIGFAPYGVYWRTLRRIAATHLFCPKQISSTEAQRSDIGSQMVSRIACHKGELRVRDILKRASLN

NMMCSVFGRRYELSSSNNETEELRGLVEEGYELLGKLNWSDHLPWIANLDLQKIRFRCCNLVPKVNHFVN

RIIQEHRTQLKGQRNDFVDVLLSLQGPDKLSDQDMVAVLWEMIFRGTDTVAVLIEWILARMVLHPDIQSK

VHRELDKVVGRSRPLMESDIQSMVYLQAVVKEVLRLHPPGPLLSWARLAITDTTVDGYEVPEGTTAMVNM

WAITRDPQVWADPLRFWPERFVCNNENAGGVDMEFSVLGSDLRLAPFGSGRRTCPGKALGLATVSFWVGT

LLHEFEWVQSDGDPVDLSEKLRLSCEMANPLSVKVYPRRGC

 

CYP78D

 

>CYP78D5 gi|255547726|ref|XP_002514920.1  Ricinus communis

gi|223545971|gb|EEF47474.1  Ricinus communis

73% to CYP78D2 Populus trichocarpa

75% to CYP78D3v1 Populus trichocarpa

MKSSMLVYLFFLLFALATAYQTQCPLIMLLFSLFFTLFAVSLNYWLVPGGFAWRDHRHHHGKLVGPVGWP

ILGFLPHMGSLAHRKLATMATSLGANKLMAFSLGTTRVVISSHPDTAKEILSGSSFSDRPIKESARLLMF

ERAIGFAPSGNYWRNLRRIAANYMFSPRRISGLEPLRQLLADEMVVTISKEMEERGVVVLRKILQKASLS

NVLESVFGSSYACLEKEEELLTSMVKEGYELITKLNLEDYFPLRFLDFYGVKRRCYKLACKVNNIVGQIV

RERKISAKQNGFSGGNDFLSALLYLPEQEELSEADMVPVLWEMIFRGTDTVAIILEWSMARIVMHQDIQA

RAQQELDRCIGRNRRMQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLAIQDVHVDKIFIPAGTTAMVN

MWAITHDPSIWKDPLEFNPDRFLEEDVAIMGSDLRLAPFGSGRRVCPGKALGLATVHLWLGRLLQQYKWL

PTVQPVDLSECLKLSLEMKKPLVCRAVHR

 

CYP79D

 

>CYP79D10P named earlier

 gi|255560398|ref|XP_002521214.1  Ricinus communis

gi|223539579|gb|EEF41166.1  Ricinus communis

gi|255560400|ref|XP_002521215.1  Ricinus communis

gi|223539580|gb|EEF41167.1  Ricinus communis

join two models

AASG02001648.1

75% to XP_002523435.1, 62% to CYP79D6v1 cottonwood

MESLVSMENTTSVISCTILAPLQGTLCSVSIAIGFLTTSLSSPHLILLLAMVLFRLLINQKLKCQRAKQL

SLPPGPKLWPVVGCLRPMLTNRPTFRWIHKLMEEMNTGIACIRLGNVHVIPVTSPEITREFLKPQDAVFA

RRPSTMSTHLTSRGYLTTSLAPLGEQRKKMKRALVTEF &

LSPAKYKWLYGKRLEEADHLVHYVYNQRKTAEEGGLVDVRITSQHYCRNVIRKMAFNK

RFFGEGMKDGGPDVEEKEHIDATFTALVYTNAFYVSDYMPCLIWLDLDGHEKLLKDAIGI

IKKYQDPIIEERLQQWRDGTR &

KVEVDDLLDVLINIEDANGNSLLSTKEIQAQIT (0)

DIMMAVVDNPSNALEWALAEMINQPKLLTEAVEELDRVVGKERLVQESDFLQLNYIKACAKEAFHLHPI &

FNVPHVSIVDTTPKGSHVLLSGVGLGRNPKNWDEPHIFRPERNLKIDGSPVMLT

EPDLHLFSFSTGRRGCPGIILGTSITVMLFARLLQGFSWSASPIEISIDLEESKNSLALA

KSLVALAKPRIPAYLYPV*

 

>CYP79D26 gi|255587166|ref|XP_002534163.1  Ricinus communis

gi|223525763|gb|EEF28220.1  Ricinus communis

77% to CYP79D1 Manihot esculenta

56% to CYP79D7 cottonwood

AASG02007751.1

MAMNIKDTAFAIGTASSATINTLKTLLITFLISISAIRIHKRRAAQKKNSRNPPLPPGPAPWPLVGNLPE

MMLYRPTFRWIHQLMQEMNTEICLIRLGRTNIVPVSCPILARELLKKNDAIFSSRPMIFSAKCMSGEYST

TIVVPNNDQWKKMRKILTSEIVSPARHKWLLDKRTEEANNLVFYLHNQYESNKNVNLRIATRHYCGNVIR

KMIFSKRFFGKGMPDGGPGLEEIEHVDAIFAALKYLYGFCVSDFMPLLQGFDLDGQENFVLAANKTIRDY

QNPLIDERIRQWKSGERKEMEDLLDVFITLADSDGKPLLTAHEIKNQIA (0)

EIMIATVDNPSNSIEWAMAEMLNQPELLQKATEELDRVVGKDRLVQESDIPKLNYIKACA

REAYRLHPVAAFVPPHVATQDTIIGGYFIPKGSWAILSRFGLGRNPKTWQDPLKFDPERH

LNEGEVVLTEHDLRFVTFSTGRRGCIAALLGSCMTTMLLARMLQCFTWSPPGNDVRVDL

TEAVDELYVANPVMAFAKPRLAPHLYPTSP*

 

>CYP79D27P gi|255564902|ref|XP_002523444.1  Ricinus communis

gi|223537272|gb|EEF38903.1  Ricinus communis

pseudogene

48% to CYP79D1 Manihot esculenta

87% to XP_002523435.1, 66% to CYP79D6v2 cottonwood

AASG02000190.1

40167 MDSFVAMQNAISVISCTRLASLHGTPDFAGIGIGFLRTLLSSCSLVLLLALALIYLTKFQKLESQNAKQL

PLPPRPKPWPLVGCLPAMLTNKPTVRWIDNLMKEMKTEIACIRLGNVHVIPVTSPELSREILKAQDAAFA

SRPLTMSTHLSTRGYLTTALVPLGEQWKKMKRVLVTQFLSPEKY*

WFYGKRLEEADHLVPYVYNQCKTAEEGGLVDVRITG

RHYCRNVIRKMVFNKRFFGEGMKEGRPGVEEKEHVDAIFTALAYTYAFCMSDYMP & 39340

(26 aa deletion)

39340 IIEARV*QWRDGTQKEVDDLLDVLINLEDANGNSLLSTEETKAQIT (0) 39203

38991 EIMLAVVDNPSKAIEWALAEMINQPKLLEKAVEELDRVVGKERLV

QESDFPQLNYI*ACAKEAFRLHPIVPFNIPHVSVADTTVANYFIPKGSTVLLSRVGLGRN

PRIWHEPHVFKPERHLKEDRFQVMLTEPDLNLLSFSTGRRGCPGIILGTSMTLMLFARLL

QGFRWSVPPNEISIDLMESKNSLALAKPLVAVAKPRLPAYLYPA 38365

 

>CYP79D28 gi|255564896|ref|XP_002523441.1  Ricinus communis

gi|223537269|gb|EEF38900.1  Ricinus communis

AASG02009001.1

91% to XP_002523435.1

66% to CYP79D6v2 cottonwood

MALQIFSGIGIGFLRTLLSSCSLVLLLALALIYLTKFQKLESQNAKQLPLPPGPKPWPLVGCLPTMLANK

PTFRWIHKLMKEMNTEIACIRLGNVHVIPVTSPEISREFLKVQDAVFASRPLTMSTDLTTSGYLTTTLVP

LGEQWKKMKRVLVTQVLSAEKYKWFYGKRLEEADHLVRYVYNQCKTAEEGGSVDVRITGRHYCGNVIRKM

VFNKRFFGEGMKDGGPGVEEKEHVDAILTALAHTYAFCLSDYMPCLRGLDLDGHEKVMKDAIGIIKKYQD

PIIEARVEQWRDGTKKEVDDLLDVFINLEDANGNSLLSMEEIKAQIT (0)

DIMLAAVDNPSNAIEWALAEMINKPKLLENAVEELDRVVGRERLVQ

ESDFPQLNYIKACAKEAFRLHPLGFFNLPHVSLADTTVANYFIPKSSHVLLSRVGLGRNP

RIWDEPHMFKPERHFKKNGCQVMLTQPDLNLLSFSTGRRGCPGIMLGTAMTVMLFARLLQ

GFSWSVPPNETSIDLSESKNSLELAKPLVALAKPRLPANLYPA*

 

>CYP79D29 gi|255564890|ref|XP_002523438.1  Ricinus communis

gi|223537266|gb|EEF38897.1  Ricinus communis

49% to CYP79D1   Manihot esculenta

AASG02005272.1

92% to XP_002523435.1, 64% to CYP79D6v1 cottonwood

MDSFVAMQNAISVISCTRLASLHCTPDFAGIGISFLGTLLNSCSLVLLLALALIYLTKFQKLESQNAKQL

PLPPGPKPWPLVGCLPTMLANKPTIRWIHKLMEEMNTEIACIRLGNVHVIPVTSPEISREFLKVQDAVFA

SRPLTMSTDLTARGYLTTGLVPLGEQWKKMRRVLVTQFLSAEKCKWFYGKRLEEADHLVRYVYNQCKTAE

EGGSVDVRITGRHYCGNVIRKMVFNKRFFGEGMKDGGPGVEEKEHVDAILTALAHTYAFCVSDYMPCLIG

LDLDGHEKIMKDAIGIIKKYQDPIIEARVKQWRDGTKKEVDDLLDVFINLEDANGNSLLSTEEIKAQIT (0)

EIMLAAVDNPSNALEWALAEMINKPKLLENAVEELDRVVGRERLVQESDFPQLNYIKACA

KEAFRLHPIVFFNVPHVSIADTTVADYFIPKGSHVLLSRVGLGRNPRIWDEPHMFKPERH

FKKNGCQVMLTQPDLNLLSFSTGRRGCPGIILGTAVTAMLFARLLQGFSWSVPPNETSID

LSESKNSLALAKPLVALAKPRLPANLYPA*

 

>CYP79D30 gi|255564886|ref|XP_002523436.1  Ricinus communis

gi|223537264|gb|EEF38895.1  Ricinus communis

53% to CYP79D1   Manihot esculenta

96% to XP_002523441.1, 67% to CYP79D7 cottonwood

runs off the contig end, missing about 150 aa at N-term

AASG02006034.1 no ESTs extend the seq.

VPLGEQWKK

MKRVLVTQVLSAEKYKWFYGKRLEEADHLVRYVYNQCKTAEEGGSVDVRITGRHYCGNVIRKMVFNKRFF

GEGMKDGGPGVEEKEHVDAILTALAHTYAFSVSDYMPCLIGLDLDGHEKIMKDAIGIIKKYQDPIIEARI

EQWRDGTKKEVDDLLDVFIHLEDANGNSLLSMEEIKAQIT (0)

EIMLAAVDNPSNAIEWALAEMINKPKLLENAVEELDRVVGRE

RLVQEADFPQLNYIKACAKEAFRLHPIVFFNLPHVSIADTTVANYFIPKGSHVLLSRVGL

GRNPRIWDEPHMFKPERHFKKSGCQVMLTQPDLNLLSFSTGRRGCPGIMLGTAMTVMLFA

RLLQGFSWSVPPNETSIDLSESKNSLELAKPLVALAKPRLPANLYPA*

 

>CYP79D31 = old CYP79A13 gi|255564884|ref|XP_002523435.1  Ricinus communis

gi|223537263|gb|EEF38894.1  Ricinus communis

named before 57% to CYP79A2 Arabidopsis

AASG02007166.1

67% to CYP79D6v2 cottonwood, runs off the contig end

ISCTRLASLHGTPDLAGIGIGFLRTLLSSCSLVLLLALALIYLTKFQKLESQNAKQLPLPPGPKPW

PLVGCLPTMLANKPTFRWIHKLMKEMNTEIACIRLGNVHVIPVTSPEISREFLEVQDALFASRPLTMSTD

LTTRGYLATGAVPLGEQWKKMRRVLVTQFLSVEKCKWFYGKRLEAADHLVRYVYNQCKTVEEGGSVNVRV

TGRHYCGNVTRKMVFNKRFFGEGMKDGGPGIEEKEHVDAIFTVLAHSYAFCVSDYMPCLTGLDLDGHGKV

MKDALGTINKYQDPIIEERVQQWKDGTKKEVDDLLDVFINLEDASGNSLLSTEEIKAQIT (0)

EIMMAVVDNPSNAIEWALAEMINKPKLLEKAVEELDRVVGRERLVQESDFPQLNYIKA

CAKEAFRLHPIVFFNLPHVSIADTTVANYFIPKGSHVLLSRVGLGRNPRIWDEPHMFKPE

RHFKRNGCQVMLTEPDLNLLSFSTGRRGCPGIILGTAVTVMLFARLLQGFSWSVPPNETS

IDLSESKNSLALAKPLVALAKPRLPANLYPA*

 

>CYP79D32P gi|255564882|ref|XP_002523434.1  Ricinus communis

gi|223537262|gb|EEF38893.1  Ricinus communis

pseudogene

52% to CYP79A2 Arabidopsis thaliana

78% to XP_002523441.1, 63% to CYP79D6v1 cottonwood

AASG02012244.1

TSLSFPYLILLLAVALIYLTKSQKLKSQNAKQLPLPPGPKPWPLVGCL

PTMLTNEPTFQWIHNLMKEMKTEIACIRLGNV

HVIPVTSPEISREILNAQDAVFASSPLTISTQLITRGYLTAVLVPFGEQWKKMKRVLGTQ

VLSPEKYKWFYGKRLEKADHLVRYVYH

 

CYP80

 

>CYP80C3P gi|255581774|ref|XP_002531688.1  Ricinus communis

gi|223528664|gb|EEF30679.1  Ricinus communis

pseudogene

57% CYP80C1 Populus trichocarpa at N-term only, 81% to EEF48750.1

The rest is not P450 seq

AASG02012637.1

Botom part = 81% to EEF48750.1

MGRAFSRVLSISSLPFLLLLPL &

FIILNHIISPSS*LRPFPPGPRQWPNVGNIHQVEKKLHVFLA &

TFAKLHGLLISLRLGAQIVVVASS

 

LVWNPSCSDQWKFLRAMCRSELFSTKAIESQATLREKKLTEMFDSFTSKKGQVVNIREVV

FTTVYNTIFNLLFSKDLLNLRDQENAGRI

 

>CYP80C4P gi|223549948|gb|EEF51435.1  Ricinus communis

gi|255539537|ref|XP_002510833.1 Ricinus communis

pseudogene

50% to CYP80C1 Populus trichocarpa, 58% to XP_002513348.1

AASG02000031.1

58% to EEF51432.1

LDPQGLKRNLTKSINEVYAVWAIYPKE*KEAH

IDNDTSRYDFLDVYLANGFQDGRINWLVL (0)

QQFTAGIDTTTTTIERAMAELFRNREVLKKVRQELDREINK &

QNPIKGFEVCQLPFINACVKETL*LHPPVPFLLPQYCAIRTCEVLNYTIPKE &

VFVNVWTIGR &

PSVWEEPLS &

PDSFLGSIRRA*FFIPPS*GRRICPGLHMATKQI &

SLF*PLLLHC*VWSLPNG &

QILKS*TTGHEKYSITVQKEQPLLL &

 

>CYP80C5 gi|223549945|gb|EEF51432.1 (S)-N-methylcoclaurine 3'-hydroxylase isozyme Ricinus communis

gi|255539531|ref|XP_002510830.1 (S)-N-methylcoclaurine 3'-hydroxylase isozyme

63% to CYP80C1 Populus trichocarpa

68% to EEF48750.1, 66% to XP_002513348.1, 54% to XP_002509713.1

60% to XP_002513351.1, 62% to XP_002513350.1, 64% to XP_002513349

297822 MLHLFSLTYLLPLPILVVILTQIISFISSRRQHLPLPPGPKPWPILGNILQVDKKLHICIANFAKVYGPL

ISLRLGNQVLVVASTPSSAAEVLKNHDRLLSARFILKAIPSESHILERVAIVWNPACNDHWKSLRALCRT

ELFSPKAIESQAILREKKLAEMLEFLITKQGQAVNVAEVVFGTIFNTISHLLFSTDLIGFENQIGGVKSL

LWSMMEMATSPNIAEFYPILAPLDPQGLKRKMTKCLKEMFGVWEIYIKERRRTHDHDHAAPKTDFLDIFL

SNGFDDDQINWLVMELLSAGTDTTSTSVEWAMAELLKNKEAMKKVREELDREINKNPIKESHVSQLPYLN

ACVKETLRLHPPAPFLIPRRATENCEVMNYTIPKDSQVLVNVWAIGRDPSVWEDPSSFKPERFLGSSLDV

KGHDFELIPFGSGRRICPGLPMATRQLSLVLASLIHCFDWSLPNGGDPAKVDMTEKFGITLQMEHPLLII

PKPKLL 296211

 

>CYP80C6 gi|255544580|ref|XP_002513351.1 (S)-N-methylcoclaurine 3'-hydroxylase isozyme Ricinus communis

gi|223547259|gb|EEF48754.1 (S)-N-methylcoclaurine 3'-hydroxylase isozyme

63% to CYP80C1 Populus trichocarpa

AASG02007177.1

MDQTAKLLNQFASSFYLLLLLLLPLIFIILKHIVTSLSSKRPRLPPGPRPWPIIGNLHQIGKKLHISVTQ

FAKVHGPLISLRLGSRVVVVGSSPLAATEILKTHDRLLSARTIPKVLPYKIHFVDRLAIVWASSCNERWK

SLRALCRTELFSANAIESQAALREKKMIEMVEYLSSEQGQVVNIGEVVFTSVFNTISNLIFSKDLLSFED

QERGSGLKNATWRLMELTVAPNIADFYPVFAGLDPQGLQKKMLKYMKEMFSAWEIHIKERRETHVHGAPT

NDFLDVFLANDFDDDQINWLTF (0)

ELFAAGSDTTTTTVEWAMAELLKNKQFMKKACEELDREIKRNSIKESDIPQLHFLN

ACVKETMRFHPPVPFLVHRALETCEVMNYTIPKDAQVLVNIWAIGRDPSAWEDPLSFDP

NRFLGSNIDFKGHDFELIPFGSGRRNCVGQPMATRQLHLILGSLMHFFDWSLPNGEDSVN

LDLSEKFGLTLQKEQPLLLVPKRKL*

 

>CYP80C7P gi|255544576|ref|XP_002513349.1  Ricinus communis

gi|223547257|gb|EEF48752.1  Ricinus communis

pseudogene

59% to CYP80C1   Populus trichocarpa

81% to XP_002513348.1

gi|255544578|ref|XP_002513350.1  Ricinus communis

gi|223547258|gb|EEF48753.1  Ricinus communis

join

60% to CYP80C1 Populus trichocarpa, 70% to EEF48750.1

AASG02007177.1

MENTAFSGALSIFSLPFFLLLPLIFIILNHVISPSSERRLLPPGPRQWPIIDNILQVGKKPHVSLAHFA

QLHGPLISLRLGTRVVVVASSPIAAAEILKIHNRLLSARSVPAAFPYGNHVLDRVAIVWNP

LCNDQWKFLRALCRTELSSAKAIESQATLRERKLAGMLDFLTIKQGQVVNIGEVMFTTVFNTISNLIFSKDML

SFEDQERAGGLKTLITTLM &

ELSTAPNIADFYPVLTRLDPQG &

MRRKIKIGLEKMFNVWEIYIKEKRENCVNDAPETYFLDLFLSNGFDDDQINWLVL (0)

ELFAAGMSTTTTVEWAIAELLKNRATLVKAEEELDREIDSKS

IEESHLLQLQYLNECTKETFGLHPSGPFLILRRALNTCEVMNYTIPKNSQVLVNVWAIGRDPLPWEDPLS

FKPERFLN*NIDFKGQDFQLLPFGSGRRTCP*QPMATRQLPMILAYVIRCFEWSLPNGKDPAMLDMN

DKFGIISVKDSPLLVVPKRKL

 

>CYP80C8 gi|255544574|ref|XP_002513348.1 (S)-N-methylcoclaurine 3'-hydroxylase isozyme Ricinus communis

gi|223547256|gb|EEF48751.1 (S)-N-methylcoclaurine 3'-hydroxylase isozyme

63% to CYP80C1 Populus trichocarpa

AASG02007177.1 top Runs off the end

AASG02009550.1 bottom Runs off the end

EST EE259209.1 (green) joins the pieces

MDTAFSGVLGILSLSFLLLLPLIFIILNHISSPSSERRPLPPGPRQWPIVGNILQVGKKPHVSLAYFAKL

HGPLISLRLGAQIVVVASSPIAAAEILKTHDRLLSARFISAANPYGDHVLDRVALVWNPSC

SDQWKLLRAMCRSELFSAKAIDSQDTLREKKLTEMLDFLTIKQGQVVNIGEV VFTTVFNTISNLIFSKDMLSFGDQGNAGGL

KTLITKLMQLATAPNIADFYPVLARLDPQNMRRKMKIGFEKVLNAWQIYIKERRENHVNDAPETDFLDVF

LSTGFDDDQINWLVLELFAAGVDTTTTTVEWAMAELLKSRATLVKVQQELDREVDNKSIEESHVLQLQYL

NACIKETFRLHPPAPFLIPRRALNTCEVLNYTIPKNSQVVVNLWAIGRDSSSWEDPLSFKPERFLNSNID

FKGHHFQLLPFGSGRRTCPGLPMATRQLPLILAYLIRCFEWSLPNDQDPAMLDMNDKFGITLVKDSPLLL

VPKRKL

 

>CYP80C9 gi|223547255|gb|EEF48750.1 (S)-N-methylcoclaurine 3'-hydroxylase isozyme Ricinus communis

gi|255544572|ref|XP_002513347.1 (S)-N-methylcoclaurine 3'-hydroxylase isozyme 62% to CYP80C1 Populus trichocarpa

MDQTAFTLTSPSFLLLPLILIIVMQILSSISSKRRPLPPGPRQWPILGNILQVGKNPHISMANYAKVHGP

LISLRLGTRVVVVASSPTAAAEILKTHDRLLSGRYIPATTPYEDNVLDRIALVWNPSC SDQWKFLRAMCR

SELFSAKAIESQATLREKKLTEMLDFLTSKQGQIVNIGEV VFTTAFNTISNLLFSKDLLSFEDQGNAGEL

KTLISTLMELATCPNIADFYPVLTKLDPQGIKRKMKNCLERMFGVWDIYIKERRERHVKDARKTDFLDVF

LSNGFDDHQINWLLLELFSAGADTTTTTVEWAMAELLKEITVLEKVREELETEIGKDMIRESHIPQLKYL

NACVKETLRLHPPVPFLIPRRAPEACEVMNYTIPKHSQIIVNVWAIGRDPSAWEDPLSYRPERFLDSNLD

FKGHNFEFLPFGSGRRICPGLPMGTRQLPLILASLVHCFDWSLQNGDDPAMLDMNDKFSITLEKEQHLLV

VPKRKL

 

>CYP80E10 gi|255537293|ref|XP_002509713.1 (S)-N-methylcoclaurine 3'-hydroxylase isozyme Ricinus communis

gi|223549612|gb|EEF51100.1 (S)-N-methylcoclaurine 3'-hydroxylase isozyme

59% to CYP80E1 Populus trichocarpa

52% to CYP80C1 Populus trichocarpus

MAIEEGNLFFLILLLVPLLCLILKHLKPSSTPPLPPGPFQWPVLGNILQLGNKPHISLTHFARIYGSVFS

LKLGTQLVVVGSTREAAMEILKTRDRTLSGRYVPHLAPTKSPQLNKLSLGWIVECNDKWKYLRTICRTEL

FSSKALESQKSKREKKILEMVAFIKKMEGKELEVRKVAVITVFNMLSSIMVSEDLMSLDQENADGEMTSL

LHSILELASTPNISDLYPILGRFDLQGLQKKIMELHERCFEICEAITEERRQGKRMDASRGSDFLDTLIN

NGSSNQQINVLLLELLSAGTDTSSNTIEWTMAELMKNPKCMKKVQEEITRNLIPDILKESPISNLTYLQA

CVKETLRLHPPGPFLLPHRATDTCQVMNYTIPKNSQVLVNFWAIGRDPKYWKDPLIFKPERFLNSNLDYK

GNDFEFIPFGSGRRICPGLPMAAKQVPLIVASLIHFFDWSLPGGKDSIDLDMTEKYGLTLRMEKPLLLIP

KIKLRNKREMA

 

CYP81

 

>CYP81B54 gi|255538132|ref|XP_002510131.1  Ricinus communis

gi|223550832|gb|EEF52318.1  Ricinus communis

59% to XP_002510130.1, 54% to XP_002510140.1, 53% to XP_002524941.1

53% to XP_002510139.1, 51% to XP_002523472.1, 48% to XP_002510136.1

46% to XP_002524942.1

69% to CYP81B3v1 cottonwood

56% to CYP81T1 Populus trichocarpa, 56% to CYP81B1v1 Helianthus tuberosus

METSFYYCFLLFFFLFFLSKRLLGINKNLPPSPGVSLPIIGHLHLLKKPLHRTFADLSKKYGPILYLKFG

SRPAVLVSSPAAVEECFTKNDIILANRPKLLAGKHLGYDYTTLVWASYGNHWRNLRRIASIELLSSNRIQ

TFSNVRVEEVRSLARRLFRGSMDGEFMTVDMKSMLFELTLNVLMRMIAGKRYYGENTAELDDAKKFKEIV

TETFQLSGASNIGDFVPALKWVGLTNIEKRLEILQRKRDRFMQELVEEHKRANSDDSASGKRCKTMIDVL

LDLQKDEPEYYTDEIIRGMMLVMLTAGSDTSAGTLEWALTLLLNNPEALLKAREEIDTNVGQSKLIEESD

IANLPYLQGIINETFRMQPAAPLLPAHESSEECILGGFKIPRGTMLLVNMFAIQNDPKLWEEPTKFKPER

FLSTEGKGEGLGYMLLPFGAGRRRCPGEGLAIRNIGLGLGTLIQCFEWERIGEEMVDMVEGSGLSMPKAH

PLVAKCRPRPTMVHLLSNA

 

>CYP81B55 gi|255538130|ref|XP_002510130.1  Ricinus communis

gi|223550831|gb|EEF52317.1  Ricinus communis

72% to CYP81B4 cottonwood

61% to CYP81B1v1 Helianthus tuberosus, 53% to CYP81T1 Populus trichocarpa

54% to CYP81Q7 Vitis vinifera

MILLHFLLFFVLYILTNHFFNKIRNHPPSPFPTLPLLGHLHLLKKPLHRSLSTLSNRYGPVLLLQFGYRR

VLVVSSPSAAEECLTKCDTVFANRPRLLAGKHIGYNYTSLAWAPYGDLWRNLRKVSALEILSSHRLQLLS

SIRRDEVKLLIQRLFRNNKDCREKVDMKSAFFELMLNVMMRMIAGKRYYGENVEQVEEAKRFREIVRETF

LAAGTSNMGDFLPLVAVVGGQEKRLKELGKRRDGFIQDLIDEHRKRMAACSSEERNKTMIEVLLSLQESE

PEYYTDETIKSLMLVLLAAGTDTSAATMEWAMSLLVNNPEALKKAQTEIDSVIGHDRLINESDTSKLPYL

NCIINEVMRMYPAGPLLVPHESSEECFIGGYRVPAGTMLLVNLWSIQNDPRVWEEPRNFKPERFEGCEGV

RDGFRLMPFGSGRRSCPGEGLALRMVGLGIGTLLQCFDWERVGKEMIDMTEGVGLTMPKAQPLVVQCSPR

PSMVNLLSQL

 

>CYP81C14 gi|255538142|ref|XP_002510136.1  Ricinus communis

gi|223550837|gb|EEF52323.1  Ricinus communis

64% to CYP81C3 Populus trichocarpa, 58% to CYP81W1 Vitis vinifera

50% to XP_002510130.1

MESLYFHLAFLLFFFLVYKILFPQKQNLPPGPFSLPLIGHLHMLKKPLPLALETLLSKYGPILSLKFGYR

SVLVVSSPSAVEECFTKNDIIFANRPKSMAGDHFTYNYTTYVWAPYGELWRSLRRLTVVELFSSKSLQNN

SAIRKQEVHRLVSRLFKVSAGGKQKVDLKFLLSLLMCNVMMKIAVGKLCVKEEIEGTEVEKQLYQGFKDK

FFPSLTLNVCDFIPFLRMIGFKGIEKNMIKMQNKRDEFLQDLLDGIRLNRKHSKTSDDEEKRSVAETLLS

LQELEPAIYTDDVIKSIMVMMFIAGVETSAVALEWAMSLLLIHPEILQKLRAEIDNCVGHGRLLNDLDLV

KLPYLRCVVNETLRLYPPGPLMLPHLSSEICTVGGFEIQKGTLLMVNLWAMHRDPNVWEEPTEFKPERFE

GDLGEEHAFKFMPFGMGRRACPGAGMGTRMVSLALGALIQSFEWEKDGLEKVDMNPRFGMSLSKAKPLVV

LCCPRPEMVEVLSQL

 

>CYP81S15P gi|255564960|ref|XP_002523473.1  Ricinus communis

gi|223537301|gb|EEF38932.1  Ricinus communis

pseudogene

60% to CYP81Q7 Vitis vinifera, 90% to XP_002523472.1, 59% to CYP81S3 cottonwood

AASG02004168.1 same contig as XP_002523472.1

DIIFAGTESTAVTLEWAMSSLLNNPQVLEKARNELNIQIGQANLMDESDLSKLPYLQNIISETLRL &

AAPLLLPHLSSQECNIGGYHVEPNTMLLVNAWAIHRDPELWDDAVKFKPERFENFVGQG

GINNQVYKVMPFGLGRRSCPGMGLANRVLGFPLGSMMHYFEWKRVSEQEIDMSEGFGLSMP

MAEPLQATCKARDIMKKVVFFSL

 

>CYP81S16 gi|255564958|ref|XP_002523472.1  Ricinus communis

gi|223537300|gb|EEF38931.1  Ricinus communis

61% to CYP81Q7 Vitis vinifera, 55% to CYP81S1v1 Populus trichocarpa

58% to CYP81S11 cottonwood

MINSSMEDTLLLLTLLLPFLLLAYKFWPQTRTQQHSLPPSPPALPIIGHLHLIKIPLHRSLQSLSNKYGP

IISLRLGSRRLIIISSPSAVEECFTKNDITLANRPALTVYKYMSYNCTTLATSSYGDHWRNLRRISAVEV

FSSNRLNMFVGIRRDEIEIFLNKLYRLSRDGFAKVELKPILMELSLNTIMRMVAGKRYYGEDVTAKDEGE

AKIFREMITEIFEYAGASYLGDYLPILKWIDPRGFLKKVASLHVRTDVLLQGLIDEHRGGYKGNIEGRNT

MISHLLSLQESEPENYSDQVIKGLLLDIIFAGTESTAVTLEWAMSSLLNNPQVLEKAKDELDIQIGQDNL

MDESDLSKLPYLQNIISETLRLYPAGPLLLPHLSSQECSVGGYLVEPNTMLLVNAWAIHRDPELWDDAVK

FKPERFENFVGQGGINNQVYKLMPFGLGRRSCPGMGLANRVLGFALGSMIHCFEWKRVSEQEIDMSEGFG

LTMPKAEPLQAMCKARDAMKMVMFSSL

 

>CYP81S17 gi|255567929|ref|XP_002524942.1  Ricinus communis

gi|223535777|gb|EEF37439.1  Ricinus communis

AASG02001034.1 runs off the contig

AASG02003644.1 runs off the contig

68% to XP_002524941.1, 68% to CYP81S11 cottonwood,

60% to CYP81Q7 Vitis vinifera

MEVLCFFLSFLILLFALRFYLSRIRHKNLPPSPPALPIVGHLHLLKPPMHRAFYHLSQKYGPIMFLQFGS

RPVVIVSSSSAAEECFTK &

NDKVFATVQIARGKFISILHTAQSPYATL

GDHWRNIRRIGTIEIFSTHRLS

KLLSIRKDEIKKLLVNLANNSLQDFSKVELKSKFQELTFSIMIRMVAGK

RYYGDDVSDKEEARQFTQLMKEAVTYGGATNPGDFLPILNWIDGGGFKKRIIGLSKRTDKFFQALIDEHR

SKKENLESTNTMIDHLLSLQESEPEYYTDEIIKGLTQNMLFAGTDTSAITLEWAMSNLLNHPSTLRKAKD

EIDNQVGQECLLDEPDLSRLPHLQNIISETLRLYPAAPLLVPHMSSDDCTVGGYNVPRGTILLVNAWAIH

RDPTLWDDATSFKPERYNSRETEAHMLMPFGLGRRSCPGAGLAQRVVGLALGSLIQCFEWERVSGEEVDM

AEGKGVTLPKAEPLEAMCKARPIMKNILPKHA

 

