Notable findings: CYP88 is present, first appearance in evolution, not in Physcomitrella, required for gibberellin synthesis along with CYP701.

CYP84 F5H is still not found in Selaginella (no S-lignols).

No CYP79s in glucosinolate biosynthesis

 

August 12, 2008

 

Sequences submitted by Jing-Ke Weng and revised by D. Nelson

 

CYP51 clan sequences (1 gene, both alleles)

 

>CYP51G1v1 estExt_Genewise1Plus.C_470465|Selmo1 98% to CYP51G1

Selmo1/scaffold_47:1366447-1368056

same as Jing-Ke model SMCYP51

MEVKA

MEADRSTVAAALLLLVGTTCCLWLLSWWRSSSGGSRSRNRLPPVVDSVPIVGGLLKFVKGPIVMLRQEYQRLGSVFTVNI

VTRKITFLIGPDVSSHFYKAQESELSQKEVYQFNVPTFGPGVVFDVDYSVRMEQFRFFTEALKVSRLKTYVDYMVEEAQ (0)

LFFSKWGDEGEVDLKEELERLIILTASRCLLGSEVRNQLFEDVSNLFHDLDNGMQPISVLFPYLPIPAHRRRDRARKELAS

VFAKIIGNRKSSGRSETDMLQVFIDSKYRATGRSTTEDEITGLLIAALFAGQHTSSITSTWTGAYLLT (2)

YKNYWDSAVEEQ

RNVMAKVGDKLDYDIVSEMDVLHRCMKEALRLHPPLIMLMRYCHKDFSVTTRDGVEYNIPAGHIVATSPAFANRLPHVFK

DPDSFDPERFAPGREEDKAVPFSYTSFGGGRHGCLGETFGYMQVKTVWSILLRNFEMELVSPFPEIDWNAMVVGPKGKVM

VRYKRKLLA*

 

>CYP51G1v2 estExt_Genewise1.C_540443|Selmo1 99% to CYP51G1

Selmo1/scaffold_54:1236520-1238160

MLRQEYQRLGSVFTVNIVTRKITFLIGPDVSSHFYKAQESELSQKEVYQFNVPTFGPGVVFDVDYSVRMEQFRFFTEALK

VSRLKTYVDYMVEEAQLFFSKWGDEGEVDLKEELERLIILTASRCLLGSEVRNQLFEDVSNLFHDLDNGMQPISVLFPYL

PIPAHRRRDRARKELASVFAKIIGNRKISGRSEMDMLQVFIDSKYRATGRSTTEDEITGLLIAALFAGQHTSSITSTWTG

AYLLTYKNYWDSAVEEQRNVMAKIGDKLDYDIVSEMDVLHRCMKEALRLHPPLIMLMRYCHKDFSVTTRDGVEYNIPAGH

IVATSPAFANRLPHVFKDPDSFDPERFAPGREEDKAVPFSYTSFGGGRHGCLGETFGYMQVKTVWSILLRNFEMELVSPF

PEIDWNAMVVGPKGKVMVRYKRKLLA*

 

>CYP51G1v2    Selaginella moellendorffii (Lycopod)

            traces 724390578, 890688186, 719688188

            71% to 51G1 Arabidopsis, N-term seq does not match

This seq is the same as v2 except at cyan

MEVKAMEADRSTVAAALLLLVGTTCCLWLLSWW

RSSSGGSRSRNRLPPVVDSVPIVGGLLKFVK

GPIVMLRQEYQRLGSVFTVNIVTRKITFLIGPDVSSHFYKAQESELSQKEVYQFNVPTFG

PGVVFDVDYSVRMEQFRFFTEALKVSRLKTYVDYMVEEAQVY

FSKWGDEGEVDLKEELERLIILTASRCLLGSEVRNQLFEDVSN

LFHDLDNGMQPISVLFPYLPIPAHRRRDRARKELASVFAKIIGNRKISGRSEMDMLQVFI

DSKYRATGRSTTEDEITGLLIAALFAGQHTSSITSTWTGAYLLT (2)

YKNYWDSAVEEQRNVMAKIGDKLDYDIVSEMDVLHRCMKEALRLHPPLIMLMRYCHKDFS

VTTRDGVEYNIPAGHIVATSPAFANRLPHVFKDPDSFDPERFAPGREEDKAVPFSYTSF

GGGRHGCLGETFGYMQVKTVWSILLRNFEMELVSPFPEIDWNAMVVGPKGKVMVRYKRKLLA* 18

 

$$$$$$

 

CYP71 clan sequences (244 sequences in 82 bins) [54% of the P450 sequences]

 

>CYP73A56v1 estExt_Genewise1Plus.C_320377|Selmo1 99% to estExt_Genewise1Plus.C_450434|Selmo1

same as Jing-Ke SMCYP73 except for 2 aa

MINVASAAEEAALAAAASSPLRLETVLFGLLALVLGAILASRALGPKLKLPPGPPAVPIFGNWLQVGDDLNHRNLAELAK

KYGEIFLLKMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRRMRRIMTVPFFTNKVV

QQSRPVWEQEIEFVLKDLLANKEAQEGGTVIRRRLQLLMYNVMYKMMFDRRFESEDDPLFLKLRQLNGERSRLAQSFEYN

YGDFIPILRPFLKRYLQMCKDVKENRLGLFKKYFLDERKQLLNAGKTGPDKVAIDHILEAQKQGEITEANVLYIVENINV

AAIETTLWSMEWVIAELVNNRDIQDKVREELDRVLGPGVAITEPDIPKFTYLTAVIKETFRYHMAIPLLVPHMNLRPAKL

AGYDIPAESKILVNAWWLGNNPELWDKPDVFDPSRFLDGKIEASGNDFRFLPFGVGRRSCPGIIIAMPLLHLVIGSLVAK

FELLPPPGCDKIDVSEKGGQFSLHIAKHSTVVVKPRVL*

 

>CYP73A56v2 estExt_Genewise1Plus.C_450434|Selmo1 60% to CYP73A50 moss, 71% to 73A5 Arab.

MINVASAAEEAALAAAASSPLRLETVLFGLLVLVLGAILASKALGPKLKLPPGPPAVPIFGNWLQVGDDLNHRNLAELAK

KYGEIFLLKMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRRMRRIMTVPFFTNKVV

QQSRPVWEQEIEFVLKDLLANKEAQEGGTVIRRRLQLLMYNVMYKMMFDRRFESEDDPLFLKLRQLNGERSRLAQSFEYN

YGDFIPILRPFLKRYLQMCKDVKENRLGLFKKYFLDERKQLLNAGKTGPDKVAIDHILEAQKQGEITEANVLYIVENINV

AAIETTLWSMEWVIAELVNNRDIQDKVREELDRVLGPGVPITEPDIPKFTYLTAVIKETFRYHMAIPLLVPHMNLRPAKL

AGYDIPAESKILVNAWWLGNNPELWDKPDVFDPSRFLDGKIEASGNDFRFLPFGVGRRSCPGIIIAMPLLHLVIGSLVAK

FELLPPPGCDKIDVSEKGGQFSLHIAKHSTVVMKPRVL*

 

$$$$$$

 

>CYP77C1v1 gw1.14.347.1|Selmo1 99% to e_gw1.37.107.1|Selmo1 38% to CYP89A10 Cucumis

MVAFLAVAVAILAASLLLLSRRRT

HLPPGPRGFPLLGNLLQMRSVLGSPMNLQNLARQHGAIMTLRVGSVPLVVISSSQLAHEALIEKGSIFSSRPSLSERQVR

LSNYRRSINAAPYGHHWRTVRRNMVSHVLSPHRVHAFEPARQRVISELVEKLRQTSQRADSPDGPSAVPVLATLRFTVFS

LLSYMCFGQWLDKDAVNGVERMLRHLITSAGRGGRMSDFVPLLKIVQRSPRDLKLEELVGERRELLLPLIQRAKLLAAED

KLDQNSYLSSLFSLQRQEDHQLKLTDEDLIVLCSEFLNAGADTTANTLEWSLANVIKHPAVQKKLLEEIHSSVGDKPVTE

KDIDKLVYLKAVVKETLRKHPPGYTTLPHAVTEPCKLGGYDIPVHATLLFNIYAINNDPELWTNPDEYKPERFLEGPGAS

ADFTASSGALNLIPFGAGRRICPGLGLATLHVHLVLARLVQEFEWNTVPGETAVDLTPIQEFTVVMKQPLRATLKARRL*

 

>CYP77C1v2 e_gw1.37.107.1|Selmo1 44% to 77A14 Vitis,

MVAFLAVAVAILAASLLLLSRRRTHLPPGPRGFPLLGNLLQMRSVLGSPMNLQNLARQHGAIMTLRVGSVPLVVISSSQL

AHEALIEKGSIFSSRPSLSERQVRLSNDRRSINAAPYGHHWRTVRRNMVSHVLSPHRVHAFEPARQRVISELVEKLRQTS

QRADSPDGPAVPVLATLRFTVFSLLSYMCFGQWLDKDAVNGVERMLRHLITSAGRGGRMSDFVPLLKIVQRSPRDLKLEE

LVGERRELLLPLIQRAKLLAAEDKLDQNSYLSSLFSLQRQEDHQLKLTDEDLIVLCSEFLNAGADTTANTLEWSLANVIK

HPAVQKKLLEEIHSSVGDKPVTEKDIDKLVYLKAVVKETLRKHPPGYTTLPHAVTEPCKLGGYDIPVHATLLFNIYAINN

DPELWTNPDEYKPERFLEGPGASADFTASSGVLNLIPFGAGRRICPGLGLATLHVHLVLARLVQEFEWNTVPGDTAVDLT

PIQEFTVVMKQPLRATLKARRL*

 

>CYP77C2 e_gw1.14.162.1|Selmo1 98% to e_gw1.37.107.1|Selmo1, 42% to CYP77A9

note 4kb from CYP77C1 on scaffold 14

MAFMVAFLAVAVAILAASLLLLSRRRTHLPPGPRGFPLLGNLLQMRSVLGSPMNLQNLARQHGAIMTLRVGSVPLVVVSS

SQLAHEALIEKGSIFSSRPSLWQVRLSNYRRNINAAPYGHHWRTVRRNMVSHVLSPHRVHAFEPARQRVISELVEKLRQT

SQRADSPDGPAVPVLATLRFTVFSLLSYMCFGQWLDKDAVNGVERMLRHLVTSAGRGGRMSDFVPLLKIVQRSPRDLKLE

ELVGERRELLLPLIQRAKLLAAEDKLDQNSYLSSLFSLQRQEDHQLKLTDEDLIVLCSEFLNAGADTTANTLEWSLANVI

KHPAVQKKLLEEIHSSVGDKPVTEKDIDKLVYLKAVVKETLRKHPPGYTTLPHAVTEPCKLGGYDIPVHATLLFNIYAIN

NDPELWTNPDEYKPERFLEGPGASADFTASSGALNLIPFGAGRRICPGLGLATLHVHLVLARLVQEFEWNTVPGETAVDL

TPIQEFTVVMKQPLRATLKARRL*

 

$$$$$$

 

>CYP77D1 gw1.4.1172.1|Selmo1 36% to CYP77A4. N- and C- terminal added. 39% to CYP77C2

MDLAALVATIALLALASWSLFFLQHLNL

RRRMPPGPIGWPVLGSMREIPRLLSDPQKFQQLVARYGPIVTLWNGSVATILISSPDIAREALVEKGSVLASRPDVPSMR

LLTSGFKTINSSPYGVHWRATRKNLVSGILSPRVMSGFAPVQEQAAEDLVRKLASEAKQSGGTVESLSVSVRCVLFQILS

FVCFGRKLEEAKLEELNALMKEATTMLHPVLGDLVPFLKVFTSHTKQKSFLVRQNQLLKGLLSRECPAASESYVQTLLSL

QGKNLEDVDLDLAVLVRELFIAGADTTTNCVEWSMANLIKYPGIQERVFRELAENVGQKSGVKVADLPKLPYLHAVVKEA

LRKHPPVYLSAPRTPVHATKLAGYDIPKESTVVVHLQSLSNDAGVWKNPDKFLPERFFEQTELSKRMSMIPFGAGRRDCP

GKHLGMLHVHLIVANLVQAFEWRAEGKEVDLSPRTVFTVQMKNPLRASICQRRS*

 

No allele found

 

$$$$$$

 

>CYP78A30 e_gw1.41.89.1|Selmo1 91% to e_gw1.41.91.1|Selmo1

94% to CYP78A45v1

MGSSSGFDWWILT

LLPFFSRHLPGEANDHAWRLIAAALAMLVVAVVSAILAPWLVPGGNAWGRTLRKKQTIPG

PRGWPVLGVLTEMGSQAHRKLAKLAEKYHAKEL

MAFSLGNTRMIITSKPEVARELLNSSEFADRPLKQSAQQLLFGRAIGFAPYGDYWRNLRRIASNYLFSPRQIAAHEPSRQ

EETSRMIKAMSTFAADNHGLVRVRDFLQRASLNNIMQTVFGRRFEDGSEDAAELAEMVREGFELLGAFNWADHLPALKAV

DPQNILQRCAVLVPRVTSFVQKIIDDHRQQEVKTAEPDFVDVLLSLDGEDKLDDADMIAVLWEMIFRGTDTVALLTEWIL

AELVIHPEIQSKLHDEITSVAGKSEVAESDLSKMVYLQAVVKETLRMHPPGPLLSWARLAIHDVTLAGHHVPAGTTAMVN

MWSITHDPSIWSEPEKFNPERFLEQDIDVKGTDLRLAPFGAGRRVCPGRALGLATVLLWTARLVQEFEFQTDPAHPVDLT

EVLKLSSEMAAPLVCTAKLL*

 

$$$$

 

>CYP78A43v1 e_gw1.35.149.1|Selmo1 93% to e_gw1.41.91.1|Selmo1 55% to CYP78A9

M  E  S  A  S  G  F  D  W  W  I  L  T  L  P  F  C

S  R  H  L  S  A  E  A  N  D  H  A  W  R  F  V  A  A  V  A  I  F  V  L

A  A  V  S  A  I  L  A  S  W  F  V  P  G  G  N  A  W  G  R  T  L  K

R  K  Q  T  I  P  G  P  R  G  W  P  V  L  G  V  L  T  E  M  G  G  Q

A  H  R  K  L  A  A  L  A  E  K  H  H  A  K  E  L

MAFSLGNTRMIITSKPEVARELLNSSEFADRPLKQSAQQLLFGRAIGFAPYGDYWRNLRRIASNYLFSPRQIAAHEPSRQ

AETSRMIEAMSTFAADNHGLVRVRDFLQRASLNNIMQTVFGRRFEDGSENAAQLSEMVREGFELLGAFNWADHLPALKAV

DPQNILQRCAVLVPRVTSFVQNIIDEHRQLDNKAAGPDFVDVLLSLDGEDKLNDSDMIAVLWEMIFRGTDTVALLTEWIL

AELVLHPEIQSKLREEIASVVGGKSEVAESDLHKMVYLQAVVKETLRMHPPGPLLSWARLAIHDVTLAGHHVPAGTTAMV

NMWSITHDPSIWSEPEKFSPERFLEQDVDVKGTDLRLAPFGAGRRVCPGRALGLATVLLWTARLVHKFEFQVDPAHPVDL

TEVLKLSSEMAAPLVVKVR*

 

>CYP78A43v2 e_gw1.41.93.1|Selmo1 92% to e_gw1.41.91.1|Selmo1

2 aa diffs to CYP78A43v1

M  E  S  A  S  G  F  D  W  W  I  L  T  L  P  F  C

S  R  H  L  S  A  E  A  N  D  H  A  W  R  F  V  A  A  V  A  I  F  V  L

A  A  V  S  A  I  L  A  S  W  F  V  P  G  G  N  A  W  G  R  T  L  K

R  K  Q  T  I  P  G  P  R  G  W  P  V  L  G  V  L  T  E  M  G  G  Q

A  H  R  K  L  A  A  L  A  E  K  H  H  A  K  E  L

MAFSLGNTRMIITSKPEVARELLNSSEFADRPLKQSAQQLLFGRAIGFAPYGDYWRNLRRIASNYLFSPRQIAAHEPSRQ

AETSRMIEAMSTFAADNHGLVRVRDFLQRASLNNIMQTVFGRRFEDGSENAAQLSEMVREGFELLGAFNWADHLPALKAV

DPQNILQRCAVLVPRVTSFVQNIIDEHRQLDNKAAGPDFVDVLLSLDGEDKLNDSDMIAVLWEMIFRGTDTVALLTEWIL

AELVLHPEIQSKLREEIASVVGGKSEVAESDLHKMVYLQAVVKETLRMHPPGPLLSWARLAIHDVTLAGHHVPAGTTAMV

NMWSITHDSSIWTEPEKFSPERFLEQDVDVKGTDLRLAPFGAGRRVCPGRALGLATVLLWTARLVHKFEFQVDPAHPVDL

TEVLKLSSEMAAPLVVKVR*

 

$$$$

 

>CYP78A45v1 e_gw1.35.145.1|Selmo1 89% to e_gw1.41.91.1|Selmo1

MGSSSGFDWWILT

LLPFFPRHLLAEADDHAWRLIAAALAMLVVAAVSAILASWLVPGGNAWGRTLRKKQTIPG

PRGWPVLGVLTEMGGQAHRKLAKLAEKYHAKEL

MAFSLGNTRMIITSKPEVARELLNSSEFADRPLKQSAQQLLFGRAIGFAPYGDYWRNLRRIASNYLFSPRQIAAHEPSRQ

EETSRMIKAMSTFAAENHGLVRVRDFLQRASLNNIMQTVFGRRFEDGSEDAAELAEMVREGFELLGAFNWADHLPALKTV

DPQNILQRCAVLVPRVTSFVQKIIDDHRQQEVKTAQPDFVDVLLSLDGEDKLDDADMIAVLWEMIFRGTDSVALLTEWIV

AELVLHPEIQSKLRDEIISLAGKSRVPESDLNKMVYLQAVVKETLRMHPPGPLLSWARLAIHDVSLAGHHIPAGTTAMVN

MWSITHDPSIWSEPEKFNPERFLEQDIDVKGTDLRLAPFGAGRRVCPGRALGLATVLLWTARLVQEFQFQADSLHPVDLT

EVLKLSSEMATPLLVKVL*

 