>CYP81S18 gi|255567927|ref|XP_002524941.1  Ricinus communis

gi|223535776|gb|EEF37438.1  Ricinus communis

61% to CYP81Q7 Vitis vinifera, 55% to CYP81E1v2 Glycyrrhiza echinata

56% to CYP81D1   Arabidopsis thaliana, 56% to CYP81T1 Populus trichocarpa

70% to XP_002524942.1, 60% to XP_002523472.1, 66% to CYP81S11 cottonwood

MEDPILYFFLSLLILLFAFKFYQSRTCPGNLPPSPPALPIIGHLHLLKPPMHRTFLTLAQKYGPIFSLRF

GYRLVVVVSSPTAVEECFTKNDIILANRPKLLVAKYVAYNNTTMTQSSYGDHWRNLRRIGSIEIFSTNRL

NTFLGIRRDEIKRLLLKLSRDSVQDFVKVELKSMFKDLTFNIIVRMIAGKRFHGEDVSDDEEARQFKDLI

GEITKYAGASNPRDFLPILNWIDGGMFEKKMKKLAERTDGFLQKLIDEHRSKKENLESMNTLIDHLLSSQ

ESEPEYYTNEIIKSIMINLLFAGTDTSAVTLEWAMTNLLNHPSTLMKAKDEIDSQVGRDSLLDEPDLSRL

PYLRNIVLETLRLYPVAPLLIPHVSSEDCTIGGYKVPRDTMVLVNAWAIHRDPTLWDEPLSFKPERFDNG

EESESFKLLPFGLGRRSCPGAGLAHRVISLTLGSLIQCFEWKRVSEDEVDVKEGRGLTLPKAEPLEALCR

SHPIMNKILSQPV

 

>CYP81S19 gi|255567921|ref|XP_002524938.1  Ricinus communis

gi|223535773|gb|EEF37435.1  Ricinus communis

gi|255567919|ref|XP_002524937.1  Ricinus communis

gi|223535772|gb|EEF37434.1  Ricinus communis

join two models

58% to CYP81Q7 Vitis vinifera, 66% to XP_002523472.1

61% to CYP81S3 cottonwood

AASG02013383.1, AASG02003644.1

MEEGTLLIITCVFFLLLAFKLCLHKRRHRKLPPSPPAVPVLGHLHLLKQPIHRSLHSLSQKYGSIFSLQL

GSYLAIVVSSPSIVQECFTKNDIVLANRPPLIMGKYLS &

LNHTTLVTAPYGDHWRNIRRISALEIFSTNRLHSFLGIRRDEVKSFLTKLCRVSFSDYAKVELRPMLSELTFNII

MRMVTGKRYGGNEGEGTARQFREMIREIFKYAEASYPGDFLPILQWIDYQGYLKKVKELGKRCDDFLQVL

IDGHRNSDKGSKTMISHLLSLQESEPEYYSDEIIKGLILDIVFGGTESSALTIEWAMANLLNNPQVLQKA

KNELDIQIGNATLMDELDLSKLPYLQNIISETVRLYPVGPLLLPHFSNNDCTLEGYNVPKNTILFVNSWA

IQRDPKLWDDAEEFKPERFECGGQDDQAYNYRFMLFGLGRRACPGMGLANRVVGFALGSMIQCFEWKRVS

DIEIDMIEGTGLAMPKAEPLVAMSKARDIIIKASNMKQT

 

>CYP81S20 gi|255538150|ref|XP_002510140.1  Ricinus communis

gi|223550841|gb|EEF52327.1  Ricinus communis

59% to CYP81Q7 Vitis vinifera, 54% to CYP81X1 Soybean

55% to XP_002523472.1, 54% to XP_002510139.1, 57% to XP_002524942.1

52% to CYP81S7 cottonwood, 55% to CYP81S11 cottonwood

MEETWVCILFTTFVILLLSRHFWSKRTTYRNLPPSPPKLPIIGHLHLMKEPVHRSLQDLSNKYGPIIFLS

FGSQPVIIISSPSLVEECFTKNDIVLADRPRRQAGKYLHYDYTTIGAANYGDLWRNLRRLATVEILSTNR

LNMFHGIRQEEVRMLVKNLFQSAGQVSAKVEMKSRLVGLSFNIIMRMVAGKRYFGSEVKDVEEATQFHDV

IRETFVLSGAANLGDFFPLIRWLDYRGIEKRLVSARKNMDLLFQRLIDEHRHKRGSCLEDKSCKTMIDVV

LSLQEFQPEYYSDEIIKGLIMAMLTAGTDTSAVTIEWAMSLLLNHPKALTKARAELDIHVGQDRLVDEQD

LPKLQYLHCIINETLRLFPAAPLLVPHKSSDDCKIGGFDIPQGTVLSVNAWALHRDPKIWEDPNSFRPER

FEGIKYETCLLVPFGLGRRSCPGAGLANRVVGLALAALIQCFDWERITEEEIDMLEGPGLTMPKVQPLEA

MCKIRESMISAILS

 

>CYP81T2P gi|255538144|ref|XP_002510137.1  Ricinus communis

gi|223550838|gb|EEF52324.1  Ricinus communis

pseudogene

56% to CYP81T1 Populus trichocarpa, 57% to XP_002510139.1

56% to CYP81X1 Soybean

gi|255538146|ref|XP_002510138.1  Ricinus communis

gi|223550839|gb|EEF52325.1  Ricinus communis

join two models

AASG02001384.1

MEAANWLSLLLLFILILLLKFILGKCIKSKNYPPSPLSLPIIG &

HLHLLKEPVRRSLGQLSAKYGYVLLLQFGTRKAVLVSSSAAVEECFMKNDIIFTNRP*L

VGKHLNYN*RTI (1?)

GLSFYGDQW*NLRHLATLELFSIARLAMFTSIR*EEVQLVLKQ*FQDSSEKQVRVK

LSSKFLDLAFNVMMRMVTGKRYYGKDAVDKEASQFRDLMREFAEIHGTTNLNDLFPVLQW

IDFQGVEKRM*RLMKKMDTFLQYLVNEHREMRSSDFSSYESSAQLII &

KEDVDVMLSLQEREREIYTNVNIKAVIL

TMLIGGTETSSTTMEWAMSLLLNHPDKMRKVAEEIATNVRLD

HLLDEAKLSKLNYLQNETFRLYPTLPLLLPHESSSDSSIYGFDVPQGTMLL &

HRDPKLWVEPTKFMPERFEGEKSDGYKLIPFGVGRRACPSAVLTRRLIELTLGALIQVFE

WDKIGN*EINMEEGITISLPEAFPLEALCKPRQATIDILSPL

 

>CYP81T3 gi|255538148|ref|XP_002510139.1  Ricinus communis

gi|223550840|gb|EEF52326.1  Ricinus communis

54% to XP_002510140.1

72% to CYP81T1 Populus trichocarpa, 57% to CYP81X1 Soybean

50% to CYP81Q7 Vitis vinifera

MEVSLWFKLAVLVVVLLFVLVPKLTFFHKLDRSPKNLPPSPPARPIVGHLHLLKQPVHRTLHELSSKYGD

ILLLRYGTRKVLVISSPSAIEECFTRNDVIFANRPQSLAGKHLNYNSTTMGFSSYGDHWRNLRRLTTVEL

FSTAHTAMFSGIRAEEVRLLLKQLFQDSRGESAKVALTSKFLDLTFNNMMRIIAGKRYYGKDVVDQEGEL

LQDIIKEMEALRGSANLNDYFPVLQWVDYQGVEQRMLRLAKKMDVFLQDLIEEHRTNSSASVNLSGASNQ

KRNLTLIDVMLSFRENLEFYSDQTIKGVILTTLTAGSQTSAATLDWAISLLLNHPKVLQKAFTEIETVVG

LDHLLDEADIPKLNYLQNIINETFRLFPPAPLLLPHESSADCTVCGYYVPQGTMLLVNTWSMNRNPKLWE

DPEKFMPERFEGQEGAGNTLLPFGAGRRACPGAGLAKRVISLTLGSLIQCFEWERIDEEEINMTEGAGLT

MPKAIPLEALCRPREAMINLLSTL

 

CYP82

 

>CYP82C23 gi|223538448|gb|EEF40054.1  Ricinus communis

gi|255562729|ref|XP_002522370.1  Ricinus communis

53% to CYP82C2 Arabidopsis thaliana

52% to XP_002510312.1

56% to CYP82C5 cottonwood

MDFFRQLLLTLIFTVVLLFSIYFYHSKRNSRCTVPQAGGAWPVIGHMHLFGGHQLTHKTLGAMADKHGPV

FTIKLGSHRVLTVNSWEMARECFTSHDRVFSSRPIIAASKLLGYDFAMFGFAPYGDYWREMRKIATIELF

STHRIDMLKHIRTSEVQIAIGKLYEKWVGKGSKESGTLVDMKQWFGDLTHNVALRTVGGKRCFGPNADVE

EGEAQRRRKVIRDFAFLFGVFVLSDAIPYLGWLDFKGYEKSMKKTAKELDILMEGWLEEHKQRRKLSGKE

KEEKDFMDVMLNILEDAKISGFDADTINKATCLNLILAGSDTTMVTLTWTLSLLLNNYNVLKKAQDELDI

HIGRDRHVEETDIKHLIYLQAIVKETLRLYPPSPMLLRAAKEDCTLSSGCYVPAGTRLMVNVWKIQRDGR

IWSNPDEFQPERFLSSHKEIDLRGQNFEFIPFGSGRRSCPGMALGLQVVHFILASFLHGFEVAKASGENV

DMTESTGLTNLKATSLEVHLVPRLNSTLYKM

 

>CYP82C24 gi|223541795|gb|EEF43343.1  Ricinus communis

gi|255556195|ref|XP_002519132.1  Ricinus communis

51% to XP_002510298.1, 53% to XP_002510313.1

64% to CYP82C15v2 cottonwood exon 1

AASG02000839

gi|223541794|gb|EEF43342.1  Ricinus communis

gi|255556193|ref|XP_002519131.1  Ricinus communis

join two models

57% to CYP82H1 Ammi majus

AASG02000839.1

Yellow end does not match, intron boundary not clear

MKFFFYLQDLSLYTFLLATILLSLAIKYANRNKKNIKNPPEPSGSWPFIGHLHLLSDSNQLLHRTLGSMA

DELGPIFSIRLGVHQAVVISNWELAKECFTINDKVFQTRPESLAVKIMGYDQVMFGFAPYGKYWRDVRKL

ATVELLSNRRLELLKHVRDRETKLFFKELYQESVKNGGGNTVIEMKERFEELAMNIIVKMIAGKRFFGGN

GIRDEESRRFSKALGDFMQLTGLVLASDTVPFLGWVDSMRGYISEMKRTAMELDSLLRRWVKEHREKRLE

GSIKEEEQDFIHVMLSVTDDGKISADAIDSIIKATCL (?)

SLILGGRDAIAVTLTWALSLLLNNRSVLIKAQDELAIHVGGHQQVHNESCMTNLTYLQAI

VKETLRLYPAAPLSVPREAMVDCTIAGYHIPAGTRLFVNLWKMHRDPNIWINPLEFQPER

FLNEHTHLDIRGQDFECIPFGSGRRMCPGVSFALQILHLTLARLLQGFELKRVSDNPIDM

SESPGLTSPKATPLEVVLSPRLLP CTMNVNVKLKGKLEGQWTYWGVKNLSH*

 

>CYP82C25 gi|255538464|ref|XP_002510297.1  Ricinus communis

gi|223550998|gb|EEF52484.1  Ricinus communis

56% to CYP82C2 Arabidopsis thaliana

MDSLLELTTIAVFFSFIILCSAWLRGTKRSRGSNVREAPEPAGAWPIIGHLRVLGGADKLLHKTLGLMAD

KYGPAFNIRIGSHRAFVIASKELAKECLTTNDKAVASRPTTAATERMCYNHAVFGFAPYSSHWREMRKIV

MFELLSNRRLEMVKNVQASEVDIGLRKLYNLWADNGCLPVLVELKQWFQDVTFNVIVRMVAGKRYAGSSD

DYEARLCQKAISQFYHLMGIFVVSDALPFLWWLDLEGHKKAMKETAKDLDTVLAGWLEEHLQRRVPGEVK

TEVQQDFIDVMLSLEEKGNLSGFLYDADISIKATCLALIAGASGTTTTTLIWAISLLLNNQAALKKAQEE

LDQHIGTERQVDESDLKNLVYLQAIIKETLRLYPVAPLIPREFMEDCTIGGYHVAAGTRLLINVWKIHRD

PRFWTNPLAFEPGRFLTSHADIDVRGQHFELIPFGSGRRSCPGAPFGLHALHLALARFLHAFDLATPMDQ

PIDMSEMPGTHVPKATPLEVLVSPRLPAKLYRCAEV

 

>CYP82C26 gi|255538466|ref|XP_002510298.1  Ricinus communis

gi|223550999|gb|EEF52485.1  Ricinus communis

58% to CYP82C2 Arabidopsis thaliana

MDSSLQLTAIAVIISFIFVCSTWLRGKKKSVGSKSREAPEPAGSWPIIGHLHLLGGADKLLHRTLGSLAD

KYGPAFNIRIGSHRALVVASKELAKECFTINDKTLASRSTTAATKHMCYDHAVFGFAPYSSHWREMRKIV

MLELLSNRRLEMVKHVQASEVDLGIRKLYNLWAQNRCLPVIVELKQFFEDLTLDVIVRVVAGKRYTGSSD

DDEARQYQKAISQFFHLMGIFVVSDALPFLRWLDLEGHEKAMKKTAKDLDAVLAGWLDEHRRRRVSGEVK

SEGDQDFIDVMLSLEEKGHLSGFQYDADTSIKSTCLALIAGASDTTTTTLVWAISLLLNNQLALKNAKEE

LEKHIGTERQVDESDLKNLVYLQAVIKETLRLYPVAPLIPREFVEDCRVGGYHVPAGTRLLVNVWKIQRD

PMLWTKASAFQPERFLTSHADIDVRGHHFELLPFGSGRRSCPGASFALHALHLTLARFLHAFDVATPMDQ

PVDMTERSGTTLPKATPLEVLLSPRLPAKLYSC

 

>CYP82C27P gi|255538468|ref|XP_002510299.1 Ricinus communis, join to XP_002510300.1

gi|223551000|gb|EEF52486.1  Ricinus communis

pseudogene

51% to CYP82C2 Arabidopsis thaliana

69% to XP_002510298.1, 65% to CYP82D14 Vitis, 66% to CYP82C5 cottonwood

gi|255538470|ref|XP_002510300.1  Ricinus communis

gi|223551001|gb|EEF52487.1  Ricinus communis

AASG02001181.1

MDLNLQLIAICGFIWTFLYFALLSRRRITTRSNGKKAPEPAGAWPIIGHLHLLGGSDQLLHHTLGMMADK

YGPAF &

AFVVASKEVAKECLTINDRAFSSKPTTAAIKHV &

CYDHALFGFAPYSSHWRAMRKIVTLELLSNCRLEMVKHVQASEVDLGIRKLYGLWAEN &

VLVELKQWFTDLTLNVVVRIVAGKCFSGGSDDGEARWCQKTIAAFFHMMGIFVVSDALPF

LRWLDLQGHERAMKKTAKDMDAILEGWLGEHHRENASGMFEAEDKQDFMDVMLLLEEEGR

LSGFPYDENTSIKATCL (?)

AIFAGGSDTTAIMLTWAISLLLNNHFALRKAQEELDLHVDVERQVEESDIKNLVYLQAIV

KETLRLYPVAPLSGPRESLEDCSVAGYHAPARTRLIVNVWKIQRDPRLWKDPTTFQPERY

LTTHVDIDVRGQHFELIPFGSGRRSCPGASFALCALHFSS &

FDLATPMDQPVDMTEGPGVITPKASPLEVLLSPRLHARLYC*

 

>CYP82C28 gi|255538472|ref|XP_002510301.1  Ricinus communis

gi|223551002|gb|EEF52488.1  Ricinus communis

55% to CYP82C2 Arabidopsis thaliana

MDVNLQEFAIIGLFSLILFYFLLLRTTKIARASNAREAPEPTGAWPIIGHLHQLAAANQLLHETLGMMAD

KYGPALCIQQGSRRAFVVSSWKVAKECFTTNDKAFASRPITAATKHMCYNNAVFGFAPYSHHWRIKKIFY

LWAENKKISLPVLVELKQWSEDITSSVIVRAVAGKCYTDASNDVEARQFQKAIAEFFRLISIFVVSDAFP

FLWWLDLQGYQRAMKKAAKELDAILGGWLNEHRQRKRSGLVRPEDEQDFIDRMLLAEEAGHLSGFPYDAD

TSIKSTCLAVVTGASDATATTLTWAISLLLNNRIALEKAQKELDLHVGRKRPVKESDIKNLIYLQAIIKE

TLRLSPVAPLSGPREAMEDCEVAGYHIRAGTRLIVNVWKIQRDPKVWANPLDFEPERFLTTHVDIDVRGQ

DFKLIPFGCGRRVCPGSSFALQALHLTLARLLHAFDLATFKDQGVDMTGMSGMNTARATPLEVVLSPRLP

ENLYC

 

>CYP82C29 gi|255538486|ref|XP_002510308.1  Ricinus communis

gi|223551009|gb|EEF52495.1  Ricinus communis

50% to CYP82Q1 Stevia rebaudiana, 51% to CYP82D1 Medicago sativa

96% to XP_002510311.1, 60% to XP_002510313.1, 57% to XP_002510312.1

69% to CYP82C9 cottonwood

MESLTSAIIIIIAFLTPLIYSFIRKSRKASKKREPPQAAGAWPVIGHLHLLSGSQPPHITLGNLADKYGP

IFAIKLGVHRTLIVSNGEIAKECLTTNDKAFANRPKSLAMEILGYDYSMLGFSPYGEYWRQMRKIITLEL

LSKHRLEMLKHVREVEVKTAIKGLYQEWMKSRNSSSKLLVEMKKWFFDITLNVILKVIVGQRFVELLDGE

QDEGSSNSWQDALREFMELSGKFSVSDALPYLRWLDLGGVEKEMKQNLEKLDCVVRKWLQDRRDKKSSGI

AKRQEDFMDVLLTILKDAEELSGRDADTINKATCLALILAASDTTAITLTWTLSLLLNNREALKTAQHEV

DIHVGKERQVTESDAQDLVYLQAVIKESFRLYPAVPLLLPHEAMEECTVNGYHIPAGTRLIINASKVHKD

PSVWLNPQEFQPERFLTSHKDVDFRGQNFDLIPFGSGRRKCPGILFALQVLSLTLATVLHSFEIETSSDN

PIDMCESAGTTNAKASPLEVVLTPRLPAHLY

 

>CYP82C30P gi|255538488|ref|XP_002510309.1  Ricinus communis

gi|223551010|gb|EEF52496.1  Ricinus communis

pseudogene upstream of XP_002510311.1, XP_002510312.1,

XP_002510313.1, XP_002510314.1

52% to CYP82Q1 Stevia rebaudiana, 81% to XP_002510312.1,

57% to CYP82C9 cottonwood

AASG02001625.1

LLFLYCLLLILK &

KKTCKKRSPSQPMGAWLVL &

GDLPL*GGRLGPHLILGN

MADKYASIFTSKMRVHRSLIISSWKLAKECFTTNDKIFANRPDFLAAELMGYNSAMFGFGPYGQY

WRQMRKITTLELLSNYR

 

>CYP82C31 gi|255538492|ref|XP_002510311.1  Ricinus communis

gi|223551012|gb|EEF52498.1  Ricinus communis

50% to CYP82Q1 Stevia rebaudiana

69% to CYP82C9 cottonwood

MESLTSAIIIIIAFVTLLIYSFIRKSRKASKKREPPQAAGAWPVIGHLHLLSGSQPPHITLGNLADKYGP

IFTIKLGVHRTLIVSNGEIAKECLTTNDKAFASRPKSLAMEILGYDYSMLGFSPYGEYWRQMRKIITLEL

LSKHRLEMLKRVREVEVKTAIKGLYQEWMKSRNSSNKILVEMKKWFSDITLNVILKVIVGQRLVELLDGE

QDEGSSNSWQDALREFMELSGKFSVSDALPYLRWLDLGGVEKEMKQNLEKLDCVVRKWLQDRRDKKSSGI

AKRQEGFMDVLLSILNDAEELSGRDADTINKATCLALILAASDTTAITLTWTLSLLLNNREALKAAQHEV

DIHVGKERQVTESDARDLVYLQAIIKESFRLYPAVPLLLPHEAMEECTVNGYHIPAGTRLIINVSKVHED

PSVWLNPQEFQPERFLTSHKDVDFRGQNFDLIPFGSGRRKCPGILFALQVLSLTLATVLHSFEIETSSDN

PIDMCESAGTTNAKASPLEVVLTPRLPAHLY

 

>CYP82C32 gi|255538494|ref|XP_002510312.1  Ricinus communis

gi|223551013|gb|EEF52499.1  Ricinus communis

51% to CYP82Q1 Stevia rebaudiana

61% to CYP82C9 cottonwood

MDLLVVAMFAFLLFLYCLLLVLKGKTYKKRVPPQPKGAWPVLGHLPLLGGPLEPHVILGNMADKYGPIFT

IKMGVHQSLTISSWELVKECFTINDKIFANRPNFLAAELMGYNSAMFGFSPYGQYWRQMRKITTLELLSN

HRLQTFKHVRESEVRAGIIDIYQLWEKSREDNKGVIVKMKQWFADITLNVIFRIIFGKRYINYTTTQEDG

DSDQWREAVRNFFVLSGKFVVSDAVPFLRWLDLGGYEKSMKKTARELDVVVQGWLDEHKRKRLMSGNRVK

GEEDFMDVMLSILDDAEELPSLDADTINKATCLALTLAASGTTKITLTWALAYLLNNLDILKKAQHELDT

HVGKERNVQESDMKNLVYLQAIVKETLRLNPAATLSVPHESTEDCVVGGYHIQKGTKLLVNLWKMHRDSD

VWSAPYEFKPGRFLTTHKDFDVRGQNFELIPFGSGRRMCPGVSFALQVMELTLAGLVHGFDISIPSGKQI

DLDAGFGLETNDETTQLEVILSPRLSAHLYKQ

 

>CYP82C33 gi|255538496|ref|XP_002510313.1  Ricinus communis

gi|223551014|gb|EEF52500.1  Ricinus communis

50% to CYP82H1 Ammi majus

66% to CYP82C11 cottonwood

MENLLIFPTNAIATAVAFLIFVCSVFCITRSMKKKKAAPEAGGAWPLIGHLHLLRGPQPSHIVFGNMADK

YGPIFTIKMGVHPTLVASNWEMAKECFTTNDKAFANRPNILAMDLLGYGRSMFAFSPYGNYWRQIRKIST

LELLSNHRLQMFNHVRESEVGTALKELYKLWEKNKTTNSNNKVLVEMKRWFGDITLNIILRIIVGKFIGY

ETADEGKESNEGWKQALRDFFHLSGRFIAADAVPFLRWLDIGGHEKTMKHTANKLDIVVTEWLNEHKEKK

ASGCVKKGEEDFMDLILDIMDDEAEATLSRDSDTINKATCLALTLAASDTTSVTLIWALSLLVNNPDVLK

KAQDELDVQVGRERQVHESDVNNLIFLKAIVKETLRLYPAGPLSVPHESMKDCTVAGYHIPAGTRLVTNL

SKIHRDPRVWSNPSEYQQERFLTSHQDFDVRGKTFEFIPFGSGRRMCPGVSFALQVLHITLATLLHGFNF

GTPTGEPLDMTENFGLTNLRATPLEVAINPRLGPHLYE

 

>CYP82C34P gi|255538498|ref|XP_002510314.1  Ricinus communis

gi|223551015|gb|EEF52501.1  Ricinus communis

pseudogene

47% to CYP82A6 Pisum sativum, 71% to XP_002510313.1 N-term

top part = 82% to XP_002510313.1, bottom part 73% to XP_002510313.1

MENLHLP &

FPTLAMATTDAVLILFGSVLYISRSMRKKRAAPE &

AGGAWPIIGHLHLLVGPQPPHIVLGNMADKC

APIFSIKMGVHRTLVLSNWEVAKECFTTNDRAFANRPNILAMDLLGYGRSIFGFSSYGNYWRQIRKISTP

ELLSNHRLQMFKHVREFEVGTASKELYKLWGKNKSTNWNNKVLAEMKRWFGDITL &

HIILKIIVGKSIGYETTNEGKESNEGWKQAIRDFFHLSGKSIAADAVPFLRWL

 

GYHIPTGT*LQTNLWKIHRDPRISTGKI &

EFQPERFLTGHKDCDVRGQ &

EFELIPFGSGRRMCPGVSFALQVLQLTLATLLHGFDFARPTSEPIDMTES

 

>CYP82D57P  gi|255538474|ref|XP_002510302.1  Ricinus communis join to XP_002510303

gi|223551003|gb|EEF52489.1  Ricinus communis

pseudogene

AASG02001181.1

Same contig as XP_002510297.1, XP_002510298.1, XP_002510301.1, XP_002510299.1

gi|255538476|ref|XP_002510303.1  Ricinus communis

gi|223551004|gb|EEF52490.1  Ricinus communis

55% to CYP82D5 Vitis

69% to CYP82D2 cottonwood

51% to XP_002510305.1

join two models

MDLLLP*LNGIALVFAAILVFFYSYYLLRRSKSDESKASPKAGGAWPIIGHLPLLVGREL

PHIALSALVDKCGPIFNIKIGI &

LVVNSWELAKELFTVHDAAISALPKSTGAKLLAYDFVTFGFFPSNEYWREMRKLTAEELL

SSRRLEQLKYIRASEVEGSLKDLYKFWEKNKDGANKALVEMKKWFNDINTNVILRMVLGK

RYFGVSAAPDEKKA*RLQKAVREFFHLMGAYVLRDALPLLGWI* &

LGGYEKAMKKTAKEFDTTIGEWLEEHRRKGGTDEVGNKDFMDVLLSALDGINLAGYDAD

TVRKATTM (0)

CALVGGVDTITVTVTWGLAQLLNHPSALRKAQEGLDVHVGKERLVNESDIDKLVYLQAIVK

ETMRLHAVTSLLAREFTEDGTINGSRIPIGTCVLVNIYKIHRNPRVWSNPTKFKPEWFL

NTHKEIDLKDQNFELIPFGAGRRMC &

PGINLSTSTTQLLLASFLQAFELSTPANVPVDMTAAAGLTNSKATPLEVMFKPRFP

 

>CYP82D58 gi|255538480|ref|XP_002510305.1  Ricinus communis

gi|223551006|gb|EEF52492.1  Ricinus communis

50% to CYP82D1 Medicago sativa, 50% to XP_002510312.1

56% to CYP82D2 cottonwood, 59% to CYP82D5 Vitis

MDFLLPNFNTVVTVIFALLLFVYYQVKKFKPATKLSPQPMGAWPIIGHLPLLSGSHLPHLTLATLADKYG

PIFTLRIGIHSVLVVSSSEVTKELFSANDLNVTFRPLLVSAKLMGYNYAFFPFTPGGPYWRETRKISNLH

LLSNRRLELLKHIRTQEVETSIKELYQSWKDNTKIIEMKEWFSDLSMNSLLRMIIGKKFFGAGATGDQTE

GRRFQNGITVLFHYLGTLVLRDAVPFLGWMDVGGHEKRMKRTAKELDDSLEKWLEEHKQKINLGDIENDK

NFMDSMISVLDGKNIEGYDANTINKATCL

SMIAGNETVTVAITWALSLLLTNKHA

LKKAQEELDKYVGKERLVNDADISKLVYLQAIVKETLRLYPPAIIPGPRQFTKDCTIGGYHVAKGTWLMM

NLWKIHRDPNVWPEPADFKPERFLTTHKDIDVRGNNFELLPFGGGRRACPAVSFGLQMMHLTLASLLHAF

EISTPNNALLDMSPGIGLTNKKTTPLEVLISPRLPSYCFE

 

>CYP82D59 gi|255538482|ref|XP_002510306.1  Ricinus communis

gi|223551007|gb|EEF52493.1  Ricinus communis

49% to CYP82C2 Arabidopsis thaliana, 48% to XP_002510305.1

53% to CYP82D2 cottonwood, 55% to CYP82D5 Vitis

MAVLLPYVNTMTAGLIAILFFAFYYVVKRSTRTKKLEPPKAAGGWPILGHLPLLSGNRPAFLTLGNLADK

YGPIYSIQLGRQQAVVVSSKEMARELFTTNDLAVSDRPELTATKHLGYNGVMFAIGRYSEYWREMRKMIM

VELLSSRQVELLKPVRVSETRTFVKVLFKFWEENKNGAGHVLVNLNQWFGDMSLNMLTGVVVGKRYFGTT

AESDRNAAERCKEGLRGFFHYLGLFVLGDAIPSLGWLDVGGHVKGMKKTAKDLNDLASEWLEEHYRTRAS

GETVKNHEQDLMGIMLSVLEGVNFSGHDTDMINKSTCVNLIAGGSDTSSIILVWIISLLLNHQDCLKMAQ

EELDMFVGRERLVDESDVRKLVYIQAIVKETLRLYPPAPLLGPREMREDCILGGYHIKKGTRVLPNVWKI

QTDPNVWPDPLEFKPERFLTSPNKDIDVRGQHMELLPFGSGRRACPGASLAMPMLNLSLATFLQCFEISN

PTDAPIDLTGGVGLNFAKASPLDVIVSPRLSPEIYHME

 

>CYP82J5 gi|255580539|ref|XP_002531094.1  Ricinus communis

gi|223529340|gb|EEF31308.1  Ricinus communis

72% to CYP82J1 Populus trichocarpa

MEFSTTSHLLSISGVLLLLLLYNLWRVRVKRQNYESNKSLLLAPEPSGALPIIGHLHLLGKENTLARTLG

RLADNYGPIFTIWLGVHRTVVVSSYEAIKECFSSNDRILASRPRSSHGQYLSYNYAAFGFASYGPYWSHM

RKLVAIQLLSSHRIKLLKHVQISEVNTLIKELYEKQGSNKKIINISECFEHLTLNMITRMIAGKRYFSSA

DSDSEQEGKRIGKIMKEFMYISGVFVPSDLIPFLGWMNFAGPVKTMKRLSRELDSLTETWIDEHKLKRVK

SEESKNMEEDFIDVMLSLLEDDFFGHSKEDIIKGTVTNLIIAGADTTSITLTWILSNLLNNRRTLELAQQ

ELDLKVGRNRCVQDSDIDNLVYLNAIVKETLRLYPPGPLAVPHEASEDCSIAGYHIPKGTRVFANLWKLH

RDPNVWSSPNEFVPERFLTSQANMDVSGQNFEYIPFGSGRRSCPGLNFAIQAIHLTLAKLLQAFSFTTPL

NVPVDMTEGLGITLPKATPLEIHIIPRLSPELYAW

 

>CYP82K2P gi|255580535|ref|XP_002531092.1  Ricinus communis join to XP_002531091

gi|223529338|gb|EEF31306.1  Ricinus communis

pseudogene

gi|255580533|ref|XP_002531091.1  Ricinus communis

gi|223529337|gb|EEF31305.1  Ricinus communis

join two models

59% to CYP82K1 Populus trichocarpa,

50% to XP_002531093.1

AASG02016975.1 runs off the contig end

LGTRRALVVSSSEAVKECFKTNDRIFLNR &

AASRYMGYNNAMFGLAPYGPYWRDIRKIAILKVLSNTRLLLLKHARASEVETGIRNLYSL

CRRDKTGLTVVDMGQWFASVTLNMVVRTVAGTRLTEDEESQRFIKAISKFMH

LLGVSAISDAIPFTE*LDFQGHVKSMKSTAMELDYFMSKWLEEHLQSWKDEQVTEERDF

IDALLSSVEDQNSLDEHKKENVVKATAL (0)