>CYP78A45v2 e_gw1.41.24.1|Selmo1 96% to e_gw1.35.145.1|Selmo1

MESSGFDWWILTLPFCSRHLSADANDHAWRVVAAALAMLVVAAVSAILASWLV

PGGNAWGRTLRKKQTIPGPRGWPVLGVLTEMGGQAHRKLAKLAEKYHAKEL MAFSLGNTRMIITSKPEVARELLNSSEFADRPLKQSAQQLLFGRAIGFAPYGEYWR

NLRRIASNYLFSPRQIAAHEPSRQEETSRMIKA

MSTFAAENHGLVRVRDFLQRASLNNIMQTVFGRRFEDGSEDAARLSEMVREGFELLGAFNWADHLPALKAVDPQNILQRC

AVLVPRVTSFVQKIIDEHRQQVTKAAEPDFVDVLLSLDGEDKLEDADMIAVLWEMIFRGTDTVALLTEWIVAELVLHPEI

QSKLRDEIISLAGKSRVAESDLNKMVYLQAVVKEALRMHPPGPLLSWARLAIHDVSLAGHHIPAGTTAMVNMWSITHDPS

VWSEPEKFNPERFLEQDIDVKGTDLRLAPFGAGRRVCPGRALGLATVLLWTARLVQEFQFQADSLHPVDLTEVLKLSSEM

ATPLLVKVL*

 

$$$$

 

>CYP78A46v1 e_gw1.35.150.1|Selmo1 92% to e_gw1.41.91.1|Selmo1

MESSSGFNW

WILTLPFFPRHLATDHAWRSVFSAAALLILAAISAILAPWLVRGGNAWGKALRKKQSIPG

PRGWPVLGVLTEMGGQAHRKLAALAERYHAKEL

MAFSLGNTRMIITSKPEVARELLNSSEFADRPLKQSAQQLLFGRAIGFAPYGDYWRNLRRIASNYLFSPRQIAAHEPSRQ

AETTRMIEAMSTFAAENDGLVRVRDFLQRASLNNIMQTVFGRRFEDGSEDAAQLSEMVREGFELLGAFNWADHLPVLKAV

DPQNILQRCAVLVPRVTSFVQRIIDEHRQSVDKKVGEADFVDVLLSLDGEDKLIDADMIAVLWEMIFRGTDTVAL

xxxxxx

AELVL

HPEIQSKLRHEITSMVGGKSKLAEPHLHKMVYLQAVVKETLRMHPPGPLLSWARLAIHDVSLAGHHVPAGTTAMVNMWSI

THDPSIWSEPEKFNPERFLEQDIDVKGTDLRLAPFGAGRRVCPGRALGLATVLLWTARLVQQFEFQADPTHPVDLTEVLK

LSSEMVAPLVVKVL*

 

>CYP78A46v2 e_gw1.41.92.1|Selmo1 92% to e_gw1.41.91.1|Selmo1, 59% to CYP78A11

MELSSGFNW

WILTLPFFPRHLATDHAWRSVFSASALLILAAISAILAPWLVRGGNAWGKALRKKQTIPG

PRGWPVLGVLTEMGGQAHRKLAALAERYHAKEL

MAFSLGNTRMIITSKPEVARELLNSSEFADRPLKQSAQQLLFGRAIGFAPYGDYWRNLRRIASNYLFSPRQIAAHEPSRQ

AETTRMIEAMSTFAAENDGLVRVRDFLQRASLNNIMQTVFGRRFEDGSEDATQLSEMVREGFELLGAFNWADHLPVLKAV

DPQNILQRCAVLVPRVTSFVQRIIDEHHQSVDKKVAEADFVDVLLSLDGEDKLIDADMIAVLWEMIFRGTDTVALLTEWI

LAELVLHPEMQSKLRHEITSMVGGKSELAEPDLHKMVYLQAVVKETLRMHPPGPLLSWARLAIHDVSLSGHHVPAGTTAM

VNMWSITHDPSIWSEPEKFNPERFLEQDIDVKGTDLRLAPFGAGRRVCPGRALGLATVLLWTARLVQQFEFQADPTHPVD

LTEVLKLSSEMVAPLVVKVL*

 

>CYP78A44v1 e_gw1.35.39.1|Selmo1 97% to e_gw1.41.91.1|Selmo1 91% to CYP78A43v1

MESSSGFDWWILTLPFFPRHLLTDHAWRFAAAAVAVLVLAAVSAILAAWLV

PGGNAWGRTLRKKQTIPGPRGWPVLGVLTEMGGQAHRKLAKLAERYHAKEL

M  A  F  G  L  GN  T  R  M  I  I  T  S  K  P  E  V  A  R  E  L  L  N  S  S  E  F  AD  R  P  L  K  Q  S  A  Q  Q  L  L  F  G  R  A  I  G  F  A  P  Y  G

D  Y  W  R  N  L  R  R  I  A  S  N  Y  L  F  S  P  R  Q  I  A  A  H  E

P  S  R  Q  A  E  T  S  R  M  I  E  A

MSTFAANNHGLVRVRDFLQRASLNNIMQTVFGRSFEDGSEDAARLSEMVREGFELLGAFNWADHLPALKAVDPQNILQRC

DVLVPQVTRFVQKIIDEHRQLVDKKVGEADFVDVLLSLDGEEKLEDADMIAVLWEMIFRGTDTVALLTEWILAELVLHPE

IQSKLRHEITSVVGKSKVAESDLQKMVYLQAVVKETLRMHPPGPLLSWARLAIHDVSLSGHHVPAGTTAMVNMWSITHDP

SIWSEPEKFNPERFLEQDVDVKGTDLRLAPFGAGRRVCPGRALGLATVLLWTARLVHKFEFQVDPAHPVDLTEVLKLSSE

MVKPLVVTVL*

 

>CYP78A44v2 e_gw1.41.91.1|Selmo1 64% to CYP78A28 moss,

MESSSGFDW

WILTLPFFPRHLATDHACRFVAAAVAVLVLAAVSAILAAWLVPGGNAWGRTLRKKQTIPG

PRGWPVLGVLTEMEGQAHRKLAKLADRYHAKGL

MAFGLGNTRVIITSKPEVARELLNSSEFADRPLKQSAQQLLFGRAIGFAPYGDYWRNLRRIASNYLFSPRQIAAHEPSRQ

AETSRMIEAMSTFAADNHGLVRVRDFLQRASLNNIMQTVFGRSFEDGSEDAARLSGMVREGFELLGAFNWADHLPALKAV

DPQNILQRCAVLVPQVTRFVQRIIDEHRQSDDKKVGEADFVDVLLSLDGEDKLEDADMIAVLWEMIFRGTDTVALLTEWI

LAELVLHPEIQSKLRHEITSIVGKSKVAESDLQKMVFLQAVVKETLRMHPPGPLLSWARLAIHDVSLSGHHVPAGTTAMV

NMWSITHDPSIWSEPEKFNPERFLEQDVDVKGTDLRLAPFGAGRRVCPGRALGLATVLLWTARLVHKFEFQVDPAHPVDL

TEVLKLSSEMVKPLVVTVL*

 

 

>fgenesh2_pg.C_scaffold_41000176|Selmo1 93% to e_gw1.35.145.1|Selmo1

MVYLQAVVKETLRMHPPGPLLSWAPLAIHDVTLAGHHVPVGTTAMVNMWSITHDPSIWSEPEKFNPERFLEQDIDVKGSD

LRLAPFGAGRRVCPGRALGLATVLLWTARLVQQFEFQADSLHPVDLTERLHGIKLPNNRGKLCHRYVSTKGPFDTCACVR

TSCKKHFTREYGGQIEASAEKINITQMICVQTFHDFEDEFSAAPAETPIPECNLQKRQ*

 

>e_gw1.19.247.1|Selmo1 79% to e_gw1.35.145.1|Selmo1

KETLRMHPPGPLLSWARLAIHDVSLAGRGPCRDHGHGEHVVIIHDPSIWSEPERFNPERFLEQDIDVKGTDLRLAPFGAG

QRH*

 

$$$$$$

 

>CYP78A47v2 gw1.53.10.1|Selmo1 53% to CYP78A7

M  E  C  G  H  G  I  W  L  Q  V  L  P

L  L  Q  V  L  A  S  R  E  R  N  Q  D  L  F  H  V 

M  L  Q  L  A  AG  M  V  R  S  S  R 

M  L  L  L  T  I  L  L  L  C  L  L  A  L  S  A

K  V  W  C  N  R  L  P  G  C  K  R  S  W  S  S  T 

IPGPAGMPVVGNLVEFGRAAGQPHRWLAELAAALNPSAGLMALQLGSTRLVVASKPEAAREILSSPCFGDRPIKQSAQEL

MFGRAIGFAPQGEHWRRLRRIAAHSLFSPRRMAAQEHIRLQESEAMLGAIRRQGQQDPLPLRCILQQTSVRTMMRSVFGW

RSSNKEQEEELVSMVREGFDLLGAVNWADHIPLLKHLDAQAIQRRSRVLAARVSAFVGGIIRQHRLAAATGNAGMRSDDF

VDVLLALQGEDELQDDDIVAVLWEMIFRGTDTTAILTEWVLAELVVHPDIQRKLHLELDATLGAEDVRDDHVHRLTYLQA

VVKETLRLHPPGPLLSWSRLCTQDTTIAGGHHVPKGTNAMVNMWAITHDSTIWTQPHRFLPERFMAGAGGADMDVKGSDL

RLAPFGSGRRVCPGRALGLATVHLWVARLLQKFEWLACTDHPVELQEVLKLSAEMAKPLRACPVPRRPM

>CYP78A47v1 gw1.7.29.1|Selmo1 100% to gw1.53.10.1|Selmo1 missing N-terminal

M  E  C  G  H  G  I  W  L  Q  V  L  P

L  L  Q  V  L  A  S  R  E  R  N  Q  D  L  F  H  V

MLQLAAGMVRSSRMLLLTILLLCLLALSAKVWCNRLPGCKRSWSST

IPGPAGMPVVGNLVEFGRAAGQPHRWLAELAAALNPSAGLMALQLGSTRLVVASKPEAAREILSSPCFGDRPIKQSAQEL

MFGRAIGFAPQGEHWRRLRRIAAHSLFSPRRMAAQEHIRLQESEAMLGAIRRQGQQDPLPLRCILQQTSVRTMMRSVFGW

RSSNKEQEEELVSMVREGFDLLGAVNWADHIPLLKHLDAQAIQRRSRVLAARVSAFVGGIIRQHRLAAATGNAGMRSDDF

VDVLLALQGEDELQDDDIVAVLWEMIFRGTDTTAILTEWVLAELVVHPDIQRKLHLELDATLGAEDVRDDHVHRLTYLQA

VVKETLRLHPPGPLLSWSRLCTQDTTIAGGHHVPKGTNAMVNMWAITHDSTIWTQPHRFLPERFMAGAGGADMDVKGSDL

RLAPFGSGRRVCPGRALGLATVHLWVARLLQKFEWLACTDHPVELQEVLKLSAEMAKPLRACPVPRRPM*

 

$$$$$$

 

>CYP78A48v1 e_gw1.1.502.1|Selmo1 99% to e_gw1.5.279.1|Selmo1

MDSKADRQDLLFYLLPLIHSNAPSFLPLLLALGAVLAAAVAIFRWTSRGGC

AWADRSSTIPGPRGLPVLGSLLEMGDLAHHRLRSLSIAHGARKLMALSLGSTRVVITSAP

EVAREILTSAAFADRPLKQSAAELLFGRAIGFAPYGDYWRGLRRIAANHLFSPRRIAAHE

PQRQRHTEVMIDAIASAAGKDHGKSVGIRGFLQRASLANV

MQGVFGRCYSGAEEAELQAMVREGFELLGAFNWSDHLPLLRAINVDPHSIQERCSKLVPRVQKFVQAIIDEHRQARSGGD

DRESSDFVDVLLNLSGEEKLQDQDMIAVLWEMIFRGTDTTAILTEWMLAELVLHPEIQRRLYHEIEELQSKKSPPSPLSD

QDVARMPLLQAVVKETLRLHPPGPLLSWARLSTQDVTIAGHHVPRGTTAMVNMWAITHDPAVWSEPELFVPDRFLGVEFD

VKGTDLRLAPFGAGRRVCPGRALGLATVGLWLAKLVERFEFVEDKERPVDLSEVLKLSCEMVNPLSVGAVERCPIAASS*

 

>CYP78A48v2 e_gw1.5.279.1|Selmo1 69% to e_gw1.41.91.1|Selmo1

MDSKADRQDLLFYLLPLIHSNAPSFLPLLLALGAVLAAAVAIFRWTSRGGCAWADRSSTIPG

PRGLPVLGSLLEMGDLAHHRLRSLSIAHGARKL

MALSLGSTRVVITSAPEVAREILTSAAFADRPLKQSAAELLFGRAIGFAPYGDYWRGLRRIAANHLFSPRRIAAHEPQRQ

RHTEVMIDAIASAAGKDHGKSVGIRGFLQRASLANVMQGVFGRCYSGAEEAELQAMVREGFELLGAFNWSDHLPLLRAIN

VDPHSIQERCSKLVPRVQKFVQAIIDEHRQARSGGDDRESSDFVDVLLNLSGEEKLQDQDMIAVLWEMIFRGTDTTAILT

EWMLAELVLHPEIQRRLYHEIEELQSKKSPPSPLSDQDVARMPLLQAVVKETLRLHPPGPLLSWARLSTQDVTIAGHHVP

RGTTAMVNMWSITHDPAVWSEPELFVPDRFLGVEFDVKGTDLRLAPFGAGRRVCPGRALGLATVGLWLAKLVERFEFVED

KERPVDLSEVLKLSCEMVNPLSVGAVERCPIAASS*

 

$$$$$$

 

>CYP78A49v1 e_gw1.13.253.1 missing N-terminal

MDSSSGAAGRSSLVYLLPLIAKPWLDSSSAAASPSWIPLALALLCVFAASAILFWCFPGGPAWGRSLIFSKKMKNAAAIPGPRGFPVLGSLLDMGalahrrlaalarshsaerlMAVSVGSTRMVVSSLPDVARQILASPCFADRPLKQSAQELLFGRAMGFAPYGDYWRRLRRIASGCLFSPRRIAAQEPLRQAETAAMVADISGSAARSNGGGIAVRGFVQRASLNSVMRSVFGRRIGDGEEEVQAMVREGFELLGAFNWSDHLPFLRQWDPQGVVKRCQQLVPRVNAFVRKIIeeensssskaagggeDFVHVLLSLQGEDKLEESDMIAVLWEMIFRGTDTTAILTEWALAELVLNPDVQHKLQSEIDSVCPAGQPVRDSDTERMPYLQAVINETLRLHPPGPLLSWARLATHDVEISGYHVPAGTSAMVNMWAITHDPSIWPNPEAFDPERFVENKSFDVRGIDLRLAPFGAGRRVCPGRALGLATVKLWIA

RLVQEFSWMPCEDSPVDLSEVLKLSCEMVNPLKARPVSRRPPATH*

 

>CYP78A49v2 e_gw1.66.204.1|Selmo1

MDSSSGAAGRSSLVYL

LPLIAKPWLDSSSAAASPSWIPLALALLCVFAASAILFWCFPGGPAWGRSLIFSKKMKNA

AAIPGPRGFPVLGSLLD

MGALAHRRLAALARSHSAERLMAVSVGSTRMVVSSLPDVARQILASPCFADRPLKQS

AQELLFGRAMGFAPYGDYWRRLRRIASGCLFSPRRIAAQEPLRQAETAAMVADISGSAAR

SNGGGIAVRGFVQRASLNSVMRSVFGRRIGDGEEEVQAMVREGFELLGAFNWSDHLPFLR

QWDPQGVVKRCQQLVPRVNAFVRKIIQERRAEMAAAEEENSSSSKAAGGGEDFVHVLLSL

QGEDKLEESDMIAVLW (0)

EMIFRGTDTTAILTEWALAELVLNPDVQRKLQSEIDSVCPAGQPVRDSDTERMPYLQAVINETLRLHPPGPLLSWARLATH

DVEISGYHVPAGTSAMVNMWAITHDPSIWPNPEAFDPERFVENKSFDVRGIDLRLAPFGAGRRVCPGRALGLATVKLWIA

RLVQEFSWMPCEDSPVDLSEVLKLSCEMVNPLKARPVSRRPAATH*

 

$$$$$$

 

>CYP98A38v1 estExt_fgenesh1_kg.C_470009|Selmo1 99% to 98A38

MDPSAEAYHHHHHHYTEFVPPDHGHRYSTWTIPVGLFLVYLTFKLLSRPRLPPGPKPWPIIGSLHRVSPVRFRCFMDWAE

KHGPIMSVWMGTNLNVVISNAELAKEVLKEKDKELASRPLTRAAARFSRNGQDLIWADYGDHYVKVRKLCTLELFTPKRL

ESLRWIREEEVGAMVKSIFQDVKNNGGAAVTVKNYVSAVAFNNITRIVFGKRFVDENGEMLPQGVEFKAIISQGMKLGAS

LTMAEHISFIRWMFPLQEEEFAKHGARRDSLTKEIMEEHALEKKKSGTSQEHFVDALLNLKDQYGLSETTVIGLLWDMIT

AGMDTTAISAEWAMAEIIKHPKVQEKAHEEMDRVIGKERIITEVDVQQLPYLQSIVKEALRLHPTTPLMLPHKATTRVKI

GGYDIPKGTIVHVNVYAIGRDPKVWKRASVFRPERFLEEDVDIKGHDYRLLPFGAGRRICPGAQLGLNMVQLMVARLLHQ

FSWAPPPGVKPEKIDLTERPGVVTFMANPVQAVATPRLAEKLYE*

 

>CYP98A38v2 estExt_Genewise1Plus.C_540107|Selmo1 99% to 98A38 same as SMCYP98 Jing-Ke

MDPSAEAYHHHHHHYTEFVPPDHGHRYSTWTIPVGLFLVYLTFKLLSRPRLPPGPKPWPIIGSLHRVSPVRFRCFMDWAE

KHGPIMSVWMGTNLNVVISNAELAKEVLKEKDKELASRPLTRAAARFSRNGQDLIWADYGDHYVKVRKLCTLELFTPKRL

ESLRWIREEEVGAMVKSIFQDVKNNGGAAVTVKNYVSAVAFNNITRIVFGKRFVDENGEMLPQGVEFKAIISQGMKLGAS

LTMAEHISFIRWMFPLQEEEFAKHGARRDSLTKEIMEEHALEKKKSGTSQEHFVDALLNLKDQYGLSETTVIGLLWDMIT

AGMDTTAISAEWAMAEIIKHPKVQEKAHEEMDRVIGKERIITEVDVQQLPYLQSIVKEALRLHPTTPLMLPHKATTRVKI

GGYDIPKGTIVHVNVYAIGRDPKVWKRASVFRPERFLEEDVDIKGHDYRLLPFGAGRRICPGAQLGLNMVQLMVARLLHQ

FSWAPPPGVKPEKIDLTERPGVVTFMANPVQAVATPRLAEKLYE*

 