NLIIAGTDTTSLTLTWALSLLLNHPKVLERAQEELDNNVGKERWVEESDFKNLPLLQAIIK

ETMRLYPAGPLSLPREAMEDCYIGGFHVRKGTILLVNVYKLHHDPRIWPNPCEFQPERFL

GSNIELDDRSQQFYIPFSSGRRSCPGISSAMQMNHLMLARVLQGFNLSTPMNAPVDMSE

ASGISLVKSAPLEAIITPRLQSNLY*

 

>CYP82L7 gi|255580537|ref|XP_002531093.1  Ricinus communis

gi|223529339|gb|EEF31307.1  Ricinus communis

72% to CYP82L1 Populus trichocarpa

MDFSSQTITGLSTLLFLFVLWRSLARKSKSKNINVPEPTGAWPLIGHFHLLARQEPACRILGDIADKTGP

LYSLRLGINRIMVASGWEVVKECFTTNDRIFATRASIAAGKYIGYNNAIFALAPYGQYWRDVRKLATLKL

LSSNRLEKLKHVRLSEVDTFLKDLHNLYVESADSNHAKVIINTLFERLTFNISLRMIVGKQFSSSTYGEE

NSEPWRYKKAIEEAVYLSGTFVMSDAIPWLEWIDHQGHISAMKRTAKELDAVIETWLEEHIKKRSSDECH

KGENDFMDVMLSDLDEDAVMSGHSRDTVIKATAMILTLTGSGSTAVTLTWALSLLLNNPGVLKAAQEELD

IHVGREKWVQESDIENLKYLQAIVKETLRLYPPGPLTGIREASEDCNLGGYFVPKGTRLIINIWQLQRDP

RVWKDPGEFQPERFLTTHSDVDFRGQNFEFIPFSSGRRSCPAITFGLQVVHLTLARVLQGFDLTTIGGLP

VDMTEGLGIALPKVNPVEVIIKPRLGLELYQCL

 

CYP83

 

>CYP83F8 gi|255538870|ref|XP_002510500.1  Ricinus communis

gi|223551201|gb|EEF52687.1  Ricinus communis

73% to CYP83F1v1 cottonwood

MIPYIFLVLALPVFLSFLLQKLKTRRNSSLPPGPKGLPLIGNLHQFDQSAPQNYLWKLSQKYGPLMSLRL

GSVPILVVSSAKMAKDILKTYDLTFCSRPPVLGQQKLSYNGLDLAFAPYNSYWREMRKICVVHLFNSNKV

QSFRPIREFEVSHMLEKISKLAAATKPVDLSEAMMSLTSTIICRVAFGKRYEEEGIERTRFQALLEETQA

LFTSFFVSDYFPFLGFVDRLTGMNRRLEKNFKEFDIFYNQIIQEHLDPSRPKPEQEDILDVLLQIWKDRS

FKAHLTPDHIKAILMNVFVGGTDTSAAAVVWAMTFLMKNSIAMKKAQEEVRHIFGKKGFVDEDDTQQLVY

LKAVIKETMRLQPTVPLLIPRESTQDCNLSGYEIPAKTVVYVNALAIGRDPEVWENPEEFCPERFIGKSV

DLKGQDFELVPFGAGRRICPGIFIGLVTVELSLANLLYKFDWEMPAGMKKEDLDMDVNPGIAVHKKNALC

LEAREYI

 

>CYP83F9 gi|255538866|ref|XP_002510498.1  Ricinus communis

gi|223551199|gb|EEF52685.1  Ricinus communis

73% to CYP83F4 cottonwood

MALLFFLLLFPILLLFLLKKHRATPHLPPGPKGFPFIGNLLQLDNSNIQKHLWQLSKKYGPIMSLRLGFK

PTLIVSSAKMAREVLKTQDLEFCSRPALTGQQKLSYNGLDLAFAPYDDYWREMRKIGVVHLFNSNRVQSF

RPIREDEVSRMIRNVSKLASDSKPVNLTEEMMALTSAAICRVAFGKRYKDGGNEAKRLHQLLNETQALFA

AFFFSDYFPYVGWIVDKLSGLLSRLETNFHEFDIFYQELIDEHLDPEREMPEHDNFLDVLLQIQKDRSIK

IQLTFDHIKAILMNIFVAGTDTSAAAVIWALSFLMKNPEAMRRAQDEIRKLTGKKGFVNEDNIQQLPYLK

AVVKETMRLQPAVPLLVPRETIGKCNLGGYDIIPSTLVYVNAWAIGRDTEVWEKPLEFCPERFLESDIDM

KGQDYELIPFGAGRRICPGIYIGVANIELSLANLLYKFDWKMPDGMKREDIDTDNVLAGISVHKRDHLLL

VAENFI

 

>CYP83F10 gi|223549316|gb|EEF50805.1  Ricinus communis

gi|255542144|ref|XP_002512136.1  Ricinus communis

exon 1 = AASG02022626.1, exon  2 = AASG02022145

61% to CYP83F1v1 cottonwood (64% in overlapping regions)

MAILIFFLLLFPIFLFLFLFKKHTALHLPPGPKGDLIFGNLKQIDNSNLQKYLWELSKQYGDLMSLRLGM

KQTLVVSSSKMAREVLKTQDLEFCSRPRLSGLQRISYDGVDLAFSPYDAYWREMRKISVVHVFNSNRVQS

FRAIREDEIRSMLEKISKLADNSSVVNLSEIMMSVGSGTICRIAFGRRYKEGGSEDKRFHDLLMELQLMF

GSFFFSDYFPYVGYVLDKFSGILSRLDK

VFHAFDDFYQELIDEHLDPKREIPEYENILDVLLQXXXXXXXXXXXXXXXXXXXXXX

NMFVAGTDTSAASVIWAMCFLLKNPREMEKAQEEVRNLVGKK

GFVDEDDIQKLPYLKAVVKEMMRLQPPVPLLIPRETVHRCKLGGYDIPPKTLVYVNAFAVGRDPEAWDNP

LEFHPERFLNSDIDMKGNNYELIPFGAGRRVCPGIFMGIANVEIALANLLYRFDWEMPAGMKREDIDIDG

VNPGIVVHKKGDLCLMAKKNI

 

>CYP83F11P gi|255589898|ref|XP_002535120.1  Ricinus communis

gi|223523988|gb|EEF27263.1  Ricinus communis

pseudogene with two frameshifts

69% to CYP83F1v1 Populus trichocarpa

AASG02011816

MVPFIFLLLALPVFLSFLIPKLKTKLERI &

SRLPPGPKGLPLIGNLHQFDHIAPQAYLWKLSQKYGPLMSLRLGSVPILVVSSAKMAKEI

LKTYDLIFCSRPSIVGQQKLSYNGLDLAFAPYNSYWREMRKICVVHLFNSNRVQSFSPIR

EVEVLHMLEKISRSSKPVDLSQAMMSLTSTIICRIAFGRRYEEDGIERTRFQALLLE

TQALFTSFFVSDYFPFLSFVDRLTGINHRLE &

RKTFKEFDLFYDQIIQEHLDPSIPKPEQEDILDVLLQIWKDRSFKAYLTPDHIKAVLM (0)

NVFVGGTDTSAATVVWAMTFLMKNPIAMKKAQEEVRHIIGKKGFVDEEDTQQLVYLKAVIKETLRLQPTIPLLVP

RKSTQDCNLGGCEIPAHTVVYVNAWAIGRDPEVWENPEEFCPERFIDNPIDLKGQDFELIPFGAGRRICP

GIYIGLTTVELSLANLLYKFDWEMPAGMEKENLDMDVNPGLAVHKKNALCLVARNYI

 

CYP84A

 

>CYP84A50 gi|255586306|ref|XP_002533804.1 ferulate-5-hydroxylase Ricinus communis

gi|223526258|gb|EEF28573.1 ferulate-5-hydroxylase Ricinus communis

gi|255586308|ref|XP_002533805.1 ferulate-5-hydroxylase Ricinus communis

gi|223526259|gb|EEF28574.1 ferulate-5-hydroxylase Ricinus communis

AASG02008037.1 runs off the contig end

EST EG657714.1 continues the seq (green)

83% to CYP84A10 cottonwood

MDSVLQALQPLPMSLMLIIPSLFLLGLISRLRRRLPYPPGPKGLPIIGNMMLMDHLTHRGLAKLAKEYGG

LFHLRMGNIHMMAVSSPEVARQVLQAQDNIFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKL

FSRKRAESWVSVRDEVDSMVKATAASKGK &

ALNVGELIFTLT

MNIIYRAAFGSKNEGQDEFIRILQEFSKLFGAFNIADFIPWLGWIDPQGLNSRLVKARNSLDRFIDMIID

DHIHKRKQGHVPDDDHTDMVDDLLAFYSEETKVAECEDLQNSIKLTRDNIKAIIM (0)

DVMFGGTETVASAIE

WALAELMKCPEELKKVQKELAEVVGLERRVEESDLDKLTYLKCMLK

ETLRLHPPIPLLLHETSESSEVAGYYLPAKSRVMINVWAIGRDKNSWEDPDAFKPSRFLK

QGVPDFKGNNFEFIPFGSGRTSCPGMQLGLYALDLAVANLLHCFTWELPDGMKPNELDMN

DVFGLTAPRATXXXXXXXXXXXXXX*

 

>CYP84A51 gi|255543847|ref|XP_002512986.1 ferulate-5-hydroxylase Ricinus communis

gi|223547997|gb|EEF49489.1 ferulate-5-hydroxylase Ricinus communis

exon 1

gi|255543849|ref|XP_002512987.1 ferulate-5-hydroxylase Ricinus communis

gi|223547998|gb|EEF49490.1 ferulate-5-hydroxylase Ricinus communis

EXON 2

76% to CYP84A12 cottonwood

AASG02003947

MDSLLHLQSLQFSSMLLILLSLLISIIFLLRSRRKLPYPPGPKGYPIFGNMNIVDQLTHRGLARLAKQYG

GLFHLQMGGLHVVAVSTPEMAREVLQVQDGIFSNRPANVAITYLTYDRADMAFANYGPFWRQMRKICVMK

LFSRRRAESWASVREEVDSMVRIVMEKTGSQVNIGELVFALTRNITYRAAFGSVSDEGQDEFMKILQEFS

KLFGAFNVADFFPRMGWMHAQDFNKRLTRARQSLDGFIDKVIDEHMGKKNSSKITKDENEEETDMVDELM

AFYSEEDVAKNGIYDSQSTIKLTRDNIKAIIM (0)

DVMFGGTETVASAIEWAMAELMNSPEELNKVQQQLIEVVGLNRKVQESDLEN

LTYLNCALKETLRLHPPIPLLLHESAEDSTVAGYKIPAKSRIMINAWAIGRDPSAWADPN

KFKPSRFLEDGAPDFKGSNFEFIPFGSGRRSCPGMQLGLYGLELTVAHLLHCFKWELDEG

VKASELDMNDVFGLTAPRAVRLVAVPTYRLNCSF*

 

CYP89

 

>CYP89A94 gi|255557719|ref|XP_002519889.1  Ricinus communis

gi|223540935|gb|EEF42493.1  Ricinus communis

66% to CYP89A26 cottonwood

MEPGLVLVTILCLCVSLHSLFNLFFHAKRLPPGPPTVPILGNLLWLLKFSKNFSSIEPLLRQLRAKYGPV

VTLYLGSRPSIFITTHEAAHRALVQTGSLFASRPPALTTSSIFFSNQHTVSTAPYGALWRLLRRNFMSRI

HPSRLHLYSHGRKWALSVLKNKLMADVDQSSNNTGIVVVVGHFQHAMFCLLVCMCFGEKLEDNVIREIEA

VQRASLTNFIRFNVFNFIPKLGKVLFPSLWKQLLEIRRNQENVLLPLIKARQEEHKCDMNRASYVDSLLH

LRIPDSGREFSDGELVSLCSEFINGGTDTSTTTLQWVMANLVKQQEIQKKLLKEINSVTEEGREIEEEYL

KKMPYLKAVILETLRRHPPGHFILPRAVTEEIKFNGYDIPKNAIVNFTVAEMGWDPKVWEDPMEFKPERF

MNNNGEEKEEEEVILFDIKGIREIKMMPFGAGRRVCPAISMALLHLEYFVANLVRDFEWNDENGCGEGVD

LSEIQEFTMVMKNPLKVRITPRRQIT

 

>CYP89A95 gi|255557971|ref|XP_002520014.1  Ricinus communis

gi|223540778|gb|EEF42338.1  Ricinus communis

67% to CYP89A15v1 cottonwood

METWFIILLSLSLCLFLNSLFSLLKPTQKATHKLPPGPFSIPIISSLKWLVKSFSELEPILRSLRAKYGP

VITLRIGPRPAIFITTHSLAHEALVQNGAVFADRPPPLAISKIISSNQHNISSAPYGPTWRLLRRNLTSE

ILHPSRVKSYSQARKWVIEILINRLKNQSETGQYVLVKEHFHYTMFCLLVLMCFGDKLDEEKIKEVQKVQ

RNLLLSFNRFNILNFWPSLTRILFCKRWEEFYKLQQDKEEVLIPLIRARKNAKLERLSKDKEDNIGKQEF

IVSYVDTLLDLQLPNENRKLEEKEIVSLCSEFLDAGTDTTSTALQWIMANLIKYSHIQEKLFMEIKGVMS

AEEEEVKEEDLQKMPYLKAVTLEGLRRHPPGHFVLPHAVTHDTVLDGFSIPKDGTVNFMVAEMALDPKVW

KDPEAFSPERFLNDDGVEAFDMTGSREIKMMPFGVGRRICPGYGLAMLHLEYFVANLIWNFRWMAVDGED

VDLSEKQEFTVVMKNPLKARISPRTKPREC

 

>CYP89A96 gi|255566108|ref|XP_002524042.1  Ricinus communis

gi|223536769|gb|EEF38410.1  Ricinus communis

66% to CYP89A18 cottonwood

MEIWLFIPISLAVSILLKLVINHLLSTKNSTHKLPPGPSPLPILGSSLWLTTTVFDLESALRSLHSKFGP

LLTLHMGSRPAIFIADRSLAHEALIQNSSIFADRPPALGMEKINTSDQHTISSAFYGPTWRLLRRNLTAK

VLHPSNIKSYSHTRKWVVQILKDRLESEFKERGRIQVMGHFQYAMFCLLAFMCFGDNLEEDQIRKIEEVQ

RQLLLNFVEFSVFSFWPSVTKVLFRKRWDEYMQIRKNQENVLIPLLRSRKAQRDKETDSVLPYVDTLMDL

GLPDEKRKLEEEEIVSLLSEILNGGTETTATALQWIMANLVKYPHIQEKLYMEIRRIVGEGEDLIKEDEL

QKMPFLKAVILEGLRRHPPAHMVVPHAVTEDTVLDKYLIPKNGTVNFMVAEMGWDSKVWKDPMAFKPERF

MGSEYEHEVFDITGSREIKMMPFGLGRRMCPGHGLAMLHLEYLVANMVWSYEWKGMDGNGVDLSEKLEFS

VVMKNPLQAQISPRRRHKLIIDKI

 

>CYP89A97 gi|255566106|ref|XP_002524041.1  Ricinus communis

gi|223536768|gb|EEF38409.1  Ricinus communis

62% to CYP89A12 cottonwood

METWFLIILVSFFIFIFLKALLNLFFSSMNKKPILTLPPGPLSLPIIGNVNVLWLLKSIGDLVPIVRSLH

AKFGPIVTLRIGPRPAIFIADRHLAHQALIQKSAVFADRPVSHALNTIISGNQHNINQGFFGPTWRILRR

NLNSEILQSSRVKSYSHARKWALTNLLNCFEMQSKSGDYIRVIDHVRYAVFSLLLFMCFGEKFEREKIEE

IQRVVIGMYDTKFNILNFWQRFSRIMYSKLWSEFLQLQKKQEDLFIPLMKSRKKLKEERLSKTDHNKKND

DYVLSYVDTIVDLQLPHEKRKLSDIEMVALCNEFLFGGSDTTGNVIQWIMANLVMYQHIQEKLFVEIKGV

VGDAEKEIKEDDLQKMPYLKAVVLEGLRRHPPTHFLLPHAVTEDVMLGGYLVPKKGSVNFMVADIGWDPK

VWEDPMVFNPERFIGGEAFDIAGIKEIKMMPFGAGRRMCPGYGLALLHLEYFVANLVWNFEWKAVDGNDI

DLSQKQEVTMVMKNPLEVRISPRLSSII

 

>CYP89A98 gi|255566104|ref|XP_002524040.1  Ricinus communis

gi|223536767|gb|EEF38408.1  Ricinus communis

69% to CYP89A12 cottonwood

METWFLIIVTLCISSLIKSLFNLFFQSKKQSLPPGPVKFPIIGNVLWLRKSFFELESIIRSLHKELGPMI

TLHIGSRPNIFIADRSLAHQALVRNGTVFANRPRAPATTKITTHNQHSVNSAFYGPTWRLLRRNLTSEIL

HPSRVKSYSHARKWVLEILLNRFESQSKSGDPVLVVDNFQYAMFCLLVLMCFGDKLDQKQIEEIERVERT

GLLSIRRFDKLNFMPRLTKIVFRKRWSEFLQLQKDREEVLIPLIRARKKVNEEIKSKNCNNEFVLSYVDT

LFDLQLPDEKRKLREKEMVALCNEFLNAGTDTTSTALQWVMANLVKYPYIQEKLFMEIKSVVADGEEEVK

EDDLQKMSYLKAVILEGLRRHPPTHFVLPHAVTEDVVLGKYLVPKNANINFMVAEMGWDPEVWEEPMAFK

PERFMGSDSNGEVFDITGSREIKMMPFGVGRRICPGYGLALLHLEYFVANLVWNFQWKAIDGDDIDLSEK

QQFTIVMKNPLQAHISPRFKRNNHNI

 

>CYP89A99 gi|255566098|ref|XP_002524037.1  Ricinus communis

gi|223536764|gb|EEF38405.1  Ricinus communis

68% to CYP89A18 cottonwood

METWFIIIISLLISALIKALFSIFFQSKKHSLPPNPVNFPIIRNILWFRKSFSELEPIIRYFHKDIGPII

TLHIGFYPNIFIADHSLAHQALVQNGAIFADRPRALAANNVGLSVYGPTWRLLRRNLMSEILHTSRVKSY

SHARKWVLEILLNRFKSQSECGHPVLVADNFQYAMFCLLVLMCFGDKLDQKQIEEIQRVEELLFANFERL

EILNLWPSVTKILFRKRWSEFLQLEKEREDVIIPLIRARKSLKEERQSKNSEDQKDDNEYVLSYVDTLLD

LQLPDEKRKLTEKEMVVLCNEFLNAGTDTATSSLQWIMANLVKYPHIQEKLFMEIKGVVTEGEEMVKEDD

LQKMPYLKAVILEGLRRHPPVHFTIPHAVTEDVVLDKYAIPKNAQINFMVADMGLDPKVWEDPMAFKPER

FISGDINGAGGEVFDITGSREIKMMPFGVGRRICPAYGLAILQLEYFVANLVWSFEWKAIDGDDVDLSEV

LDFIVNMKNPLQAHISPRLNRGF

 

>CYP89A100 gi|255566096|ref|XP_002524036.1  Ricinus communis

gi|223536763|gb|EEF38404.1  Ricinus communis

69% to CYP89A12 cottonwood

METWFLVIITLCISALIKSLVNIFFESKKHRLPPGPVNFPIIGNILWLRKSFFELESIIRSLHKNLGPMI

TLHISTRPTIFIADRSLAHQALVQNGAVFANRPRAPATSKITTSNQHVISSAFYGPTWRLLRRNLTSEIL

HPSRIKCYSHARKWILEILLNLFESQSKSEDPVLVVGNFQYAMFCLLVLMCFGDKLGQKQIEEIERVQRS

AIVNSRRFEKLNFMPRLTKILFRKDWSEFLQLQKDREDVLIPLIRARKKVNEERQSKKSNSKKDDEYVLS

YLDTLFDLQLPDEKRKLTEKEILSLCNEFLNAGTDTTSTTLQWIMANLVKYPYIQEKLFMEIKSVVADGE

EEVKEDHLQKMPYLKAVILEGLRRHPPAHFLLPHAVIEDVVLGKYLVPKTANINFMVAEMGLDPEVWEDP

MAFKPERFMGSSDNSSSEGGGGEVFDITGSREIKMMPFGAGRRICPGYGLAMLHLEYFVANLVWNFEWKA

IDGDDIDLSQKQEFTIVMKNPLKAHISPRLNRGF

 

>CYP89A101 gi|255566094|ref|XP_002524035.1  Ricinus communis

gi|223536762|gb|EEF38403.1  Ricinus communis

66% to CYP89A12 cottonwood

METRFIITIILSLFISALIRTLFNLFFKSKKHSLPPTPVNFPIIRNILWLRKSFSELEPIIRSFQKDMGP

VITLHIGFRPNIFIADHFLAHRALVQNGAVFADRPRVVAANNVGLSVYGLTWRLFRRNLTSEILHPSRVK

SYSNARKWVLEILLDRFELLSKCGNPVLVAGNFQYAMFCLLVLMCFGDKLDQKQIEEIQRVEQLVFANLE

RLVELNLWPSVTKILFRKRWAEFLQLEKEREDVMTPLIRARKKLKEERQSKNYKDQKDDEYVLSYVDTLL

DLQLPGEKRKLTEKEMIVLCNEFLNAGTDTTSSSLQWIMANLVKYPCIQERLFMEIKEVVADGEKNVKEE

DLQKMPYLKAVVLEGLRRHPPAHLVLPHAVTEDIVLGKYLIPKNANINFMIADMGLDPEVWEDPMAFKPE

RFISGDSNNAGAEVFDITGSREIKMMPFGVGRRICPAYGLAILHLEYFVANLVWSFGWKAINGDDVDLSE

VQDFTVVMKNPLKAHISRRGFFEP

 

>CYP89A102 gi|255566092|ref|XP_002524034.1  Ricinus communis

gi|223536761|gb|EEF38402.1  Ricinus communis

65% to CYP89A18 cottonwood

METWYLVLILIISITSFLPFKSLFPIRNLPPGPLSFNLMFLRNSVNLEAILRSLHSKFGPIYTLYMGHIP

VIFIADHSLAHQALVQNSAIFADRPPDFAISKVLSSNQLSVTTGFYGPTWRLLRRNLTSKILHPLRVKSY

GRARKRVFQILRNRIGSQAKSGHPVFLSEHFHFSLFALSAFMCFGDKLDEDQIKQTEKVQREILLCYRKY

NRLNFLPRLTKIFMRRQWDEFFQIRKNQENVLIPLIKARKKLKEVNNEERQYDFTLSYVDTLFDLEHPEE

KRKLHDDEMVSLCSEFLNAGADATATTLEWIMANLVKYPEIQEKILVEIKGVIKDGEEEVKEGNLQKMPY

LKAVVLEGLRRHPPAHFVLPHAVTQDAVLHKYLIPKNGIVSFLIADIGLDPKVWEDPMAFKPERFLNDEG

KAFDITGSREIKMMPFGAGRRICPGYGLAMLLLEYFVANLIWNFEWRAVDGDEIDLSEKPEFTVVMKNPL

QAQISPRFIK

 

>CYP89K1 gi|255616623|ref|XP_002539766.1  Ricinus communis

gi|223502570|gb|EEF22617.1  Ricinus communis

34% to CYP89E1   rice N-term, different from XP_002534544.1

AASG02045737.1

gi|255581363|ref|XP_002531491.1  Ricinus communis

gi|223528900|gb|EEF30898.1  Ricinus communis

AASG02012505.1 runs off the end, no ESTs extend seq.

Yellow region is exact overlap (join pieces)

51% to CYP89A12 cottonwood, 47% to CYP89A2 Arabidopsis thaliana

64% to XP_002534544.1

16803099_peptide|Rcommunis|29581.t000007|29581.m000259

29581: 146612 – 147508,

MELYIFIFIFSCLCLLLKPLFHLLLPPSNPATNLPPGPSKISLLARFFLGRKSFYELGPIISSLRKKYGP

LITVHLGSQPTLFITNSSLAHQALIQNGAVFADRPPSINN

LIASNSKKIISKSPYGPIWRALRRNLTSGVLHPAQLKSFSRVRKRVLSNLIRSLGDDSEV

NKVVYVEKHFRHAIFSLLVLLCFGENVEENQIVEIENAQ

MKLFKSFPRFKVFIMMPRLGKFLFKKLWKELNEIVTGFDDCIKPLIWLRKKDLEQEISRTDQDCTFYVDT

LLNLQVPGEEGKITDAEVLGLCNEFIAAGTDTTMLSLEWIMANLVKYPTIQARILEEIKAVTGDEGECIK

EEDLQKMPYLKAVILEGLRRHPPGYALATPHAVTEDIELGGYTVPKGTAANFLIADMGRDPNIWDDPMEF

KPERFSRNEAQDFDVTGIREIKMMPFGAGRRICPGYGLAMLHLEYLVANLVWQFEWRPVNGEDVDLTEKY

GITISMKNPLRVLLSPRF

 

>CYP89K2 gi|255588234|ref|XP_002534544.1  Ricinus communis

gi|223525077|gb|EEF27840.1  Ricinus communis

AASG02010089.1 no ESTs extend seq. missing 64 aa at N-term

50% to CYP89A18 cottonwood, 52% to XP_002524040.1

50% to CYP89A2 Arabidopsis thaliana

GSSPTIFITNNTLVHQALVLNGATFADRPKSIHNLTASHSWKII

MSNSPYGSTWRALRRNLTGGVLHPSQLKSFSHARKRVLDNLIAGLEHDSKDNKAIYVAEHFRYAIFSLLV

LLCFGDNIDDNQMKEIEVAQKESFLSYQRMKLFFIMPKLGKFFFRKLWNELNNAMINCNNVFLFMVRSRK

QEISARKNQESLSYVDTLLDFQLPGEEGTLAENHIVGLCSEFITAGTDSTTSALQWIMACIVKYPSVQAK

VYEEMKAVLGQENQWVQEDDLQKMPYLRAVILEGLRRHPPGYAPATPHAVTEDVELGGYTLPKGTAVNFL

IPDIGRDPNVWEHPLEFKPERLLKSDDTSEDDSFDITGKGEIKMMPFGAGRRICPGNGVAMLHLTYIVAN

LVWHFEWSPPDGEEVDLTEKYEITISMKRALKACLSPRFK

 

CYP92

 

>CYP92A59 gi|255560607|ref|XP_002521317.1 flavonoid 3-hydroxylase Ricinus communis

gi|223539395|gb|EEF40985.1 flavonoid 3-hydroxylase Ricinus communis

82% to CYP92A19 cottonwood

METPTWVAYASVWLATVALILLSRRLRRRKLNLPPGPKPWPIIGNLNLIGALPHRSLHSLSQTYGPIMQL

KFGSFPVVVGSSVEMAKAILKTHDVAFAGRPKIAAGKYTTYNYSDITWSPYGAYWRQARKMCVMELFSAK

RLESYEYIRIEELRLLLKSMFLSSGNPINLKDHLTDLSLNVISRMVLGKKYTVKSENVDEIVTPEEFKEM

LDELFLLNGVLDIGDSISWLAFLDLQGYIKRMKTVSKKFDRFLEHVLDEHDARRKRVDNHVAKDMVDVLL

QLADDPNLEIKLERNGVKGFTQDLIAGGTESSAVTVEWAISELLRKPEIFGKATEELDRVIGRERWVEEK

DIVNLPFIYAIIKETMRLHPVAPMLVPRQCREDTKVAGYDIPEGTRVLVNVWTIGRDPSIWDNPDEFCPE

RFIGKTIDVKGCDFELLPFGAGRRMCPGYPLGIKVIQASLANLLHGFKWKLPGDMKIEDLNMEEIFGLST

PKKFPLVVVAEPRLPSHVYSL

 

>CYP92A60 gi|255550439|ref|XP_002516270.1 flavonoid 3-hydroxylase Ricinus communis

gi|223544756|gb|EEF46272.1 flavonoid 3-hydroxylase Ricinus communis

67% to CYP92A25 cottonwood

MMDAPLNQSWILSAMAWLAGAGLLFLAKLFISHHHSSLKLPPGPKPWPIIGNLNLIGPLPHRSLHKLAQQ

YGHIMQLRFGSFPVVVASSAEMAKQILKTNDEIFASRPKFAAGKYTAYNYSNVLWAPYGEYWRQGRKLYL

NELFNSKRLQSYEYIRVEEMHNFLSGVHSLSCSGKAVLLKDHLSHYTLSILSRIVLGKKYSSAESESQTN

IVTPEEFQEMLDELFSLNGVFHIGDWIPWLDFLDLQGYVKRMKALKIKFDRFHDHVISEHRIKRKGALLE

DSAPKNIVDHMLQLADNPDLDIKLNTDSVKGFSQEIIGGGKDTAAAAVEWAMSELMKHPNLVKKATDELD

RVVGKQRWVEEKDIPNLPYIDAIMKETMRKHPVGTMLAPRLATKDCKVGGYDILKGSRVVINTWSMGRDP

SIWDEPEEFRPERFLDKTIDVKGQSFELLPFGSGRRMCPGYSLGLKMIRSCLANLLHGFNWKLPDNMKPE

DLSMDEVYGLATLRKSPLVAVAEPRLPLHLY

 

>CYP92A61P gi|255604505|ref|XP_002538235.1 flavonoid 3-hydroxylase Ricinus communis

gi|223513153|gb|EEF24148.1 flavonoid 3-hydroxylase Ricinus communis

pseudogene

AASG02035077.1

gi|223534829|gb|EEF36518.1 flavonoid 3-hydroxylase Ricinus communis

gi|255569720|ref|XP_002525824.1 flavonoid 3-hydroxylase Ricinus communis

98% to XP_002516018.1, 69% to CYP92A24 cottonwood, 100% to XP_002538235.1

100% to

join

CYP92A gi|255599825|ref|XP_002537317.1 flavonoid 3-hydroxylase Ricinus communis

gi|223516748|gb|EEF25066.1 flavonoid 3-hydroxylase Ricinus communis

Only 1 aa diff from XP_002516018.1 and truncated

AASG02014049.1

YFAVAFFFLSKLFTSRHYYNRSLNLPPGPKPWPIIGNFNLIGHLPHQSLHKLSQKFGPIM

QLKFGSYPVVIVSSAEMAKQILRTNDHIFASRPQTAAGKYTTYYYSNVTWAPYGAYWRQG

RKIYLHELFSSKRLDSYHDIRVEEMRAFVSPIHALSVTGKPILLKDHLSGATLSIISRIV

LGKKYFITESESESVSESETSVITTLGEFQKILDELFLLNGVLNIGDWIP*LAFLDLQGY

VKRMKALKVKWDRFHDHVLGEHKAKKAEVKNFVPKDMVDLLLQLADDPELEVKLNNDSVK

GFIQ (0)

DLIAGGTDTSATTVEWAMSELLKQPSLIKKATEELDRVIGKERWVEEKDIPQLPYIDAIMKETMRKHPV

AVMLAPHYALEEAKVNGHDIAKGTTVFINTWSIDRDPLLWDDPEEFRPERFLG

KAIDVKGQSFELLPFGSGRRMCPGYSLGLKMIQSSLANLLHGFNWKLPDDMKPEDLSMDEVYGLATPRKF

PLVPVTEPRLPINLY

 

>CYP92A62 gi|255549934|ref|XP_002516018.1 flavonoid 3-hydroxylase Ricinus communis

gi|223544923|gb|EEF46438.1 flavonoid 3-hydroxylase Ricinus communis

69% to CYP92A24 cottonwood

MDAALTLLCLTLPVAFFFLSKLFTSRHYYNRSLNLPPGPKPWPIIGNFNLIGHLPHQSLHKLSQKFGPIM

QLKFGSYPVVIVSSAEMAKQILRTNDHIFASRPQTAAGKYTTYNYSNVTWAPYGAYWRQGRKIYLHELFS

SKRLDSYHDIRVEEMRAFVSRIHTLSVTGKPILLKDHLSRATLSIISRIVLGKKYFITESESESLSESET

SVITTLGEFQKILDELFLLNGVMNIGDWIPWLAFLDLQGYVKRMKALKVKWDRFHDHVLGEHKAKKAEVK

NFVPKDMVDLLLQLADDPELEVKLNNDSVKGFIQDLIAGGTDTSATTVEWAMSELLKQPSLIKKATEELD

RVIGKERWVEEKDIPQLPYIDAIMKETMRKHPVAVMLAPHYALEDAKVNGHDIAKGTTVFINTWSIGRDP

LLWDDPEEFRPERFLGKAIDVKGQSFELLPFGSGRRMCPGYSLGLKMIQSSLANLLHGFNWKLPDDMKPE

DLSMDEVYGLATPRKFPLVAVTEPRLPINLY

 

CYP93A

 

>CYP93A52 gi|255583272|ref|XP_002532400.1  Ricinus communis

gi|223527896|gb|EEF29985.1  Ricinus communis

63% to CYP93A4 Populus trichocarpa, 81% to CYP93A6 cottonwood

AASG02008279 No ESTs close the gap

MADILQDYALQLLIFLGSLFLLQTIFAKTRNKAHLPPSPRALPIIGHMHLLGPIPHQAFHKLSTRYGPLL

YFFIGSKPCVLASTPEIAREILKNNESNFMNRPKVANLHYLTYGSADFATIPYGPHWKFMKKLCMTELLG

SRTLDQFLPIRQQETMRFLKVVLSKAAAKDAVNIGGELMRLTNNIMSRMVLRTRCSGKDDEADEVRKLVK

ELNELGAKFNLSDSIWFCKNLDLQGFEKRLKDARDRYDSMIERIIKEHEEARKKKEMDDG

GDRVKDVLDILLDIYEDEHAERRLTIENXXXXXX

NIFGAGTDTSSITVEWGLAELINHPHVMEKARLEIDSVVGNTRLVEESDIANLPYLQAIVKEVLRLHPTG

PLIVRESSEDCTIAGYTIPAKTRLFVNIWSLGRDPNHWENPLEFKPERFTGEEWSAKNNMLDVRGQHFHL

LPFGTGRRSCPGASFALQFVPTTLAAMIQCFEWRVGDSENGTVDMEEGPGLTLPRAHSLVCFPAVRLSPL

LSI

 

>CYP93A53 gi|255583270|ref|XP_002532399.1  Ricinus communis

gi|223527895|gb|EEF29984.1  Ricinus communis

74% to CYP93A4 Populus trichocarpa

AASG02023403.1

AASG02015663.1

MADFQEYMILLLVWLVSMIVVRAVLRKFQAKAHLPPSPPALPIIGHLHLLGSIPHQGLHKLSIRYGPLIH

ISLGSIPCVVASSPETAKAFLKTHETSFLDRPKMIAVDYLTYGSADFSFTPYGPYWKFMKKLCMTELLGG

RVLDQLLPVRHEEIRRFLKIMLKKANAGESIDVGGQLIRVTNNVISRMIMNQTCSEDEDEANNVRKLVQE

TAELTGKFNLSDFIWLCKNLDLQGFGRRMKEVRDKFDTMTERIITKHEEERKIKKDTG

RGELMKDLLHILLDIQEDENSEMKLTRENIKAFIL (0)

XXXXXXXXXXXXXXXXXXAELINHPDIMKKAREEIDFVIGKSRLVQELDIPNLPYLQAVVKETLRLHPTG

PLIVRESTETCA

INGYEIPARTRLFVNVWALGRDPNHWDNPLEFSPERFMNAESNTKSQLDVKGQHFHLLPFGSGRRGCPGT

SLALQMVQSSLVAMIQCFEWKVNGGNGTVDMEEGPGLTLSRANPLICVPVARLKPFPSF

 

>CYP93A54 gi|255544284|ref|XP_002513204.1  Ricinus communis

gi|223547702|gb|EEF49195.1  Ricinus communis

63% to CYP93A4 cottonwood

MEESSTILPSIDYAQYQTEKMAELQEYTTLFLLWLVSTFLVRAILSRTRSKAQLPPSPISLPIIGHLHLL

RPIPHQALHKLSQRFGPLFHLSFGSVPCVVASSPEMAKEFLKTHEMSFCNRPSTAAVRCLTYGASGFSFA

PYGPYWKFMKQICMTQLLGGRTLDSFSDVRRQEIGTFLKLMLQKSQQGKEVNLGEELMNFANNIISRMTM

GKRCSTTDDEAGDVRKLIEEVGVLTGEFNFQDYIWFCKNIDIQGFGKRLKKVQVRLDAMMESVLKEHEEV

RTMMKNSELGDNDAKKDLVDILLDIMEDESSEMRLSRESVKAFILEMFTTGTGTSAGVIQWAMAELINHP

NIFKKAREEIDSVVGKNRLIKELDIQSLPYLQAIIKETLRLHPSGPLFTRESSQDCNIGGYQIPAKTRLI

VNVWAIGRDPNYWENPMEFKPERFMSEEDCTMSSPLTDVRGQHYHLLPFGSGRRSCPGTSLALQVIQTTL

GSMVQCFDWKIINGDNNNSNGNNIDMSEAAGISLEMANPLMCEPVTRLQYYENIIC

 

>CYP93B21 gi|255580554|ref|XP_002531101.1  Ricinus communis

gi|223529297|gb|EEF31266.1  Ricinus communis

47% to CYP93A4   Populus trichocarpa

53% to CYP93B7 exon 1 only, no ESTs extend the seq.

AASG02003357

MILVYAILFLLSLVFLKVIFYRHHRHLPPSPLALPIIGHLHLLAPLMHQALQKLSSRHGPLMYLRLGSIH

SIVVSNPEMAKEFLKTHDLTFSYRIFNQAINYLTYDAATPLAPYSSPWIFVKKLSISELLGSHTLNKFLP

IRTQELHSFLRLLFEKSKTGETVNVSKEILKLTNNIISQMILSSRCSETDDADGGRVIKLVREVTEIFGE

FNVSDFIWIFRNWDLQGIRRRLEDIRKRYDALLEKIIKEREEARKEKIDKRDSINGVKDFLDLMLDVVED

SKSEVQLSRDHLKGLVM (0)

 

>CYP93B22 gi|255580558|ref|XP_002531103.1  Ricinus communis

gi|223529299|gb|EEF31268.1  Ricinus communis

66% to CYP93B7 cottonwood

possible GC boundary after KALLL

MIFELLSSFAFILFIVIYFIQKKQWQNLPPSPTALPIIGHLHLLRPLIHHSFRDISSRYGPLIYLKLGSV

PCVVASTPELAKEFLKTHELTFSARKRSIAIDHLTYNSSFAFSPYGPYWRFIKKISAFELLGNRMLNQFL

PIRRKELLHFLQGFYAKSKAGESVNVTHELVKLSNNIISQMMLSMSSCETESEAEIARTVIRE

VTQIFGEFNVSDFIWFCKNIDFQ

GFRKRID

HTFNKYDGLLEKLITEREKQRKKNKSDGVKHEAMNFLDIMLDVMEDETAEMKLTRDHIKALLL (0)

DFLTAATDTTAVTLEWALAELINQPQVLAKAREEINRVIGNERIVQESDNPNLPYIQAILKETFRLHPPI

PMVARKSIQDCKISGYKIPANCLLFVNMWSIGRDPKYWKNPLQFEPERFLQSSKEDSLTSCIDIRGQHYQ

LLPFGTGRRSCPGIALAMQELPTTLAAMIQCFDWKVINPPGMKNNGDGNVVDMTERPGLTAPRVHDLVCT

PVPLLPNLIDPSCENY

 

CYP98

 

>CYP98A63 gi|255570490|ref|XP_002526203.1  Ricinus communis

gi|223534481|gb|EEF36182.1  Ricinus communis

91% to CYP98A27 cottonwood

MAFPLIVTIPISILLLILTYKLYYRLRFKLPPGPRPWPIVGNLYDIKPVRFRCFAEWAQAYGPIISVWFG

STLNVIVSNTELAKEVLKEHDQQLADRHRSRSAAKFSRDGKDLIWADYGPHYVKVRKVCTLELFTPKRLD

ALRPIREDEVTAMVESIFMDCTNPENNGKSVLVKKYLGAVAFNNITRLAFGKRFVNAEGIMDEQGKEFKA

IVANGLKLGASLAMAEHIPWLRWMFPLEEDAFAKHGARRDRLTRAIMEEHTLARQKSGGAKQHFVDALLT

LQQKYDLSEDTIIGLLWDMITAGMDTTAITVEWAMAELIKNPRVQQKVQEELDRVIGFERVLTEADFSSL

PYLQCIAKEGLRLHPPTPLMLPHRANSNVKIGGYDIPKGSNVHVNVWAVARDPAIWKSPEEFRPERFLEE

DVDMKGHDFRLLPFGAGRRICPGAQLGINLVTSMLGHLLHHFRWTPPEGVKPEEIDMSENPGLVTYMRTP

LQAVATPRLPSELYKRVAVDM

 

>CYP98A64 gi|255570488|ref|XP_002526202.1  Ricinus communis

gi|223534480|gb|EEF36181.1  Ricinus communis

78% to CYP98A27 cottonwood

AASG02033185.1 runs off the contig

EST EG665749.1 extends seq in green

MALPLLLTSVLLILLAYRLYHLLRFRLPPGPRPWPIVGNLYHIKPIRFRCFAEWAQTYGPIVS

VWFGSSLNVIVSSTELAREVLKEHDQHLADRSRSRSATR

MSRGGKDLIWADYGPHYVKVRKVCTIELFSIKRLESLRPIREDEVTAMVESIYSDCTNPENTIRSLLVRK

YLEAVAFNNITRLAFGKRFVNEEGVMEEQGKAFKASVASGTKLGASLSMSEHIPWLRWMFPLDNEVIDKH

TAERDRLTREIMEEHTVARRKTGDTKQHFIDALLTLKEEYDLSEDTVIGLLWDMIVAGTDTTAIAVEWTM

AELVKNPRVQQKAQEELDRVIGSKRVLNESDFSSLPYLQCVAKEGLRLHPPTPLMLPHRASDSVKIGGYD

IPKGSIVQVNVWAIARDPTVWKNPEEFWPERFLEEDVDMKGHDFRLLPFGAGRRVCPGAQLSISLVTSML

GHLLHHFHWTLPSGVKAEDIDMSESPGRVTYMRTPLQAVATPRLP

 

>CYP98A65 gi|223550681|gb|EEF52168.1  Ricinus communis

gi|255541003|ref|XP_002511566.1  Ricinus communis

58% to CYP98A27 cottonwood, 55% to CYP98A3 Arab.

MQKMDPFLLFISIVFIFSFTCKYYQKLKYKLPPGPFPWPVLGNLPNIEPDVSKCLDNWSQTYGRIISIWV

GSTLNVVVSSSELAEEVLKDKDQVLAHRPRNKAVSIMSRNGKGILWADYGPQYARLRKICMLELFSQKGT

EAFRPIREGEVRAMIESIYKDSTCLDNKQDDNLFLRKYLNPVVLNSVSMLVLGSRFLTREGVTNELGSEF

KAIFGDEMKLATSLTPAEHIWWLNWIFRFRNKAFSGLLARRDSLIRAIMEEHKKVCDAKQHLVDSLLNLQ

ETSNGICDEDITGLLWDVTTAGMETSTVVVEYTMAQLVKNPRLQLKAQEELDHVIGNKRVMSESDISNLP

YLRCVVKEALRLHPPAPFLQPHKANADVKIGGYDIPEGTNIHVNVRAIGRDPEIWKDSLEFKPERFLEED

VEMKGYDFRLLPFGAGRRMCPAAQLGINLATSMIGHLLHHFNWSLPDAVVPEEIDLSAIPGSPSFLKTPL

QVVPTLRLPAHLYKHESYDAK

 

CYP701

 

>CYP701A36 gi|255538446|ref|XP_002510288.1 ent-kaurene oxidase Ricinus communis

gi|223550989|gb|EEF52475.1 ent-kaurene oxidase Ricinus communis

77% to CYP701A11 cottonwood

MDAVTPNILLNFQTMTYATPAAVGGLFFSMFVMKKLISNQKKRHARLPPVPEVPGWPVIGNLLQLKEKKP

HKTFMRWAETYGPIYSIRTGASTIIVLNSTDVAKEAMVTRYSSISTRKLSKALVILTQDKCMVATSDYDE

FHKMVKRYLLTNVLGANAQRRHRCHRDTLIKNISSRFHAHVKTNPEQTVNFRDIFESELFGLSLKEALGK

DVQSIYVDELGTTLSRKEIFEVLVLDPMEGAIDVDWRDFFPYLRWVPNKSWEMKIQQMHFRRKAVMGALI

KEQKKRIALGEEVNCYLDFLSSESTLTDEQIRMLIWETIVETSDTTMVATEWAIYELAKNPNCQDLLYRQ

IQNVCGSEKITEEHLSKLPYLNAVFHETIRKYSPAPVIPLRYVHEDTELGGYYIPAGSEIAINIYGCNMD

KNRWVNPEEWNPERFLNGNYDSGDLHKTMAFGAGKRACAGALQASLIASTSIGRLVQEFEWGLKAGEEED

VDIVGLTTRKLHPLHLSIKPRRL

 

CYP703

 

>CYP703A16 gi|255564679|ref|XP_002523334.1 flavonoid 3-hydroxylase Ricinus communis

gi|223537422|gb|EEF39050.1 flavonoid 3-hydroxylase Ricinus communis

83% to CYP703A4 cottonwood

MDFLNFSLILLFVALITNLLQWPMQKYKRLPPGPQRWPIVGNLLQLGHLPHRDLASLCNKYGPLVYLRLG

SVDAITTNDPEIIREILLRQDDVFASRPRTLAAVHLAYGCGDVALAPVGPNWKRMRRICMEQLLTTKRLE

SFAKHRAEEAQHLIRDVWTQARTGKAVNLREVLGAFSMNNVTRMLLGKQYFGAESAGPQEALEFMHVTHE

LFRLLGVIYLGDYLPFWRWIDPYGCEKKMREVEKRVDDFHSTIIEQHKKARKMKGEKESVEEGEMDFVDV

LLSLPGLDGQEHMDDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKHPRVLQKIQEELDSVIGPNRMVTE

SDLVHLNYLRCVVRETFRMHPAGPFLIPHESLHATTINGYYIPAKTRIFINTHGLGRNTKVWTDVEEFRP

ERHWLDDGSRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHAFDWSPPDGLRYEDIDTNEV

YGMTMPKAKPLFAVATPRLAPHMYN

 

CYP706

 

>CYP706B5 gi|255537053|ref|XP_002509593.1  Ricinus communis

gi|223549492|gb|EEF50980.1  Ricinus communis

64% to CYP706B3 cottonwood

MIFSFWSWWYDASNYREKYLIPVLATALTIISLLSFLFNVRKLKYSTPPLPPGPRGLPVFGYLPFLGTFL

HKKFTDLAGEYGPIYKLWLGRKLCIVISSPSLAKEIVRDEDKIFANRDPPTASKIITYGGNDIVWSSYGP

EWKKIRKVFVREMLSNASLEASYPMRKEEVQKTIRDLCNEVGKTVDFGQLVFEIAANASISMLCGSTLKG

EKAISFVGEFRKWAEEIMVLQGKPNVSDLFPVLARFDLQGLERETRRIFLCIDQILDSVIEQCLNTDVAT

EEKAEKSESRKDFLQILLEFNKHGDAATSITTNQLKALLIDIVVGGTETTSTMLEWAMAELMLNQEVMKT

VYQELDQVVGINNIVEEFHLPRLQFLDAVLKETFRLHPALPLLVPHFSSRSCRVGGYTIPKGSTIFLNAY

AIHRDPLLWDNPLEFRPERFLSNDDNYSKFDYSGNNFQYLPFGSGRRVCAGLPLAERMQLYIFASLLHSF

EWKLPLGTELELSDKFGIVVKKMKPLLLVAKPRLSTVEKY

 

>CYP706B6 gi|255537069|ref|XP_002509601.1  Ricinus communis

gi|223549500|gb|EEF50988.1  Ricinus communis

64% to CYP706G1 Vitis vinifera, 100% TO XP_002509595.1

67% TO XP_002509593.1

gi|255537057|ref|XP_002509595.1  Ricinus communis

gi|223549494|gb|EEF50982.1  Ricinus communis

55% to CYP706G1 Vitis vinifera, 61% TO CYP706B3 COTTONWOOD

AASG02002448, EST for mid region

EG661832.1

gi|255537055|ref|XP_002509594.1  Ricinus communis

gi|223549493|gb|EEF50981.1  Ricinus communis

top half of single gene (join)

MSGAVMTMLVSVILSFLFLWNVIKRSKKGISPLPPGP

RGFPVLGYLPFLGTELHKKFTELAGVYGPIYKLWLGNKLCVVISSPSVAKEVVRDQDATC

ADRDASIVAKIATYGGNDIGWCPYGPLWKKLRKLFVGKLLSNASLEVLSALRKQEIKNST

RNAYNKIGKPIDIGELAFLTSINTIMNMLWGGTLEEEASNKARKEFRNLLAEMMEITGKP

NISDFFPMLAMFDLQGLKKQAEKIVQGYESFFYNLI &

RAEQLTEASMEKNKQRENFLQLLLDLNKHDSTEMLLSKNELKGLLMDIVTGGTDTTSTMVEWVFAEVMKHQEIMEKVQQ

ELDEVVGLNNCVEEFHLPKLCYLDAVVKETLRLHPALPLLVPRRTSQPCELGGYTIPKGTTIFLNVYAIH

RDPQFWDNPLEFRPERFLNNINAGNFDFSGNNFQYLPFGSGRRVCAGLPLGEKMLMYQVATFLHSFNWKL

PNDTELELSDKHGIVIKKLKPLVAIPTPRLSNLDLY

 

>CYP706C31 gi|255537051|ref|XP_002509592.1  Ricinus communis

gi|223549491|gb|EEF50979.1  Ricinus communis

74% to CYP706C6 cottonwood

MKPISSFLESLDINFPSAIILILCTIFTLSWCTWLLYSNSKKQKNLPPGPPGLPVIGNLASLHPELHSYF

ATLANRYGPILKLHLGRKLGIVVTSPSLAKEILKDHDITFANRDVPDVARSAAYGGRDIVWTPYGAEWRM

LRKVCVLKMLSNTTLDSVYTLRRHEVRQTVGYIYNRSGSPVNFGEQVFLTILNVITNMLWGGTVQGEERA

TLGAEFREVVAEMTDLLGKPNISDFFPGLGLFDLQGLQKKMHSLAKQFDEIFERMINKRLKMDKEGESGK

ECKDFLHFLLKVKEEGDSKTPLTMTHLKALLMDMIVGGSDTSANSIEFAMAEIVNNPEVMRKAQQELDAV

VGKNDIVEESHINQLPYLYAIMKESLRMHPALPLLVPHCPSETTNIGGYTVPKGARVFINVWQIHRDPSI

WENPLEFKPERFLDSRWDYSGSDFSYFPFGSGRRICAGIAMAERMFLYSLATFLHSFDWKFPEGKKMDLS

EKFGIVLKLKNPCIAVPTPRLSDPKLYD

 

>CYP706J9 gi|223550035|gb|EEF51522.1  Ricinus communis

gi|255539711|ref|XP_002510920.1  Ricinus communis

50% to CYP706C6 cottonwood, 58% to CYP706F2 Carica papaya

64% to CYP706J1 Vitis vinifera

frameshift at &

MSTTRVAATLVAAFLIIFWYSWLMNKSKTISPPLPPGPRGLPLVGNLPFVEPEFHRYFAKLSEIYGPIFK

LQLGRKTCIVIGSNFLAKQILKGRDAIFANRDPPVVALAATYGGLDIAWRPNSEGWRKLRKVCVREMMSN

TTRDACYMLRRRELRKMVKEVYEKVGSPVNIGEQIFLTILNIILSMLWGEALHDKDRNGIGVELQQAVLE

IVELLGKPNISDLYAALAKLDLQGIESKINKLRQWFDTIFESVIADHNYVDQAKSKISKEFLQFLLEHMK

QGDNKSTFSITELKALFMDIIVAGTDTTSTTVEWAMAEILKHPEVMAKIHEELERVVGNNNIVEESQLPE

LPYLEAVIKETLRLHPPIPLLIPHSPISCTVAEYTIPKGLRVF &

FNVWEIQRNPDAWNDPLEFQPDRFLKEAGKSDYWGNDFNFL

PFGSGRRVCAGIPLADRMVKHALATLLHSFDWKLEEGTELDLTEKFGIVLKKMTPLVCIPTAKLSTAESY

C

 

CYP712

 

>CYP712A14 gi|255583276|ref|XP_002532402.1  Ricinus communis

gi|223527898|gb|EEF29987.1  Ricinus communis

83% to CYP712A3v1 cottonwood

MALSEMSYYLLFLIWFITALLVHYFIKHAFFKPPTKLHTPPSPPALPLIGHLHLIGSVLPSSFQALARRY

GPLMQIRLGASTCVVASSAAVAKEIFKTQDLNFSSRPEFGSSEYFIYRGSRFVTAQYGDYWRFMKKLCMT

RLLAVPQLDKFSDIRDQEKIKLVESVMRCATEGKICDLTSEFTTLTNNTICRMAMSTRCSGSDNDAEEIK

GLVKTCLELAGKLSLGDVLGPFKIFDFSGTGKKLVGALKKYDRLVERIIKEHEEKVLKGLVGDRKDLMDI

LLEIYNDPTAEIRLSKNDIKSFLLDIFFAGTDTSSAAMQWAMGELINSPRAFKILRDEINTVVGSNRLVK

ESDVPNLPYLRAVVRETLRLHPSAPLIIRECGEDCKVNGSIIKNKTRVLVNVFAVMRDEDSWTNPDEFLP

ERFMESSEEKIGEHQMEFKGQNFRYLPFGSGRRGCPGASLAMLVMHAAVGALVQCFDWKVKDGDRVDLSL

GSGFAAEMATPLVCYPIKHMNPF

 

>CYP712C3 gi|255584959|ref|XP_002533191.1  Ricinus communis

gi|223526989|gb|EEF29183.1  Ricinus communis

60% to CYP712C2 cottonwood

AASG02000934.1

MDTSFINTCCFLFISIIAALLVRPLTKIIINSVTTKSRRRSECHPPPGPPSLPFIGHLHLLSSRLPESLQ

NLASRYGPIMQIYMAGKPVVVVSDANTAKAMLKTYDADFASKYILGFGLSRFNIYDGDSFVNCQYGPYWR

FLKKLSRTQLLAGKQLDRFSHIREQETLKLLKSLVERSQEGEPCDLGLELSNLANSIICKMALGKRCEQN

PNLPSDIRKAIGAIMGYTAKLSFTQIFGPLKNFDLSGNGKRLISATWEYDRLMEQLFKDYEVNRTNDSGP

DEGKDMIHILLETYRDPSAELKLTKNQIKSFFLEIFLAGADTTSATIQWAITELANNPRTLKKLRDEMDV

SVGSNRLVQESDIPNLPYLQAIVKETLRKHPPGPLLRRECMIDTEINGYDLKAGTKIIINAYAIMKDPKT

FNEPEKFIPERFLVDHQEMDFNGQDLNFIPFGSGRRACIGASHGLIVTNTTIASLIQCFDWKLKDGDRFD

IKETSGYSGAMAIPLLVYPITRFDPFRA

 

>CYP712J1 gi|255583274|ref|XP_002532401.1  Ricinus communis

gi|223527897|gb|EEF29986.1  Ricinus communis

50% to CYP712A3v1 cottonwood, 48% to CYP712A1 Arabidopsis thaliana

50% to CYP712C1 Populus trichocarpa (cottonwood)

52% to XP_002532402.1, 47% to CYP712B1 Arabidopsis thaliana

MAATSDDSISDCCLLFLLSLISIFVVRNLIRTYIKPSTAIRCPPSPPALPIIGHLHLVGAPFPLSFQTLA

RRYGNLMQLRLVSSTFVVASSAAIANEIFKTHDLNFASRFEMGPTEYNIYRGTGFIVSPYGAYWRFMRKL

CMTELFGGSQFDRFNHIQEKEVRNLLKLLTKLAREGEPCDLNVELETLTNNLICKMALSKRFSNNDTEAK

KMRKLVSDIMDTGAKLGVSEVFGLLKKIDLLGHGKKLEEALWRYDGVMEQIMKDYEENLVNGGENKEKDV

MDILLQIYRNPNAEVKLTRIQIKHFILELFMASIDTESAAIQWTMAELINRPKVLNRLREEIDSVVSSSR

LVKESDIPDLPYLQAIVKESLRLHPPSAMISRECTHDCKIDGFDIKAKTRMLINTYAIMRDPDMWPDPDE

YMPERFLINATGKFDRHQMEMKRRECSYLPFGGGRRACIGFAHAYTLMHTTIAVLVQCFDWKVKDGEKID

INVSNGFSGTMAPPLLCYPITHFNPF

 

CYP736A

 

>CYP736A101 gi|255582520|ref|XP_002532045.1 flavonoid 3-hydroxylase Ricinus communis

gi|223528288|gb|EEF30335.1 flavonoid 3-hydroxylase Ricinus communis

76% to CYP736A4v1 cottonwood

MEYPHSQDMSLTWATLALIALACFLQALLWLRKTNNKKLPPGPRGFPIFGSLHLLGKYPHRELHRLAQKY

GPIMHLRLGLVSTIVVSSPQAAESFLKTHDLAFASRPPHQAAKFISYEQKNLSFAPYGSYWRNVRKMCTL

ELLSNVKVNSFKSMRKEELDLLIDCIKNASCQRVAVDLSAKVASLSADMSCRMVFGKKYMDKEFDERGFK

AVIQEGMHLGAAPNLGNYIPQIAGLDLQGLTKRMKAVSKVFDSFFEKIIDEHMEFKDENRTKDFVDVMLG

FMGSEVSEYHIGRDNIKAIILDMLAGSMDTSAAVIEWALSELLKHPGVMKKVQKELEEKVGMTRMVEESD

VEKLEYLEMVIKETFRLHPVAPLLLPHEAAEDTTIDGYLIPKKSHIIINTFAIGRDPSAWTEAEKFLPER

FLGRNIDIRGRDFQLLPFGAGRRGCPGIQLGMTVVRLVVAQLVHCFDWELPNGMLPTELDMTEEFSLVTP

RAKHLEAIPNYRLHI

 

>CYP736A102 gi|255547105|ref|XP_002514610.1 flavonoid 3-hydroxylase Ricinus communis

gi|223546214|gb|EEF47716.1 flavonoid 3-hydroxylase Ricinus communis

56% to CYP736A1 Pyrus communis

54% to CYP736A5v1 cottonwood

MSTATLAILLFILPCLLPLIYILSTILRCPKPRKHHRNDLKPLPPGPRPLPIIGNLHLLGLLPHQSLYHL

AKEHGQIMFLKLGFVDTVVVSSAQAAELFLKTHDAAFANRPKVLVSHYLSYGSRGMIFDDYGPYWRNVRK

VCTLQLLSSSKIESFAPLRKEELELMVATIKQAAERKEMVDVSARLGDFSENLICRMIFGQRSNDEFDLR

PLIKESLELIGAINIADYVPYIGVLDLQGLTRRMRAYRKGMDKVLEKIIDSHEKDGRWKTKEQKDFIDVM

LSVMNRSSPMIPPNDPQSYVIDRTCIKAIIQDIIVGGFETSTSSIEWTFSELLRHPRVMKCLQKELETVV

GLDRMVEERDLPNLTYLDMIVKESLRLYPTLPLIPRKCVEDITVNGYHIPSNSRILVNAWAIGRDTNVWS

DNALEFYPERFKDECVDLRGLHFQLIPFGSGRRSCPGMSLGLRNIRLVIAQLAHCFNWDLPSGDLDMTEK

YGLTLPRANHFSALPTYRLHV

 

>CYP736A103 gi|223549148|gb|EEF50637.1 flavonoid 3-hydroxylase Ricinus communis

gi|255541808|ref|XP_002511968.1 flavonoid 3-hydroxylase Ricinus communis

55% to CYP736A8v1 cottonwood

MSPLMLAILIVLLASIVSFLYISKHDRKLPPGPRGFPIVGNLHKLGDLPHQALHHLAKKYGPIMSMRLGL

VPTIIISSPQAAELFLKTYDTNFASRPNIQASHYLSYGRKGLVFSEYGSYWRSTRKLCTLQLLSASKIQA

FAPMRKEEYGLMVGKLKKAAAAREVVNLSVSVSDLIQNMSCRMVFGVSTNNGDFRLKSVVEETLRLVGAF

NIGDFVPFLGAFDLQGVKKRSKACNEAFDKIMEKIIDEHEKEAHWENKQQRDFVDALLSVVNQSMISHDG

AESEIDRSNIKAILIDIIVAAVDTSATAIEWTLAELIRHPQAMKTLQDELQNVVGLDKMVEEKDLSKLTY

LDMVIKESSRLHPVAPLLVPHESIDEITIDGYHIPKRSRILVNIWAIGRDSNVWSDNVDEFLPERFIGTN

VDLHGHDFRLIPFGSGRRGCPGIHLGLTTVRMAIAQLVHCFNWKLPDGDVSPSELDMSEQFGLTVSRASH

LFLVPEYRLPV

 

CYP72 CLAN

 

CYP72

 

>CYP72A259 gi|255572060|ref|XP_002526971.1  Ricinus communis

gi|223533723|gb|EEF35458.1  Ricinus communis

64% to CYP72A47 cottonwood

AASG02004124

MGLSSSSVAVSIVFVIIITWVWKILNWVWFRPKSLENYLKKQGLGGNPYRFLYGDMKENM

ASLKKAKSSPIGFSEHIALRVTPLLHQVVNSC (1)

GKNSFIWVGPTPRVNIMNPEHIKDVFTKIHEFTRPRMNPQSRLLASGVAFHEGEKWNKHRKIINPAFHQEKLKLMLPQ

FYQSCKEMIEKWEKLISTKESYEVDVWPYLQNLACDVISRAAFGSNYEEGKMIFDNLKELARLIMQGFLS

VYLPGWRFMPTKTNRRIKQIDREIQASLRSIIDKREKAMKAGEATNDDLLGILMESNLREIEENSMGLSI

QEVMDECRLFYFAGQETTSVLLVWTMILLSKYPHWQEQARQEVLQVFGGKMPEFDGLNRLKVVTMILHEV

LRLYPPVPVLSRSVDEDIRLDDVMLPAGVYVSLPTILIHQDPELWGDDASEFKPERFSGGIAKATKNQIS

FFPFGWGPRICIGQNFALAEAKMALAIILQHFTFELSPSYTHAPTTVITLRPEHGAQLILGKL

 

>CYP72A260 gi|255553643|ref|XP_002517862.1  Ricinus communis

gi|223542844|gb|EEF44380.1  Ricinus communis

48% to CYP72A47 cottonwood

54% to CYP72A2 U35226.3  Nicotiana plumbaginifolia

MAILAITLLLLLQLALFSSLRLVYVIWWRPKITVKKLRKQGIHVLSYKLPHENVKLTSESKSKPMELTHD

IAPRLDPLLRELAITYKKPFAVCYGMIPTVIVLDPKLIREILTRIFDFQKPKVGPTMKFFLKGLANIDGD

KWAKHRKIINPAFHIEKLKGMFPCFMASCEEMVEKWGKLIDSGSGDSSELDVLPEFQNLAGNVISRAAFG

SNLEEGKLLFSLQRKQGELLLQSLINLNSVWSRFLPSKLNKRMKQIHQEIRSLLQGIIDNREKAVLSGND

DHNDLLNLLLRSNFNEIYQNKNIGMSREDAIEECKLFYFAGSETTANSLTWTMIVLSMHQNWQERARQEV

LQLVGKSKPTFNDLNHLKTVNMILLEVLRLYPPTSLVRSIYKETKLGEYYLPAGVSLKVPLYLVQRDLEL

WGEDATEFNPERFSDGISKAAKDQSSFFAFGWGPRICIGQNFAMLEAKLALALILQHFSFELSSTYRHAP

GVAITLQPQFGAQIILRKI

 

>CYP72A261 gi|255553639|ref|XP_002517860.1  Ricinus communis

gi|223542842|gb|EEF44378.1  Ricinus communis

49% to CYP72A43 cottonwood, 85% to XP_002517862.1, 50% to CYP72A5 Zea mays

55% to CYP72A2 U35226.3  Nicotiana plumbaginifolia

54% to CYP72A29 Solanum  tuberosum

MAVLAIALWLFVLLALLSSLRLVYVIWWRPKIIEKKLRNQGIHVLPCKLPHGNVKEINELASEAKSKPCP

ELTHDIAPRLDPLLQELSMAYKKPFAVCYGKIPTVIIMDPELIREILTRKFEFQKPEVGPTMKLFLKGLA

NIDGDKWVKHRKIINPAFHIEKLKGMLPFFMASCEEMVEKWDKLIDSAGSCELDVMPEFQNLTGDVISRA

AFGSNLEEGRLLFSLQRKQGELLLRSLINLNSLWSRFLPSELNKRMMQIHQEIQSLLLGLIENREKAVLS

GNENQNDLLNLLLKSNFNEVHQNKNIGMSREDMIEECKLFYFAGHETTANLLTWTMIVLSMHQNWQERAR

QEVLQLIGKNKPTFNDLNHLKTVKMILLEVLRLYPPTSLVRSIYKETKLGEYSLPAGVSLKVPLYLVQRD

PELWGADATEFNPERFSNGITKAAKDFFAFGWGPRICIGQHFAMLEAKLALALILQHFSFELSSTYRHAP

NVVLTLQPQFGGQIILRKI

 

>CYP72D9 gi|255550159|ref|XP_002516130.1  Ricinus communis

gi|223544616|gb|EEF46132.1  Ricinus communis

68% to CYP72D1 cottonwood

MECSISKTLLLSCVLLSLYSVIRFAYMIWFGPKRLEKQLRKQGIRGNSYKLFNGDGEAITKSSMRALSKP

IALNDQINPRVLPFFHEMVKNYGKVSLSWFGTRPRLILADPEMIRWVLTDKNGHFVKPPLNPLVNLLQLG

VSTLEGDKWAKRRKLMTPAFHYEKLKCMVPQFATSCSDLINRWKKLVSPKGLCEIDVATEFDALAGDVIA

RTAFGSSYQEGKRIFELQKEQVSLVLEAYRSIYIPGLRFIPTKKNKRRYDIDDEIKATLRDMIRRKEQAM

QIDSPSNVDLLSLLIRCKREAASDMTNEDIIEECKLLYFAGQETTANWLTWTLIVLSRNPNWQVKAREEV

LQICGKKIPEIEDLNRLKSVTMILNEVFRLYPPVAALYRHTLKETNIKGMSIPAGVELYLPTIFVHHDPD

YWGDNVEEFRPERFAEGVSKASKDQMAFYPFGWGPRICLGQNFANIEAKMALAMILQNFWFELSPSYTHA

PYVNITLRPQHGAPVILHQI

 

>CYP72D10 gi|255550487|ref|XP_002516294.1  Ricinus communis

gi|223544780|gb|EEF46296.1  Ricinus communis

53% to CYP72D1 cottonwood

AASG02008953.1 runs off the end of the contig

AASG02003022.1 runs off the end of the contig, no ESTs join seqs.