>CYP98A38v2   Selaginella moellendorffii

 

           DN838382.1 cDNA

           traces 719863659, 914824739, 880042810

           64% to 98A3

MDPSAEAYHHHHHHYTEFVPPDHGHRYSTWTIPVGLFLVYLTFKLLSRPRLPPG

PKPWPIIGSLHRVSPVRFRCFMDWAEKHGPIMSVWMGTNLNVVISNAELAKEVLKEKDKE

LASRPLTRAAARFSRNGQDLIWADYGDHYVK (0)

VRKLCTLELFTPKRLESLRWIREEEVGAM

VKSIFQDVKNNGGAAVTVKNYVSAVAFNNITRIVFGKRFVDENGEMLPQGVEVKAIISQG

MKLGASLTMAEHISFIRWMFPLQEEEFAKHGARRDSLTKEIM

EEHALEKKKSGTSQEHFVDALLNLKDQYGLSETTVIGLLW (0)

DMITAGMDTTAISAEWAMAEIIKHPKVQEKAHEEMDRVIGKERIITEV

DVQQLPYLQSI

VKEALRLHPTTPLMLPHKATTRVKIGGYDIPKGTIVHVNVYAIGRDPKVWKRASVFRPER

FLEEDVDIKGHDYRLLPFGAGRRICPGAQLGLNMVQLMVARLLHQFSWAPPPGVKPEKID

LTERPGVVTFMANPVQAVATPRLAEKLYE*

 

$$$$$$

 

>CYP701C1v1 e_gw1.0.513.1|Selmo1 99% to e_gw1.60.109.1|Selmo1 missing small N-terminal

VAEVPGLPFVGNLLQMTVERPHRKLTSWSNEYGPIYTIRTGQKSQVIVSSPELAREAVVAKYSSISNRDLGSNLTILTRN

RKIVAMSDYGDRYRMLKRMVVNNLLGQTSQKALHVQRENYLGIALDGLFDELGRFPGSTGQVNARDCIANFLFRLGTHQA

SVFGRDIESVRVPELGAEVTRWEIYRILVQDVMKAAVQIDWRDFFPTLKWIPNWKFEDGIYKVERKRSAVTKALMEQHRQ

LSRSQQRDKCYCDVLLDNESHYSEDELLLAAWEPIIESSDTTLVTSEWALYELASAPKLQEKLYNEIKRVVGDERMVSED

DLPNLPFLNAVIKETLRKYSPVPILPPRYIHEQVELGGYTIPAGYQLIVNIFGIHHDPKRWSNPETWDPSRFLGVEGGSF

DMGLTDMRLMPFGGGKRICAGMAQVFYVVPMIIATLVQHFEWTLPQGDMDKRNVVEDTVYLTTQKLEPLQACAKPRVPRR

LPSKTLNAVPSNNKVPKHKH*

 

>CYP701C1v2 e_gw1.60.109.1|Selmo1 48% to CYP701B1 moss, 43% to 701A3

VAEVPGLPFVGNLLQMTVERPHRKLTSWSNEYGPIYTIRTGQKSQVIVSSPELAREAVVAKYSSISNRDLGSNLTILTRN

RKIVAMSDYGDRYRMLKRMVVNNLLGQTSQKALHVQRENYLRIALDGLFDELGRFPGSTGQVNARDCIANFLFRLGMHQA

SVFGRDIESVRVPELGAEVTRWEIYRVLVQDVMKAAVQIDWRDFFPSLKWIPNRKFEDGIYKVERKRSAVTKALMEQHRQ

LSRSQQRDKCYCDVLLDNESHYSEDELLLAAWEPIIESSDTTLVTSEWALYELASGPKLQEKLYNEIKRVVGDERMVSED

DLPNLPFLNAVIKETLRKYSPVPILPPRYIHEQVELGGYTIPAGYQLIVNIFGIHHDPKRWSNPETWDPSRFLGVEGGSF

DMGLTDMRLMPFGGGKRICAGMAQVFYVVPMIIATLVQHFEWTLPQGDMDKRNVVEDTVYLTTQKLEPLQACAKPRVPRR

LPSKTLNAVPSNNKVPEHKH*

 

$$$$$$

 

>CYP701C2v1 fgenesh2_pg.C_scaffold_51000105|Selmo1 76% to e_gw1.60.109.1|Selmo1

39% to 701A3, 38% to 701B1 moss

MAKSDLDQAFSEFATGSFLPPAATGAASVAILHKHASKRRNKLPPGVYRSIDGFFSVYGIKFDCVWQRLPFVGNLLQMTV

ERPHRKLTTWSNEYGPIYTIRTGQKYQVIVSSPELAREVVNSIFHGKAITRWWQALVAKYSSISNRDLGSNITILTRNRK

IVAMSDYDERYRMLKRMMVNNLLGQTSQKSFRGHREKYLYIALDGLFDELRRLPGSTGHVNARDCILNFSSVKECTRQVF

GRDIERVSVLKLGMEVTRWEIYRTLVQNLMKASVQIDWRNFFPSLKWIPNRKFEDGIYRVERKRSAVTKALMEQHRELSR

SQQRDKCYCGVLLDNESHFSKDELLLAAWEPIIESSDTTLVTSEWALYELARAPKLQEKLYDEIKRVVGDEHMSEDDLPN

LPFLNVVIKETLRKYSPVPILPPRYIHEICAGIAQAFYVVPMIIASLVQHFEWSLPQGDMDKKNVLEDTATQKLEPLQAC

AKPRVPRRLAGNAQKVK*

 

>CYP701C2v2 fgenesh2_pg.C_scaffold_71000012|Selmo1

91% to fgenesh2_pg.C_scaffold_51000105|Selmo1

MAKSDLDQAFSEFATGSFLPPAATGAALHHRRHLTQACLETTQQITARLPFVGNLLQMTMERPHRKLTTWSNEYGPIYTI

MTGQKYQVIVSSPELAREVVNSIFHGKAITRWWQALVAKYSSISNRDLGSNITILTRNRKIVAMSDYDERYRMLKRMMVN

NLLGQTSQKSFRGHREKYLYIALDGLFDELRRLPGSTGHVNARDCILNFSSVKECTRQVFGRDIERVSVPKLGMEVTRWE

IYRTLVQDLMKASVQIDWRDFFPSLKWIPNRKFEDGIYRVERKRSAVTKALMEQHRELSRSQQRDKCYCDVLLDNESHYS

KDELLLAAWEPIIESSDTTLVTSEWALYELASAPKLQEKLYDEIKRAVGDERMVSEDDLPNLPFLNTVIKETLRKYSPAP

ILPPRYILELGGYTIPAGYQHFKWSLPQGDMDKKNVLEDTVYFTTQKLEPLQACAKPRRLAGNGQKVK*

 

$$$$$$

 

>CYP703C1v1  Selaginella moellendorffii

          Traces 862178140, 914752762, 890725025, 914889541

          49% to 703A1, 47% to 703A2

MSTVVDFLSSAPGWNAACMVVAALVFVVLVMLGRKENRNLPPGPPGWPIIGNLMQLGPLPHRTMAGWCQ

KYGPLVYCRLGSTPTITASSPQMIRELLWTQDETFASRPRTTAGKLMAYHDQDVGLAPYD

AHWKLMRRICVENLLTTRRMEGFQKSRAEEARDLVETMLKEAKAGN

TINMREHLGGFTMNVITRMLIGKKYFGTESTGEKEATDIRELLHEAVALIGVFFIPDHV

PLLKWMDPKGYRHQFKKIGKRMDDYYSYIIEEHRTRQEVVDGPKDFVDV

LLGENSELNDVEIKALIQ (0)

DMVVGGTDTASFTMEWFMLEMIRNPKVMRKVQEEIDSVLEKK

VTNKHLVEESDLASLDYLKAAVKETFRMHPVGGFLIPHESIGDTKVAGYHVPKGSLILIN

THGLGRNTAVWDNVDEFRPERFLRTDDKVHLRDSEYRVIPFGSGKRACPGAQLGQSM

LLLGLGRLLRGFDWYPPPGMSTGDIDVMEAYGLTTPPRTPLRAVAKSRLDERFYSLH*

 

>CYP703C1v1 fgenesh1_pm.C_scaffold_0000132|Selmo1 100% to 703C1

M  S  T  V  V  D  F  L  S  S

A  P  G  W  N  A  A  C  M  V  V  A  A  L  V  F  V  V  L  V

MLGRKENRNLPPGPPGWPIIGNLMQLGPLPHRTMAGWCQKYGPLVYCRLGSTPTITASSPQMIRELLWTQDETFASRPRT

TAGKLMAYHDQDVGLAPYDAHWKLMRRICVENLLTTRRMEGFQKSRAEEARDLVETMLKEAKAGNTINMREHLGGFTMNV

ITRMLIGKKYFGTESTGEKEATDIRELLHEAVALIGVFFIPDHVPLLKWMDPKGYRHQFKKIGKRMDDYYSYIIEEHRTR

QEVVDGPKDFVDVLLGENSELNDVEIKALIQDMVVGGTDTASFTMEWFMLEMIRNPKVMRKVQEEIDSVLEKKVTNKHLV

EESDLASLDYLKAAVKETFRMHPVGGFLIPHESIGDTKVAGYHVPKGSLILINTHGLGRNTAVWDNVDEFRPERFLRTDD

KVHLRDSEYRVIPFGSGKRACPGAQLGQSMLLLGLGRLLRGFDWYPPPGMSTGDIDVMEAYGLTTPPRTPLRAVAKSRLD

ERFYSLH*

 

>CYP703C1v2 estExt_Genewise1Plus.C_80237|Selmo1 96% to CYP703C1

same as Jing-Ke SMCYP703 except for an intron in Jing-Ke model.

MQLGPLPHRTMAGWCQKYGPLVYCRLGSTPTITASSPQMIRELLWTQDETFASRPRTTAGKLMAYHDQDVGLAPYDAHWK

LMRRICVENLLTTRRMEGFQKSRAEEARDLVETMLKEAKAGNTINIREHLGGFTMNVITRMLIGKRYFGTESTGEKEATD

IRELLHEAVALIGVFFIPDHVPLLKWMDPKSYRHQFKKIGKRMDDYYSYIIEEHRKRQEVVDGPKDFVDVLLGENSELND

VEIKALIQDMVVGGTDTASFTMEWFMLEMIRNPKVMRKVQKEIDSVLEKKATNKHLVEESDLASLDYLKAAVKETFRMHP

VGGFLIPHESIRDTNVAGYHVPKGSLILINTHGLGRNSAVWDNVDEFRPERFLRTDDKVHLRDSEYRVIPFGSGKRACPG

AQLGQSMLLLGLGRLFHGFDWYPPPGMSTGDIDVMEAYGLTTPPRTPLRAVAKARLDESFYCLH*

 

>CYP703C1v2 SM1588295 N-term exon is identical to estExt_Genewise1Plus.C_80237|Selmo1

remove intron

C-term exon is new 78% to CYP703C1

MVVAALVCVVLVMLGRKENRNLPPGPPGWPIIGNLMQLGPLPHRTMAGWCQKYGPLVYCRLGSTPTITASSPQMIRELLWTQDETFASRPRTTAGKLMAYHDQDVGLAPYDAHWKLMRRICVENLLTTRRMEGFQKSRAEEARDLVETMLKEAKAGNTINIREHLGGFTMNVITRMLIGKRYFGTESTGEKEATDIRELLHEAVALIGVFFIPDHVPLLKWMDPKSYRHQFKKIGKRMDDYYSYIIEEHRKRQEVVDGPKDFVDVLLGENSELNDVEIKALIQ

VTKRSLLVPLYRKFFSQ

DMVVGGTDTASFTMEWFMLEMIRNPKVMRKVQKEIDSVLEKKVPHKPLVEESDLGSLDYLKAAVKETFRMHPVGGFLIPPGWIGDPKVAGYQVPKGLFIFINTHGVGRNTPVWGNVDGFRPGGFLRAGDKVPLRDFGYRVIPFGSGKGGGPGAQFGQWMFLLGLGGLLRGFDWFPPPGMSPGDIDVLEAFGLPTPPGIPLGAGAKFWVGGGFYSFP*

 

$$$$$$

 

>CYP703C2v2 estExt_Genewise1.C_80352|Selmo1 89% to CYP703C1

MSTVVDFLSSAQGWNAACMVAAALVCVVSV

MLGRKENRNLPPGPPGWPIIGNLMQLGPLPHRTMAGWCQKYGPLVYCRLGSTPTITASSPQMIRELLWTQDETFASRPRT

TAGKLMAYHDQNVGLAPYDAHWKLMRRICVEHLLTTRRMEGFQKSRAEEARDLVQIMFKEAKAGNTINMREHLGGYTMNV

VTRMLIGKRYFGTESMGEKEATDFRELIHAAIVLHGVFYIPDHVPLLKWIDPNGYRRLFKKMGKRMDDYYSYIVEEHRKR

QRNGEVVDGPKDFVDVLLGLAGENSELHLNDVEIKALIQDMVVGGTDTASFTMEWFMLEMIRNPKVMRKVQAELDSVLQK

KATNKHLLEESDLASLDYLRAAVKETFRIHPVGGFLIPHESIRDTKVAGYHVPKGSLILINTHGLGRNAAVWDNVDEFRP

ERFLRPEDKVHLRDSEYRVIPFGSGKRACPGAQLGQSMLLLGLGRLLHGFDWFPPPGTSREDIDVMEAYGLTTPPRTPLR

AVAKARLDQSFYSFH*

 

>CYP703C2v1 e_gw1.0.1187.1|Selmo1 89% to CYP703C1,

99% to estExt_Genewise1.C_80352|Selmo1 extend the N-term

MLGRKENRNLPPGPPGWPIIGNLMQLGPLPHRTMAGWCQKYGPLVYCRLGSTPTITASSPQMIRELLWTQDETFASRPRT

TAGKLMAYHDQNVGLAPYDAHWKLMRRICVEHLLTTRRMEGFQKSRAEEARDLVQIMFKEAKAENTINMREHLGGYTMNV

VTRMLIGKRYFGTESMGEKEATDFRELIHAAIVLHGVFYIPDHVPLLKWIDPNGYRRLFKKMGTRMDDYYSYIVEEHRKR

QRNGEVVDGPKDFVDVLLGLAGENSELHLNDVEIKALIQDMVVGGTDTASFTMEWFMLEMIRNPKVMRKVQAELDSVLQK

KATNKHLLEESDLASLDYLRAAVKETFRIHPVGGFLIPHESIRDTKVAGYHVPKGSLILINTHGLGRNAAVWDNVDEFRP

ERFLRPEDKVHLRDSEYRVIPFGSGKRACPGAQLGQSMLLLGLGRLLHGFDWFPPPGTSREDIDVMEAYGLTTPPRTPLR

AVAKARLDQSFYSFH*

 

$$$$$$

 

>CYP703D1v1 estExt_Genewise1Plus.C_71051|Selmo1 43% to 703B1, 45% to CYP703A2

MDSSVFQAIVAAFFLFLSLIHFLFFRPIRPGAKSNVDPGVKGRDRRQRLHLPPGPKPWPVIGNLLQIGPFPHKSMMEFTR

RHGPLVYLKLGVVPTIVTDSPAIIRDILIKQDHIFASRPENIACQYFTYNGRDIAFAPYGQHWRAMRKICTLELLSPRKI

ASFRDGRCQELDLMVESVFQDLGREEGSSPTTHKINLRDKFASLSCNILTRMLLGKRHFGPGAAGPEDAAEHKQMIYEGF

ALVNAFNVADYLPFLRAFDLQGHERKMRRIMQRADEVYDEIIEEHRQKLAKNSGGSCQEQQGASFVDVLLSVPGANGEKQ

LSTTTIKAIMIDMLSAGTDTSSVISEWAMAELARHPREMAKVREELDAAVGVDRPVDESDVVNLNYLKAVVKEIFRLHPV

GAFLIPHFSTEDTRIGGYDIPKNTRILVNTYSLGRSRSVWGDDVHLFRPDRFLASPGDLSSQIVELMDSECRVVPFGAGR

RSCPGASLGSCMVVMGLARLIQRFDWSAPPGEEIDVSERVGFTVLDKPLELVAKPRECVNF*

 

>CYP703D1v2 e_gw1.36.497.1|Selmo1 99% to estExt_Genewise1Plus.C_71051|Selmo1

MDSSVFQAIVAAFFLSLSLIHFLFFRPIRPGAKSNVDPGVKGRDRRQRLHLPPGPKPWPVIGNLLQIGPFPHKSMMEFTR

RHGPLVYLKLGVVPTIVTDSPAIIRDILIKQDHIFASRPENIACQYFTYNGRDIAFAPYGQHWRAMRKICTLELLSPRKI

ASFRDGRCQELNLMVESVFQDLGREDGSSPTTHKINLRDKFASLSCNILTRMLLGKRHFGPGAAGPEDAAEHKQMIYEGF

ALVNAFNVADYLPFLRAFDLQGHERKMRRIMQRTDEVYDEIIEEHRQKLAKNSGRSCQEQQGASFVDVLLSVPGANGEKQ

LSTTTIKAIMIDMLSAGTDTSSVISEWAMAELARHPREMAKVREELDAAVGVDRPVDESDVVNLNYLKAVVKEIFRLHPV

GAFLIPHFSTEDTRIGGYDIPKNTRILVNTYSLGRSRSVWGDDVHLFRPDRFLASPGDLSSQIVELMDSECRVVPFGAGR

RSCPGASLGSCMVVMGLARLIQRFDWSAPPGEEIDVSERVGFTVLDKPLELVAKPRECVNF*

 

$$$$$$

 

Ginkgo N-term seq EX934075

MNTSAEAINSDKLQAQYYPMMITVTVVAIVVGFSLRILKGSLRL

GLRLPPGPPGWPIVGNLLQLGPLPHRDFAALCEKYGPLVYLRLGNIDA

ITTNDPEIIREILLKQDDAFASRPKTIAATYLAYKSRDVAFAPLGKHWKHMRRICMEQL

 

>CYP703D2v1 fgenesh1_pm.C_scaffold_6000041|Selmo1 95% to estExt_Genewise1.C_560078|Selmo1

MDLAMGFFQDPVLRTDVVLYLPAFGHLQYL 

VLLGLLLLAYFSALKHNRLRFVSSSSSKDDSCSNK

NSNLAGLTLPPGP

MPWPIVGNLLQTSPIPHERMLAMNKRYGPLVFLKLGRVPAVVTDDPAIVKAILKNQDAVFASRPASIASQHFTYGGNDIA

FAPYGAHWRAMRRICTLELLAPRRLELFKQGREEEIALMARAVWTTSIRKSNNLARMLLGKRFFGPGVTGPRDGSEHRSL

IYDAFALVNAFNLADYLPFLRWLDVQGYEKKIKDIMNRTDRLYDAVIEEHRRKRTSAEKDGDSTTNKFVDVLLAQKGLSH

TVIKAILVDMAAAGTDTTSITSEWTMAELVRHPAVLSKVRDEIERVVGGRHRAVRESDLKHLTYLRAVVKEVLRLHPVGA

FLIPHVTVQDTELAGYFIPKNTRALINTYSLGRNPAVWDNPLEFRPERFLGDEESTTRSDREVEAAASSSLFDPEYRMVP

FGAGRRGCPGAALGTCMIMYGVSTLVHGFEWATPEGREIDVSPAYNSVILDKPLKLVPTPRLAEHVYH*

 

>CYP703D2v2 estExt_Genewise1.C_560078|Selmo1 43% to 703A2 in CYP71 clan

MPWPIVGNLLQTSPIPHERMLAMNKRYGPLVFLKLGRVPAVVTDDPAIVKAILKNQDAVFASRPASIASQHFTYGGNDIA

FAPYGAHWRAMRRICTLELLAPRRLELFKQGREEEIALMARAVTDSITENNIVELRHLFGSLASNNLARMLLGKRFFGPG

VTGPRDGSEHRSLIYDAFALVNAFNLADYLPFLRWLDVQGYEKKIKDIMNRTDRLYDAVIEEHRSKRTSAEKDGDSTTNK

FVDVLLTQKGLSHTVIKAILVDMAAAGTDTTSITSEWTMAELVRHPAVLSKVRDEIERVVGGRHRAVRESDLKHLTYLRA

VVKEVLRLHPVGAFLIPHVTVQDTELAGYFIPKNTRALINTYSLGRNPAVWDNPLEFRPERFLGDEESTTRSDREVEAAA

SSSLFDPEYRMVPFGAGRRGCPGAALGTCMIMYGVSTLVHGFEWATPDGGEIDVSPAYNSVILDKPLKLVPTPRLAEHVY

H

 

$$$$$$

 

>CYP703E1v1 fgenesh1_pm.C_scaffold_101000013|Selmo1, 98% to gw1.104.62.1|Selmo1

M V  E  I  P  Q  L  L  S  S  S  T  P  E  L  Y  L  K  L  A  V  A  G  S

L  L  V  L  L  L  L  L  L  N  L  P  S  S  R  G  A  R  R  K  S  S  S  S

S  S  S  S  G  S  S  S  S  S

SPPLPPGPRGWPIIGNLLDVGTVPHEGMMKLTRAYGPLVYLRLGAIPHVVSDDPAIIKEFLKIQDHIFASR

PGNVILAELLTYGGKDIGFAPYGAHWRNMRKICTLELFSAKSVDSFQRLRRMEMIHTLGLILDAAVDRRAVDLRDAFNGL

TSNMMTRMLLGKRYFGPGDPGPEVGAELKAMIAEGILMMNGFNISDYLPFLRFLDLQGQERRMKQIMRHIDGLATALLLE

LAPRIGKKPESFVDILVNLRGENGEPHLPEDVMKAVMVDMMAAGTDTPGVSCEWAMAELLRDPALLARVREEVDRVVCVD

RLVDESDLAHFRLLRAVLKESFRLHPVGAILIPHLAMEDAVVAGYGIPKDTRVLINVFALNRNAQVWERPHEFDPERHLR

GLGEGAVVEFGDPECRLIPFGSGRRMCPAASLGLTMVLLALANLVHAFDWEVPANLSMERAPGKMVKAQALTALARPRLP

RHLYSQQI*

 

>CYP703E1v2 gw1.104.62.1|Selmo1 40% to 703A2, CYP71 clan

M  V  E  I  P  Q  L  L  S  S  S  T  P  E  L  Y  L  K

L  A  V  A  G  S  L  L  V  L  L  L  L  L  L  N  L  P  S  S  R  G  A

R  R  K  S  S  S  S  S  S  S  S  G  S  S  S  S  S

SPPLPPGPRGWPIIGNLLDVGTVPHEGMMKLTRAYGPLVYLRLGAIPHVVSDDPAIIKEFLKIQDHIFASRPGNVILAELLTY

GGKDIGFAPYGAHWRNMRKICTLELFSAKSVDSFQRLRRMEMIHTLGLILDAAVDRRAVDLRDAFNGLTSNMMTRMLLGK

RYFGPGDPGPEVGAELKAMIAGGILMMNGFNISDYLPFLRFLDLQGQERRMKQIMRHIDGLATALLLELAPRIGKKPENF

VDILVNLRGENGEPHLPEDVMKAVMVDMMAAGTDTPGVSCEWAMAELLRDPALLARVREEVDRVVSVDRLVDESDLAHFR

LLRAVLKESFRLHPVGAILIPHLAMEDAVVAGYGIPKDTRVLINVFALNRNAQVWERPHEFDPERHLRGLGEGAVVEFGD

PECRLIPFGSGRRMCPAASLGLTMVLLALANLVHAFDWEVPANLSMERAPGKMVKAQPLTALARPRLPHHLYS

 

$$$$$$

 

>CYP797D1v1 e_gw1.5.245.1|Selmo1 98% to e_gw1.33.70.1|Selmo1 CYP71 clan

MATIFGGVLVFLVLFFLTKRLSFTRQRLPPSPLSLPLIGHLHLLTRMAHQSLQVLSNKYGPILYLKLGMVPTIVVSSPDM

AREILKTHDAKFSSRPYFLVGEYFSYGYCGMGFTSGGEHWKNLRKLCATELFTINRIDSFEWVRKEEISRMISTIENTTG

VINMRNLLITYGFNVMTETVMSKRFFCENGALLDADQAREFKKVSIETVEMALKFHISEFVPSYLRWIDWNIPKVKILQA

KSDKFMQQIVQEHKRSKNSRKTKDFMDVLLESFTDSSNKQSLKAENTVKALTMELLAGGTDTSASSIEWALMELLLNPHT

MVKAREELVKFVDLTNSTVNEGDLPKLTYLNAVIKETMRLHPPAPLLVPHKSTVECKIAGFDIPKGTTTIVNLYAIGRDP

NVWENPTKFCPERFLGDSRIDVKGQNFELIPFGSGRRTCPGMILGLRNVQLVLANLIHRFEWALIPGREYGVEETTGTVN

WAKTPLEVLKR*

 

>CYP797D1v2 e_gw1.33.70.1|Selmo1 38% to 75B1, 41% to 92A9

MATIFAGVLVFLVLFVLTKRLSFTRQRLPPSPLSLPLIGHLHLLARMAHQSLQVLSNKYGPILYLKLGMVPTIVVSSPDM

AREILKTHDAKFSSRPYFLVGEYFSYGYCGMGFTPGGEHWKNLRKLCATELFTINRIDSFEWVRKEEISRMISTIENTNG

VINIRNLLITYGFNVMTETVMSKRFFCENGALLDADQAREFKKVSIETVEMALKFHISEFVPSYLRWIDWNIPKVKILQA

KSDKFMQQIVQEHKRSKNSRKTKDFMDVMLESFTDSSNKQSFKAENTVKALTMELLAGGTDTSASSIEWALMELLLNPHT

MVKAREELVKFVDLTNSTVNEGDLPKLTYLNAVIKETMRLHPPAPLLVPHKSTVECKIAGFDIPKGTTTIVNLYAIGRDP

NVWENPTKFCPERFLGDSRIDVKGQNFELIPFGSGRRTCPGMILGLRNVQLVLANLIHRFEWALIPGREYGVEETTGTVN

WAKTPLEVLKR*

 

$$$$$$

 

>CYP797E1v2 e_gw1.125.9.1|Selmo1 40% to 92A9, CYP71 clan

MEFPVYLLVALVVCFLGRSLLQSRKRLPPSPWGLPLIGHVHHLSRLPHQSLQNLSRKLGGIMYLRLGMTPAIVISSPDLA

KEALRSNDSSFGFRPYLLVGEYLTYNFKGIGLSNGDHWKNMRKICITELFSVKRMESFRGLRLAEVSHLVSRLAQASKSQ

SVVNVRELVTDFNFNIHLTVLTFNVQTRILMSKRFFGENLSDDELAEARVFKELIDESVKFAFQFHISEFVPSWLKWIDW

NIPQAKRVAAKQDEFLQKIIDEHKAKKSRPTKDFMDILLEQRGDDQEVVKAILMSFAQEILIAGMDTSACTVEWALLELV

HNPEVMKKAQEELDVVVGRNRMVTETDFSKLTYLEAVIKETLRLHPPVPILVPHMSNKACVLAGFDVPKGATTIINFYSI

SRDPNVWEHPTKFWPERFGQITADVKGQDFELIPFGAGRRMCPGMSLGLKTVHLVLSNLLHSFHWERVPGESYNLDEGVG

SVTWPKSPLQAQLTPRLRNLDVIFNFAQ*

 

>CYP797E1v1 e_gw1.43.465.1|Selmo1 91% to e_gw1.125.9.1|Selmo1 with some indels

extend it

MKELSYLVSSLAQACNDQSIVDVREHLTVLTFNVQTRILMSKRFFGENLSDDELAEARVFKELIDESVQFAFQFHISEFV

PSWLKWIDWNIPQAKRVAAKQDEFLQKIMDEHKAKKSSPTKDFMDILLEHRGDDQEVVKATLMEILIAGMDTSACTVEWA

LLELVNNPEVMKKAQEELDVVVGRNRMATETDFSKLTYLEAVIKETLRLHPPVPILVPHMSNRACVLAGFDVPKGATTII

NFYSISRDPNVWEHPTKFWPERFGQITADVKGQDFELIPFGAGRRMCPGMSLGLKTVHLVLSNLLHSFHWERVPGESYNL

DEGVGSVTWPKSPLQAQLTPRLRNLDVIFNFAQ*

 

 

>fgenesh2_pg.C_scaffold_70000128|Selmo1 76% to e_gw1.43.465.1|Selmo1

MSSLAQACKDRSVVDLREHLTVFAFNVQTRVLMSKRFLGKNLSGDELEEAKVFKELIDESVKFSLQFHISEFVPSWLKWI

DWNIPQAKRVAAKQNEFLQKIIDEHKVNKSRPTMDFMDILLEHRGGDHEVVRATLMNSHVATQEAAPSPWLRSNDSPISS

WGCYVMPCVTDAHTMLAAVWMAIMAGYLESISSKDFDSSDLRKNSTHGVMGYIEARDEAKAVEAFASMRHEESFSLRL*

 

$$$$$$

 

>fgenesh2_pg.C_scaffold_23000207|Selmo1 44% to e_gw1.125.9.1|Selmo1

fragmented, pseudogene?

MPPMSRSSSITWPSFSLVPMFNFILERSKGSGSWKTLSFFSDAARQLAKGSIFSLSSGHGGRTIFQTVPISLALAELEMM

GVAIVGATFLALSRGGRQHLLAAPGFIRHNSYIEAAFPRKLHGVVSLIDSGCHHTVGDMQWGDVAWVPYLYPTAPLERPE

PASRILELPPAQ

MGVYVLSTIAIAIAIFLWKLSVRPKLRLPPSPLGIPLIGHLAHLAGKDAHITLQRLSNKLGPILFLRLG

WT

 

LARESSENGVVDVRKLVSIFIFNIITQIVMSKRFLGTGDCEESREFKEIVAGIVDVALQFHVADFVPERLRW

IDWTV

PQLKRLAAKKDKFFQRIVDEHKAARLQANAVEDFTHVMLTNYADDEELIKAMVQCIVKETLRRHPPVPLLVPHMSTQACK

VETPLLKAVATPKLSKDAY*

 

$$$$$$

 

 

$$$$$$

>gw1.133.17.1|Selmo1 49% to e_gw1.43.465.1|Selmo1 mid region

IIAAGSDTSSCALLDLLNNPDVMTKLQEELGAVVANQMVTEYDFLNLPYLRAVVKETVRLHAFTPLLLPRMSTQDCVLAG

YNVPKDATTIV

 

$$$$$$

 

>CYP795A1v1 e_gw1.2.767.1|Selmo1 97% to e_gw1.2.766.1|Selmo1

MEFLVGFAILLILVVFSSVFYLRVASQSPSLPTPLPIIGHLYLLGKLPHHSLLAIARKYGPLVQLRLGSVPVVIASSPEM

AREFLRNQDLTFASRPTLLTTKYILYDSKDMVFAPYGEHWRSMRKLCVVELLTDRRLASSQQARLEELQRLLAKIAKVVE

TSEPFLLLDLLTEFTFNVITRMVMNKAYFGSGETMEELAATRDFIHMQEQGTILLGEFHIGDYIPFLKWFDSSVAKMKAL

HKIQDEFPQKVVDQHVLARQSREQTQAHDGDGDFVDTLLSLDSPDPNNQARNIKALIQNLLGAGTDTSITTIQWAMAELL

NNPRALEKAQEELRAKFGNARQEIIQEHELKDLPYLHAVIKETFRLHPPAPLLIPHQSTQDTTVAGLAIAKGTRLFVNVY

AIGRDPALWKSPDDFLPERFLGSSIDVHGKNFELLPFGSGRRGCPGMALGLITVQLALANLLHRFQWSLAPGVDAHPMAE

CFGVVTTMEIPLRARASPNKD*

 

>CYP795A1v2 e_gw1.2.303.1|Selmo1 97% to e_gw1.2.766.1|Selmo1

MEFLVGFAILLILVVFSSVFYLRVASQSPSLPTPLPIIGHLYLLGKLPHHSLLAIARKYGPLVKLRLGSVPVVIASSPEM

AREFLRNQDLTFASRPTLLTTKYILYDSKDMVFAPYGEHWRSMRKLCVVELLTDRRLASSHQARLEELQRLLAKIAKVAE

TSKPFVLLDLLTEFTFNVITRMVMNKAYFGSGETTEELAATRDFIHMQEQGTILLGEFHIGDYIPFLKWFDSSVAKMKAL

HKIQDEFLQKVVDQHVLARQSREQTQAHDGGGDFVDTLLSLDSPDPNNQARNIKALIQNLLGAGTDTSITTIQWAMAELL

NNPRALEKAQEELRAKFGNARQEIIQEHELKDLPYLHAVIKETFRLHPPAPLLIPHQSTQDTTVAGLAIAKGTRLFVNVY

AIGRDPALWKSPDDFLPERFLGSSIDVHGKNFELLPFGSGRRGCPGMALGLITVQLALANLLHRFQWSLAPGVDAHPMAE

CFGVVTTMEIPLRARASPNKD*

 

>CYP795A2v1 e_gw1.2.766.1|Selmo1 40% to 703A2, 43% to 92A11, CYP71 clan

MEFLVGFAILLILVVFSSVFYLRVASQSPSLPTPLPIIGHLYLLGKLPHHSLLAIARKYGPLVQLQLGSVPVVIASSPEM

AREFLRNQDLSFASRPTLLTTKYILYDSKDMVFAPYGEHWRSMRKLCVVELLTDRRLASSQQARLEELQRLLAKIAKVAD

TSEPFVLLDLLTEFTFNVITRMVMNKAYFGSGETTEELAATRDFIHMQEQGTILLGEFHIGDYIPFLKWFDSSVAKMKAL

HKIQDEFLQKVVDQHVLARQSREQTQAHDGDGDFVDTLLSLDSPDPNNQARNIKALIQNLLGAGTDTSITTIQWAMAELL

NNPRALEKAQEELRAKFGNARQEIIQEHELQDLPYLHAVIKETFRLHPPAPLLIPHQSTQDITVAGLAIAKGTRLFVNVY

AIGRDPALWKSPDDFLPERFLGSSIDVHGKNFELLPFGSGRRGCPGMVLGLITVQLALANLPHRFQWSLAPGVDAHPMAE

CFGVATTMEIPLRVRASPNKN*

 

>CYP795A2v2 e_gw1.2.292.1|Selmo1 97% to e_gw1.2.766.1|Selmo1

MEFLVGFAILLILVVFSSVFYLRVASQSPSLPTPLPIIGHLYLLGKLPHHSLLAIARKYGPLVKLRLGSVPVVIASSPEM

AREFLRNQDLTFASRPTLLTTKYILYDSKDMVFAPYGEHWRSMRKLCVVELLTDRRLASSHQARLEELQRLLAKIAKVAE

TSKPFVLLDLLTEFTFNVITRMVMNKAYFGSGETTEELAATRDFIHMQEQGTILLGEFHIGDYIPFLKWFDSSVAKMKAL

HKIQDEFLQKVVDQHVLARQSREQTQAHDGVGDFVDTLLSLDSPDPNNQARNIKALIQNLLGAGTDTSITTIQWAMAELL

NNPRALEKAQEELRAKFGDARQEIIQEHELQDLPYLHAVIKETFRLHPPAPLLIPHQSTQDATVAGLAIAKGTRLFVNVY

AIGRDPALWKSPDDFLPERFLGSSIDVHGKNFELLPFGSGRRGCPGMALGLITVQLALANLLHRFRWSLAPGVDAHPMAE

CFGVVTTMEIPLRARASPNKD*

 