MPFSLLFLAIYGAVKALYSIWWKPKWLERRLRQQGIDGTxx

KLLVGDMKDFIKMITEAWSKPVNLNHKIVQRVDPFTFNTVQKYGKISMFWNG

KTPRLIISDPELMKEVLSNKLGHIQKPPLNPLILILARGLTVLEGEKWAIHRRLINPAFHLEKLKGMVPV

FVISCNKMIEEWKKMINHQETCEVDVWPEIQKVAKDIISRAAFGSNYEEGKKIFELQHELMMLTIEAMQT

LYIPGFRFVPTKKNRRRKKLNIEITSMLRDIVERKQNAMRTGQSKVDDLLSLLLHSSEQNSSGNESGRRS

DGLTIEEVIEECKVFYLAGQETTSSLLTWTIIVLAMHQDWQEKAREEVLQVCGKKEPDFEALTHLKTVTM

ILNEVLRLYPPAIALYQHTREATKIGDISIPAGVDITLPTMLIHRDPEFWGDDAEEFKPERFAAGITKAS

KDHLAFFPFGWGPRICIGQSFSLLEAKTVLAMILQHFSFELSPSYAHAPYTVMTLQPQRGAQLIIHQV

 

CYP709

 

>CYP709F3 gi|255548211|ref|XP_002515162.1  Ricinus communis

gi|223545642|gb|EEF47146.1  Ricinus communis

AASG02018681 top part, AASG02011377.1 bottom part, runs off the contig end

Green part from EST EE260711.1

57% to CYP709F1 cottonwood

MMMGYTDIFIVAFAALLAAKIWRAVLISLWRPYALTRSFREQGVEGPPYLLFRGSLNELKRLKMAANQTV

LDHHSNDIVQRVLPQYHKWSPLY (1)

GETILYWHGTRPVICITDPELAKQ

LSNKFGFYAKPDLSPAILALTGNGVAVVNGLEWVRRRRI

VNPAFSVDKIKVMVKSMATCIVSMLDEWENQASAAEDQCKKIEMKAEFLKLTADIIAHTAFGSSYAQGKE

AFEGQNELQHYSAASTLNLFIPGSHYLPTPSNLQLWKLDRRVRNSLRAIINGRLNSSTSDCSYGDDLLGL

LMGASENAEKKDGPKLNMDEIVEECKTFFFAGHETSSNLLTWTLFLLSLHQDWQTRLREEVLKECRMEIP

DSDMLGRLKLVNMVLLEALRLYCPVVDMYRQASKDMKLGNLMIPKDAWITIPLAKIHRSKEHWGEDANEF

NPIRFANGISKAAKHPNAFLAFGIGPRTCIGQNFGMLEAKAVLAMILQRFSFTLSPEYKHAPINNLALQP

QYGLPIVIKPLLA

 

CYP714A

 

>CYP714A20 gi|255550874|ref|XP_002516485.1  Ricinus communis

gi|223544305|gb|EEF45826.1  Ricinus communis

60% to CYP714A3 cottonwood

MEIYSLLLSAFGVIGFVYCFIHIFKESLLGPFAVKRKLHIQGIKGPSPSFLYGNLSQMQQIQLKTKKEPP

PHDQIAALDYTSIVFPYFEHWRKQYGPVYTYSTGFKQHLYLTDPELVREMNQCNTLDLGKPPYVTKRFAP

MFGNGIIRSNGHFWALQRKMVAPEFFMFKVKSMVGLMVESTKPLIREWEQRIETQGGAQAEITVDDDLKG

LSANVIARACFGSSYFKGNEIFSKLRTLHKALTKHATLFGFSGFRKNYREIRSLEREIESLIWDTVQERQ

RQGLTERDLMQLILEEAVNNTDAGKLSPKQFIVDNCKSLYFAGHDTTAISASWCLMLLALHPDWQSQIRA

EVAEFCNDELLDANSLSNLKTVTMVIQEALRLFPPAGFVVREAFEEVKIRNIIIPKGVCTWTLISTLHRD

PSIWGPDADKFNPGRFADGISKACKFPQAYIPFGLGTRLCVGRNFAIVELKIVISLIVSKFRISLSPNYV

HSPVLRMLVEPEHGLQLLIQKI

 

>CYP714A21 gi|255548610|ref|XP_002515361.1  Ricinus communis

gi|223545305|gb|EEF46810.1  Ricinus communis

62% to CYP714A1   Arabidopsis thaliana

70% to CYP714A3 cottonwood

MEVSLALTLIVSSVVLLLLAVCFIIHLYKTVLLSSQRLKTKLHVQGIRGPSPSFLYGNLSEMQQIQLKAM

KAQNHGEIVAHDYTSSIFPYFEYWRKQYGLIYTYSTGFRQHLYVNDPEVVKEMNQSINLDLGKPTYLTKR

LEPMLGNGIIRSNGHLWAQQRKIIAPEFFKDKVKGMVGLMIESAEALVRKWEESITEAEGGSQADIRVDE

DLRGLSADVIARACFGSSYSKGKQIFSKLRSIQNLLTNQSILFGVTSFGFYASKNHKIITNLEREVESLI

WETVKERERQCSEKASIEKDLMQQLLEEAVNDGEATKFSPKRFIVDNCKSIYFAGHESTATAASWCLMLL

ALHPEWQSRIREEVNQVCKDGLDANSISNLKMVTIVIQEALRLYPPAAFVSREALEEVQIGKYTVPKGVC

IWTLIPTLHRDPNIWGQDANEFRPERFADGVSKACKSAQAYIPFGVGTRLCLGRNFAMIQLKVVLSLIIS

KFTFTLSPNYQHSPAFRMIVEPEHGVQILIKKV

 

>CYP714E16 gi|255570861|ref|XP_002526382.1  Ricinus communis

gi|223534244|gb|EEF35958.1  Ricinus communis

75% to CYP714E4 (old 714G1) Populus trichocarpa

MELIRILVSFAVVGFFGILLRVYNVLVLKPERLRSILKKQGINGPPPTLVLGNIREIKKSQSSKVGNVTP

TSQPPVTHNCAADIFPFFEQWRKQYGEVFVFSLGNIQILSVNQPDMVKEITTCTSLDFGKPSYQHKERGP

LLGQGILTSNGTVWAHQRKILAPELYMEKVKGMVNLITESTNTLVNSWKIRIDSDGGISDIKIDDAMRSF

SGDVISRACFGSNYSKAERIFLLLRSLQEAMSRKSLATVPGMRYLPTKSNKEAWALEKEIRNLILEVVKE

RQEATHERDLLQMVLEGAKNSNLSQEAINRFIVDNCKNIYLAGYETTAVSATWSLMLLAANQEWQDRVRA

EVLETCGGRMPDADMVRKMKMLNMVIHESLRLYPPVAVVSREAFKDMRFGKINVPKGVNVWTMVLPLHTD

PEIWGPDSYKFNPDRFANGIAGACKYPFMYMPFGVGPRVCLGQNLAMVELKILIALIVTNFCFSLSPTYI

HSPAIKLVIEPEYGVNLLVKKL

 

>CYP714M1 gi|255582038|ref|XP_002531816.1b  Ricinus communis

gi|223528550|gb|EEF30573.1b  Ricinus communis

AASG02007424.1

48% to CYP714A3 cottonwood, 50% to CYP714H1 soybean, 47% to XP_002515361.1

frameshift at &

MEGYHAETFWSVAIVGFCILLIRVCDAIWLKPRRIRSVLLK

QGIGGPRPCFLYGNVQEMQKIQAMVAKTTQTSHVQPASSSHNAWAYSIFPHFHQWAQQYG

RVYTYTTWSK

QHLYVGEPELMKALNLNTSLDLGRSTHLSNSIEPMVGNGIIRANGPYWAHQKKLIAPEFFLHKIKRMSGL

MEECTLAMIRTWQNEVESKEGVADITIDRDLKSLAGDIISKACFGSSYSQGKQIFATLEALQEATSKPII

QRFGLKNFRFLPTKSNREIWRLQKEVKTQILKVVKARRGKSQRTSKPEDLLDALLQSVADSKEIQHPRDA

ERFIVDNCKNIYFAGHETTALSASWCLMLLALHPEWQERVRAEIVEICGDRLHDSLLDLDKLYQLKM (0)

LPMVIHESLRLYNPAVITSREALSDITVGDLMIPKGTNIWISVTALHRDLTIG &

NWGEDANEFRPERFAQGITEACKYPQSYIPFGFGSRLCIGKTFAMLELKIILSLILTNFSFSL

SPEYHHIPVYKIALSPKQGIRLLAKSVLSGPNNI

 

>CYP714M2P gi|255582038|ref|XP_002531816.1a  Ricinus communis

gi|223528550|gb|EEF30573.1a  Ricinus communis

pseudogene

47% to CYP714H1 soybean (two genes fused?)

AASG02007424.1

39% to CYP714A3 cottonwood N-term part

66% to XP_002531816.1b

MEDFLAEVVWLVILAGFCILLLRVSDTIWLKPR

RIRLVFLKQGIGGPRPRFLYGNIQEMQEIQEMVMKSTTQKSHLQPALSHNAWVCSIFPHLQLWEKQY (1)

GQIYMYSTRNSHHLYVTKPELLKALCIHKFLDLGRSTYLSDPIEPIVGNSIIRANGHNWD

HQKKLIAPEFYPHKLK (2)

(0) HLLGLMEESTLAMIKTWQSQVE (1)

IKLKVADITMDKDMKSLSADIILKACFGSSYSQG &

PDFYTLGVLQEALIKQIAQLELINFR (2)

FLPIKSNREIWRLQKEVDAHILKIVEARRTK &

YKSRKSKDLLDALLDSVADSNGI

 

>CYP714M3P gi|255582040|ref|XP_002531817.1  Ricinus communis

gi|223528551|gb|EEF30574.1  Ricinus communis

AASG02016465.1

64% to XP_002531816.1

MEGIVGAVVAVVLCIVFIRVVDEMWRKPRRIRSMLLKQGIRGPTPSFLYGNIQDME 3231

3230 KIQSHSHNTQLPSWVSAIFPYLHR*ANEY (1)

3038 GPIFMYSTANKQHSYVGKPELMKALNLHKSLDLGRPNYLSKTTGPLLGNGIISANGPHWA 2859

2858 QQRKLIAPEFFLHKVK  (0)

HMLGLMEESTMAMISNWRSQVERMGGVADINVDKDLKSASADIISKACFGSSYSQGKQIFAKLDALQGAMS

NTSILFGFPNFR (2)

FLPTKSNREIWSLQKEIETLILEVVNARREERQRSRKSENDFLEAILESAADIEELEHTHNTDRFIVD

NCKNIYFAGQETTALSASWTLLLLSLHPESQDRVRAEIVEICGDRIQDSLLDLDKLRQLKT (0)

LNMVIQESLRLYGPAVIAGREAFDDMKMADLTVPKGTYIWVLIPALHRDPENWGPDANEFKPERFAGGT

IEACKHPQSYIPFGLGSRVCLGQTFAMLELKILLSLILSDFSFSLSP &

VYRMLLVLEHGIKLLARKVKKEDGPN*

 

CYP715

 

>CYP715A19 gi|255545268|ref|XP_002513695.1  Ricinus communis

gi|223547603|gb|EEF49098.1  Ricinus communis

77% to CYP715A3 cottonwood

AASG02001154.1

MEFLYLSKAFTLTVFGVFLYLFLRVLISFWISPYKAYLKLQKNGFGGPTPSFPLGNIEEMKKISKI

CAASASSNGSLTISNDIHSTVFPYFAQWQESH (1)

GKVFIYWLGTEPFLYIADPEFLKRMSNGVMGKSWGKPNVFKHDRKPMFGDGLIMVEGDDW

VRHRHIITPALSPANLK (0)

AMASLMVESTTNMLDKWGDLINSGYEEIDVEREIIATAGEIIAKTSFGIGYESGRQVFEKLRAMQITLFKT

NRYVGVPFSKFLCPKQTLEAKNLGKEIDDLLLSIITDRKRSNGGHIQKDLLGLLLAENHEDGKLGKTLSA

RELVDECKTFFFGGHETTALALTWTLLLLAVHPEWQVQLREEITEVTKDKELDFSVLAGLKKMGWVMNEV

LRLYSPAPNVQRQAREDIKVNNLTIPEGTNMWIDVVGLHHDPNLWGEDVMEFKPERFKDDLYGGCKHKMG

FLPFGFGGRMCIGRNLSMMEYKIVLTLILTRFSFSLSPTYYHSPSILLSLRPSFGLPLIVKPL

 

CYP721

 

>CYP721A30 gi|255538580|ref|XP_002510355.1  Ricinus communis

gi|223551056|gb|EEF52542.1  Ricinus communis

75% to CYP721A7v1 cottonwood

MLLLLKILIFLLLICALKFIYSTIWVPFRIQGHFKKQGVTGPNYRPIFGNSAEIRRLYVEAQSKSMSSFS

HDVLHRVVPSYYQWSLKYGKIFVYWFGSRPRLALFDQDMIKDVLMNTGGGSFERVKQNPQSKLLFGDGLI

GLDGEKWALHRRIANQAFNMERVKGWVPQIVASTTKMIKKWEEIRGERDEFEMEVYKELHDLLADVISRT

AFGSSFEEGKRIFALQEQQMHLVSEAIRSVYIPGFRFLPTKKNRERWRLDKETREAIRTLIKTNSREREN

SRNLLSLLMSPYKSQEGKEERLSEEEIIGECKTFYFAGKETTANLLTWALLLLALHQEWQDKAREEVLRI

FGRNNLPIAESLNELKIVSLIINETLRLYPPAVMLTRQVSKRVKLGTLDIPAGTQFYIPLTAIHHDPDIW

GEDANEFNPSRFNESGKHLASFFPFGIGPRICAGQNLAIVEAKIILAMIIRHFSFSLSPTYVHAPMLFLS

LMPQHGDPAKIVKLGEVDIADDTQLALVVIATHHDPAIWEEDTEKFNPGKFSKPFKHLASFFPWGLGHRI

CVGQSYAMVEVKLLLAMINRQYSFVLSTTFVHAPVQFLTVQSQHGAQILFGKI

 

CYP734

 

>CYP734A26 gi|255566913|ref|XP_002524439.1  Ricinus communis

gi|223536227|gb|EEF37879.1  Ricinus communis

87% to CYP734A9 cottonwood

MEELLLLFNYYFWFKFLAVSFLVCVLGLKIAVLLWWRPRRIEVHFSKQGIRGPPYRFFIGNVKELVEMML

KASAQPMPFSHNILPRVLSFYHHWKKIYGATFLVWFGPTVRLTVSDPDLIREIFTTKSELYEKIEAHPLV

KQLEGDGLLSLKGEKWAHHRKIITPTFHMENLKLLVPVVAKSVMDMLEQWSTMSSSDEVEIEVSEWFQTL

TEDVITRTAFGSSYEDGKAIFRLQAQQMVLAAEAFQKVSIPGYRFFPTRRNMNSWKLDKETKKSLMKLID

RRRENSGNLVQEKGSPKDLLGLMIQASNSCPNAVTVHDIVEECKSFFFAGKQTTSNLLTWTTVLLAMHPH

WQVQAREEVLRVCGSREIPTKDDVIKLKTLGMILNESLRLYPPTIATIRRSKTDVELGGYKIPRGTELLI

PILALHHDQTIWGNDANEFNPGRFSDGVARAAKHSIAFIPFGLGVRTCIGQNLAILQAKLTLAILLQRFS

FRLAPTYQHAPTVLMLLYPQYGAPIIFKRLLNPIHPSTY

 

CYP735

 

>CYP735A22 gi|255551354|ref|XP_002516723.1  Ricinus communis

gi|223544096|gb|EEF45621.1  Ricinus communis

84% to CYP735A5

MAVLTTVLVIVFSLFFKVAYDTISCYLLTPRRIKKIMEKQGVRGPQPRPLTGNILDVTALVSQSTSRDCD

YVHHDIVYRLLPHFVTWSKQYGKRFIYWNGIEPRMCLTETELIKELLTKYSTKAGKSWLQQQGSKHFIGR

GLLMANGDNWYHQRHIVAPAFMGDRLKSYSGHMVECTKKMLQSLQKAVESGQTEFEIGEYMTRLTADIIS

RTEFDCSYEKGKQIFHLLNVLQRLCAQASRHLCFPGSRFFPSKYNREIKSLKMEVERLLMEIIQSRKDCV

EIGRSSTYGNDLLGMLLNEMQSKRENGFSLNLQLIMDECKTFFFAGHETTALLLTWTVMLLASNPSWQEK

VRAEVNQVCNGETPSVDHLPKLTLLNMVINESLRLYPPATVLPRMAFEDIKLGDLHIPKGLSIWIPVLAI

HHSEELWGKDANEFNPDRFASKTFAPGRHFIPFAAGPRNCIGQTFAMMEAKIILAMLISKFNFNISDSYR

HAPVIVLTIKPKYGVQVCLRPLNNP

 

CYP749

 

>CYP749A24P gi|223549223|gb|EEF50712.1  Ricinus communis

gi|255541958|ref|XP_002512043.1  Ricinus communis

pseudogene

55% to EEF50709.1, 52% to CYP749A9 cottonwood

LGPRAHYVILEPELVKEILNDS &

EKWFKMRKLTNFAFYADSLE

VMLERWKDHTGSEIEVDEEFKLLASEVISRTAFGSSYIEG &

TYNIFDMITKFSVIINRKCNKI

 

>CYP749A25 gi|223549222|gb|EEF50711.1  Ricinus communis

gi|255541956|ref|XP_002512042.1  Ricinus communis

60% to CYP749A4 cottonwood

AASG02000129.1

MIILVSSCIFVCFISFLIKFLYEIWWNPIRIQSSLRSQGIQGPSYRFYYGNSQDMVK

MRMEALRSSTELSHQLLPRVQPHIYFWINLHGKNYVSWLGPRPQLVLTEPNLVKEVLSNRDETYPKPEFE

SYVKQLFGNGLVAITGEKWNRQRKLANHAFHGENLKGMVPAMIASVEMMLERWRQNEEKEIEVYQEFKLL

TSEIISRTAFGSSYLEGQHIFDMLGKLARILNKNSYQVRIRAIEKLWKRKDDTESEKLEQGIRDSVLKMI

NKREEDEKTGEVDSCGSDFLGVLLKAYQETDESKKISVDDLIDECKTFYIAGHETTSSALTWCIFLLAIH

TDWQEKARQEVLESFGQRIPTSDEITRLKIMNMIVNETLRLYAPITNLIREVQKGSRLGKLVAPSRIDII

VPPLALHQDPEIWGEDAYLFKPERFAEGIAKATKNNIAAFLPFGLGPRNCVGMNFAMAETKISLSMILQR

YRFTLSPTYVHSPTFLIAVCPQKGLQINLQAL

 

>CYP749A26 gi|223549220|gb|EEF50709.1  Ricinus communis

gi|255541952|ref|XP_002512040.1  Ricinus communis

64% to CYP749A6 cottonwood

MGTLIIYLSSCTLCLFFLLFLAKFFDKVWWTPIRTQSMLRSQGIRGPCYKIFHGNTKEIISMVNNASSNP

AELSHQQLLPTVLPHIYSWIKIYGNNFLTWHGRRAYFVVTEPDLIKEILNGKDGVFPKAEPEHYEQKIFG

DGTITSKGEKWVKMRKLSNHAFHAESLKGLIPVMIASVEIMLERWKYHDGKEVEVFQEFEHLTSEVISRT

AFGSSYWEGKHIFDMLTRLIIILSKNKYNIRIPGIRNLVKTGDDIESDKLEKNIHDSFINMIKRREEEAT

MGQADGFGSGFLGLLLKAHHDNNMAKKISVDDLIDECKTFYVAGRETTTSLITWILFLPAIHPDWQHKAR

EEVIEIFGSQHPRLDGLTRLKIVSMIINETLRLYPPAVIFKRYVQRQVRLGKLILPANIVMEIPILAVHH

NPQIWGEDVNLFKPERFAEGVAKATKNNAAAYLPFSLGPRNCVGYNFAITETKIALSIILQRYRFSLSPN

YVHSPIPLIGLCPQHGLQIMLHKL

 

>CYP749A27 gi|223549219|gb|EEF50708.1  Ricinus communis

gi|255541950|ref|XP_002512039.1  Ricinus communis

64% to CYP749A6 cottonwood

AASG02000129.1

MGTLIIFLSSSILCLSFLSFFIKFLNKIWWTPIHIQS

MLRSQGIKGPSYRFYHGNSKEIINMEYNASSNPMKLSNDQLFSTVLPHIYSWSKLYGKNFLYWHGPRAHI

VVQEPSMLKDIFNRDEIFTKGEPEDYVKKLLGDGIVTARGEKWLKLRKISNHTFHAESLKGMIPGMIASV

EMMLERWNNHDGKEIEAYKEFKILTSEIISRTAFGSSYLEGQHIFDMLIRLAVIVIRNKYKVRIPGIRNL

VKTRDDTDSDKLEQGIHNSFIYMIKKREVAMTDQSGSFRNDFLGSLLKAYHENNMAKKITVANLIDECKT

FYVAGHETTTSLLTWILLLLAIHPEWQEKAREEVLEIFGSQRLSSDGLTGLKIVSMIINETLRLYPPVVN

VIRKVDGEVKLGELIIPENTEIDIPVIAIHHNPQIWGEDVYKFKPERFAEGVAKATNNNITAYLPFGLGP

RNCVGSSFAITETKIALSMILQRYRFSLSPTYVHSPIPILTMCPQYGLQMVLHKL

 

>CYP749A28 gi|223549218|gb|EEF50707.1  Ricinus communis

gi|255541948|ref|XP_002512038.1  Ricinus communis

64% to CYP749A5 cottonwood

MAEMVMGTLIFCFLGFLCSYFLLILSKFLYKEWWTPVRIQSLMRSQGIKGPSYRFIHGNTKDITNMRKET

MENPMELSHLILPRIQPHIYSWIKLYGTNFLLWYGGRAQLVVTEPELAQEILNSKEVTFYKVGFQEYITK

LLGDGLVLASGEKWIKMRKLASRAFHSENLKGMVPAMIASSEVMLEGWRSHPGKEIDAFQEFKVLTSEII

SRTAFGSSYLEGEKIFEMLKKTISIIAGNHYKVRIPGIKFFKTTYDVELDKLQQDIRDTIMEMVKKREEA

AKISEQDSFGHDFLGSLIKAYKDEDKNKKISIEDMIDECKNFYVAGQETTASSLSWTILLLAIHRDWQEK

ARKEVLELFGQQNPTADGITRLKTMSMIINESLRLYPPVLHVNREVKREVKLGKLLIPAKMETNVPVLAL

HTDNKIWGEDAHLYRPERFAEGVAKATNNNISSYIPFGLGPRTCVGLNFAITEKKIALSMILQRYRFTLS

PTYVHSPVHILTMCPQYGVPIILEAL

 

>CYP749A29 gi|223549217|gb|EEF50706.1  Ricinus communis

gi|255541946|ref|XP_002512037.1  Ricinus communis

59% to CYP749A1v1   Populus trichocarpa

71% to CYP749A5 cottonwood

MKNLIVCLASCFCLYFLLNLIKFLSKVWWNPICVQSSMRSQGIKGPSYRFLLGNTKEITNMRSRIMNGPM

ELSHEMLPRIQPHIYYWIKLYGTYFLNWYGPKAQLIITEPELVQEVLNNKEGAFGKKHIQNYADKLLGNG

LFASQGEKWLKMRKLANQAFHGESLKGMVPAMVASVETMLQRWRQNQEGKEIEVYQEFKVLTAEIISKTA

FGSNYLEGKNTFDMLARMANIVARNNYRVGIPGIKKFLKTRDDTASEKLEQGMRDSIMKIIKKREEEMLM

GKNDAYGNDFLGLLLKAHHDNDKAKKISVNDLIDECKSFYVAGHETTSSSLTWTVLLLAIHPIWQEKARE

EVLELFGKQNPSPDGIRRLKIMSMIVNESLRLYTPAFSITREVQKEVKLGKLVVPEKMSVCLPVLAVHHN

PQVWGEDVHLFKPERFIDGVAKATENSIGAFLPFGGGPRSCVGMNFATTEMKIVLSMILQHCRFTLSPTY

VHSPVDILTIRPQYGLQIMLEAL

 

>CYP749A30P gi|223549216|gb|EEF50705.1  Ricinus communis

gi|255541944|ref|XP_002512036.1  Ricinus communis

pseudogene

58% to EEF50707.1, 57% to CYP749A6 cottonwood

AASG02000129.1

MGTLILYLYRSLCLVFLIILTKFLSKVWWTPIRIRSSMRLQ*IRGPPYRILRGNTKEI

MSKRKEVTTRPMELSHQIFPRVLPHIYAWTKVY (1)

GRNFLCCYGTQAHMVVTDPELIKEVLNNKEREYPKIQ

FDHYMKKLLEEGTVTARGEKWAKLRKFSNHAECLK (0)

AMILAMITSVEIMLEGWRKHNGKEIEVFQKFVLASEIISRTAF &

LSNYLEGEQIFDKLTRFAHLIFKNPYKIRVPG (?)

LLKTSDDVESEKLEQGIRNSIFNMVR

KREEAALIDQMKQHYGSDLLGLLVKASHDTDEKVKLSIDDVIDECKPF*VGGHETTACSLAWT &

LLLLASHTDWQDNARKKVLELFGKENPTPDGIARLKIVS (?)

MSMVVNEALRLYPPVVNMGRLT*KEAKLENLTLPQKVQVFNPIIALHHNPRIW (?)

GEDAYLFKPERFAEGVTKASNNNIAAFLPFGMGPRNCIGSNFAIIQTKVAISMILQHYKF

TLSFSYVHSPVHLLTMTPKQGIPVNLQAL*

 

CYP74 CLAN

 

CYP74A

 

>CYP74A27 gi|255538510|ref|XP_002510320.1  Ricinus communis

gi|223551021|gb|EEF52507.1  Ricinus communis

70% to CYP74A1 cottonwood

MASSSIPSAILQTQVQTLKHSTRRSSVSPITASVSEKPSTTNSPLIVSPTESSKLPIRKIPGDYGLPFFG

PIKDRLDYFYNQGREEFFKSRSQKYQSTVYRTNMPPGPFISKNPHVVVVLDGKSFPVLFDVTKVEKKDLF

TGTYMPSVDLTGGYRVLSYLDPSEQKHTQLKQLLFYLLKSRRDHVIPEFASSYTELFDGLEKDLASKGKV

SFNDPGEQAAFSFLGKCYFGTNPVDSKVGTDGPSLIAKWVLFQLAPILTLGLPAILEEPLIHTFRLPAFL

IKKDYKRLYDYFNSSAGSLLDEAEKMGISRDEACHNLLFATCFNTFGGMKIFFPNILKWIGRAGVALHTE

LAKEIRSVLNGGEVTMSALEQMPLMKSAVYEAFRIEPPVPAQYGKAKRDIVIESHDAAYEVKEGEMIFGY

QPFATKDPKIFDRPEEYVPDRFVGEGEKLLQHVLWSNGPETEHPTIGNKQCAGKDFVVFISRLFVVEIFR

RYDSFEIEVASSTLGSSVTITSLKRATF

 

CYP74B

 

>CYP74B18 gi|255576897|ref|XP_002529334.1  Ricinus communis

gi|223531205|gb|EEF33051.1  Ricinus communis

72% to CYP74B7 cottonwood

16812519_peptide|Rcommunis|29901.t000011|29901.m000415

29901: 160313 – 166417 long first intron

MATISTKMMKMAMSSSSSSSSSSSPVETVSTSTPQPPSSSLPLRTIPGSYGWPLLGPVSDRLDYFWFQGP

ETFFRKRSDKYKSTVFRANVPPTFPLFTGVNPNVIAVLDCKSFAHLFDMDIVEKKNILVGDFVPDIKFTG

SIRVSVYLDPSEPLHGKVKNFAMDILKRGSKVWLTELLANLDTLWDTIDKDISAKGSASFLFPLQQCIFK

FLTKALIGADTSASPEIEKSGYAMLDRWLALQLLPTIYIGVAQPLEEIFLHSFAYPFFLVSGDYRKLSEF

IRKEDVIQRAKTEYGLSEEEIIHNLLFVLGFNAYGGFSVFIPNLLSTIGSDTTGLQEKLRKEVREKGGPS

LNFDSVKEMPLVQSVVYETLRLNPPVPLQFARARKDFQLSSHDSVFEIKKGEILCGYQPLVMRDSEIFDD

PETFKPDRFMGSGQELLNYLYWSNGPQSGTPTASNKQCPAKDYATLSACLIVAHLFRRYDSFTGSSSSIT

AVEKAK

 

CYP85 CLAN

 

CYP85A

 

>CYP85A1 gi|223534738|gb|EEF36429.1  Ricinus communis

gi|255569892|ref|XP_002525909.1  Ricinus communis

88% to CYP85A1 cottonwood

AASG02022844 runs off the contig. No ESTs extend seq.

Missing the N-term

ALLRWNEVKY

MKKGLPPGTMGWPVFGETTEFLKQGPNFMKNQRARYGNFFKSHILGCPTIVSMDPEVNRYILMNEAKGLV

PGYPQSMLDILGKCNIAAVHGSTHKYMRGALLSLISPTMIREQLLPTIDVFMRTHLSNWHDKIIDIQQKT

KEMALLSSLKQIAGPDSSSISQAFMPEFFKLVLGTLSLPIDLPGTNYRNGFQARQNIVSLLRQLIEERRA

SKETHKDMLGCLMKTDENRYKLNDDEIIDQIITILYSGYETVSTTSMMAIKYLHDHPQILQELRKEHLAI

REKKMPEDPINLNDLKSMCFTRAVIFETSRLATIVNGVLRKTTKEMEINGFVIPEGWRIYVYTREINYDP

YLYPDPLSFNPWRWMDRSLESQNYLFIFGGGTRQCPGKELGIAEISTFLHYFVTRYRWEEVGGDTLMKFP

RVEAPNGLHIRVSSY

 

 

CYP87A

 

>CYP87A27 gi|255576544|ref|XP_002529163.1  Ricinus communis

gi|223531387|gb|EEF33222.1  Ricinus communis

54% to CYP87A2 Arabidopsis thaliana

55% TO CYP87A8 COTTONWOOD

MVFVTVVGLSLLLCLAHWVYNWRNPKCNGKLPPGSMGFPIIGETIQFFIPHRNLDVPPFIRKRTEKYGSL

FKTSIVGCKIIVSADAEVNHLIFQQEGKSFISWYMDSFTDILGKDNILFLQGFIHKHLRNLILNFVGSQS

LKQRLLPEIENLTCKHLQLWSTQGTVELKEAISTMIFSFSTELLFSCNGTKSTTKMRKYYADFLDGLISF

PLYIPGTAYWKCLQGRKEAMEIIKSTLEERRTAPKKEKKDFLDVMLEETDKDGSFLTEKTALDFLFMLPF

AFFESTSSVMVLALQLLSENPEALEELTKEHEAILSNREKNDSKLTWEEYRSMTFTHLVINETTRLVNIV

PRVFRKAVNDVQIKGYTIPAGWMVMVCPTTVHLNPVKYNDPLAFNPWRWQGEELNAGSKNFMAFGGGVRL

CAGADFVKLQMAIFLHYLVTKYRWSVIKGHVLKKPGVVFPDGFHVQLFDKNT

 

>CYP87A28 gi|223549941|gb|EEF51428.1  Ricinus communis

gi|255539523|ref|XP_002510826.1 Ricinus communis

57% TO CYP87A8 COTTONWOOD

MVFVTVVGLSLLLCLAHWIYTWRNPKCNGKLPPGSMGFPIIGETVQYFIPCTNLDIPPFLRERMERYGSL

FKTSIVGYKIVVSTDPEINHFIFQEEGKSFISWYVDSFTDIFGKDNSFFLQGFVHKYVRNLTLNFVGVQS

LKERVLPQVEKLTCKHLQSWSSQGTVELKEAISTMIFNFSAEMLFSSNETESTTKLRKSYAAFLDGLICF

PLYIPRTAYWKCLQGRKEAMGILKSMLEERRTAPKREKKDFLDVMVEETKKDGSFLTEKMVLDLLFMLPF

AFFESTSSTMVLAVKFLVENPEALEDLTKEHEAILSNRKTNDSEITWEEYRSMTFTHMVINETTRLANIV

PGIFRKAVKDVQIKGYTIPAGWMVVACPTTVHLNPVKYSDPLAFNPWRWQGEELHSGSKNYMAFGGGVRL

CAGADFVKLQMAIFLHYLVTKYRWSVIKGHVLKKPGVVFPDGFHIQLFDKNTN

 

>CYP87A29 gi|255537303|ref|XP_002509718.1  Ricinus communis

gi|223549617|gb|EEF51105.1  Ricinus communis

84% to CYP87A7

AASG02003363.1

MWSLWFGALVIISITNWVYHWRNPKCNGKLPPGSMGLPLLGETLQFFTPNTSSEIPPFVKERMKRYGPVF

RTSLVGRPVVVSTDPDLNYFIFQQEGQLFQSWYPDTFTEIFGRQNVGSLHGFMYKYLKNMVLNLFGPESL

KKMLPEVQQAASERLQLWSTQGSVELKEATASMIFDLTAKKLISYDEKNYSENLRDNFVAFMQGLISFPL

EIPGTAYHKCLQGRKRAMKILKNLLNERRRNPRQHQRDFFDYVLEDLQKEGSVLTEEIVLDLMFVLLFAS

FETTSLAITMAVKFLSDHPLALKQLTEEHEAILENRENADSGITWKEYKSMTFTFQVINETVRLANIVPV

IFRKVLRDIQFKGYTIPAGWAVMVCPPAVHLNRTKYEDPLSFNPWRWKDQEINTASKNFMAFGGGMRFCV

GTDFTKVQMAVFLHCLVTKYR (2)

WQTTKGGNIVRTPGLQFPNGYHIQFADKTTGLNST*

 

CYP87B

 

>CYP87B14 gi|255570410|ref|XP_002526164.1  Ricinus communis

gi|223534541|gb|EEF36240.1  Ricinus communis

50% to CYP87D12 Populus trichocarpa, 56% TO XP_002510669.1,

67% TO XP_002526166.1, 53% to XP_002514563.1

55% to CYP87B9 Vitis, 54% to CYP87D7P cottonwood

MTETKMWVLFHAVALIIIAMTHWIYKWRNPKCSSGKLPPGSMGLPLIGETIQFFIPSKSVDIPSFAKNRI

KRFGPVFKTSLAGRPVVVSSDADFSHFILQQEGKLVELWYMDSFAKLLGQYGSLQEGSTNVIGAFHKNIK

KLISDYFGPENLKEKLLPELEEMANQTLSTWSCQDSVEVKLECSKMILNFTARHLFGYDPIKYGIDISEM

FTVFTQGLMSFPVNIPGTAFHKCMQTRKKIFKMIRDTIQERCTCPEARREDFLDHLIDDMKTENLLTENL

ITFAIFALLLATFETIPSTLALAIKLLAEHPTVVQELLKEHKEIIESRGNEASAGIIWKENKAMTFTMRV

INESLRISSAAVGILRKSIQDIHANGYVIPKGWTIIVLPSAIHLNPQTYQDPLHFNPWRWKVITRIGPNV

SAKNFIPFGGGLRSCGGAEFSKVLMAAFFHVLVTKYRWIKVKGGEIVRGPSLGFGNGYYIKVSEWSQ

 

>CYP87B15 gi|255570414|ref|XP_002526166.1  Ricinus communis

gi|223534543|gb|EEF36242.1  Ricinus communis

53% to CYP87B6 Vitis vinifera, 66% TO XP_002526164.1, 51% TO CYP87D8 COTTONWOOD

AASG02000889

gi|255570412|ref|XP_002526165.1  Ricinus communis

gi|223534542|gb|EEF36241.1  Ricinus communis

76% to XP_002526164.1, 55% to CYP87B9 Vitis

N-TERM OF XP_002526166 (JOIN)

MWPMGIYIFAFAILVYVAFWIFRWRNPPCNGRLPPGSMGLPLIGETIQFFIPSKSLDMPLFVKNRIKK (2)

YGPMFKTSLAGRPVVVSSDADFNHFILQQEGKLVELWYLDSFAELLGQNGSLKEGFLGYVHKHIKKLISEHFG

PERLKAKLLPQLEEMVNNSLQAWSKQESVEVKHACSRMILDFTSKLLFSYDTGNNEESLSETFSSFIQGL

FSFPLNIPGTSFRKCMQNQKKILNMIRVTLVERRAFPETSRGDFLDSLAEDMKADSLFTDDLVTLVIFVL

LLATSETIPSTLTLAIKLLTEHPLVMQELVKENEEIIRSRENKETGLTWKEYKSMTFTMHVINEALRMSG

SVGILRRTMEDVYINGYTIPKGWTVMIVPSSLHLNPHTYKDPLAFNPWRWKDLGPNVRAKNFIPFGGGMR

TCGGAEFSKVLIAVFLHVFVTKYRCTNVKGGEIVRTPMLGFGHGHYIKVSKKPEMI

 

>CYP87B16 gi|255547011|ref|XP_002514563.1  Ricinus communis

gi|223546167|gb|EEF47669.1  Ricinus communis

50% to CYP87D1 Populus trichocarpa, 62% TO CYP87B9 VITIS

MWPYWFYVVALVVVGITHWVYRWKNPKCNGKLPPGSMGFPLIGETIEFLRTSKSLDVSPFMKKRMKKYGS

LFKTNLAGRPVVVSSNPDFSYFLLQQEGKLVERWYLDSLAKLLRQDVTSIISVHYIHKYLRNLILSHFGS

ERLKAELLPGLENAISGSLQDWSELPRVEVKSVISNMIFDFTARRLFGYEVAKSSEKDLAQSFTNFLEGL

MKFPLNVPGTSFYKCKKNQKRILKLIADELGKRRESPKKQKEDMLDQIVEDMKKETFWTDDFAIYVMFGI

LLASFETISSTLAVCINFLTDNPSMVQKLTEEHEELVKNRENKNSGLSWEEYKSMTYTHHVVKESLRLAS

VAPGILRRALKDIEVDGYTIPKGWAILVVPAAVQLNPNTYEDPLAFNPSRWENMGEVATAKNFIAFGGGS

RSCTGAEFSKVLMAVFLHVFVTKYRLTKIKGGEMIRCPVLAFGDGLHVQVTAKLE

 

>CYP87B17 gi|255539208|ref|XP_002510669.1  Ricinus communis

gi|223551370|gb|EEF52856.1  Ricinus communis

52% to CYP87A2 Arabidopsis thaliana, 69% to XP_002514563.1

56% to XP_002526164.1, 65% TO CYP87B9 VITIS, 76% to CYP87D7P cottonwood

note 87D7P is 61% to CYP87B9 Vitis so 87D7P is missnamed

METWSIYWLSFLSFIVISATHYLIYKWSNPKCNGKLPPGSMGFPLIGETIEFLIPSKSLDVPNFIKKRMR

KYGPLFRTNLVGRPVAVSSDPDFNYYLLQQEGKLVERWYMDSFSKLLHHDVTQVISKHGSIHKYLRNLVL

GHFGPEPLKEKLLPQLETGIRQRLQIWSKQPSIEAKSASSAMIFDFTAKVLFSYDPEKSKENIGESLSNF

LQGLMSIPLNIPGTAFHRCLKNQKRAIKVITKLFEERRSNPEINKGDFLDQIVEDMKTDSFWTEEFAIYV

MFGLNLASFETISSTLALAIKFLTDNPSVVDRLTEENEAILKNRENADSGLSWKEYKSMTYTHQVVNESL

RLASVAPGILRRAITDIEVDGYTIPKGWTIMVVPAAVQLNPNTYKDPLAFDPSRWENMGSVAMAKNFIAF

GGGSRSCAGAEFSRVLMAVFFHVFVTKYRWVKIKGGDMVRSPALGFGNGFHIKVTEKQE

 

CYP87D

 

>CYP87D14 gi|255573862|ref|XP_002527850.1  Ricinus communis

gi|223532774|gb|EEF34553.1  Ricinus communis

59% to CYP87D8 Populus trichocarpa, 51% to CYP87E3 Solyc04g009930

49% to XP_002510669.1

MLTIILFLVALLPLYYAFWINKWRNPNSKGVLPPGSMGFPVIGETLQLLIPSFSLDIHPF

IRKRTQRYGPIFRSNLAGQSIVISTDPEFNRYILTQEGRLVEIWYLNTFSKIFSLEGESR

TTAAGEIHKYMRGTFLTQFGLERLKEKLLPQIVNMVNETLYSWSTQEVIKVKHAVSTTIC

DFTAKIFCGYDARVSPDKLSECFTTFAEGLMSFPLNLPGTTYYQCLKNQQKAINILKKMV

KERRTSAEKHVEDFLSTALNDMEKEKFLTDDFITTLLFGLLFASFETISTTMTLMLNLLS

SHPSVLQDLMAEHESILQNKPLDSSIKWDEYKSMTFTHQVINETLRLGNVAPGLLRKAIK

DVHYKGYTIPAGWTIMVATSIRHVNPEIYKNPLVFNPYRWKDLDSHIISKNFTPFGGGTR

QCVGAEYSRVILAIFLHVLVTKYR

 

>CYP87D15P gi|255573860|ref|XP_002527849.1  Ricinus communis

gi|223532773|gb|EEF34552.1  Ricinus communis

pseudogene

57% to CYP87D11 Populus trichocarpa N-term, 65% TO XP_002527850.1

AASG02012222.1

MWTIILFLAALLVIYYTIWINKWGNPECEGVLPPDSMGIPIIGETLQLFIPSNSLDIH ()

RYGPIFRSSVAGRPAVISTDQELNHYILTQEGRTVQLWYLGTFSKIFALDGESRTHPFGY

IHRYSRGAILSQI &

GSESLREKLLP &

QMESMVTETLHS*SAQEQIVELKHAVSK

 

CYP88A

 

>CYP88A41 gi|255571147|ref|XP_002526524.1 Ent-kaurenoic acid oxidase Ricinus communis

gi|223534199|gb|EEF35915.1 Ent-kaurenoic acid oxidase Ricinus communis

77% to CYP88A9 cottonwood

MEMGFVWVVLIWISGGFWCLKWILKRVNCWLYENQLGEMQYSLPPGDLGWPFIGNMWSFLRAFKSNDPDS

FMRNFTARYGSGGIYKAFMFGKPSVLVTTSEACKRVLTDDDAFKPGWPSSTTELIGKKSFIGISYEEHKR

LRRLTASPVNGHEALSVYMHYIEDKVKSALEKWSTMGEIQFLTQLRKLTFRIIMYIFLSSESHSVMEALE

REYTTLNYGVRAMAINLPGFAYYKALKARKNLVAVLQFVVDARRNQKKGAEPNSSKKKDMMDALLDVEDE

KGRKLSDEEIVDVLLMYLNAGHESSGHITMWATVFLQEHPEFLQKARQEQEEIIKRRPPTQKGLTLKEVR

DMEYLSKVIDETLRLITFSLVVFREAKTNVNISGYVIPKGWKILVWFRSVHLDPEIYPNPREFNPSRWDN

HTAKAGTFLPFGAGSRMCPGNDLAKLEIAIFLHHFLLNYELERLNPGSSMMYLPHSRPKDNCLARIKKIP

SA

 

CYP90A

 

>CYP90A35 gi|255622756|ref|XP_002540303.1  Ricinus communis JOIN with XP_002534433

gi|223496973|gb|EEF22080.1  Ricinus communis (TOP PART)

73% to CYP90A1 Arabidopsis thaliana N-term, 85% to CYP90A7 cottonwood

gi|255587896|ref|XP_002534433.1  Ricinus communis

gi|223525301|gb|EEF27948.1  Ricinus communis (BOTTOM PART)

MALVFLFLSLFSFSLVIFIIHRTSRHRRLRLPPGNFGLPFVGETLQLISAYKTENPEPFIDERVNRFGSL

FTTHVFGEPTVFSADPETNRFILQNEGKLFESSYPSSISNLLGKHSLLLMKGSLHKRMHSLTMSFANSSI

IKDHLLVDIDRLVRLNLNCWTDRVFLMEEAKK (0)

ITFELTMKQLMSFDPGEWTESLRKEYVLVIEGFFTVPLPIFSTTYRRAIKARTKVAEALSLIVMQRRRESESGERK

KDMLGALLAADDGFSDEEIVDFLVALLVAGYETTSTIMTLAVKFLTETPLALAQLKEEHEGIRAKKSEGE

ALEWSDYKSMPFTQCVVNETLRVANIISGVFRRAMTDINIKGYTIPKGWKVFASFRAVHLDHDHFKDARS

FNPWRWQNNSGVTCPGNVFTPFGGGPRLCPGYELARVELSVFLHHLVTRFSWVPAEEDKLVFFPTTRTQK

RYPINVQRRSDVKS

 

CYP90B

 

>CYP90B21 gi|223539281|gb|EEF40874.1  Ricinus communis

gi|255561182|ref|XP_002521603.1  Ricinus communis

82% to CYP90B7 cottonwood

MSDSELIPFILPSILSLILVFILIYRKQARFNLPPGNMGWPFLGETIGYLKPYCATTIGEFMEQHISRYG

KIYKSNLFGEPTIVSADPGLNKFILQNEGRLFECSYPRSIGGILGKWSMLVLVGDMHRDMRTISLNFLSH

ARLRTHLLREVEKHTLLVLDSWSDNSTFSAQHEAKKFTFNLMAKHIMSMDPGKPETEQLKKEYVTFMKGV

VSAPLNFPGTAYRKALQSRSSILKFIERKMEERVGKMEEEEDLLGWVLKHSNLSREQILDLVLSLLFAGH

ETSSVSIALAMYFLQGCPRATQQLREEHMAIARAKNESSRSELNWEDYKKMEFTQCVISETLRLGNVVRF

LHRKAVENVRYKGYDIPRGWKVLPVIAAVHLDSSLFDQPQLFNPWRWLHHHSNRGGCGNYFMPFGGGPRV

CAGSELAKLEMAIFIHHLVLNFSWELADNDQAFAFPFVDFPKGLPITIRANHQKKQETS

 

CYP90C

 

>CYP90C14 gi|223539182|gb|EEF40775.1  Ricinus communis

gi|255560984|ref|XP_002521504.1  Ricinus communis

no ESTs in the EXXR region

AASG02004514 runs off the end of the contig at TDY

AASG02009303.1

74% to CYP90C3 cottonwood

MGCWVVMGAIVIGWCWFYSNNKKMKMKMKNDSKVKGMKSKMGKKSEVPKGNLGWPFLGETFDFIACGYTS

QPVNFMEKRKSLYGKVFKTHILGTPIIVSTDPEVNKVVLQNHGNVFIPAYPKSIRELLGEFSILQVNGNL

QKKLHAVIAGFLRSPQLKAVITKDIENSVKLTLASWRGMPLVLVQEQTKKITFQVLVKALMSIGPGNDLD

FLKREFEEFIKGLICLPIKLPGTRLYKSLKAKEKLLKMVKKIVEQRKEAMEKCNDEANLRPNDILDVLLR

DNVEGNDHKQSDFISSNIVEMMVPGEETVPMAMTLAVKFLSDCPVALKQMTEENMELKRQKTDTCDEYDW

TDYMSLTFTQN (0)

VISETLRLANIINGVWRKALKDVEIK (1)

GNLIPKGWCVLASFISVHMDKEKYENPYQFDPWRWERTGTAVNNSCFTPFG

GGQRLCPGLELSRLEISIFLHHLVTTYRWVAEKDDIVYFPTVKMRRKLPITVTTLHQPYQ

 

CYP90D

 

>CYP90D21 gi|255572967|ref|XP_002527414.1  Ricinus communis

gi|223533224|gb|EEF34980.1  Ricinus communis

86% to CYP90D5 cottonwood

MDSLLLIVLTILLSSVIILYRNCRLFSILFRSSKTKTPLPLGNLGWPFLGETLEFVSCAYSDRPESFMDK

RRRMYGKVFKSHIFGTPTIVSTDAEVSKFILQGDAKMFVPSYPKSLTELMGKSSILLINGSLQKRIHGLI

GSFFKSPHLKAQITRDMQVYVQESMKNWRCDQPIYIQDETKNIAFQVLVKALISLDPGQEMESLKKQFQE

FICGLMSLPVNIPGTQLYRSLQAKKKMVKLVQRIIQSKRDGGISTVPKDVVEVLLNDANAQLTDDLIADN

MIDMMIPGEDSVPVLMTLAVKYLSDCPAALQQLTDENMKLKSLKAQLGEPLTWTDYLSLPFTQRVITETL

RMGNIIIGVMRKAMKDIEIKGYLIPKGWCAFAYFRSVHLDENHYDWPYQFNPWRWQDKDMSNSNFTPFGG

GQRLCPGLDLARLEASIFLHNFVTQFSWVAEEDTIVNFPTVRMKRRMPIWVKRREEDQSLSL

 

CYP707A

 

>CYP707A78 gi|255555455|ref|XP_002518764.1  Ricinus communis

gi|223542145|gb|EEF43689.1  Ricinus communis

58% to CYP707A1   Arabidopsis thaliana

80% to CYP707A12v1 cottonwood

MEIAFILIYMCLFVSCLLSYPLLIIKKKKWESKPRARLPPGSMGWPYVGESLKLYSQDPNVFFATRQLRY

GEIFKSHILGCPCVMLASPEAARFVLVTHAHLFKPTYPKSKEKLIGPSALFFHQGEYHNHLRKLVQSSLS

PDTVKKLIPDIQSTAISALESWADGHIINTFNEMKKLSFQVGILSIFGHLDSNYREKLDENYHIMNKGYN

SFPTNIPGTAYQKALLARKKLNQILGEIISERKEKRLLEKDLLGRFLNFKDENGQILTEDQLADNIIGVL

FAAQDTTASVLTWILKFLYDDQKLLEAVKAEQMAIYKVNKGGKFLTWAQTRNMPLTHKVILESLRMASII

SFAFREAIIDVEYKGYLIPKGWKVMPLFRNIHHNPELFPDPDIFDPSRFEVPPKPNTFIPFGNGAHACPG

NGLAKMEMLIFIHHLVTKFRWEVEGSVDGIQYGPFPVPQQGLPARFWQESN

 

>CYP707A79 gi|255555535|ref|XP_002518804.1  Ricinus communis

gi|223542185|gb|EEF43729.1  Ricinus communis

78% to CYP707A1 Arabidopsis thaliana

83% to CYP707A15 cottonwood

MDFFAFFFLLFLSISFVFLLISLLNFFFPSNSSAKLPLPPGSLGWPYIGETFQLYSQNPNVFFASKQKRY

GSVFKTHILGCPCVMISSPEAARFVLVSKAHLFKPTFPASKERMLGKQAIFFHQGDYHNKLRKLVLRAFV

PDAIKSIVSDIESIAKESVHSWEGRDINTFQEMKTYAFNVALLSIFGKDEFQYREELKRCYYILEKGYNS

MPINLPGTLFHKAMKARKELAQILAKTLSSRRQMKLDRNDLLGSFMEDKEGLSDEQIADNIIGVIFAARD

TTASVLTWILKYLGENPSVLQAVTEEQEEIVRSKEKSGEQKVLSWADTKKMPVTSRVIQETLRVASILSF

TFREAVEDVEYEGYLIPKGWKVLPLFRNIHHSPEIFPDPEKFDPSRFEVAPKPNTFMPFGNGTHSCPGNE

LAKLEILVLLHHLTTKYRWTMVSTDNGIQYGPFALPQNGLPIKLSQKS

 

>CYP707A80 gi|255588229|ref|XP_002534542.1  Ricinus communis

gi|223525080|gb|EEF27842.1  Ricinus communis

CYP707 fragment 56% to CYP707C1v1 Selaginella mollendorffii

65% to XP_002510214.1

84% to CYP707A10 cottonwood

AASG02015057.1 no ESTs extend seq.

REQEEIRREIIEANRRLTWDDTKRMPLSSR

VIQETLRRASILSFTFREAVQDVEFEGYLIPRGWKVLPLFR

SIHHSADFFPQPEKFDPSRFE (0)

VPPRPNTYMPFGNGVHSCPGSELAKLEMFILIHHLTITYR (2)

WQAMEEEDGIQYGPFPVPKKGLPIRVTPRPMSRLAI

 

>CYP707A81 gi|255565166|ref|XP_002523575.1  Ricinus communis

gi|223537137|gb|EEF38770.1  Ricinus communis

59% to CYP707A1 Arabidopsis thaliana

68% to CYP707A11 cottonwood

MGMVLVYSFCLALLLITILKRWQPKQKPNLPPGSMGLPYIGDTLQLYSQNPNIFFASRQKRYGEIFKTRI

LGCPCVMVASPEAIRFVLVTQASLFKPTYPPSKENLIGPSAIFFHQGSYHSQMRKLVQVSLSLDVIRNLV

PHIEAIAVSALGSCSSANVVNTFHEMKKFAFDAAVLSIFGNCLDNSYREKLKRNYYILDKGYNSFPTNLP

GTSYSKSVMARKRLSRILGQMIRERKEKGLVQKDLLGYLLNFKDEKGQFLSDEKITDNIIGVLFAAQDTT

ASILTWILKYIHDDPKLLEAIKIEQTAIFESNGRGEKPLTWSQTRNMPITNRVIMESLRMASVISFTFRE

AVEDVEYKGYLIPKGWKVLPLFRNIHHNPNFFRDPHVFNPSRFEVGPKPNTFMPFGNGVHACPGNEVAKL

EMIILIHHLVTKFRWEIIGPVSGVEYDPFPVPEKGLPAKFWEESRNHSWP

 

>CYP707A82 gi|255538298|ref|XP_002510214.1  Ricinus communis

gi|223550915|gb|EEF52401.1  Ricinus communis

84% to CYP707A13

AASG02009225.1 top part

AASG02024284.1 bottom part, no EST to join  fragments

MGGILVYILFFLFSLLWYITKRRNKKELSKGVKLPPGSMGWPYIGETLQLYSQDPNVFFADKQKRYGEIF

KTHILGCPCVMLASPEAARFVLVTQAHLFRPTYPKSKEHLIGPSALFFHQGDYHLRLRKLVQGSLSLFAL

RNLVADISSIAASTLDSWDGGHVINTFQELKKFSFEVGILAIFGNLESHYREDLKKNYRIVDKGYNSFPT

SLPGTPYRKALMARKRLSKILSDIISQRKEKKLLDNDLLGCLLNSKDEQGNVLTDDQIADNIIGVLFAAQ

DTTASAMTWIVKHLHDNXXXXXXXX

AEQKTIYELNDEGSQPLSWGQTRNMPLSHKVVLESLRIASIISFTFREAVADVEYKGYLI

PKGWKVMPLFRNIHHNPEYFSDSQKFDPSRFEVAPKPNTFMPFGNGVHACPGNELAKLEMLIITHHLVTK

FRWEVVGSQNGIQYGPFPVPVHGLPARFWRESTSC

 

CYP716

 

>CYP716A54 gi|255574173|ref|XP_002528002.1  Ricinus communis

gi|223532628|gb|EEF34414.1  Ricinus communis

61% to CYP716A1 Arabidopsis thaliana

81% to CYP716A8 cottonwood

MFPFAVLLIALSISYLIFKHKSNASSRKNLPPGNTGWPLIGESIEFLSTGRKGHPEKFIFDRMEKFSSKV

FKTSLLLEPAAVFCGAAGNKFLFSNENKLVTAWWPNSVNKIFPSSLQTSSQEESKRMRKLLPQFLKPEAL

QRYISIMDVIAQRHFAFGWNNKQQVTVFPLAKMYTFWLACRLFLSMEDREEVEKFAKPFDVLASGIISIP

IDFPGTPFNRGIKASNEVRRELIKMIEQRKIDLAENKASPTQDILSHMLTTADEYMNEMDIADKILGLLI

GGHDTASAAITFVVKYLAEMPQVYNKVLEEQMEIAKAKAAGELLNWEDIQKMRYSWNVACEVMRLAPPLQ

GAFREAMTDFTYAGFTIPKGWKLYWGANSTHRNPECFPEPEKFDPSRFEGKGPAPYTFVPFGGGPRMCPG

KEYARLEILVFMHNIVKKFRWEKLLPEEKIIVDPLPIPAKGLPLRLHPHTS

 

>CYP716A55 gi|255574133|ref|XP_002527982.1  Ricinus communis

gi|223532608|gb|EEF34394.1  Ricinus communis

54% TO XP_002528002.1, 50% to CYP716A1 Arabidopsis thaliana,

52% to CYP716A10 cottonwood, best hits all CYP716A

MELIHSVFISAIFSIALVLYFLNYKSKPRKDRAESLIPTPPGTTGWPLIGETLEYLSTTKAGIPEKFIND

RRKRYSSKLFKTSLLGQPTVLLCNADGNKFIFSNENKLVTSWWPSSVDKFFDTQNASKTEESMKMRKFVT

PVLKPDTLRKYVHIVDAITRQHLRDHWGGKQVVEVYPFAKDLTFVLACRLLLGIDDEEAISQLQKPFAHF

SAGLLSLPLDLPGTNFRRAIKAAKQLRNEFEVMIKRWKTDTSQSQGILSQHLVEINEEGQSTSESEMATR

ILALISASYDNVSTAMTFVIKYLAEMPNVYDAVLREQMGIAKAKEAEVGLNWDDIQKMRYSWNVASEVLR

LHPPANGAFREVIHNFMYAGYLIPKGWKLHWNAFATHKSAEYFPEPEKFEPSRFEGNGLVPYSYVPFGGG

AHMCPGKEYARIAMLVLMHNVVTNFKLEKVFPNEKVIGLPVLRPAKGLPLRLHPQHSLST

 

>CYP716A56 gi|255563874|ref|XP_002522937.1  Ricinus communis

gi|223537831|gb|EEF39448.1  Ricinus communis

62% to CYP716A1 Arabidopsis thaliana

79% to CYP716A9 cottonwood

MDHFYLTLLFLFVSFITFSIFIIFYKHKSQYNYPSLPPGKPGLPFVGESLEFLSSGWKGHPEKFVFDRTS

KYSSEIFKTNLLGQPAAVFCGASANKFLFSNENKLVQAWWPDSVNKIFPSSLQTSSKEEAIKMRKLLPQF

MKPEALQRYIGIMDTIAQRHFASGWEKKNEVVVFPLAKNYTFWLACRLFVSLEDPDHIAKFADPFQELAS

GIISVPIDLPGTPFRRAIKASNFIRKELISIIKQRKIDLAEGKASGTQDILSHMLLTSDEDGKFMNEMDI

ADKILGLLIGGHDTASAACTFIIKYLAELPQIYDAVYKEQMEIAKSKGEGELLNWEDIQKMKYSWNVACE

VMRVAPPLQGAFREAINDFIFNGFYIPKGWKLYWSANSTHKSATYFEEPEKFDPSRFEGKGPAPYTFVPF

GGGPRMCPGKEYARLEILVFMHNLVKRFNFQKIIPDENIIVNPLPIPAKGLPVRLLPHQI

 

>CYP716A57 gi|255544242|ref|XP_002513183.1  Ricinus communis

gi|223547681|gb|EEF49174.1  Ricinus communis

58% to CYP716A1   Arabidopsis thaliana

69% to CYP716A10 cottonwood

MELFFLIALTLFIILVTLPILAVLYRPNIINLPPGKTGLPYIGESLEFLSTGRKGHPEKFLSDRMEKFSR

QVFRTSILGEQTAVVCGAQGNKFLFSNENKLVTAWWPKSILRLFPSSNQSTILAEGMRMRKMLPHFLKPE

ALQRYIGVMDHMAQVHFQDSWENKQEVTVYPLAKMYTFSVACKVFLSMDDPKEVAKFAAPFNDMASGIIS

IPINFPGTSFNRGLKASKIIRNEMLRMIKQRRKDLAENKATPMQDILSHMLVATDEEGQRLGEVGIADKI

ISLLIGGHDTASATITFVVKFLAELPDIYDQVLKEQLEIAKSKEPGELLTWEDIQKMKYSWNVACEVMRL

APPLQGSFREALHDFDYAGFSIPKGWKLYWSTHTTHKNPEYFSDPEKFDPSRFEGSGPAPYTFVPFGGGP

RMCPGKEYARLEILVFMHNIAKRFKWNKVIPDEKIVVDPMPIPAKGLPVHLYPQKHE

 

>CYP716C8 gi|255578049|ref|XP_002529895.1  Ricinus communis

gi|223530622|gb|EEF32498.1  Ricinus communis

71% to CYP716C1 Poptr

MEVFLITCILASVSFLVFVFRYLFSNDSFKKLPPGSMGWPIIGETLEFLFGKPENFVFKRMEKYSHDIFK

TKILGEKTAVICGPNGHKFLFSNEQKLFTVFRPHSMQKLFRSSYQNKAPPKEAELKNLRASPAFLKPEAL

VRYLAKMDSITQQQMRNHWEGKDSVKVFPFSKTLTLTLACRFFLGTEDPERIARLVGHFDDITVGMHSIT

VNFPGTIFYRAKKAVTAIRKELIAVVKQKKEAIAAGAPMQDILSHMIVASDPSGKFMPEAEIADKMMGLL

TAGYSTVATSITFFMKYVGERPDIYKKILEEQREVASAKKEGEVLQWEDVQKMKYTWNAVNEVMRLTPPL

QGTFREAITDFTYAGYTIPKGWKIYWTVTTTNKNPEYFPNPEEFDPSRYDDDKAIPPYAFVPFGGGPRTC

PGKEYARLAILTFVHHVIKRFKWELEIPGEKIFGDMMPTPEKGLPVRLRPANF

 

>CYP716C9 gi|255578045|ref|XP_002529893.1  Ricinus communis

gi|223530620|gb|EEF32496.1  Ricinus communis

78% to CYP716C1 Poptr

MDLNFLFLMSLPAFAVIALFAFKIRSKNGSKNLPPGSLGWPVIGETIEFLFGKPEKFVFDRMKKYSPEIF

KTNILGEKTAVICGPNGHKFLFSNEQKLFTAFRPHSMQKIFRSYQSSAPPAQISREAEIKMLRSPGFLKP

EALVRYLGTMDSITQQHMEYYWVGKDELKVFPLAKTLTLSLACRFFLGTHEPDKITRLVGNFDDITLGIH

SIPVNFPGTIFNKANKAAAAIRKELRTIINEKKAAMETGGRMQDILSHMIMASDPTGKHMPEAEIADKIM

GLLVAGYSTVATAMTFFMKYVGERPDIYAKVLAEQKEISEAKKDGELLEWNDIQKMKYSWNVMYEVMRLT

PPLQGTFREALTDFTFAGYTIPKGWKVYWTVSTANKNPDYFPNPEEFDPSRYEDDKRLPAFTFVPFGGGP

RMCPGKEYARLAILTFINNVVKRFKWEVAIPQEKVIGDMMPTPEKGLPICLISH

 