>fgenesh2_pg.C_scaffold_2000295|Selmo1 98% to e_gw1.2.766.1|Selmo1

MRKLCVVELLTDRRLASSQQARMEELQRLLAKIAKVAETSEPFVLLDLLTEFTFNVITRMVMNKAYFGSGETTEELAATR

DFIHMQEQGTILLGEFHIGDYIPFLRWFDSSVAKMKALHKIQDEFLQKVVDQHVLARQSREQTQAHDGDGDFVDTLLSLD

SPDPNNQARNIKALIQRKKPAWISKALYSF*

 

$$$$$$

>CYP783A1v1 e_gw1.57.83.1|Selmo1 37% to 75B1, CYP71 clan

MEGAWFLALALLILLWWSRNLRARLKLPPGPFPWPIVGSLFIVKEPLPIFFAELGRKYGPVVYFKLGMVPTVAINSAAAA

REVLKSRDLEFASRPDLGNLRQISFDYNDLGVAPYGETWKLMRRVSATHLFTPSKLNTTASVRHREVKAMIKNILDEGPE

VVDLTAATNAAVVQGVVNLLVGTDDKSLGIDARSLNGIFEKAGEELLNVNLGDLFPFLRRFDVQGLERRFKYVVMPPIKS

LMEKIIAHHKSSSREVEDFVDVLVNLNGEDGLTHIQTIGLLSDFFIAGINTSQTSIDFTLAELVRHPAILSRAQKEIDQV

VGSSRLVQESDLPRLPYLHAVIKESLRLHPPLPLLLPHHNPAASKIGEYDIPAKSTIFVNAWAIGRDPSTWDRPLEFVPE

RFLERDVKLTGDDFSLLPFGAGRRTCAGYLMAMRMLPLSVATVIQAFDLATLEGREVDMGESTGGATRRNKNLMVSATPR

LAKELYA*

 

>CYP783A1v2 e_gw1.83.45.1|Selmo1 99% to e_gw1.57.83.1|Selmo1

MEGAWFLALALLILLWWSRNLRARLKLPPGPFPWPIVGSLFIVKEPLPIFFAELGRKYGPVVYFKLGMVPTVAINSAAAA

REVLKSRDLEFASRPDLGNLRQISFDYNDLGVAPYGETWKLMRRVSATHLFTPSKLNTTASVRHREVKAMIKNILDEGPE

VVDLTAATNAAVVQGVVNLLVGTDDKSLGIDARSLNGIFEKAGEELLNVNLGDLFPFLRRLDVQGLERKFKYVVMPPIKS

LMEKIIAHHKSSSREVEDFVDVLVNLNGEDALTHIQTIGLLSDFFIAGINTSQTSIDFTLAELVRHPAILSRAQKEIDQV

VGSSRLVQESDLPSLPYLHAVIKESLRLHPPLPLLLPHHNPAASKIGEYDIPAKSTIFVNAWAIGRDPSTWDRPLEFVPE

RFLERDVKLTGDDFSLLPFGAGRRTCAGYLMAMRMLPLSVATVIQAFDLATLEGREVDMGESTGGATRRNKNLMVSATPR

LAKELYA*

 

$$$$$$

 

>CYP785A1v1 estExt_Genewise1.C_830110|Selmo1 37% to 75B1 CYP71 clan

same as Jing-Ke SM1583054 100%

MDLLSLPSLSALVLLAAALWCSSTRRRNPPGNLPPGPLNLPVIGCLHKLGSLPHISLHKLSKRYGDVMHLKLGSVSTVII

SSERAAREIFKRHGLEFASRAPLICGKYFGNDYSGLVFSQYTPEVKLYRKLINTHLLSPTKLKSYDGIRREEQRRLARSL

SDDRGNPVLLRQKLHIMNMNVITYMLFGKHFCGHYKNTANVDEFVQTVVEMVRLAGIFNVSDYIPGIRWLDVQGLEKKYK

QLMNQVNWHLLGILRDRLVDPPVFTSEEPMSFIDVLISMGEKLSDTTKITLLLDVLMGAVDTSALSLEWAMAELLRHPAE

FSRVQSQIDTIVGKKKLVDESDIAKLPYVEAIAKETMRLRSVVPLGLPKIVQGGPIELDGYTLPNGTVIYISSYSIGLDE

RFWKDPLEFRPQRFIDLPDIDVFGQNFNLLPFGTGRRVCPGAKLGFDAVQMGIATLVQGFDWKLDGDLDDPAKLNMDQTF

GLVCQKSQPLVAIPIPRLDSHVY*

 

>CYP785A1v2 fgenesh2_pg.C_scaffold_57000020|Selmo1 95% to estExt_Genewise1.C_830110|Selmo1

MDLLSLPSLSALVLLAAALWFSSSRRRNPPGNLPPGPLNLPVIGCLHKLGSLPHISLHKLSKRYGDVMHLKLGSVSTLII

SSERAAREIFKRHGLEFASRAPLICGKYFGNDYSGLVFSQYTPEVKLYRKLINTHLLSPTKLKSYDGIRREEQRRLARSL

SDERGNPVLLRQKLHNMNMNVITYMLFGKRFCGHYKNTANVDEFVQTVVEMVRLAGIFNVSDYIPGIRWLDVQGLEKKYK

QLMNRANRHLLGILRDRRGDPPVFTSEEPMSFIDVLISMGEKLSDTTKITLLLDVLMGAVDTSALSLEWAMAELFRHPAE

FLKVQNQIDSIVGKEKLVDESDIAKLPYVEAIAKETMRLRSVVPLALPKIVQGGPIELDGYTLPDGTVIYISSYSIGLDE

RFWKDPLEFRPQRFIDLPDIDVFGQNFNLLPCGSGRRVCPGAKLGFDAVQMGIAALVQGFDWKLDGDLDDPAKLNMDQTF

GLVCQKSQPLVAIPIPKLDSHVY*

 

>SMCN1 CYP785A2 Jing-Ke 91% to fgenesh2_pg.C_scaffold_57000020|Selmo1

new not in JGI downloaded set

MDLLSHPILSALVLLAAALWFSSTRRRNPPGNLPPGPLNLPVIGCLHKLGSLPHISLHKLSKRYGDVMLLKLGSVPTVIISSERAARDIFKRHGLDFASKAPPMCGKYFGNDYSGLVFSQYTPEVKLYRKLINTHLLSPTKLKAYDGIRREEQRRLARSLSDERGNPVLLRQKLHDMNMNVITYMLFGKRFCGHYKNTANVDEFAQAIVETVRLAGIFNVSDYIPGIRWLDVQGLEKKYKQLMNRANRHPLSILRGQQGDPPVFTSEEPMAFIDVLISMGEKLSDTTKITLLLDVLMGAVDTSALSLEWAMAELLWHLVEFTRAQSQINIIVGKKNLVNELDITKLPYVKAIAKETVRLQSVAPLALPKIVQGGPIELDGYTLPDGTVIYISSYSIGLDERFWKDPLEFRPQRFIDLPDIDVFGQNFNLLPCGSGRRVCPGAKLGFDAVQMGIAALVQGFDWKLDGDLDDPAKLNMDQTFGLVCQKSQPLVAIPIPKLDSHVY*

 

>CYP785A3v1 e_gw1.57.197.1|Selmo1 93% to estExt_Genewise1.C_830110|Selmo1

MDLLSLPSLSALVLLAAALWFSSTRRRNPPGNLPPGPLNLPVIGCLHKLGSLPHISLHKLSKRYGDVMHLKLGSVSTVII

SSERAAREIFKRHGLEFASKAPLICGKYFGNDYNGLVFSQYTPEVKLYRKLINTHLLSPTKLKIYDGIRREEQRRLARSL

SDERGNPVLLRQKIHDMNMNVITYMLFGKRFCGHYKNTANVDEFVQAIVEMVRLAGIFNVSDYIPGIRWLDVQGLEKKYK

QLMDRVNRHLLSILRDRRGDPPVFTSDEPMAFIDVLISMGEKLSDTTKITLLLDMLLGAVDTSAISLEWAMAELFRHPIE

FSRAQNQIDAIVGKEKLVDESDIAKLPYIEAIAKETMRLRSVAPLALPKIVQGGPIELDGYTLPDGTVIYISSYSIGLDE

RFWKDPLEFRPQRFIDLPDIDVFGQSFNLLPFGTGRRVCPGAKLGFDAVQMGIATLVQGFDWKLDGDLDDPAKLNMDQTF

GLVCQKSQPLVAIPIPRLDSHVY*

 

>CYP785A3v2 fgenesh2_pg.C_scaffold_83000058|Selmo1 94% to estExt_Genewise1.C_830110|Selmo1

MDLLSLPSLSALVLLAAALWFSSTRRRNPPGNLPPGPLNLPVIGCLHKLGSLPHISLHKLSKRYGDVMHLKLGSVSTVII

SSERAAREIFKRHGLEFASKAPLICGKYFGNDYNGLVFSQYTPEVKLYRKLINTHLLSPTKLKIYDGIRREEQCRLAQSL

RDERGNPVLLRQKIHDMNMNVITYMLFGKRFCGHYKNTANVDEFVQAIVEMVRLAGIFNVSDYIPGIRWLDVQGLEKKYK

QLMDRVNRHLLSILRDRRGDPPVFTSEEPMSFIDVLISMGEKLSDTTKITLLLDMLLGAVDTSALSLEWAMAELLQHPVE

FSRAQSQIDTVVGKEKLVDESDIAKLPYVEAIAKETMRLRSVAPLALPKIVQGGPIELDGYTLPDGTVIYISSYSIGLDE

RFWKDPLEFRPQRFIDLPDIDVFGQSFNLLPFGTGRRVCPGAKLGFDAVQMGIATLVQGFDWKLDGDLDDPAKLNMDQTF

GLVCQKSQPLVAIPIPRLDSHVY*

 

>fgenesh2_pg.C_scaffold_7000376|Selmo1

92% to fgenesh2_pg.C_scaffold_83000058|Selmo1

MDLLSHPILSALVLLAAALWFSSTRRRNPPGNLPPGPLNLPVIGCLHKLGSLPHISLHKLSKRYGDVMHLKLGSVPTVII

ISERAAKEIFNRHGLEFASKAPLICGKYFGNDYNGNPVLLLQKIHDMNMNVIIYMLFGKRFCGHYKNTANVDEFVQAIAE

TVRLAGIFNVRDYIPGIRWLDVQGLEKKCKQLMNRVNRHHLSILRDRRGDPPVFTSEEPMAFIDVLISMGEKLPDTTKIQ

LLLPQCFIDLPDIDVFGQSFNLLPFGTGRRVCPGAKLGFDAVQMGIAMLVQGFDWKLDRILMIRQS*

 

>CYP785A4v1 e_gw1.57.90.1|Selmo1 38% to 75B1 in the CYP71 clan,

99% to estExt_fgenesh2_pg.C_3360001|Selmo1, missing N-terminal

MDLLSLPSLSALVLLAAALWFSSTRRRNPPGNLPPGPLNLPVIGCLHKLGSLPHISLHKLSKRYGDVMHLKLGSVSTVII

SSERAAREIFKRHGLEFASRAPLICGKYFENDYNGLVFSQYTPEVK

LYRKLINTHLLSPTKLKVYDGIRREEQCRLARSLSYERGNPVLLRQKLHNMNMNVITYMLFGKRFCGHHKNTANVDE

FVQAIVETVRLAGVFNVSDYIPGIRWLDVQGLEKKYKQLMDRINRHLLSILRDRQEDPPVFTSDEPMAFIDVLISMGEKL

SNTTKITLLLDILLGAVDTSALSLEWAMAELLRHPAEFSRARSQIDAIVGKEKLVDESDIAKLPYVEAIAKETMRLRSVA

PLALPKIVQGGPIELDGYTLLDGTVIYISSYSIGLDERFWKDPLEFRPQRFIDLPDIDVFGQNFNLLPFGTGRRVCPGAK

LGFDAVQMGIATLVQGFDWKLDGDLDDPAKLNMDQTFGLVCQKSQPLVAIPIPRLDSHVY*

 

>CYP785A4v2 estExt_fgenesh2_pg.C_3360001|Selmo1 93% to estExt_Genewise1.C_830110|Selmo1

2 aa diffs to SM1583284 from Jing-Ke

MDLLSLPSLSALVLLAAALWFSSTRRRNPPGNLPPGPLNLPVIGCLHKLGSLPHISLHKLSKRYGDVMHLKLGSVSTVII

SSERAAREIFKRHGLEFASRAPLICGKYFENDYNGLVFSQYTPEVKLYRKLINTHLLSPTKLKVYDGIRREEQCRLARSL

SYERGNPVLLRQKLHNMNMNVITYMLFGKRFCGHHKNTANVDEFVQAIVETVRLAGVFNVSDYIPGIRWLDVQGLEKKYK

QLMDRINRHLLSILRDRQEDPPVFTSDEPMAFIDVLISMGEKLSNTTKITLLLDILLGAVDTSALSLEWAMAELLRHPAE

FSRARSQIDAIVGKEKLVDESDIAKLPYVEAIAKETMRLRSVAPLALPKIVQGGPIELDGYTLLDGTVIYISSYSIGLDE

RFWKDPLEFRPQRFIDLPDIDVFGQNFNLLPFGTGRRVCPGAKLGFDAVQMGIATLVQGFDWKLDGDLDDPAKLNMDQTF

GLVCQKSQPLVAIPIPRLDSHVY*

 

>CYP785A5v1 estExt_fgenesh2_pg.C_570026|Selmo1 92% to estExt_Genewise1.C_830110|Selmo1

MDLLSLPSLSALVLLAAALWFSSTRRRNPPGNLPPGPLNLPVIGCLHKLGSLPHISLHKLSKRYGDVMHLKLGSVSTVII

SSERAAREIFKRHGLEFASRAPLICGKYFENDYSGLVFSQYTPEVKLYRKLINTHLLSPTKLKVYDGIRREEQCRLARSL

SYERGNPVLLRQKLHNMNMNVITYMLFGKRFCGHHKNTANVDELAGVFNVSDYIPGIRWLDVQGLEKKYKQLMDRINRHL

LSILRDRQGDPPVFTSDEPMAFIDVLISMGEKLSDTTKITLLLDILLGAVDTSALSLEWAMAELLRHPAEFSRARSQIDA

IVGKEKLVDESDIAKLPYVEAIAKETMRLRSVAPLALPKIVQGGPIELDGYTLLDGTVIYISSYSIGLDERFWKDPLEFR

PQRFIDLPDIDVFGQNFNLLPFGTGRRVCPGAKLGFDAVQMGIATLVQGFDWKLDGDLDDPAKLNMDQTFGLVCQKSQPL

VAIPIPRLDSHVY*

 

>e_gw1.36.361.1|Selmo1 92% to e_gw1.57.197.1|Selmo1

HCKLGSLPHISLHKLSKRYGDVMLLKLGSVPTVIISSERAARDIFKRHGLDFASKAPPMCGKYFGNDYNGLVFSQYTPEV

KLYRKLINTHLLSPTKLKAYDGIRCEEQRRLARSVSDE*

 

$$$$$$

 

>gw1.60.167.1|Selmo1

ISQDLLLGALATSALSLEWAMADLLRNRRVLGSEPDRCKEKLVDESDIAKLPYIKAIAKETLRLLAQLALPNIVQGGPIK

LRGYTIPDDTTIYINTYWIAMDERFWKDPLEFRPQCFMPDIDAFGHGRRICPGAKL

 

>gw1.0.1002.1|Selmo1 98% to gw1.60.167.1|Selmo1

76% to e_gw1.57.197.1|Selmo1

EKLVDESDIAKLPYIEAIAKETLRLLAQLALPNIVQGGPIKLRGYTIPDDTTIYINTYWIAMDERFWKDPLEFRPQCFMP

DIDAFGHGRRI

 

$$$$$$

 

>CYP785A6v1 e_gw1.57.80.1|Selmo1 36% to CYP75B1, CYP71 clan

MLLVLTFISLWFLLASLTRRRNLGKLPPGPFNLPVIGCLHMLGSLPHISLHKLSQKYGDVMYLKLGIKPTVIISSGRAAR

EIVKLHNLKFASKVPLISGKYFGNDYSGIAFSQYTPEVKLYRKLINTHLLSPTKLKIYDGIRREEQRRLARSLSDERGNP

VLLRQKLHNMNMNVITYMLFGKRFCGHYNNTVNVDEFVQVIVDILRLAGVFNVSDYIPGIRWLDVQGLEKQYKHLMDRVN

RHLLSILQDRRVNPPVFTSEEPIAFIDVLISMEEKLSDITIISLLLDLLLGAVDTSALLLEWAMAELFRHPVEFSRAQSQ

IDAVVGKEKLVDESDILKLPYIDAIVKETMRLRSVAPLSLPKQVQGGPIKLSGYTIPDGTTIYINSYSIGIDERFWKDPL

EFQPQRFFDLPDVDVFGHNFNFLPFGTGRRVCPGAKLGFDAVQIGLATLVQGFDWKLDAPGNMNMDQTFGLVCHKSQPLV

GIPVPRLDSHVY*

 

>CYP785A6v2 e_gw1.83.39.1|Selmo1 97% to e_gw1.57.80.1|Selmo1

MLLVLTSIPLWFLLASLTRRRNLGKLPPGPFNLPVIGCLHMLGSLPHISLHKLSQKYGDVMYLKLGTRSTVIISSGRAAR

EIVKLHNLKFASKVPLISGKYFGNDYSGIAFSQYTPEVKFYRKIINTHLLSPTKLKIYDGIRHEEQRRLARSLSDERGNP

VLLRQKLHNMNMNVITYMLFGKRFCGHYNNTVNVDGFVQVIVDILRLAGVFNVSDYIPGIRWLDVQGLEKQYKHLMDRVN

RHLLSILQDRRVNPPVFTSEEPIAFIDVLISMEEKLSDITIISLLLDLLLGAVDTSALLLEWAMAELFRHPVELSRAQIQ

IDAVVGKEKLVDESDILKLPYIDAIVKETMRLRSVAPLSLPKQVQGGPIKLSGYTIPNGTTIYINSYSIGIDERFWKDPL

EFQPQRFFDLPDVDVFGHNFNFLPFGTGRRVCPGAKLGFDAVQIGLATLVQGFDWKLDAPGNMNMDQTFGLVCHKSQPLV

AIPVPRLDSHIY*

 

$$$$

 

>fgenesh2_pg.C_scaffold_42000190|Selmo1

C-term of CYP75B like enzyme (possible gene fusion)

76% to e_gw1.88.42.1|Selmo1

MAELLRHPAAMCQVQHKIDAVVGRNRVVGLNFLHAIVKESLRLHPPSPVILYESTMPWLSAACQCLRNLQGCQFVGEGAG

FPAGVIRGGREEGRDVRGQNFELIPFGSGWRI

RDGDRTPDGAVRAGEAAARIRLGESGRDRHEGEIWARHAKARPSPGNP

MPQEVRGKEVFTSPRWASIADCASSRTLAFESVRSFNRDPHVKIDMQPHKDAVMLSPHKYVGGPETPGLLCMNKKLNKLQ

GSRTVDNRRLRQLQQRGHRKPRRRWNTFHTPADKTGMVSGYRLIESREQSLITTTLIVRSTQVKRTAVVSFLVRTTDSKD

ELQQTVPQGRFVAKLLNNLFGRRCRSLADDLSLKFRAAIQEEYSGVKPGRTRLNFAYFPKEEFLCTVEFVADYAQRFLPL

YEFDRQWELEIQGGEQHQYHGNGPKSAQGIPGHRHGDPKAASTQSKASTAGIDTELPPRGDDQALENSTQCRPPSLLNPT

LLKDPWVQSSGFLQGISVWQAT

 

$$$$$$

 