>CYP716D13 gi|255564830|ref|XP_002523409.1  Ricinus communis

gi|223537359|gb|EEF38988.1  Ricinus communis

57% to CYP716D1 Poptr, 61% to CYP716D3v1 cottonwood

AASG02007472.1 runs off the end (top part)

AASG02011572.1 no ESTs close the gap

MELVMFPVLALVSTLFLLALHFIIRTLKERLFGSPNLPPGRLGWPLIGETPAFFRAGFEAKPEKFIGERM

EKYDSRVFKTSLLGKPFAVISGTAGHKFLFSNENKLVNLWWPESVRMLFKSALVSVVGDEAKRIRKMLMT

FLGLDALKNYTERIDMVTQQHIRTYWEGKEEVTVYSTLKLYTFTLACNLFASINDPERLSKLGAHFDVFV

KGVISLPISIPGTRLYKSMKAANAIREELKLIVRDRKEALERKMASPTQDLLSYLLVDSDTNGRFLSEME

ILDNIMLLLYAGHDTSKSSLTLXXXXXXXXXXXXXXXXX

EQLEIANSKKPGELLQWEDVQKMRYSWNVISEVLRLSPPVSSAYRHAIVDFTYEGYTIP

KGWQLFTSFGTTHRDPALFPNPERFDASRFEGNGPPSYSYIPFGGGPRMCIGYEFARLEMLIFLHNIIKR

FKWDILIPDEQFGYNPLLAPSQGFPVRLRPHHSHL

 

>CYP716D14P gi|255556691|ref|XP_002519379.1  Ricinus communis

gi|223541446|gb|EEF42996.1  Ricinus communis

64% to CYP716D3v1 Poptr, 50% TO XP_002513183.1

pseudogene

AASG02004165.1 missing the N-term

LMLTFLNPEALKRYTERMDTIDRHMKEHWEGKEEVKVHPAARIFTFELACNLFASIDDPAQISKLAALFTV

FKEGLFDFPINMPGKRFYSFMKAASAIKEDLKLIARERKEALDKKLVSPTQDLLSLLLVTADTSGRFLSE

TEIVDNILALLFAGHDTSRSARTLLMKCLGELPEVYAKVLKEQTEIAKCKEPGQMLQWEHIQKMKYSWNV

ASEIMRLSPPVNGAFREALVDFFLSGLHDPKRME

LHLSTASTHQDPESFDASRFEGGGPAP*SYVSFG

GGPRMCLGHEFARLEILVFLHNVVTRFKWDLLIPDE

KFRQEPTLTPTQELPIRLHPHQS

 

>CYP716E9 gi|255571712|ref|XP_002526799.1  Ricinus communis

gi|223533803|gb|EEF35534.1  Ricinus communis

58% to CYP716E1 Poptr, 61% to CYP716E2 cottonwood

MDFLYPYLLHLVILALSLFLIFLVYFKHSKFPPVKLPPGTKGWPFIGESLAFLMTSRRGHPEKFINDRVT

KYSADVFQTSLLGENMAVFCGAAGNKLLFTSENKYVKAWWPKSLLKAFLVPDPDEFSFKEVSTGYRRILT

EFLKPEALQRSIPVMDSMAREHLKTDWHPFKEVKVFPLIRKYSFALSCRLFISIKDPNLVSKLLGPFALV

SSGMLSVPINFPGTPYYKAIKASKVINHDFLEIMNRRKLELAEKKNITSPDLLTRLLLHKEDDGRSMTDA

GVYSRIMALLFASHDTISTAITFMFKHLAEHPHVSNRVFKEQMEIAKSKEPGELLNWEDIQKMKYTWCVA

CETMRLLPPSQGAFREAITDFTYAGFTIPKGWKIYWTVHSTHKNPKYFPDPEKFDPSRYEGDGPAPYTFV

PFGGGPVMCPGREYARLEILIFMHNMVTKFKWHKVIEGEKIIFHSAPIPVKGLPILLEPL

 

>CYP716E10 gi|255561544|ref|XP_002521782.1  Ricinus communis

gi|223538995|gb|EEF40592.1  Ricinus communis

59% to CYP716E1 Poptr, 60% to CYP716E2 cottonwood

MDNLSLYFLLICLSLCIFLIYKSKPANPQFPPGKTGWPVIGETLDYLINARHGVPDKFVIKRMKTYSPDV

FQTSLLGDRMAVFCGASGNKFIFSTGNKFVQAWWPRSLKQALLFPETHDNSYNEESCILRSFLRDFLRAE

ALKDYIPVMDSMAKEHLEAEWLPYKEVKVFPQVKTYIFALACRMFMSIKDPVHVKRVKDLFDVVAAGVFS

LPVNIPGTAFNRAFRGGKIMREEFLAIIKQRRSELLENKGTEEAGMDLMSRMLLGLDHDHQEGGTLDEMK

IANRIMGLLIAGYDTTTISLTAIVNYLAENPNIYDKVLREQMEIAKSKIPGELLNWGDVQKMKYAWCVAC

ESMRLSPPVQGTFKEVTTDFTYAGFIIPKGWKTHWTVHSTYKDPKYFPDPGKFDPSRFEGQGPPPYTFVP

FAGGPRMCPGKEYARFEILVFVHNLVTKFQWEKVIPDEKIIYIPNVTPENGLPVRLLPHQNYE

 

>CYP716E11 gi|255603132|ref|XP_002537996.1  Ricinus communis

gi|223514286|gb|EEF24387.1  Ricinus communis

49% to CYP716E1 Poptr N-term, 88% TO XP_002526799.1

AASG02033806 runs off the contig end, no EST extends the seq.

MDFLHPYFLHLVILVLSLFLIFLVYFKHNKSPHVKLPPGTKGWPFLGESLAFLMTARRGHPEKFVK

DRVKKYSPDVFQTSLLGENMAVFCGASGNKLLFTSENKYVKAWWPKSLLKAFIVPDPDEFSYKE

VSTSWRRILTEFLKPEA

 

CYP718

 

>CYP718A11 gi|255558720|ref|XP_002520384.1  Ricinus communis

gi|223540431|gb|EEF42000.1  Ricinus communis

AASG02006032 top part, AASG02016734 bottom part (runs off the contig)

Missing EXXR up to the heme signature, no ESTs fill in the gap

MAMDISNASSSWAIFCLAIAILISTMFLKHKLVHNKIKRRLPPGELGLPWIGETMEFFQAQRSNRLFEEF

VQPRIAKYGNIFKTRLMGSPTIVVNGAEANRFFLSNEFKLVISSWPTSTVQLMGKNSIMEKQGDQHRCIR

GLIATTLSNARLEVLVPKMCQSVEVHLEKYWNGDKNVSLYRSAKALTFTIVFECLLGIKVDAGTLSTFEW

ILDGVFATPFSLPGSRFSKAKKARKEVEKMLVELVREKRKEMEEGLQRVDDGVLLCQLIGGMIRGEIREE

EVIDNVVLLVFAAHDTTSFAIAMTFKMLALHPDCYALLLQ

 

FGGGPRLCAGYQLAKLNILIFVHYVVTRYDWSL

IYPDEQITMDPLPFPSHGMPIKISANPRA

 

CYP720

 

>CYP720A1 gi|255569035|ref|XP_002525487.1  Ricinus communis

gi|223535224|gb|EEF36902.1  Ricinus communis

67% to CYP720A1 Arabidopsis thaliana, 73% to CYP720A1 cottonwood

AASG02009008, possible GC boundary at CRK

MREVTLWAFVIPTLLLLLCIIFVLNKKFKLKRRHFQLPPGRRGWPFVGDSFNWYKAVAG

SYPPQFVHQQANR (2)

YGKIFSCSLFGKWVVVSTDPTFNRFVMQNEGKLFKSNYPKSFRDLVGKNGVITVQ

GEKQRKFHGIASNLMRIDKLKFHFLNDIQMVMLQTFNNFRNNQVILLQDVCRK (0)

VAINLMVNQLLGVSSESEINEMAQLFSDFVDGCLSLPINLPGCTYYTAMKAREKIISKIKRTIEDHRGSAYEGND

VLGRLLNEENLDDEAIADFVINLLFAGNETTAKTMLLAVYFLTQCPKAMQQLLNEHDSLRKNRGDKLLTW

QHYKAMPFTQCVIDETLRIGGIAIWLMREAKEDVYYQEYIIPKGSPVIPFLSAVHLDENIYKGALTFNPW

RWMDPEYQENRNWRSSPVYSPFGGGARFCPGAELARLQIALFLHYFVTKYRWTQLKADQLSFFPSARLVN

GFQIRLITRDDQQNETSF

 

CYP722

 

>CYP722A1 gi|255538716|ref|XP_002510423.1  Ricinus communis

gi|223551124|gb|EEF52610.1  Ricinus communis

AASG02000457.1

74% to CYP722A1 cottonwood

MHSFLSADANPYCLCFYAVLVLLLLLFILRK

MLWGPFQESLANIPPGSRGLPLIGETLQFMAAINSDKGFYDFVRVRRLRYGNCFKTSIFGQTHVFISSTE

SAKTILNNESGKFTKKYIKSIAELVGDQSLLCASHLHHKLIRSRLINLFSTTSLSLFIEQFDQLVITSLH

SWKNMGTVIVLDQALKITFKAMCKMLMSIENEQELQMLQDDITHVCEAMLAFPLRLPCTRFHKGLKARKR

IMNRLEMMMVNRRRCSDTNQRDFLQQLLIGDEKSCSDGAFKLTDPEIKDNILTMIIAGQDTTASAITWMV

KYVGENQNVLDTLCAEQFHIAEKIASEGQFLSLEDLSEMPYASKVVKESLRMASVVPWFPRLALEDCEIE

GFKIMKGWNVNIDARSIHRDPILYEESNNFHPPRFEDDSKPYSFLAFGMGRRTCLGMNMAKAMMLVFLHR

LITTYEWKLLASDSSIEKWALFSRLKSGCPIHVTSITN

 

>CYP722C2 gi|223539215|gb|EEF40808.1  Ricinus communis

gi|255561050|ref|XP_002521537.1  Ricinus communis

46% to CYP722A1 cottonwood

74% to CYP722C1 soybean

MALSNLSMEGFLLLVRKNYDTILVGLCLWLSMAIAYVVSKAWRSDGDSAGSIPGRLGLPFIGETLSFLSA

ANSTKGCYEFVRLRRLWHGKCFKTRVFGKVHVFVPSPEGARKIFANDFVDFNKGYVKSMADAVGEKSLLC

VPHDSHKRIRHLLSEPFSMPSLSKFVQKFDQMLAWELKKLEESGKCFTVLDFSMKMTFDAMCNMLMSVTE

DSLLRGIEKDCTAISDSMLSIPLMIPGTRYYQGIKARQRLMETLKGIIDKRRSEMGSDEDFLQSMLQRDS

YPSDEKLDDSEIMDNLLTLIIAGQTTTAAALMWSVMFLHQNQEAQTRLREEQLSIAKHKQDGASLSLEDL

NKMSYGLKVAKETLRMSNVLLWFPRVALNDCTIDGFEIKKGWHVNIDATCIHYDPAFYKDPELFNPSRFD

EMQKPYSFVPFGSGPRTCLGMNMAKVTMLVFLHRLTSGYKWNIHDLDPSLEKKAHIPRLRSGCPITLEAL

NK

 

>CYP722C3 gi|255566698|ref|XP_002524333.1 Ent-kaurenoic acid oxidase Ricinus communis

gi|223536424|gb|EEF38073.1 Ent-kaurenoic acid oxidase Ricinus communis

65% to CYP722C1 soybean

44% to CYP722A1 cottonwood

MLKLSKEELLFLAQNKYDIVMVALFSIAVFAVLKAWRKKITTSNKEDIPGGLGLPFVGETLSFLSATNST

RGCYDFVRLRRKWYGKWFKTRIFGKIHVFAPSTEAARKVFTNDFGEFNKGYIKSMATVVGEKSVFAVPLE

SHKRIRHILSALFSIPSLSIFVQNFDQMLSQRLKNLQERGITFAVLDFTMKLTLDSMCNMLMSITEESLL

KQILRDCAAVSDALLSVPLMIPGTTYYKGMKARERLMEIFKEKIARRRSGEEYKDDFLQSLLERDSYPSS

ERLQDSEIMDNLLTLLVSGQVSSAATMMWSVKFLDENKEVLDKLREEQSNIAKNMQGASLSMVDLNKMSY

CYKVVKESLRMSNAVLWLPRVAQKDCTVDGFEIKKGWNVNVDATHIHYDPALYKDPLRFNPSRFDEMQKP

YSFIPFGAGPRTCLGIEMAKLSMLVFIHRLTSEYEWRIEDPDPSLERTTHVPRLRTGLPITLKPLKSASQ

D

 

CYP724A

 

>CYP724A1 gi|255572058|ref|XP_002526970.1  Ricinus communis

gi|223533722|gb|EEF35457.1  Ricinus communis

71% to CYP724B8 cottonwood

MEVEVSLLAILLGLALAFVLARFFTSDKPTILPDGTMGWPLLGETLAFLKPHKSNSMGSFLQEHCSRYGK

VFKSHLFGSPAIVSCDHELNMFILQNEEKLFSASYPTAMHGILGKFSLLLISGDLHKKLRNVAVSFIAVC

KSSPGYLHCVENFAVSMMESWKECKEIAFHKEVKKLTLNLMVKNLLSIEPEEPLAVKILHDFRTYMKGFV

SLPLDFPGSPYTKAVKARARLSSSVREIIKERELNKTVGLTKGDFLDMILSKRRLTEEETVSIVLDILLG

GYETTATLISLIVYFLGHAPAAFQSLKKEHEAIRKGKEEGKPLNWEDYQKMEFTQNVISEAMRCGNVVKF

VHRKALQDIKYNEYIIPSGWKVLPVFTGAHFDPSLHENPFDFNPWRWTVFHLFEQEKGTSKTVMPFGGGP

RLCPGAELAKVEIAFFLHHLVLSYRWKIKVDDDYPIAYPYVEFRRGLVLAIEPVEAVTGDEP

 

CYP724B

 

>CYP724B20 gi|255567210|ref|XP_002524586.1  Ricinus communis

gi|223536139|gb|EEF37794.1  Ricinus communis

85% to CYP724B7

AASG02010059

MAATGCSWLGVLVGIFCGLLGIIFNHFLPMFLKRGSDHVPKGSFGWPILGETLGFLKPHASNSLGKFLQD

HCSRYGKVFKSHLFFSPTVVSCDQELNYFILQNEGKLFQCSYPKPIHGILGNVSMLVAVGDTHKRLRNVA

LSLVNITKSKPEFLNDIERTTIQILNSWKDKKQVMFCEEARKFTFNVIVKQVLGLTPEEPETTKILKDFL

TFMKGLISLPLYIPGTPYARAVQARSRISSTVKAIIEERRRNVDCRSKRRSDFLEILLSVDTLSEDEKVS

FVLDSLLGGYETTSLLMAMVVHFLANSPTALDQLKLEHQNIRSMKEKDEYLNWEDYKNMEFTQNVISEAL

RYGNIVKFVHRKALQDVKFGGYLIPSGWKVLPVFTAVHLDSSLHASALQFHPWRWETQDQTCKKFTPFGG

GSRCCPGSELAKVEVAFFLYHLVQNFR (2)

WRTEDVEQDQPIAYPYVEFQRGLMLHLEECSILSPE*

 

CYP728

 

>CYP728D12 gi|255563939|ref|XP_002522969.1  Ricinus communis

gi|223537781|gb|EEF39399.1  Ricinus communis

74% TO CYP728D5 COTTONWOOD

MNTLFIIFIFLIPICLLLTRRRRRRRLPKELPPGSLGIPIIGQSLSLLQNMRANTAEKWLEERIKRYGPI

SKLSLFGKPTVFIYGQAANKFVFTSDSSTLANGQTQSVKMILGDRCLLELSGEDHRRVRDALMSFLKPES

LKQYVGKMDEEVRLHIQSYWQGKQEVKVLPLMKTLTFNIICSLLFGIERGTRRDYFVDRFQEMISGMWSI

PVNLPFTRYNRSLKASTSVRNMLKDLIREKRMELEQKCANTRQDLITWLISICNQNNNAAITEKEILDNV

MLVMTAGHDTSSILLTFLVRLLANEPTIHAAVLQEQEEIAKSKSSGEFLTWEDLGRMKYTWRVALETMRL

FPPIFGGFRKTVKDIEYDGYLIPKGWQIFWVSCMTQMDDDIFQEPRRFDPARFENPSSVPPYCYVPFGGG

PRICPGYEFARIETLVTIHYLVTQFTWKLNADNFFRRDPMPVPTKGLPIKISPRKQML

 

>CYP728D13P gi|255554931|ref|XP_002518503.1  Ricinus communis

gi|223542348|gb|EEF43890.1  Ricinus communis

70% to CYP728D2 Populus trichocarpa

AASG02008535.1 PSEUDOGENE

LVSRPINLPLTRFNRSLNARAKIRTMLLDLVHGKRTALEQQS (ON OPPOSITE STRAND)

LLTSLLSL*D*DNAVLLSDEEIVDNATINMIAGHD

TTSILLTFLIRLLANDDSVYDKILQ

EQDEIAKNKAPGELLTWD

DMG*ARMQYTWRVA

MESLRMSPPVFCSFRKVLKDFEYEGFLIPKGWQIIWAACMTHMEDCIFPNASKLDPTHFDKQAPAYSFMA

FGGGPRICPGNEFARIETLVTIHYLVTPVQVGPLFLRHVILQRSNAKFQAGTRDTNRAKNLFRSQLKCTS

RHTYFNES

 

>CYP728E2P gi|255559695|ref|XP_002520867.1  Ricinus communis

gi|223539998|gb|EEF41576.1  Ricinus communis

58% to CYP728E1 Populus trichocarpa

gi|223540000|gb|EEF41578.1  Ricinus communis

gi|255559699|ref|XP_002520869.1  Ricinus communis

AASG02000071.1 pseudogene

MEFPIYFKVPSFESPITVLLTLVALVAAYYELKTSQLHVKQLPPGSFGFPLFGESTSFVRAQKHD

ET*QWIQKRVKNYGPIFKT

MTGQAGNRFVFNGGDDGISFQQPKTGVRILGKDSLFELSGSLHKLIRGAIVGCLNPESIR

RYVSEMDSLVQQHLPKVLLEYS*

FYQPDGKEQDMLLEDFTMMVKGIWAIPLNVPGAILHR

LQAKARICKRL*EVIDIRKRQIIEGKGDSQENIFSSLLNLRDENGKPLQEELILNI

VLASHDTTANLMTFLFRDLSKDVEVHNKVL

EQMKVAKAKRGSNGEFMSWIDIKMMYTWNVAQEIMRFHPPVFGKFRLTTRDISFGEFHIPKGCQ (0)

LLRVASSTHMDETIFEDPDKIDPSRFDTPSKLSPRFTYIPFGAGPRICPGTEFARVESQLGIHNLITEYQWTEVIPDE

PVTRAPIPYPAMGLPLKLEPENVKIEG

 

CYP733

 

>CYP733A1 gi|255584586|ref|XP_002533019.1  Ricinus communis

gi|223527208|gb|EEF29373.1  Ricinus communis

NW_002994955.1 81934 to 84238

85% to CYP733A1 cottonwood

MELGILLIFALLSILLLSTFLLLHLWISPKEMEDLPGSLGWPIVGESFSFLSEFSSPSGIYSFMKNRQQR

YGKVFKSFVLGRFTIFMTGREASKILLTGKDGLVSLNLFYTGQQVLGPTSLLQTTGEAHKRIRRLIAEPL

SVDGLKKYFQFINTLAIETLDQWSGRKILVLEEAST (0)

FTLKVIGNMIMSLEPTGEEQEKFRANFKIISSSF

ASLPFKIPGTAFHNGIKARDRMYALLDSIIASRRSGKSVQQDFLESLIIKHSKGGEGEDDEDKLTDKQLK

DNILTLLVAGHDTTTAALTWLIKFLDENPRVLEQLREEHIQIQAKRTDGATLTWSEVNSMPYTNKVISET

LRRATILPWFSRKAAQDFEIDGYKIKKGWSINLDVVSIHHDPEVFPDPQKFDPTRFGAPLRPFSFLGFGS

GPRMCPGINLAKLEICVFIHHLVTRYKWRPLEKDDSVQPTLVRMPKNKYPVVVEPL

 

CYP86 CLAN

 

CYP86A

 

>CYP86A74 gi|255569281|ref|XP_002525608.1  Ricinus communis

gi|223535044|gb|EEF36726.1  Ricinus communis

89% to CYP86A18 cottonwood

16805597_peptide|Rcommunis|29681.t000015|29681.m001310

29681: 78205 – 79740,

METLPFFFTLAASVSAYLFWFYLLARKLTGPRVWPLVGSLPVLFKNRRQIHDWIAGNLRATGGASTYQTC

TIALPFLARRQGFYTVTCHPKNLEHILRTRFENYPKGPHWQKAFHDLLGQGIFNSDGETWLIQRKTAALE

FTTRTLRQAMARWVNRTIKNRLWSILDKSAKEKISVDLQDLLLRLTFDNICGLTFGKDPQTLAQEMPENP

FAIAFDTATEATLQRLLYPGFLWRFEKIFSIGAEKRLQKSLKVVENYMDDAIAARKENPSDDLLSRFMKK

RDVDGNPFPIAVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPQVEAKIVKEISNVLKETRGDNCQKWIE

EPLDFDEADKLVYLKAALAETLRLYPSVPQDFKYVVADDVLPDGTFVPAGSTVTYSIYSVGRMKSIWGED

CVEFKPERWLSPEENRFEPPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSLVPGHRVEQK

MSLTLFMKNGLRVFLHPRILA

 

>CYP86A75 gi|223549055|gb|EEF50544.1  Ricinus communis

gi|255541622|ref|XP_002511875.1  Ricinus communis

frameshift at &

AASG02000538.1

85% to CYP86A20

C-term seems too long but EST EE256543.1 supports the sequence

MLVFVYTMDVSTALMLFSAVTAYLLWFTFISRSLKGPRVWPLLGSLPGLIENCDRMHDWICDNLRACGGT

YQTCICAIPFLAKKQGLVTVTCDPRNI &

EHLLKTRFDNYPKGPTWQAVFHDLL

GEGIFNSDGDTWLFQRRTAALEFTTRTLRQAMARWVSRAIKLRFCPILETAQLKA

EPVDLQDTLLRLTFDNICGLAFGQDPQTCAPGLPDNSFALAFDQATEASLQRFILPEVLWKFKKWLRLGM

EVDLSRSLTQLDEYLTAVINARKKELLNQQKDGNLHDDLLSRFMKKKESYSDTFLQHVALNFILAGRDTS

SVALSWFFWLIIQNPSVEEKILDEICTVLNETRGADVSKWVNEPLGFEEVDRLIYLKAALSETLRLYPSV

PEDSKHVVADDVLPDGTFVPAGSSVTYSIYATGRMRSTWGDDCLEFKPERWLSEDGKNFMKHDSYKFVAF

NAGPRICLGKHLAYLQMKSVAAALLLRHRITLVPGHKVEQKMSLTLFMKDGLKVNVHKRNLEGTAARVIT

RNNLVRNNNEGRDGVRCNGVSESGEEEVVGVV

 

>CYP86A76 gi|255537507|ref|XP_002509820.1  Ricinus communis

gi|223549719|gb|EEF51207.1  Ricinus communis

82% to CYP86A21

AASG02000197.1

MLPMDVSMAPMILLAIVAYFLWWKFISRPLTGPRLWPLVGSLPGLIENANRMHDWIAHNLQSSGGTYQTC

ICAIPFLAQKQGLVTVTCDPKNLEHILKARFDNYPKGPTWQSVFHDLLGEGIFNSDGDTWLFQRKTAALE

FTTRTLRQAMARWVNQAIKHRFCPILRCAQLQAQPVDLQDLLLRLTFDNICGLTFGKDPQTLSPDLPENG

FAVSFDRATEATLQRFILPEVVWKLKKWFRLGMEVRLSQSLEHIDAYLSGIINTRKLELLNQKNGVGTGK

PHDDLLSRFIKKKESYSDKFLQHVALNFILAGRDTSSVALSWFFWLVSQNPKVEEKILIEICIVLMETRG

NDICKWLEEPLVFEEVDRLIYLKAALSETLRLYPSVPQDSKHVVSDDVLPNGTHVPAGSSITYSIYSVGR

MKFIWGDDCLEFKPERWLSLDGKKMEVQDSYKFIAFNAGPRICLGKDLAYLQMKSISAAVLLRHRLSVAA

GHRVEQKMSLTLFMKYGLKVNVHPRDLKPLVEVINKKGNIINGNREGIEWVAAGA

 

CYP86B

 

>CYP86B14 gi|255565570|ref|XP_002523775.1  Ricinus communis

gi|223536987|gb|EEF38624.1

82% to CYP86B5 cottonwood

MINPSKNFTSLSSSSSDDLTGNFISRRLIFFFFHDIQVLELFLALFVFISIHSLRQKKRYGLPVWPVLGM

LPSMIFALQSNLYEWISDVLCRQNGTFRFRGPWFSSLNCVVTADPRNLEHLLKSKFSNFPKGQYFRDTVR

DLLGDGIFNADDEMWQRQRKTASIEFHSTKFRQLTTKSLLELVHSRLLPVLENAVNNSITIDLQDILLRL

TFDNVCMIAFGVDPGCLNLDLPEIPFARAFEDATEATVLRFVTPTCIWKAMKYLDLGAEKKLKGSIKAVD

EFAEKVIRTRKKEMSSTTSDDDKKHGSDILTVFMRLKDENGKPFSDKFLRDICVNFILAGRDTSSVALSW

FFWLLDKHPKVEEKILAEIYKIVKQRSEDPFDPKSPLMFRPEEVKKMEYLQAALSEALRLYPSVPVDHKE

VIEDDIFPDGTRLKQGTKVIYAIYAMGRMEAIWGKDCREFKPERWLRDGRYMSESAYKFTAFNGGPRLCL

GKDFAYYQMKFAAASIIYRYHVKVAKDHSVVPKLALTMYMKHGLKVNLFKRDDSEISRIK

 

CYP86C

 

>CYP86C13 gi|255547992|ref|XP_002515053.1  Ricinus communis

gi|223546104|gb|EEF47607.1  Ricinus communis

no ESTs cover the gap region at the I-helix

AASG02005252.1 runs of the end of the contig at TTSV

AASG02017729.1 runs of the end of the contig at DKY

MTMTRNSVFSSMESVFAHLCFWDLAFAFLGLFVFSCIREKLTNNGPMLWPVLGIMPTMLLHINDTLNFGT

RALIRAGGTFRYRGVWMGGAHGVMTADPVNIEYILRTNFTNFPKGKYYRERFQDLLGDGIFNADYELWKE

QRRTAKMEMHSSRFIDHSLRTMQDLVHLKLLKLTEKLVRSEDSFDLQEMLLRFTFDNICTAAFGVDPGYL

NLDLPEVPFAKAFEEATELTLNRFLVPLFVWKTMKLFGIGYEKRLRTAIEFVHEFADETVRKRRNELIKL

GSLNDQSDLLSRLMDIVPTEDGKNQQQFPDKY

XXXXXXXXXXXXXX

TTSVALAWFFWLVHSNPDVESKILREINEILSHRNR

NCENGNDNDILFAIEELNNMVYLQAALSESMRLYPSVPTEIKEVIEDDVLPDGSVVKKGARVLYCIFSMA

RMESVWGKDCLEFKPERWINKDEKFASANQFKYAVFNAGPRSCLGKKFAYLQMKMVAASILLRYCVKVVE

GHNVVPKMTTTLYMKNGLMVTLKPRLPYKF

 

CYP94A

 

>CYP94A40 gi|255559967|ref|XP_002521002.1  Ricinus communis

gi|223539839|gb|EEF41419.1  Ricinus communis

70% TO CYP94A11 cottonwood

MLTELSLSFFFILLSIFFIFKTPKSKKSVSANLPKPYPIIGNYLDIKANWNRRFQWTSDLLQNSPSATYV

IHRPLGGRWIVTGNPANVQHILKTHFHLYQKGHTFRSALFDFLGNGIFNVDGDTWKFQRQVASHEFNTKS

LRKFVETVVDTELIQRLIPFLSAAAENGTVLDFQDILQRFAFDNICKIAFGYDPAYLLPSLPQAKFAQAF

EDGVRISSDRFNSPFWRIKRAFNIGSEKKLQEAISQVRDFAAHVVEEKKQELKENSSLESVDLLSRFLSS

GHSDETFVIDIVISFILAGRDTTSAALAWFFWLINKNPQVETRILEEINEKSEMPIFEEVKDMVYTHASL

CESMRLYPPVPTDSKLAIGDDVLPDGTVVTKGSRVTYHPYAMGRLEMLWGADWADFKPERWLERDIVNEK

WNFVGRDAYTYPVFQAGPRICLGKEMAFLQMKRVVAGVLSKFKVVPAFEDGFEPELVAYLTAKMDGGFPV

RIVERAK

 

>CYP94A41 gi|255559971|ref|XP_002521004.1  Ricinus communis

gi|223539841|gb|EEF41421.1  Ricinus communis

70% TO CYP94A12 cottonwood

MSVVELLLSLFLLIFSLIFIYFTITRYGDSKRSLPIHIPKSYPLIGSSFAIKSNFDRRVQWTSDILQTLP

SATFVLHRPMGHRQIFTGNPANVQHILKTHFHLYQKGPFTRYTLFDFLGNGIFNADGNTWKFQRKVASHE

FSTKSLRKFVEIVVDTEISQRLVPILSAAAANKTVLDLQDILQRFTFDSICKIAFGYDPAYLLPSLPPAP

FADAFEESIRIISDRFNCAFPILWKIRKLLGVGSEKRLTETMSQVRDFAKNIVKEKKQELAKNSSLESVD

LLSRFLSSGISDETFVTDVVISFILAGRDTTSAALTWFFWLISRNPQVETEIFKEIQENTEAPIFEEVKD

MIYTHASLCETMRLYPPVPVDSKTAIGNDVLPDGTPVKKGTRVTYHPYAMGRLEALWGADWVDFRPERWL

LQQDGARKKWSFVGRDPFTYPVFQAGPRVCLGKEMAFLQMKRVVSGVLSKFKVVPAMEDGHEPVYIADFT

NKMRGGFPVRIEERRNN

 

CYP94B

 

>CYP94B38 gi|223550311|gb|EEF51798.1  Ricinus communis

gi|255540263|ref|XP_002511196.1  Ricinus communis

65% to CYP94B3, 77% to CYP94B6 cottonwood

AASG02000117

MLIFLIICVSLGCFLFSFLFSLFQVFYNTRHD

MKLLSSHGPPSYPIIGCLLSFYKNRFRLLDWYTDLLSVSPTQTIEVQRLGGRRIVVTANPANVEHMLKSN

FSNFPKGKPFTEILGDLLGCGIFNADGELWSTQRKLASHEFSTKSLREFVVKTLQEVVENRLIPLLEDAA

DRESVLDLQDVLRRFAFDIVCLVSLGTDPFCLDFSRPIPPLVKAFDTASEISAMRGTAPVYAVWKTKRML

NLGTEKKLKEAVKMVHSSVLEIVKNKKKVLENDQGSDLLSRLLSGGHDEEVIRDMVISFIMAGRDTTSAA

MTWLFWLLSKNKNSEEMIVKEVTTLLNRGEKAIDFELLKEMNFLKASLCESMRLYPPVAWDSKHALSDDI

LPDGTFVGKGDRVTYFPYGMGRMEKLWGKDCFEFKPDRWFNKPVGFGFESTGDRVMKSVSPYKFPVFQAG

PRVCLGKEMAFIQMKYVAASILRRFEIRPVREDQPVLVPLLTAHMAGGLKVTVKRRIENC

 

>CYP94B39 gi|255536915|ref|XP_002509524.1  Ricinus communis

gi|223549423|gb|EEF50911.1  Ricinus communis

76% to CYP94B7 cottonwood

MATLMSLLTCQFLSFLLSLYMPFLYLFHVFLRKFRRVSGHGPPSYPIIGCLISFYKNQARLLDWYTQLLA

ASPTNTIVVNRLGARRTIVTANPENVEYMLKTNFNNFPKGEPFTEILGDFLGYGIFNVDGEIWHRQRKLA

SHEFSAKSLREFYMITLEEEVEKGLLPVLESLAARKEVVDLQELLRRLAFNMVCKVSLGIDRYSLDPSLP

SPPLATAFDMASEICARRAAAPLFVVWKIKRWLGIGSERRLKDAVEQVHQYVGGIIAERKKVIEERGEND

GEDFLSRLILAGHEENVIRDTMISFIMAGRDTTSAAMTWLFWLLSCHPGIEQEVVRETKFMTERKPDYDS

LKELRLLKACLCESMRLYPPVAWDSKHAIVDDLLPDNTSVRAGDRVTFFPYGMGRMEALWGKDGLEFRPD

RWFLEPEKRTSLRKVCPFKFPIFQAGPRVCLGKQMAFIQMKYVTASVLSKFEIRHVGSHKPVFVPRLTAH

MAGGLKVVVRRRTEEDKYN

 

CYP94C

 

>CYP94C39 gi|255585725|ref|XP_002533544.1  Ricinus communis

gi|223526580|gb|EEF28834.1  Ricinus communis

60% to CYP94C1 Arabidopsis thaliana

64% to CYP94C5 cottonwood, 76% to CYP94C7 cottonwood

MELEASWFLQSLHAVLFFVLLAIIGSCLFSLLFYSLRLKLRCNCEICEAYLTLSWTKQFNNLCDWYAHLL

KSSPTKTIHIHVLGNTITANPENVEYMLKTRFDNYPKGKPFSTILGNFLGRGIFNVDGDSWRFQKKMASL

ELDRFSIRMYAFEIVLYEIEHRLVPLLSSVSGNEGGVLDLQDVFRRFSFDSICRFSFGLDPRCLEPTLPI

SEFAVAFDLASKLSAERAMVVSPLVWKIKRKLNLGSEKKMKEAMTVINILAQEVIRQKRIMGFLSHKDLL

SRFMQTVNDETYLRDIVISFLLAGRDTVASALTSLFWLLANHPEVSSAILLEADRVLGPNQELTSYEQMK

DLHYLQATVYESMRLYPPIQFDSKFCQEDDTLPDGTFVNRGTRVTYHPYAMGRMEDLWGQDCLEFKPERW

LRNGTFFNENPFKYPVFQAGLRVCLGKEMALLELKSVAISLLRKFHIELETSYRTPRFSPGLTATFSGGL

PVVVRSSKVNP

 

>CYP94C40 gi|223531470|gb|EEF33302.1  Ricinus communis

gi|255576331|ref|XP_002529058.1  Ricinus communis

79% to CYP94C5 cottonwood

AASG02019206

MEQFDGLGSISGVFSLLFFGFTLLFSLFSLLIFLLRQKPWCNCDICKSYITASWAKEFVNLCDWYTHLLK

KSPTGTIHIHVLGNIITSNPENVEYILKTNFENYPKGKPFSALLGDLLGRGIFNVDGDSWRFQRKMASLE

LGSVSIRMYAFELIMSEIKSRLIPLLSSISCDKDQQGIDLQDVFRRFSFDNICKFSFGLDPGCLKLSLPI

SEFALAFDTASKLSAERALAASSMIWKMKRFLNIGSEKKLKEAIQMVNELAEGVINHRRKEGCMDNKDLL

SRFMGSINDDKYLRDIVISFLLAGRDTVASGLTSFFWLLSKHPQVESAIREESDRVMGSSEELTSYEQLR

ELHYLNAAVYESMRLFPPVQFDSKFSQEDDILPDGTFIRKGTRVTYHQYAMGRMERIWGQDCLEFKPERW

LKNGVFVPESSSKYPVFHAGFRVCLGKEMALVEMKSVALTMIRAFNVRVVDPNQVPRFSPGLTATMRGGL

PVVIQERET

 

CYP94D

 

>CYP94D40 gi|255556888|ref|XP_002519477.1  Ricinus communis

gi|223541340|gb|EEF42891.1  Ricinus communis

62% to CYP94D2

77% to CYP94D23v1 cottonwood

MEPLSLPLLLLLFFLCFCLYLRSSQNKPTKNGFKNYPILGALPDFLKNRHRFLDWTTEVLSCCPTNTSVF

RRPGKVHGVITANPLNVEHILKTKFENYPKGERFISLLEDFLGQGIFNTDGELWRVQRKTASYEFNTKSL

RNFAMENVKVELSTRLVPILARASGMNQVLDLQEMLERFAFDNICKLAFNVDPGCLGGDGTACGEFMQAF

EEATTLSSARFMYALPFLWKFNKFFLLGPERTLKRSIKIVHEFADEIIQSRLAQNRDKQDQDLLSRFIGD

GDNSLDFLRDIVISFILAGRDTTSSALSWFFWQLSLNPHVERKILEELEAIRARNGKNIGETYSFEELRD

MHYLQAAISETLRLYPPVPVDTKACKNDDYLPDGTFVGKRWFITYHTYAMGRMESIWGKNCCEFVPERWL

DDGICRQESPFKFPVFHAGPRMCLGKDMAYIQMKSIAASVVERFHIDVQNKDKCPEHLLAMTLRMKDGLH

VKVKERCSSDYRAPRI

 

CYP94F

 

>CYP94F5 gi|255572197|ref|XP_002527038.1  Ricinus communis

gi|223533600|gb|EEF35338.1  Ricinus communis

64% to CYP94F2 Vitis vinifera

70% to CYP94F1 cottonwood

MLQLILFLSFVSVISFFFFCTTSHPRTRTPSPESYPLIGNLPGFLRNRHRFHDWVTDMLVNTPSSTLQVN

SFLNISRGICTANPVNVEHLLVTNFSNYVKGSRFLNVLYELLGHGIFNVDGHLWIMQRKIASHEFNTKSL

KHFISDVVKSEMTRTLMPYLVKACEDDAVFDLQQVLGKFTFTTICEVAFGVDPESSMPNLPFAKAFDDAV

AICFFSRFLSPFPPVWKLKRLLNLGSEKRLKEAIGTIEKFVLEIIKSKNQEKDSDKSQDLLSRFMFLSSD

YEFQDQEQKTKFLRDIVISFVLAGKDTTSTALAWFFWLLVGNPRCGRLIYEELTEVAPPEAVSESRMRIF

SYDDLKKLHYLHAALSETMRLFPPVAINSRLTVDDDVLPDGTRVGKGWFADYSAYAMGRMEKVWGQDCRE

FKPERWLDKDGKFQPSDQFRFPVFHCGPRTCLGKELAYIQMKAIAAAVMYEFEILAIDGGANAERMMNPP

YIVTLLLKMRGGFSVRLKRREREGPGSKLV

 

>CYP94F6P gi|255573647|ref|XP_002527746.1  Ricinus communis

gi|223532887|gb|EEF34659.1  Ricinus communis

pseudogene

56% to CYP94F2 Vitis vinifera, 61% to CYP94F1 cottonwood aa 23-468

86% to XP_002527038.1

AASG02017079 no ESTs extend the seq.

MRNLPFAKAFDNAVVICFFSRLLSLFPLVWKLKRLFNLGSKKRLKEAIGIIDKFALEIIKSKNQEKESDK

SQDLLSRFMFLSSDYEFQDQEQKTKFLRDIVISFVLAGKDTISTALTWFFWLLMENPCCGRLIYQELTEV

APLEAVSESRMRIFSYDDLKRLHCLHS

AISEIMRLFPPVAINLRLTMDDDVLPDGTRVGKRWFADYLAYAIGRMEKVWGQDCSEFKPERWLE

 

CYP96

 

>CYP96A58P gi|255587386|ref|XP_002534255.1  Ricinus communis

gi|223525635|gb|EEF28128.1  Ricinus communis

56% to CYP96A1 Arabidopsis thaliana

59% to XP_002529227.1

AASG02015916.1 defective at I-helix, probable pseudogene

SFLVAGRENSLAWFFWLLSENPQAEAKIREELNSLLPENKVHEGPQLFDLEKLNKLLYLHGALCETLRLYPPVM

FEHKEPLQPDILPSGHHVDPRMKILVSTYLMGRMKSIWGEDCLEFKPERWISKADGRLVQHPPHKFMA

FNAGPRTCLGKDIALLVMKIVAAILLQNYNVEVVKEHPVAPNCASIILHIKHGLMARISRRWTSN

 

>CYP96A59 gi|255576677|ref|XP_002529227.1  Ricinus communis

gi|223531300|gb|EEF33140.1  Ricinus communis

66% TO CYP96A17 COTTONWOOD

MASISLLEIFLAVISFVVLRYLLNTKGMPINWPVVGMLPDTIFNFHRIHERFAEVLEQNGLTFLYAGPWF

SNVKILGTVDPANIHYVMSSNFANFPKGSEFSKIFNILGDGIFNSDSDSWKNQRKTAQALINHQRFHQFL

VKTCRNMVEKGLLPVLEHVADQESVMDLQDIFQRFTFDITCILVTGYNPKCLSIAFPEVEFSKAIDDAEE

ALFYRHFCPEYTWKLQRWLGFGQEWKMEKAWKVLDDVSARFVSRKREQLKEGSILREDGEGVDLLTSYMS

SEVESNGPQPEDKFLRDTIINFLLAGRDTTSSALTWLFWLVCKNPQVLSKIREEIKAKIPENQDEKCRMF

NPQELNSLVYLHGAFCESLRLYPPVPFQHKAPLREDVLPSGHKVSPDMKIIFCLYSMGRMASIWGEDCLE

FKPERWITGGKIKHEPSYKFLAFNAGPRTCLGKEIAFIQMKTVAAFVLNNYNVHLVEGQHVSPATNSIIL

HMKYGLKVSVSRRWV

 

>CYP96F6P gi|255581084|ref|XP_002531357.1  Ricinus communis

gi|223529038|gb|EEF31025.1  Ricinus communis

55% to CYP96F1   Populus trichocarpa

74% to EEF40966.1

AASG02000681.1 pseudogene

VYLHAMMCDTLRLLPPVPFKVKVSVESDILPGGHKVTRNVKIL*YTMGRMENICGKDC

LKFRPQRWISEAGKIKQVP

 

>CYP96F7 gi|223539375|gb|EEF40966.1  Ricinus communis

gi|255560926|ref|XP_002521476.1  Ricinus communis

47% to CYP96A1

60% TO CYP96F4 COTTONWOOD

MAILLLGLLIVFLSTAFLWSWWRDRSSLINWPVVGMIPGLFSNLYHAHDFLTSRLLQSEGTFLFKGPWFS

GMNFLVTADPMIVHHTLSKNFANYVKGADFKQILEVLGDGIFNADSDSWRFQRRTIHFLLKQPSFQMAVE

RTMKLKVSKGLFSVLDNASKLGCEVDIQDVFQRFTFDSICMLVLSFDPECLSVEFPNVPFEKAFDCIEEV

IFYRYIVPISIWKLQRWLQIGQERTMRKAWETFDFFVEQCLARKREQLDQRKNTVESENFDLLTYFLVED

GGEDGVFTKSNKFVRDMTFNLLLAGRDTVGAGLVWLFWLVAAHPFVEQKILEEIREHLGENTGEKWRLFN

VEELSKLVYLHAVVCETLRLYPPVPFEVKVPVESDILPGGHHVNRDIKILYSLYSMGRMEDIWGKDCLKF

RPERWISEAGKIKQVPSYKFTAFNAGPRTCLGKELGFVEMKLVASAIIWNYSIKVVEDHPVSPSLSLILY

MKDGLKVRVAKRNAT

 

>CYP96F8P gi|223539374|gb|EEF40965.1  Ricinus communis

gi|255560924|ref|XP_002521475.1  Ricinus communis

40% to CYP96A1   Arabidopsis thaliana N-term

77% to EEF40966.1

AASG02000086.1 pseudogene

MAILLLGLLMAFFSTTFLWFWWRNRSSLLINWPVVGMIPGLFSNLYHLNDFVTCILLQSEGTFLFKGPWF

SGMNFLVTSDLMIVHHTLSKNFANYQIGAEFK

ISKGLLSVLDDALKLGCEVDIQDVFRRFTFDSICLLVL

SFDPECLSVEFPHVLFEKAFDDIEEVIFYRHTMPLSIWKLQRWLQIGEDKKMRKAWDT 

FDQFVEQCITRKREQLGQRK

 

>CYP96F9 gi|223539373|gb|EEF40964.1  Ricinus communis

gi|255560922|ref|XP_002521474.1  Ricinus communis

46% to CYP96A1

57% TO CYP96F4 COTTONWOOD

MIGCTEMAIALLSIIFLRVWWRSRGLVVTNWPVVGMIPGLLFRPISSVHDFATYVLQRSGGTLLFQGPWF

SGMNFLMTSDPMNVQYIVSKNFANYPKGPDFRQIFEVLGDGIFNVDSDSWRIQRRIMHSLLKSKRFHLAV

ERTVEHKILKGLFVVLDNVSELASEVDIQDVFQRFTFDSICILALSYDPDSLSIEFPHVPFAKAFDDIEE

AVLYRYLVPSSIWKLQKRLRIGKEKKLRNAWDTFDRFLEQCITRKREQVRRSKNQKERDQDYFDLLTYYF

MEVEGGDVNVPVKSNKLLRDTATALLIAGRDTVSAALAWFFWLIGTHPSAEKKILEEIKAKVQPDTNDEW

RHFSLEALNKLVYLHAAICETLRLYPSIPINHKMSVEADVLPSGHRVPGNTRILYFLYSMGRMEEIWGKD

CSEFKPERWICEKGQIKHIPSYKYIAFNAGPRTCLGKDLTFLQMKIVASAIIWNYSLQVVDNRPATPCNS

VVLHMKGGLKVRVSKRWNS

 

>CYP96H3 gi|255570693|ref|XP_002526301.1 heme binding protein Ricinus communis

gi|223534382|gb|EEF36090.1 heme binding protein Ricinus communis

61% to CYP96H1 Populus trichocarpa, 50% to CYP96A16v1 cottonwood

AASG02000221.1 TOP PART RUNS OFF THE END

AASG02000270.1 bottom part RUNS OFF THE END, no ESTs close the gap

MVPLACYLQLILTAVFFSFFICLFKSNKNGLPRNWPFLGMSPMFILINLRRLPDKIAELLERNEGTFLLK

GPWFSDVDMLVTSDPANVHYVTTKNFWNYPKGPESKQLFDFLGNTLFNMDFDEWTSVRKITNSYLKHQQF

HRFVNEVIVDNVNKGLIPVLEHVAAQGLVVDLQDLFKRYTYDAAWKITTGYSPNSLSIDFPEVPFINAID

DACEASFNRHLLPGSLWRLKRWLQLGTEKKLSAARKTLHDVAAKYLLMKTEELKKAGEKQFKEDDAETFD

ALRYCMLNIRELVETTFPAEEVVRDNIISLTFAAYDTSAPTLSWLFWLLSENPHVEAKIKEELHNNFSKK

WQLSSKEELRKLVYLHAALCE

XXXXXXXXXXXXXXXXXXXX

ILPSGHHVNSKVRIIMSGYAIGRMTSVWGDDCLEFRPERWIDEKGTLKYETPAKFFIFNAGPRTCLGKE

VALTMLKAAAATIVYNYDIQVAETRLATPKSSIILQMKNGMRVRLKRNA

 

CYP704A

 

>CYP704A81 AASG02013739.1 runs off the end of the contig

84% to CYP704A10

possible end of XP_002529550.1 sequence, no ESTs extend the sequence

DDDGVFQQESPFKFTAFQ (0)

AGPRICLGKEFAYRQMKIFSAVLLGCFIFKLRDEKKAVNYRTMINLHIAGGLHVHAFYRYKT*

 

>CYP704A82P gi|223550003|gb|EEF51490.1 pentatricopeptide repeat-containing protein Ricinus communis

gi|255539647|ref|XP_002510888.1 pentatricopeptide repeat-containing protein

mostly non-P450 seq

67% to CYP704A1 Arabidopsis thaliana in small fragments

AASG02000135.1 CYP704A pseudogene

50% to CYP704A12 cottonwood, 45% to EEF50415.1,

40% to CYP704G1 Medicago truncatula

CSMIEVKGIVHEFSVIGSPNIVMEELISVLNALSNEMKINNNL

DMLMKSSLDSKFKVGFGVELNALSGL

DGFGTGFTKTFDYSSATVYWR

VVLLWSIIMLLDVSLEASLKEKIRINHDFIYELIKCKR

DMQSRFLLESEKDPDKMTDQY*ENITLNFIIPGSNTSAYTLTRFFYLLCRHPLLQEKQCWKWVR

ISAHDFTELITE

TLDKMQYLHAALAETLRLYPAVP

DDIRSDGFGVKKGDGAIGRMAHIWGDDVEDLYPES

WFENGVFQPRS

FINH*SGPRICL

KFLAATLLYFFRFKI

SDSKFTYRTMSALHMDRGLHLYAIPRL*

 

>CYP704A83 gi|223548925|gb|EEF50414.1  Ricinus communis

gi|255541362|ref|XP_002511745.1  Ricinus communis

78% to CYP704A9 cottonwood

AASG02001212.1

MDIFFIIFTFTATPFLLFVLTFLYVMLKVYTGKSINNPDYAPVIGTVFGQLFYFSYLYDHQAELAKTHKT

FRLLGPEESELYTTDVRNIEHVLKTNFDKYSKGKYNQDVLTDLFGEGIFAVDGDKWRQQRKLASFEFSAR

VLREFSCSVFRTNTAKLVRVMSKVAVPDKVFDMQ (0)

DILMRCTLDSIFKVGFGVELNCLEGSSKKETAFTRA

FDDSNELVYWRYVDPFWKLKRFFNVGCEASLRKNIKTIDEFVSNLIGTRRKLLAEQRYQ (0)

NVKEDILSRFL

TESEKDPEKMNDKYLRDIILNFMLAGKDSSANTLSWFFYMLCKNPIVQEKVAQEVTQVTGSQDSTVDVED

FMAKITDTVLEKMHYLHATLTETLRLYPAVPV (0)

DGRCAEVDDVLPDGFRMKKGDGLYYMAYAMGRMRYIWG

EDAEEFRPERWLNNGIFQPESPFKFIAFH (0)

AGPRTCLGKDFAYRQMKIVSMALLRFFRFKLDDDTRKVTYRTMFTLHINGGLYLRAIPRTASS*

 

>CYP704A84P gi|223548926|gb|EEF50415.1 heme binding protein Ricinus communis

gi|255541364|ref|XP_002511746.1 heme binding protein Ricinus communis

59% to CYP704G1 Medicago truncatula, 73% TO EEF50414.1

73% to CYP704A9 cottonwood

pseudogene

AASG02000417.1

LSAISTFATIPFLLIFITFVYLMLKTHTGKSIKDPNYAPVTGTVFGQIFFCYNNIYDHLTEVA

KKQKTFRILIPKHSALFTTDTRNIEHMLKTKFHKYSRGKLNKEIESDLFGEGIFEVDRDK

RKHQRKLASFELSTRVVRDFSCSVFKTNATKL &

LRVISEIAAVDGVFDMQ (0)

DILMKCTLDSIFKIGFGVELNFLEWSTAEGTALMRAFDESNALIHWRHVDPSWKLKK ()

(2) YFNIGCEASLKKNIKVIDDFVSNLIGTRRKLLSKHLYQ (0)

NAKEDMLST &

FLMESEKDPEKMNDKYLRNII

LNFMIAGKDTSANSLSWFFYVLCKNPLVQEKVAQVVGQVTVSQDDNVVGDFIARITDETLEQMHYLHATL

TETLRLYLGVPL (0)

DGRCAKEDDILPDGFRMRKGDGLFYMAYAMGRMPYIWGEDAEDFRPERWLNNGIF*PESS

FKFIAFH (0)

AGPRICLGKDFAYRQMKILTIALLRFFRFKLADDATKVIYRMMFTLHMNSGLHLRAIPRTTSSRF*

 

>CYP704A85P gi|255577339|ref|XP_002529550.1  Ricinus communis

gi|223530977|gb|EEF32833.1  Ricinus communis

AASG02008611.1

pseudogene

Missing exon 5

49% to EEF50414.1

46% to EEF50415.1

75% to CYP704A10 cottonwood

MEFVTNPILFSALALIPCLLIFPLLITKLKRGEQRENKLKYHPIGGTVFNQLLNFNKLHHYMTDLAAKYR

TYRLISPFRNEIYTSDPVNVEYILKTNFQNYGKGEYNYNNLRDLLGDGIFTVDGEKWRQQRKVSSYEFST

RVLRDFSSIIFRENVVKLAGAVSEAAKSNQSMDIQDLFMKSTLDSIFKVVFGVELDSMCGSNEEGIIFSN

AFDNASAMTLWRYVDIFWKIKRFLNIGSEAELKKNVKVVDDFVYKLISSKIEQVHNFNNDISAKKDDILS

RFLQVSETDMTYIRDIILNFVIAGKDTTAATLSWFIYVLCQHPVVQ

EKVAKEIREVSKVKEIMNFAEFAASIDEEALAKMSYLHAAITETLRLYPAVPV (0)

DAKICLFDDTLPDG &

FSVKKGDMMSYQPYAMGRMKFIWGDDAEVYKPERWLNDDGVFQQESLLKxxxxx

 

>CYP704A85P gi|255623329|ref|XP_002540358.1  Ricinus communis

gi|223496455|gb|EEF22025.1  Ricinus communis

52% to CYP704G1   Medicago truncatula, 100% TO XP_002529550.1

EKVAKEIREVSKVKEIMNFAEFAASIDEEALAKMSYLHAAITETLRLYPAVPV

 

CYP704B

 

>CYP704B35 gi|255562920|ref|XP_002522465.1  Ricinus communis

gi|223538350|gb|EEF39957.1  Ricinus communis

78% to CYP704B1 Arab., 84% to CYP704B3 cottonwood

MEKEMGISLVSSPSSSDGYNMVLMIACLVLSWMFIYRWTQRNKKGPKSWPIVGAAIEQLTNYDRMHDWLV

EYLSELRTVVVPMPFTTYTYIADPTNVEHVLKTNFANYPKGETYHSYMEVLLGDGIFNVDGDLWRKQRKT

ASFEFASKNLRDFSTTVFREYTLKLSSILSHASFHNKEIDMQELFMRLTLDSICKVGFGVEIGTLAPDLP

DNCFAQAFDTANIIVTLRFIDPLWKVKKFLNVGSEALLEKSIKIIDDFTYSVIHRRKAEVEEARKTRNNN

KVKHDILSRFIELGEDPDNNLTDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTNNHVAENLFMELKTLE

EERAKEENVTLLQIDLDDPESFTQRLVQYAELLTYDSFGKLYYLHAVITETLRLYPAVPQDPKGILEDDV

LPDGTKVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGFFQNASPFKFTAFQAGPRICLGKDSAY

LQMKMTLAILCRFFKFDLVSNHPVQYRMMTILSMAHGLKLRVTRCS

 

CYP97 CLAN

 

CYP97A

 

>CYP97A34 gi|223548570|gb|EEF50061.1  Ricinus communis

gi|255543092|ref|XP_002512609.1  Ricinus communis

82% to CYP97A7 cottonwood

MAANFALLQVPSSISAKHHCLQTKFQVRRVKPINLSSFPPTQNGVLGKRKFAVISCASSKGREPESEEDP

VKSVERILEEKRRAELSAKIASGEFTVQQSGFPSILRNGLSKLGVPNETLEFLFKWVDAGEGYPKIPEAK

GAISAIRSEAFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIAKHILRDNSKAYSKGILAEILDFVMGK

GLIPADGEIWRVRRRAIVPAFHQKYVAAMIGLFGQATDRLCKKLDAAASDGEDVEMESLFSRLTLDIIGK

AVFNYEFDSLANDTGIVEAVYTVLREAEDRSVAPIPVWEIPIWKDISPRQRKVSAALKLINDILDDLIAL

CKRMVDEEELQFHDEYMNEQDPSILHFLLASGDDVSSKQLRDDLMTMLIAGHETSAAVLTWTFYLLSKEP

SVLSKLQNEVDTILGDRFPTIEDVKKLKYTTRVINESLRLYPQPPVLIRRSLQDDMLGKYPIKRGEDIFI

SVWNLHRSPHLWDDAEKFNPERWPLDGPNPNETNQNFCYLPFGGGPRKCVGDMFASFETVVATAMLVRRF

NFQLALGAPPVKMTTGATIHTTEGLTMTVTRRIQPPIMPMLDMPAMKGDAPGSVPSGESQLGQKGEVSPA

HS

 

CYP97B

 

>CYP97B26 gi|255559122|ref|XP_002520583.1  Ricinus communis

gi|223540243|gb|EEF41816.1  Ricinus communis

85% to CYP97B7 cottonwood

AASG02002665 runs off the contig end

Missing ~27 aa at N-term, no EST extend seq.

FRFMGISKFPSHYPLLNSKAKGSPVIRCQPKITDEPKTRTLLDNASNLLTSFLSGGSLGSMPIAEGAVSDLFN

RPLFFSLYDWFLEHGSVYKLAFGPKAFVVVSDPIVARHILRENAFSYDKGVLADILEPIMGKGLIPADLD

TWRQRRRVIAPAFHASYLEAMVKLFSDCSERSILKFEELLEGEDSHGRDTIELDLEAEFSSLALDIIGLG

VFNYDFGSVRKESPVIKAVYGTLFEAEHRSTFYVPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRNA

KETRQETDVEKLQQRDYSNLRDASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQ

NPPKLRKAQAEIDVVLGRGRPTFELIKKLEYIRLVVVEALRLYPQPPLLIRRALKTDVLPGGYKGDNNGY

AIPEGTDIFISVYNLHRSPYFWNSPNEFEPERFLVQRKSDEIEGWAGFDPSRSPGALYPNEIISDFAFLP

FGGGPRKCVGDQFALMESTVALAMLLQKFDVELKGSPESVELVTGATIHTKNGLWCKLKKRSNVH

 

CYP97C

 

>CYP97C23 gi|255556788|ref|XP_002519427.1  Ricinus communis

gi|223541290|gb|EEF42841.1  Ricinus communis

84% to CYP97C4 cottonwood

MPLSYSFVSFSHLSVPLIKPATILTSKPHFISIKSSLDNKTPKPNSNNTKPSSWVSPDWLTSLTKTLTLN

QKHDDSGIPIASAKLEDVSDLLGGALFLPLFKWMNEYGPIYRLAAGPRNFVVVSDPAIAKHVLRNYGDGK

YAKGLVAEVSEFLFGSGFAIAEGSLWTARRRAVVPSLHKKYLSVIVDRVFCKCAQRLVEKLQPDVLNGTA

VNMEEKFSQLTLDVIGLSVFNYNFDSLTTDSPVIGAVYTALKEAEARSTDLLPYWKVKALRKIIPRQIKA

EKAVTVIRQTVEELIVKCKEIVDTEDERIDDEEYVNDTDPSILRFLLASREEVSSVQLRDDLLSMLVAGH

ETTGSVLTWTLYLLSKDPVSLLKAQEEVDRVLQGKPPSYEDIKDLKFLTRCINESLRLYPHPPVLLRRAQ

VADVLPGNYKVNAGQDIMISVYNIHHSSKVWDRAEEFVPERFDLEGPVPNETNTDFRFIPFSGGPRKCVG

DQFALLEAIVALAIFLQNMNFELVPDQKISMTTGATIHTTNGLYMKLGKRKKIQAFALSSAR

 

 

CYP710 CLAN

 

>CYP710A52 gi|255584759|ref|XP_002533098.1  Ricinus communis

gi|223527110|gb|EEF29290.1  Ricinus communis N-term aa 1-159

join two fragments with a gap in the middle

Runs off contig

No ESTs to fill in the gap.

AASG02025735.1

MFTITCLLSTLIPYLVSFIVFLVFLEQISYLIKRRNTPGPLLVLPFLGNAISLVRDPTKFWDRQSSFSKK

LGFSTNYIIGRFILFIRDTELSHLIFANVRPDAFMLVGHPFGKKLFGEHNLIYMFGQDHKDLRRRIAPNF

TPRALSTYSDIQQIIILKH

 

AASG02027890.1  Ricinus communis AA 420-510 C-term

      FTEPDRFD &

1622  PERFSAERQEDQLHKRNFLAFGAGAHQCLGQRYALNHLVLFIAMFVTLLDFKRHRIDGCD  1443

1442  DIVYNPTICPKDGCTVFLSRRFSQLPNLSLE*  1347

 

CYP711 CLAN

 

>CYP711A37 gi|255550067|ref|XP_002516084.1  Ricinus communis

gi|223544570|gb|EEF46086.1  Ricinus communis

82% to CYP711A7 cottonwood

MGFGLIQEAFFSTCSNSTSVTIVLALVFTALAIVLGYLYKPFWGVRRVPGPPSVPLLGHLPLLAKYGPDV

FSVLAKQYGPIFRFHMGRQPLIIVADPELCKEVGIKKFKDISNRSIPSPIAASPLHKKGLFFTRDSRWST

MRNTILSVYQPSHLASLVPTMQSFIESATANFQSSKDEDITFSNLSLKLATDVIGQAAFGVDFGLSKPQS

TTDSANTFRNQENGKEVSDFINQHVYSTTQLKMDLSGSFSIIIGLLIPILQEPFRQILKRIPGTMDWKVD

RTNKNISGKLDEIVTKRMKDKNRGSKDFLSLILSARESETLSKNVFSPDYISAVTYEHLLAGSATTAFTL

SSIVYLVAGHPEVEKKLLAEIDVFGPPDQTPTSQDLQTRFPYLDQVIKEAMRFYVVSPLVARETSKEVEI

GGYLLPKGTWVWLALGVLAKDPKNFPEPDKFKPERFDPKCEEEKQRHPYALIPFGIGPRACIGQKFSLQE

LKLSLIHLYRKYIFRHSPNMEKPLELEYGIVLNFKHGVKLRVIKRN

 

 

CYP727 CLAN

 

>CYP727B23 gi|255569165|ref|XP_002525551.1  Ricinus communis

gi|223535130|gb|EEF36810.1  Ricinus communis

AASG02000341.1

73% to CYP727B1 cottonwood

MENSRMLLKDYATRELNAFLWISLITITALMLDKVFKLFRLWSKARAIAGPPCSSFFGHNNFGSRGNFLE

LLSELHDKYGSVLKLWLGPTQLLVSIKDPVLIQDMLLKAEDKLPFTGKAFRLAFGRSNLFFCSYDQAQKR

RESLALQLNEKLLPKAEIIPKHTIDCITQRIDEGMIKGGIDCKLISQHMAFTVLGTTLFGGEFLAWSKAT

SYEELLMEIAKDASFWASYRVTPIWEQGFWRYQSLCTKLKFLTQDILQQCRKNCKLFSRVDQNLNNEAVK

YGMRAASSVPLSGVVMQDKFSQRDLDGHINAREEPCGNIMGMMFHGCIATASLLGNILDRLVTNPEIQDK

IYSEIIMVRQGSTKDVQNVDEMPLLLATIYESARLLPAGPLLQRCSLREDLRLKNGVTIPAGSVLVVPVH

LLQMDDASWGSDACKFNPYRFLSKDKKVSDSVEDSSFT (1)

EDAVDPGQSSYILNDPNENAAFLPFGSGVRACVGQKFVIQGVAILLASLLERYEVRL

QPLSENYPQSTNQEIVFVKRSS

 

Contamination

 

>gi|255594353|ref|XP_002536077.1  Ricinus communis

gi|223520979|gb|EEF26306.1  Ricinus communis

32% to CYP1027C1 Frankia sp. EAN1pec (bacterial contamination?)

37% to CP001738.1 Thermomonospora curvata DSM 43183

top Blast hits in Genbank are all bacteria

This is a contamination

MTDAEQRAREAGLEVVNWDIELDERFRHQSPTFSVNEAARLYSRDKGMFFSNAARGFFVLTKYDYVVEVL

NDAELYCSSKGTHLFLHEPMAHRPLPMEMDPPEHTKVRQLLAPFFTPSRVQGKYKDEARNLAIKIIREVA

EKGSCDAIQDLGEPIAAAITLNNMGVDPALATMLKGAVKQRSLPKTVDEEKKAGYEKGVSTIRDLFVDIL

AKRREKREDDIPSALLDSLIDGEPIADDVVLNLCCTVFAAGVHTTSTQLGFAFYNLARDPSLRRRLVDEP

KIIVKAIEELMRYEAAAVLQGRMVTRDVDFHGLQLRAGDRLILAQAAANRDPEVFSDPDQIDFDRKNAVK

QVTLGRGPHRCIGSYQAKMILQIALEEWHARIPEYTLGDMSQATYELSCAGSISQVPLVFEPQQAN