>CYP797A1v1 e_gw1.45.108.1|Selmo1 99% to e_gw1.63.102.1|Selmo1 = Jing-Ke SM147.5 100%

MEHFDLALYLGLILLAGALWRQYRSFKVRLPPGPRGLPLIGHLHLLSTLPHRSLQKLSQAHGPLMHLRFGTVPVIVASSP

AMAKEVLKTHDLAFASRPYLLVGEYAAYNFHNIGLAPYGDHWKMMRKLCSTELFTAKRIDSFSWVRVEELSGMVSGLLAK

SASKEVVQIKSFLTDFTFNVMTRILMDRAFFGPAGADSQGKAREFRGIVEEILQVAGSFNVSEYIPSAFKWIDWNIPRFK

RLHARQDRFLQEIIDEHKVGHDALAKPRDFIDILLSYFNHGDSRIDLDNIKAVLSDLLPGGTDTSITTVEWILAELLRNP

LALKKAQDELDAVVGKDRMVNESDFPKLHYLHAIIKETFRLHPPIALLVPHMSRYECKVAGYDVPKGATTLVNVYAIGRD

PTVWEDPTRFSPDRFLEGAGKGMDVRGQDFELLPFGSGRRSCPGLQLGLKTVELALSNLVHGFDWSFPNGGGGKDASMDE

AFGLVNWMATPLRAVVAPRLPPHAYEKV*

 

>CYP797A1v2 e_gw1.63.102.1|Selmo1 44% to CYP75B1, 44% to 92A9, CYP71 clan, 45% TO 736A12, 45% to CYP764 Panax

MELFDLALYLGLILLAGALWRQYRSFKVRLPPGPRGLPLIGHLHLLSTLPHRSLQKLSQAHGPLMHLRFGTVPVIVASSP

AMAKEVLKTHDLAFASRPYLLVGEYAAYNFHNIGLAPYGDHWKMMRKLCSTELFTAKRIDSFSWVRVEELSGMVSGLLAK

SASKEVVQIKSFLTDFTFNVMTRILMDRAFFGPAGADSQGKAREFRGIVEEILQVAGSFNVSEYIPSAFKWIDWNIPRFK

RLHARQDRFLQEIIDEHKVGHDALAKPRDFIDILLSYFNHGDSRTDLDNIKAVLSDLLPGGTDTSITTVEWILAELLRNP

LALKKAQDELDTVVGKDRMVNESDFPKLHYLHAIIKETFRLHPPIALLVPHMSRYECKVAGYDVPKGATTLVNVYAIGRD

PTVWEDPTRFSPERFLEGAGKGMDVRGQDFELLPFGSGRRSCPGLQLGLKTVELALSNLVHGFDWSFPNGGGGKDASMDE

AFGLVNWMATPLRAVVAPRLPPHAYEKV*

 

$$$$$$

 

>CYP790D1v1 SM1585879 42% to e_gw1.63.102.1|Selmo1 new Jing-Ke not in JGI downloaded set

MLEMILTIVLTLALILVVLFCTNKRNQSLPPSPRALPIIGHIHLVGKKLPHEYLFRLAKQHGGLMYLQLGRIKTLVASTPAAAEEVLKTHDRAFASRPANSAAKYFGYDATDLVWAPYGDHWRHLRKICTLEFFITKRVQMFQPVRKLEMSMLITELVEACNQRRPVDMTSRFFQFAFNTMSRMVLNKSISDASGSESEKLKEFLNNLNEASKVGNGLQIGDLIPCLSWADPKVFRIKWLQTQLVNYLGEQLQEHKKNRESHDEVKDFMDVLIAGGVLDDTRIKALTSDMLAAGTDAIAVTIDWALAELMRNPELMQEVKQELEEVVGSKGTVEEEHIPKLEFLQAIVKETLRLHPPAPLLAPHESVESCNIWGYNIPAGTGLLVNAYALGRDESTWSEANKFNPKRFLETKSDVQVTGQNFELIPFGSGRRMCPALSMGLTMVHYALATMLHTFEWSLPDGKDEVNMKAYFGIVLIREEPLMLVPRLAKSCP*

 

>CYP790D1v2 SM1585879_2 has 5 aa diffs to CYP790D1

scaffold_169

32804-34344

MLEMILTIVLTLALILVVLFCTNKRNQSLPPSPRALPIIGHIHLVGKKLPHEYLFRLAKQHGGLMYLQLGRIKTLVASTPAAAEEVLKIHDRAFASRPANSAAKYFGYDATDLVWAPYGDHWRHLRKICTLEFFITKRVQMFQPVRKLEMSMLITELVEACSQRRPVDMTSRFFQFAFNTMSRMVLNKSISDASGSESEKLKEFLNNLNEASKVGNGLQIGDLIPCLSWADPKVFRIKWLQTQLVNYLGEQLQEHKKNRESHHEVKDFMDVLIAGGVLDDTRIKALTSDMLAAGTDAIAVTIDWALAELMRNPKLMQEVKQELEEVVGSKGTVEEEHIPKLEFLQAIVKETLRLHPPAPLLAPHESVESCNIWGYNIPAGTGLLVNAYALGRDESTWSEANKFNPKRFLETKSDVEVTGQNFELIPFGSGRRMCPALSMGLTMVHYALATMLHTFEWSLPDGKDEVNMKAYFGIVLIREEPLMLVPRLAKSCP*

 

$$$$$$

 

>CYP790D2v1 SM3781.1 40% to e_gw1.63.102.1|Selmo1 new seq not in downloaded set from JGI

Jing-Ke

MLEMILTIVLTLALILVVLLCTNKRNQSLPPSPRALPIIGHIHLVGKKLPHEYLFQLAKQHGGLMYLQLGRIKTLVASTPAAAEEVLKTHDREFASRPANSAAKYFGYEATDLVWAPYGDHWRHLRKICTLEFFITKRVQMFQPVRKLEMSMLITELVEACSQRRPVDLTSRFFQFAFNTMSRMVLNKSISDASGSESEKLKEFLNNLNEASKVGNGLQIGDLIPCLSWADPKVFRIKWLQTQLVNYLGEQLQEHKKTRESHHEVKDFMDVLIAGGVLDDTRIKALTSDMLAAGTDAIAVTMDWALAELMRNPELMQEVKQELEEIVGSNGTVEEEHIPKLEFLQAIVKETLRLHPPAPLLAPHESVESCNIWGYNIPAGTGLLVNAYALGRDESTWSEANKFNPKRFLETKSDVQVTGQNFELIPFGSGRRMCPALNMGLTMVHYALATMLHTFEWSLPDGKDEVNMKAYFGIVLIREEPLMLVPRLAKSCP

 

>CYP790D2v2 SM1585879_3 3 aa diffs to CYP790D2v1 SM3781.1

481784 MLEMILTIVLTLALILVVLLCTNKRNQSLPPSPRALPIIGHIHLVGKKLP 481635

481634 HEYLFRLAKQHGGLMYLQLGRIKTLVASTPAAAEEVLKTHDREFASRPAN 481485

481484 SAAKYFGYDATDLVWAPYGDHWRHLRKICTLEFFITKRVQMFQPVRKLEM 481335

481334 SMLITELVEACSQRRPVDLTSRFFQFAFNTMSRMVLNKSISDASGSESEK 481185

481184 LKEFLNNLNEASKVGNGLQIGDLIPCLSWADPKVFRIKWLQTQLVNYLGE 481035

481034 QLQEHKKTRESHHEVKDFMDVLIAGGVLDDTRIKALTS (0) 480921

480881 DMLAAGTDAIAVTMDWALAELMRNPELMQEVKQELEEVVGSNGTVEEE 480726

480725 HIPKLEFLQAIVKETLRLHPPAPLLAPHESVESCNIWGYNIPAGTGLLVN 480576

480575 AYALGRDESTWSEANKFNPKRFLETKSDVQVTGQNFELIPFGSGRRMCPA 480426

480425 LNMGLTMVHYALATMLHTFEWSLPDGKDEVNMKAYFGIVLIREEPLMLVP 480276

480275 RLAKSCP 480255

 

>CYP788A1v1 estExt_Genewise1Plus.C_31354|Selmo1 99% to gw1.87.407.1|Selmo1

same as Jing-Ke SMF5H, N-term start differs

MNLSSI

MGEYTQHDNFTAVASLSLVLAAAIALLAALFSRLRNSKRPPLPPSPPSKLITGHLHLLDQLPNQSLYKLAKIYGPLIQLR

LGVVPVVVASTAEMAREFLKVNDSVCASRPRMAAQKIITYNFTDIGWAAYGAHWRQLRKICTLELFTHRRMQETAKVRAR

ELADTMAGIYRDRETSINMNTRIFSLTMNVINQMVMRKKPFSGSDTKEAREFIDLINGVFMVWGAFNIGDYIPGLSIFDF

QGYIGMAKVLHKKLDHLLDKVIEEHIQRRMAKSDEPPDFVDVLLALTLEDGSKVSHKTIKGIIVDMIAGGTDTAAVTIEW

ALSELMRKPHILKKAQEEMDRVVGRDRVVDESDLPNLPYLECIVKEALRLHPSVPILRHESIEDCVVAGYRIPKGTGIMI

NVWAIGRDSATWENPMEFDPDRFISAGNTLDVRGNHFDLIPFGSGRRMCPGMPLGISMLQMSLGRFIQCFDWGLPPEMKS

AEEIDMTETFGLTVPRKYPLHAVPIPRLPAHLYQA*

 

>CYP788A1v2  gw1.87.407.1|Selmo1 46% to 92A11, CYP71 clan

LSLVLAAAIALLAALYSRLRNSKRPPLPPSPPSKLITGHLHLLDQLPNQSLYKLAKIYGPLIQLRLGVVPVVVASTAEMA

REFLKVNDSVCASRPRMAAQKIITYNFTDIGWAAYGAHWRQLRKICTLELFTHRRMQETAKVRARELADTMAGIYRDRET

SINMNTRIFSLTMNVINQMVMRKKPFSGSDTTEAREFIDLINGVFMVWGAFNIGDYIPGLSIFDFQGYIGMAKVLHKKLD

HLLDKVIEEHIQRRMAKSDEPPDFVDVLLALTLEDGSKVSHKTIKGIIVDMIAGGTDTAAVTIEWALSELMRKPHILKKA

QEEMDRVVGRDRVVDESDLPNLPYLECIVKEALRLHPSVPILRHESIEDCVVAGYRIPKGTGIMINVWAIGRDSATWENP

MEFDPDRFISAGNTLDVRGNHFDLIPFGSGRRMCPGMPLGISMLQMSLGRFIQCFDWGLPPEMKSAEEIDMTETFGLTVP

RKYPLHAVPIPRLPAHLY

 

$$$$$$

 

>e_gw1.23.273.1|Selmo1 97% to e_gw1.11.363.1|Selmo1

57% to e_gw1.45.108.1|Selmo1

MLNGGTHTTSATIEWAVTETIRHPRILEKAQQELEAVVGLHRRVEESDLEKLPYLQCIVKETLRRHPPAPLLVPHMSTQA

CKVGGYDVPKGTTLFVNAYAIGMDPSYWENPLEFLPERFAGTAVDVRGQDFELLPFGSGRRSCPAMTMGLKTAQFAVSSL

IHAFDWSAEIPRAVKDLTIDEGFCSLLWPETPLLKAVATPKLSKDAY*

 

>e_gw1.11.363.1|Selmo1

MLNGGTHTTSATIEWAVTETIRHPRILEKAQQELEAVVGLHRRVEESDLEKLPYLQCIVKETLRRHPPAPLLVPHMSTQA

CKVGGYDVPKGTTVFVNAYAIGMDQSYWENPLEFLPERFAGTAVDVRGQDFELLPFGSGRRSCPAMTMGLKTAQLAVSSL

FHAFDWSAEIPRAVKDLTTDEGFCSPLWPETPLLKAVATPKLSKDAY*

 

$$$$$$

 

 

$$$$$$

 

>CYP797B17 e_gw1.110.82.1|Selmo1 35% t 71B23, 36% to 92A11, CYP71 clan

MDLTLSVVVSSLLLLFILAVVIISYKSRVTSPPGPWGLPLIGHLHLLARMPLHRALQSMSQKHGPIVSLSLGMRPAILIS

APALARELFTSQDVNFPSKPYTSVSEHIDYNFRSIGTAPYGEYYSSIRKLCLTELFTARNIDSFSWIRREELSHLLSAIL

SRASHGQALDLRKTLSVFSFNSITGALMSKRYLSHEHTGAASSKEAMEFKNWLIEVLQRVMEPCLSNFVPWYLRWLDWKT

PGLRRLHAKVDKFLQMVVEEHKKSTREQKDFLDILLKAFGEEEAYAKANLLVRDLMVAGTETSVTGTEWLMAAVIQEPRI

LKKAQQELHDAVGNRRMVQESDLSKLGYLDAIIKESLRRYPIVPIYIRECQGQASKLGGYDVPKGTIVIVNSWALGMDPV

VWENPTQFLPERFLARSIDIKGQDFELLPFGSGRRRCPGMPLGLRTMKLLVANLIHGFDWSVEPGKIQSMEDCFKSTCIM

KHPLQLVVTPRLPKDAYTTQIHDFFI*

 

>CYP797B1v1 e_gw1.11.382.1|Selmo1 96% to e_gw1.110.82.1|Selmo1

MDLTLSVVVSSLLLLFILAVVIISYKTSPPGPWGLPLIGHLHLLARMPLHRALQSMSQKHGPIVSLSLGMRPAILISAPA

LARELFTSQDVNFPSKPYTSVSEHIGYNFRSIGTAPYGEYYSSIRKLCLTELFTARNIDSFSWIRREELSHLLSAILSRA

SHGQALDLRKTLSVFTFNSITGALMSKRYLSHDTGAASSKEAMEFKNWLIEVLQLVMEPSLSNFVPWYLRWLDWKTPGLR

RLHAKLDKFLQMVVEEHKKSTREQKDFLDILLKAFGEEEAYAKANLLDLMVAGTETSVTGTEWLMAAVIQEPRILKKAQQ

ELHDAVGNRRMVQESDLSKLGYLDAIIKESLRRYPIVPIYIRECQGQASKLGGYDVPKGTIVIVNSWALGMDPVVWENPT

QFLPERFLASSIDIKGQDFELLPFGSGRRRCPGMPLGLRTMKLLVANLIHGFDWSVEPGKIQSMEDCFKSTCIMKHPLRP

VVTPRLHKDAYTTQIHDFFI*

 

$$$$$$

 

>CYP797B16 fgenesh2_pg.C_scaffold_110000082|Selmo1 79% to e_gw1.11.382.1|Selmo1

MSARTASGAGFEEDPVGVHIQQHNRLHHEQTTPGLRRLHAKLDKFLQMVVEEHKKSTREKKDFLDILLKAFGEEEAYAKA

NLLELKLPSLGPSGSWQLIQEPRILKRAQPEPHNAVSNRRMVQESDLFKLGYLDAIIKESLRRYPIVPIHIHECQGQATT

SQKEPSVQLDVESLVFLDEITLTYYHRFGNLRLVLVDHNKLEPVHAIVGQSLSDVIVETLEHSMCSSRDVAMATLLLNGA

GRYDRNGFFKMLRKRVSDLSVLSPREILNKQIEVWTSAAGSSGRIARIGMCSMGIALSRFLTVETGVSDEFLHLQRLGPY

TKAFSQGNITISGAQVRHITKGLFTRQS*

 

$$$$$$

 

>CYP797B2 e_gw1.11.381.1|Selmo1 93% to e_gw1.110.82.1|Selmo1

MDVVSSLLLLFILAVVIISYKSRVTSPPGPWGLPLIGHLHLLARMPLHRALQSMSQKHGPIVSLSLGMRPAILISAPALA

RELFTSQDVNFPSKPYMSVAEHIDYNFRSIGTAPYGEYYSSIRKLCLTELFTARNIDSFSWIRSEELSHLLSAILSSASH

GQALDLRKTLSVFTFNSITGALMSKRYLSHEHAGAASSKEAMEFKNLVFEVVHCIMDPCLSNFVPWYLRWLDWKTPGMRR

LHAKVDKFLQMVVEEHKKSTREHKDFLDILLEAFGEEEAYAKANLLDLIMAGTETSVIGTEWLMAAVIQEPRILKKAQQE

LQDAVGNRRMVQESDLSKLGYLDAIIKESFRRYPVVPIHIRECQGQASKLGGYDVLKGTIVLVNSWALGMDPVVWENPTQ

FLPERFLASFIDIKGQDFELLPFGSGRRRCPGMPLGLRTVKLLVANLIHGFDWSVEPG*

 

No allele found

 

$$$$$$

 

>CYP784B1v2 e_gw1.12.160.1|Selmo1 35% to 75B1, 35% to 706A5, CYP71 clan

MGITIAILVCLLATAAIIKSLLAGRSSRLPPGPISFPVVGSLLSLRQPLHRHFARLADRYGPIVFLKIGMVPYVIANTAR

AAEFFLKIHDAEFANRPQSEEFFRIFSFGWSDLAFRSPGPEWKLMRKICATNLFSNAMLATSAPYRRSQLQSAMDAILDR

SRGGEPVNLRTLFARYTSGSLCLTLFSEECPEVVETINNMAGQAINLNIGEIIPSLDWMDLHGVYAKMRGEIMPRIKALL

DDQVREHQERKKAAGDGFVCRDFVDVLISLDESDKLSDQEIIGLLCDMVGAGFKTSMESIEWCMAEVISKPEIMRKAQEE

LDQIIGRERAVEEHDLQNLPFIQAILKEALRLHPAVPLGMPHYNLRPVELGDGHGTIIPAKCKLLVNLWAANRDPAHWTS

PHEFQPERFLGTNISPGGQHFQIIPFSAGRRMCAGYGLAMRSLFFLLASLLHGFIWSEISDNPIVLEESIGTISCPPAKD

LIVAASPRIEERILAQY*

 

>CYP784B1v1 e_gw1.4.680.1|Selmo1 99% to e_gw1.12.160.1|Selmo1

MGITIAILVCLLATAAIIKSLRARRSSRLPPGPISFPVVGSLLSLRQPLHRHFARLADRYGPIVFLKIGMVPYVIANTAR

AAEFFLKIHDAEFANRPQSEEFFRIFSFGWSDLAFRSPGPEWKLMRKICATNLFSNAMLATSAPYRRSQLQSAMDAILDR

SRGGEPVNLRTLFARYTSGSLCLTLFSEECPEVVETINNMAGQAINLNIGEIIPSLDWMDLHGVYAKMRGEIMPRIKALL

DDQVREHQERKKAAGDGFVCRDFVDVLISLDESDKLSDQEIIGLLCDMVGAGFKTSMESIEWCMAEVISKPEIMRKAQEE

LDQIIGRERAVEEHDLQNLPFIQAILKEALRLHPAVPLGMPHYNLRPVELGDGHGTIIPAKCKLLVNLWAANRDPAHWTS

PHEFQPERFLGTNISPGGQHFQIIPFSAGRRMCAGYGLAMRSLFFLLASLLHGFIWSEISDNPIALEESIGTISCPPAKD

LIVAASPRIEERILAQY*

 

>e_gw1.4.276.1|Selmo1 36% to 75B1, 100% to e_gw1.4.680.1|Selmo1

RSSLRARRSSRLPPGPISFPVVGSLLSLRQPLHRHFARLADRYGPIVFLKIGMVPYVIANTARAAEFFLKIHDAEFANRP

QSEEFFRIFSFGWSDLAFRSPGPEWKLMRKICATNLFSNAMLATSAPYRRSQLQSAMDAILDRSRGGEPVNLRTLFARYT

SGSLCLTLFSEECPEVVETINNMAGQAINLNIGEIIPSLDWMDLHGVYAKMRGEIMPRIKALLDDQVREHQERKKAAGDG

FVCRDFVDVLISLDESDKLSDQEIIGLLCDMVGAGFKTSMESIEWCMAEVISKPEIMRKAQEELDQIIGRERAVEEHDLQ

NLPFIQAILKEALRLHPAVPLGMPHYNLRPVELGDGHGTIIPAKCKLLVNLWAANRDPAHWTSPHEFQPERFLGTNISPG

GQHFQIIPFSAGRRMCAGYGLAMRSLFFLLASLLHGFIWSEISDNPIALEESIGTISCPPAKDLIVAASPRIEERILAQY*

 

>CYP784B2v1 e_gw1.91.39.1|Selmo1 36% to 75B1, 99% to e_gw1.4.680.1|Selmo1

MGITIAILVCLLATAAIIKSLLARRSSRLPPGPISFPVVGSLLSLRQPLHRHFARLADRYGPIVFLKIGMVPYVIANTAR

AAEFFLKIHDAEFANRPQSEEFFRIFSFGWSDLAFRSPGPEWKLMRKICATNLFSNAMLATSAPYRRSQLQSAMDAILDR

SRGGEPVNLRTLFARYTSGSLCLTLFSQECPEVVETINNMAGQAINLNIGEIIPSLDWMDLHGVYATMRGEIMPRIKALL

DDQVREHQERKKAAGDGFVCRDFVDVLISLDESDKLSDQEIIGLLCDMVGAGFKTSMESIEWCMAEVISKPEIMRKAQEE

LDQIIGRERAVEEHDLQNLPFIQAILKEALRLHPAVPLGMPHYNLRPVELGDGHGTIIPAKCKLLVNLWAANRDPAHWTS

PHEFQPERFLGTNISPGGQHFQIIPFSAGRRMCAGYGLAMRSLFFLLASLLHGFIWSEISDNPIALEESIGTISCPPAKD

LIVAASPRIEERILAQY*

 

>e_gw1.1.192.1|Selmo1 48% to e_gw1.12.160.1|Selmo1

MDLGVALFLLSVGLTILIGRILSSQRRLPPGPFCFPIFGALFSLQEPLHQHFAKISKKYGPIVFLKIGMVPFVVVTDKEM

AAQVLKAHDLEFASRPDEEFFRIVSHDWNDLILAPIGDKWKTMRRISSTHLFNNSTLKASAGFRESEMKHAVKAIFQQSG

TTIKLQEVLSNLASNSLCLVLFSKRGVEVVDLIRNILGLSLNLNIGTLLPALDWLDLHGVYKKLNTELVPRLKLLLEDQI

DKHRRRKDQAGDTFVPQDFTDVLISLEDKDKLSNISILALLSVSI*

 

>gw1.5.450.1|Selmo1 75% to e_gw1.1.192.1|Selmo1

IGLITLSLLIGRVGRVGRVQSLQQRLPPGPFSFPIFGALFSLKEPLHHHFALISKKYGPIVFLKIGMAPFVVVNDNEMAA

QVLKVHDLEFVSRPDDEYFRIVSQDWNDLVLAPIGDKWRTMRRICSTHLFSNNMLKASAGFRESEMKHTVKSI

 

>CYP784B3P fgenesh2_pg.C_scaffold_91000059|Selmo1 30% to 92A11 with some gaps, pseudogene?

Nearly identical to e_gw1.91.39.1|Selmo1 in parts

MGITIAILVCLLATAAIIKSLLARRSSRLPPGPISFPVVGSLLSLRQPLHRHFARLADRYGPIVFLKIGMVPYVIANTAR

AAEFFLKIHDAEFANRPQSEEFFRIFSFGWSDLAFRSPGPEWKLMRKICATNLFSNAMLATSAPYRRSQLQSAMDAILDR

SRGGEP

 

RGVSLPVVETINNMAGQAINLNIGEIIPSLDWMDLHGVYATMRGEIMPRIKALLDDQVREHQERKKAAGDGFVC

RDFVDVLISLDESDKLSDQEIIGLLC

 

AILKEALRLHPAVPLGMPHYNLRPVELGDGHGTIIPAKCKLLVNLWAANRDPAH

WTSPHEFQPERFLGTNISPGGQHFQIIPFSAGRRMCAGYGLAMRSLFFLLASLLHGFIWSEISDNPIALEESIGTISCPP

AKDLIVAASPRIEERILAQY*

 

>fgenesh2_pg.C_scaffold_59000168|Selmo1 30% to 706A5 partial

possible pseudogene, 70% to e_gw1.12.160.1|Selmo1. pseudogene, fused with a O-methyltransferase

MAHHKVQTMLNKFALKYCLQSAESQSEEFFRIFSFGWSDLAFRSPGKLMRKICATNLFSNAMVTTSAPCRHGQHPRSIAA

QRADPLRQTRVGSLCLTLFSEECPEVSGSTGSAR RRGDGFVCRDFVDGLISLDDSDKLSDQEIIVRYGGCRIQTSTIEWY

MSEVISKHEVMRNAQEELDQIIGRGGRIRPPKSPIHPGDPQGGPPPPPGVAAGAPPPRGARRWPWHHNPRECKLLVNEFQ

PERFLSRPGQHVQIIPFSVGRRLCAGYGLAMRSLFFLLATRIQLEQSHHSIGTTLIVYQRVYLGFKPNALGAHCLRVLLR

QHRGEGAIANHPVLCEDQLLGSSILSGEIPCYPAFFLAPSAPKPGGYGEISYWDKRYAEQPDALVLGLLQIRDDCPNVND

MVEDGYREIVNTDLSSMVIDNFKARYAHVPQLSYSRDMSAFQDCSFDAVIDKGLAGAMLERVCVTKNILCGVDPAEGVLQ

MRRETYRILKPQGVFMLITYGHPEIRMPALLEPGLKWSILVYALAKPATEKAVMETIKGVTPDSLPIDERN*

 

$$$$$$

 

>e_gw1.106.48.1|Selmo1 96% to gw1.1.171.1|Selmo1

81% to e_gw1.1.192.1|Selmo1

MAAQVLKAHGLEFASRTNNEFFRIVSHAWNDLILAPVGDKWKIMRRICSTHLFNNSMLKASSGFRESEMKHTVKSIIQQS

GATIKLQEVFSGLLSISLCLVLFSERGLEVVDLIRNIVALSLNLNIGLLFPALDPWIFMESTRNATQSSCLA*

 

>gw1.1.171.1|Selmo1

FPVFGALFSLKEPLHHHFAKISKKYGPIVYLKIGMAPVVVVNDNKMAAQVLKAHGLEFASRRKNEFFRIVSHDWNDLILA

PVGDKWKIMRRICSTHLFNNSMLKASSGFRESEMKHTVKSII

 

$$$$$$

 

>gw1.5.109.1|Selmo1 97% to gw1.1.372.1|Selmo1

RLPPGPFSLPIFGALFSLEEPLHHHFAKIGKKYGPIVFLKMGMAPFVVVNDNQMAAQVLKAHDLEFGSRPDDGFFRIVSH

GRNDLVLAPIGDKWKAMRRICSTHLFSNSMVKASAGFRESEMKHAVKAIFQQSG

 

>gw1.1.372.1|Selmo1

SSRLPPGPFSLPIFGALFSLEEPLHHHFAKISKKYGPIVFLKMGMAPFVVVNDNQMAAQVLKAHDLEFGSRPEDGFFRIV

SHGGNDLVLAPIGDKWKAMRRICSTHLFSNSMVKASAGFRESEMKHAVKAIFQQSGTTIKLQEVLSNL

 

>fgenesh2_pg.C_scaffold_1000572|Selmo1 77% to gw1.1.372.1|Selmo1

73% to e_gw1.1.192.1|Selmo1

MDLGAALLVFGISCIALLLLIRRIRSPKRRLPPGPFSFPVFGALFSLEEPLHHHFAKISKKYGPIVYLKIGMVVVVNDNE

MAAEVLKAHDLEFPNRPDDEFFRIVSHDWNNLIMAPIGDKWKAMRRICSTQPFNNTMLKASAGFRELEMKHTVRSLFQQS

GTAINLQEVFTSGDWKWWISSGT*

 

$$$$$$

 

 

$$$$$$

 

>CYP787B1v1 e_gw1.47.107.1|Selmo1 39% to 75B1, CYP71 clan

MEALSIILVGAATLVLCSLFASRFLYPLPPGPWGTPLFGHLYSLGELPHQTLSKLSKKYGPIMTVRLGMVPALVIDSPQW

AREFLTTHDIAFASRPQNTNSKYLFFNGSDVGFSPYGEHWRNLKKLITMELFTAKK

MEVFKALRANGILRVLKSIAAEEG

NVVSIRNLLSMLNMNNISQMAFSKQVIDDPIFQRFLAVLEESLDLMAVFVLGDFIPFLKWFDPYGYVAKMKANRKEISGI

YQMIIDEHKLKRKKNCTPTDLVDILLSQGVDETTIKGTIM GMFVAGTDTSSLTSEWALTSLINNPGCMRRAQEELDRVVG

RERRVQEEDLSSLVYLKAIVKETFRLHPPAPLLLPRESTQECTVKGGYKIPKGTRLIINTWSIGRDPVS*

 

>CYP787B1v1 e_gw1.47.107.1  manually annotated

MEALSIILVGAATLVLCSLFASRFLYPLPPGPWGTPLFGHLYSLGELPHQTLSKLSKKYGPIMTVRLGMVPALVIDSPQW

AREFLTTHDIAFASRPQNTNSKYLFFNGSDVGFSPYGEHWRNLKKLITMELFTAKKMEVFKALRANGILRVLKSIAAEEG

NVVsirnllsmlnmnnisQMAFSKQVIDDPIFQRFLAVLEESLDLMAVFVLGDFIPFLKWFDPYGYVAKMKANRKEISGI

YQMIIDEHKLKRKKNCTPTDLVDILLSQGVDETTIKGTIMGMFVAGTDTSSLTSEWALTSLINNPGCMRRAQEELDrvvg

rerrvqeeDLSSLVYLKAIVKETFRlhppaplllpRESTQECTVKGGYKIPKGTRLIINTWSIGRDPAETPSPEEFKPER

FLGKSIDIKGQDFELIPFGAGRRICAGLPLGQTMVELTLASLLQAFEWKTDKTLDMEESEGLTTRMKVPLAAHVTRRTSL

KF*

 

>fgenesh2_pg.C_scaffold_54000204|Selmo1 100% to e_gw1.47.107.1|Selmo1

MEVFKALRANGILRVLKSIAAEEGNVVSIRNLLSMLNMNNISQMAFSKQVIDDPIFQRFLAVLEESLDLMAVFVLGDFIP

FLKWFDPYGYVAKMKANRKEISGIYQMIIDEHKLKRKKNCTPTDLVDILLSQGVDETTIKGTIMIWSSYYKTVVVRL*

 

>CYP787B1v2 fgenesh2_pg.C_scaffold_47000217|Selmo1 97% to e_gw1.47.107.1|Selmo1

MEVFKSLRANGILRVLKSIAAEEGNVVSIRNLLSMLNMNNISQMAFSKQVIDDPIFQRFLAVLEESLDLMAVFVLGDFIP

FLKWFDPYGYVEKMKANRKEISGIYQMIIDEHKLKRKENCTPTDLVDILLSQGVDETTIKGTIM

VIQLCVFLQPKVPQHS

QSKVASLVSKKRGSFDNFLEETLESLPKVTVSLTSLRRGFLFVATHRKECGQNNNVKLVPHPALQMRNKRNGSQGVEVHH

SQGGSIWNRLTVLNVNNITQMAFHKQVIGHPMFERFLTVVEMINEIYRMVLDEHKLKRKETYNAGPSDLVDILPAEGVDE

NIIKGMVMGMLFAGTEEELDRVVGRDRHVQEEDLVYWNPPVPLVLPREST*

 

$$$$$$

 

>CYP785A7v1 estExt_fgenesh1_pm.C_540040|Selmo1

MDLATLCALMLVAL

MPLLYFAGSRRGRRRDGDRLPPGPFNLPVIGSLHRLGSLPHISLQKLSRKHGDVMHPKLGRVSAVI

ISSARAASEIFKLHSLQCSSKPSLICSKYFGNDSSGIIFSSYTPQVKLYRKLINTHLLSPARLRICDGIRRAASLDPSAT

SREIRCSCAKTYRLFGERSFCGSSQEFVRAIVETIRLVGIFNVSDYIPWLRWLDVQGLEKQYKQLTDKLNRHLFSILRDR

RENPRVVTTDEEPMAFIDVLISMDELSDTTKITLLLITQDILLGAVDSSALSVEWAMAELLRHPAELSRARREIDDVVGS

QRLVEDSDLPKLRYVEAIAKETLRLHQVTPLINPKLVEGGPIKLGGFTIPAGALVYLSSYAIGMDEKFWKEPLEFRPQRF

IEQDIDVFGQNFHFVPFGTGRRVCPGAKLGLDTVRIGVATLVQGFDWELDQDPAKLDMAETFGLVCQKTQPLVAIPRPRL

DSHVY*

 

>CYP785A8v1 e_gw1.47.77.1|Selmo1 92% to estExt_fgenesh1_pm.C_540040|Selmo1

37% to 92A9 in CYP71 clan

MDLATLCALMLVAL

MPLLYFAGSRRGRRRDGDRLPPGPFNLPVIGSLHRLGSLPHISLQKLSRKHGDVMHLKLGRASAVIISSARAASEIFKLHSLQCSSKPSLICSKYFGNDSSGIIFSSYTPQVKLYRKLINTHLLSPARLRICDGIRREEQHRLARSIRDEQGNPVLLREK

FHDFNMNIIAYRLFGERSFCGSSQEFVRAIVETIRLVGIFNVSDYIPWLRWLDVQGLEKQYKQLTDKLNRHLFSILRDRR

ENPRVVTTDEEPMAFIDVLISMDELSDTTKITLLLDILLGAVDSSALSVEWAMAELLRHPAELSRARREIDDVVGSQRLV

EDSDLPKLPYVEAIAKETLRLHQVTPLINPKLVEGGPIKLGGFTIPAGALVYLSSYSIGMDGKFWKEPLEFRPQRFIEQD

IDVFGQNFHFVPFGTGRRVCPGAKLGLDTVRIGVAMLVQGFDWELDQDPAKMDMAETFGLVCQKTQPLVAIPRPRLDSHV

Y*

 

$$$$$$

 

>gw1.0.1017.1|Selmo1 86% to gw1.0.398.1|Selmo1 CYP71 clan

LIPHTSPEPRIVAGFEIPAKATVVIKAYAIGRDSQAWPNDPGKLRPGRFVGSNINVYGHDFELLPFGSGKRGCPGLPLGV

 

>gw1.8.451.1|Selmo1 94% to gw1.0.1017.1|Selmo1

LHNPEWMEKLQQEIESVVGRDPMVEESDLAKLELVNAVIKETLRLHPPLPLMIPHTFPEPRIVAGFEIPAKATVVIKAYA

IGRDSQAWPNDPGKLRTGRFVGSNTNVYGHDFELLPFG

 

>CYP796C1v1 gw1.0.398.1|Selmo1 85% to gw1.0.1017.1|Selmo1, 38% to 75B1, 42% to 92A9. Missing N- and C-terminal

MLPAIVLVLTLAFFVTQWMWSKRAI

KLPPGPRALPLIGHFHLLGRIPQISLYHLSKKFGPLMYLRLGSAPLIVISSPAMAREFLKTHDAAFARRPPRVAVDILMY

KFKSLSYSEGEYHKNIRRMCSMELFTARRVTSFTKIIRDELWDLTAELAKASKAGQPVALRGKLRSLSFNVMTRILMNKT

YFGSKASSDDPQAREFVGVIDEVMDAAGAFSIADYFPSVGWLDWSIARCRRAHQRMDAFLDKVLNEQRPGEIPDFVEMTK

ARVDGPEQAQYLKALLMDLLLGGSETSSTVVEWAMAELLHNPEWMEKLQQEIESVVGRDRMVEESDLAKLELVNAVIKET

FRLHPPLSLMVPHTSPEPRLVAGFEIPAKATVLINTYAIGRDSQAWPNDPDKFKPGRFVGSNINVYGHDFELLPFGSGRR

GCPGLPLGLRNVQLVLSNLIHGFDWRFRDG

ATRKLSFDSGPGFINIIADAVVAQVSPRLEQCAFGTLAAS*

 

>CYP796C4 gw1.8.204.1|Selmo1 98% to gw1.0.398.1|Selmo1 extend it

LPPGPRALPLIGHFHLLGRIPQISLYHLSKKFGPLMYLRLGSAPLIVISSPAMAREFLKTHDAAFARRPPRVAVDILMYK

CKSLSYSEGEYHKNIRRMCSMELFTARRVTSFTKIIRDELWDLTAELAKASKADHPVALRGKLRSLSFNVMTRILMNKTY

FGSKASSDDPQAREFVDVIDEVMDAAGAFFIADYFPSVGWLDWSIARCRRAHQRMDAFLDKVLNEQRPGEIPDFVEMTKA

RVDGPEQAQYLKALLMDLLLGGSETSSTVVEWAMAELLHNPEWMEKLQQEIESVVGRDRMVEESDLAKLELVNAVIKETF

RLHPPLSLMVPHTSPEPRLVAGFEIPAKATVLVNTYAIGRDSQAWPNDPDKFKPGRFVGSNINVYGHDFELLPFGSGRRG

CPGLPLGLRNVQLVLSNLIHGFDW

 

>gw1.8.752.1|Selmo1 95% to gw1.0.398.1|Selmo1

KRAIKLPPGPRALPLIGHFHLLGRIPQISLYHLSKKFGPLMYLRLGSVPLIVISSPAMAREFLKTHDAAFARRPPRVAVD

ILLYKSKSLSYSEGEYHKNIRRMCSMELFTARRVTYFTKIIRDELWDLTAELAKASKADQPVALRGKLRSLGFNVMTRIL

MNKTYFGSKASTDDPHAREFVGVIDEVMNATGAFSIADYFPSVGWLDWSIARCRRAHQRMDAFLDKVLNEQR

 

>gw1.0.799.1|Selmo1 95% to fgenesh2_pg.C_scaffold_8000404|Selmo1

85% to gw1.0.398.1|Selmo1

LVLALVFFVTQWMWSKRANLPPGPRALPLIGHFHLLGRIPQISLYHLSKKFGPLMYLRLGSLPLFVVSSPAMAREFLKTH

DAAFAHRPPKVAVYSYKSVSYSEGEYHKNLRRMCSMELFTARRVTSFTKIIRDELWDLTAELANASKADQPVALRGKLRA

LSFNVMTRILMNKTFFGSKASGGGDQEARNFLETIDEVLAAFGAFAIEDYFPSIGWL

 

>CYP796C3 fgenesh2_pg.C_scaffold_8000404|Selmo1

MLFATVLVLALVFFVTQWMWSKRANLPPGPRALPLIGHFHLLGRIPQISLYHLSKKFGPLMYLRLGSVPLIVISSPAMAR

EFLKTHDAAFAHRPPKVAVYSYKTISFSEGEYHKNLRRMCSMELFTARRVTSFTKIIRDELWDLTAELTNASKADQPVAL

RGKLRALSFNVMTRILMNKTFFGSKASGGGGQEARDFLETIDEVLAAVGAFAIEDYFPSIGWLDRSIARRCRRAYGKMDA

FLENVLDEQRPGEIPDFVEMTKARVSRRYKEAVP*

>CYP796C3 fgenesh2_pg.C_scaffold_8000404 manually annotated

MLFATVLVLALVFFVTQWMWSKRANLPPGPRALPLIGHFHLLGRIPQISLYHLSKKFGPLMYLRLGSVPLIVISSPAMAR

EFLKTHDAAFAHRPPKVAVYSYKTISFSEGEYHKNLRRMCSMELFTARRVTSFTKIIRDELWDLTAELTNASKADQPVAL

RGKLRALSFNVMTRILMNKTFFGSKASGGGGQEARDFLETIDEVLAAVGAFAIEDYFPSIGWLDRSIARRCRRAYGKMDA

FLENVLDEQRPGEIPDFVEMTKARVNGPDQIQTLKALLMVSENSGSETSSTTTEWAMAELLHNPEWIEKLQQEIEIVVGR

DRMVEESDLAKLELVNAVIKETFRLHPPLGLLVPHTSPEPRLVAGFEIPAKATVLINAYAIGRDSQAWPNDPDKFKPGRF

VGSNINVYGHDFELLPFGSGKRGCPGLPLGLRNVQLVLSNLIHGFDWRFPEDTRKLSLDSGPGLVDTVADAVVAHVSRRL

QQCAFDTLAA*

 

>CYP796C2 fgenesh2_pg.C_scaffold_8000403|Selmo1 77% to gw1.0.398.1|Selmo1

MELFTARRVTSFTKIIRDELWDLTAELSKASKGDQPVPLRGKLRSLSFNVMTRILMNKTYFGSKASSDDPEAREFVEVID

ELLESAGSFSLADYFPSISWLDWSIARCKQAHCKMDAFLDKVLSEQRPGEVPDFVEMTKARARVPQSLAHNGKLSLDSVI

NVIADVVHQAQVSPRLEQCVFDNLKT*

>CYP796C2 fgenesh2_pg.C_scaffold_8000403 manually annotated

MLLVIVALTALLFITQWMWSKRVKLPPGPRALPLIGHFHLLGRLPHISLYHLSKKFGAPMYLRLGSVPLFVVSSSSMAKE

FLKTHDAAFAHSVPRCGIRTQCPSRSLCITTGEGEYHKNIRRMCSMELFTARRVTSFTKIIRDELWDLTAELSKASKGDQ

PVPLRGKLRSLSFNVMTRILMNKTYFGSKASSDDPEAREFVEVIDELLESAGSFSLADYFPSISWLDWSIARCKQAHCKM

DAFLDKVLSEQRPGEVPDFVEMTKARARVPQSLAHDLLLGGSETSSTVIEWAMAELLHNPEWMEKLQQEIESVVGRDRMV

EESDLAKLELVNAVIKETFRLHPPLPLMIPHTSPEPRIVAGFEIPAKATVVINAYAIGRDSQAWPNDPDKFKPWRFVGSN

TNVYGHDFELLPFGSGKRGCPGLPLGLRNVQLVLSNLIHGFDWRFPDGKLSLDSVINVIADVVHQAQVSPRLEQCVFD

NLKT*

 

$$$$$$

 

>gw1.85.73.1|Selmo1 100% to gw1.85.139.1|Selmo1

95% to fgenesh1_pm.C_scaffold_118000010|Selmo1

95% to estExt_Genewise1.C_850155|Selmo1

93% to estExt_Genewise1.C_850132|Selmo1

92% to e_gw1.85.46.1|Selmo1

91% to fgenesh2_pg.C_scaffold_118000033|Selmo1

PSSSTVLINAYAIARDSSAWGDDALLFRPERFLGTDLDIRGRDFEAVPFGSGRRQCPGMALALTTVHLTLANLLHGFEWR

EPSGESIDTSNEQYGLTLLMANKLRLISTPRL

 

>gw1.85.139.1|Selmo1

PSSSTVLINAYAIARDSSAWGDDALLFRPERFLGTDLDIRGRDFEAVPFGSGRRQCPGMALALTTVHLTLANLLHGFEW

 

>CYP793B3v2 fgenesh1_pm.C_scaffold_118000010|Selmo1 99% to estExt_Genewise1.C_850155|Selmo1, 40% to 92A14

MTVRRKVFQFYQSVSSLMIFFLAELAVVTKEPRLHIFPDRPIGLPLIGHLHLLFANPPHTVLQRLSARHGPIMSLRFGHV

PVVVASSPAAAKEFLKTHDAAFASRPLSAVGRIFVHYNADIAFAPYGDSWRHLRKIATLELLTARRIDMFQGARMEEVRS

MCQSLLGVNNCETGIVDVRGRLSALTFNLITFMLMGKRYFGKDAENDEGAKKFLNVIAGTFEVCGEFPIGDYFPWLPKFL

DPAEHRMHSLAKSLHEFLMDNISEHENKRNNSEKNSTEDDFLDILLSLRDNGDERLQNKNIISVMTNLVAAGTETSAVTL

EWAMAESIKNPTIAAKAREEIELVLGEKWMTKMVEEHDLSQLTYLQAIVKETLRLHPAVPLLVPHQSTQPVSNVMGYHIP

RGTTVLINAYAIARDTSAWGDDALLFRPERFLGTDLDIRGRDFEAVPFGSGRRQCPGMALALTTVHLTLANLLHGFEWRE

PSGESIDTSKEQYGLTLLMANKLRLISTPRLEQSTF*

 

>CYP793B3v1 estExt_Genewise1.C_850155|Selmo1 extend it

MSLRFGHVPVVVASSPAAAKEFLKTHDAAFASRPLSAVGRIFVHYNADIAFAPYGDSWRHLRKIATLELLTARRIDMFQG

ARMEEVRSMCQSLLGVNNCETGIVDVRGRLSALTFNLITFMLMGKRYFGKDAENDEGARKFLKVIAGTFEVCGEFPIGDY

FPWLPKFLDPAEHRMHSLAKSLHEFLGDNISEHENKRNNSEKNSTEDDFLDILLSLRDNGDERLQNKNIISVMTNLVAAG

TETSAVTLEWAMAELIKNPTIAAKAREEIELVLGEKWMTKMVEEHDLSQLTYLQAIVKETLRLHPAVPLLVPHQSTQPVS

NVMGYHIPRGTTVLINAYAIARDTSAWGDDALLFRPERFLGTDLDIRGRDFEAVPFGSGRRQCPGMALALTTVHLTLANL

LHGFEWREPSGESIDTSKEQYGLTLLMANKLRLISTPRLEQSTF*

 

>CYP793B1 estExt_Genewise1.C_850132|Selmo1

MSLRFGHVPVVVASSPAAAKEFLKTHDAAFASRPLSAAGRTIVHYNADIVFAPYGDSWRHLRKIATLELLTARRIDMFRG

ARMEEVRSMCRSLLVADDREMGVVDVRGQVTALTFNLITLMLMGKRYFGKDIENEKGAKKFLEVIASTFKVCGEFPIGDY

FPWLPKFLDPAERRMHSLAKSLHEFLSDNIIEHENKRKNKKKNNNDEDFLDILLSLKDNGDEHLQNENIISVMTNLVTAG

TDTSAVTLEWAMAESIKNPTIAAKAREEIELVLGEKWRTKMVEEPDLSQLTYLQAIVKETLRLHPAGPLLVPHQSTEAVS

NVMGYHVPRGTTVLINAYAIARDSSAWGDDALLFRPERFLGTDLDIRGRDFEAVPFGSGRRQCPGMALALTTVHLTLANL

LHGFEWREPSGESIDTSKEQYGLTLLLAKKLRLIATPRLEQGTL*

 

>CYP793B2v1 e_gw1.85.46.1|Selmo1

MASDFVLVVAAALSITAVLWKLWKSRIKSSLLPPGPIGLPLIGHLHLLFANPPHTVLQRLSARHGPIMSLRFGHVPVVVA

SSPAAAKEFLKTHDAAFASRPLSAAGRIIVHYNADIVFAPYGDSWRHLRKIATLELLTARRIDMFRSARMEEVRSMCRSL

LVADDRETGIVDVRGRVTALTFNLITFMLMGKISSLSCSWASVMIAGTFEVCGEFPIEDYFPWLPKFLDPAEHRMHSLAK

SLHEFLGDNISEHENKRKNNKKNNTDEDFLDILLSLRDNGDKHLQNENIRSVMTNLVTAGTDTSAVTLEWAMAESIKNPT

IAAKAREEIELVLGEKWRTKMVEEPDLSQLTYLQAIVKETLRLHPAGPLLVPHQSTEAVSNVMGYHVPRGTTVLINAYAI

ARDSTAWGDDALLFRPERFLGTDLDIRGRDFEAVPFGSGRRQCPGMALALTTVHLTLANLLHGFEWREPSGESIDTSKEQ

YGLTLLLAKKLRLIATPRLEQGTL*

 

>CYP793B2v2 fgenesh2_pg.C_scaffold_118000033|Selmo1

MSLRFGHVPVVVASSPAAAKEFLKTHDAAFASRPLSAAGRIIVHYNAGIVFAPYGDSWRHLRKIATLELLTARRIDMFRS

ARMEEVRSMCRSLLVADDRETGIVDVRGRVTALTFNLITFMLMGKRYFGKDTENEEGARKFLEVIAGTFEVCGEFPIGDY

FPWLPKFLDPAEHRMHSLAKSLHEFLGENISEHENKRKNNKKNNTDEDFLDILLSLRDNGDKHLQNENIRSVMTAVSNVM

GYHVPRGTTVLINAYAIARDSTAWGDDALLFRPERFLGTDLDIRGRDFEAVPFGSGRRQCPGMALALTTVHLTLANLLHG

FEWREPSGESIDTSKEQYELTLLLAKKLRLIATPRLEQGTL*

 

$$$$$$

 

>gw1.73.89.1|Selmo1 98% to e_gw1.90.44.1|Selmo1

LPPGPLAIPFVGHLHLLLKGHPHVVLKALAEKYGPVLFLRFGVVPVVVVSSSQSAVEFLKVQDKVFTSRPRFLSAGRLLL

GFDGEDMVFAPYGMRWKQLRRLCTTKLFTAR

 

>CYP793A1 e_gw1.90.44.1|Selmo1 43% to fgenesh1_pm.C_scaffold_118000010|Selmo1

MEVFLLLLVVITFGFFLRTRNRNNILPPGPLAIPFVGHLHLLLKGHPHVVLKALAEKYGPVMFLRFGVVPIVVVSSSQSA

VEFLKVQDKVFTSRPRFLSAGRLLLGFDGEDMVFAPYGMRWKQLRRLCTTKLFTARNFADVRMSEVRSLVRAIQAFGEAS

PNSALDLRTKFKHLTFNIITRMLMSKRYFEGDTADSKEAEEFIYLMEESFSLAGAFPVSDYLPYSFVKWLNMNQDDRIKT

LSVRSRQFVDKIITEHELRSPTCSDDFLGLLLKLRSTEDVLQRNTIRGLMINLLQAATDTSSVSLEWTLAELINHPACMS

MVQDEIASVVGSNRMVEERDISKLPYLQAIVKESLRLHPPGPLLLPRECSKTCEVMGYKIPEATTLMVNAYAIGRDPKVW

KEPLKFKPERFLDYSCFDVGGNNLDVIPFGAGSRACPGISIAFSILHLALANLVHAFHWTLPAEVVHVDTSNEKYGLTVT

LAKKLEAIPLCKIDTIVCGDE*

 

$$$$$$

 

>gw1.139.27.1|Selmo1 59% to 71V3, CYP71 clan

RRHPPAPLMAPHESHQDCEVNGFTIPAKTRVLINIWSIARDPRWWGESAGIFNPERY

 

$$$$$$

 

>gw1.44.49.1|Selmo1 98% to estExt_Genewise1Plus.C_440490|Selmo1

98% to e_gw1.2.293.1|Selmo1 only partial sequence, maybe pseudogene

LLRLGMMPTVVISSQELVKEVFTTHDVNFGSRPYMVLGEHFSYNYLGLGTCPYGKHWR

 

>CYP797B9 e_gw1.2.293.1|Selmo1

MYILFVALILFLVLSWSYKSHKNVPPGPWGLPLIGHLHLLAGTLPHKGLQYISKKYGPVVFLRLGMMPTVVISSQELVKE

VFTTHDVNFGSRPYMVLGEHFSYNYSGLGTCPYGKHWRDSRKLCTIELFTAKCIDSFAWMRKEELSHALRVILGGSKPVK

MRALLSNFAFNNMSRILMSKRYFGDDEVDRDAVEFKEMLSSVVDLVMNPCVSNLVPWYLRWLDWQIPRYKRIHAKQDNFL

QKIIDEHKETTRECKDFLDIMLEFYGTNVQGETHIKANLLEMLVAGTDTSATTSEWLMASVMHNPRVLIKLQQELDRVVG

GNRMVQESDLPKLDYLQLVLKETFRCYPPGVLLFPRMSTQDVTVAGYHVPKGTTLLVNAWAVHMDPEVWENPTQFQPERF

LGSSIDVKGQNFELLPFGAGRRKCPGMSLGLRTVELLVANLIHGFDWNFVPGTTPSMEEVFNSACYLKTPLQAMATPRLR

MDIYKNMIM*

 

>estExt_Genewise1Plus.C_440490|Selmo1 99% to e_gw1.2.293.1|Selmo1 1 aa diff

42% to 92A9

MYILFVALILFLVLSWSYKSHKNVPPGPWGLPLIGHLHLLAGTLPHKGLQYISKKYGPVVFLRLGMMPTVVISSQELVKE

VFTTHDVNFGSRPYMVLGEHFSYNYSGLGTCPYGKHWRDSRKLCTIELFTAKCIDSFAWMRKEELSHALRVILGGSKPVK

MRALLSNFAFNNMSRILMSKRYFGDDEVDRDAVEFKEMLSSVVDLVMNPCVSNLVPWYLRWLDWQIPRYKRIHAKQDNFL

QKIIDEHKETTRECKDFLDIMLEFYGTNVQGETHIKANLLEMLVAGTDTSATTSEWLMASVMHNPRVLIKLQQELDRVVG

GNRMVQESDLPKLDYLQLVLKETFRCYPPGVLLFPRMSTQDVTVAGYHVPKGTTLLVNAWAVHMDPEVWENPTQFQPERF

LGSSIDVKGQNFELLPFGAGRRKCPGMSLGLRTVELLVANLIHGFDWNFVPGTTPSMEEVFNSSCYLKTPLQAMATPRLR

MDIYKNMIM*

 

$$$$$$

 

>CYP792A4v1 e_gw1.47.87.1|Selmo1 35% to 75B1, CYP71 Clan

MEHITVFFAFLASFFLVIFYYDRSKSRSSHVMPPSPRAFPILGHIPLLASTSRGPHLILFDLAKKLGPIFYLRLGYTPTI

VISSAKIAQEILKSHDRTFSSRPSLTFAEAILPDDLVFARYGARWRELRKICTLELFTARRVGSFAAVRQVEMEKFLAML

SQNLGRTVNMTQELTVLTLEIMQTLVFGTSRTFDAKDFLHLIRQGNELGGSLHIGDYIPSLKWMDPSLPKLRTLADNFHA

LLQAHIDEHRSSIAKQGHGGESFLDVLLSLDNMSDLTIRCLMLDAVSAGLHTTATAIDWALTELLLHPQILAKAQKELDD

VIPASSAIVSEADIPKLKYLGAIVKETLRQHPPAPLMVPRESTADCKVTGYTIPAKTQVLINLYAIGRDPSIWENPLEFI

PERMSSEFNAAVELMTFGFGRRSCPGMNLGMTAVHFVLANLLYRFNWTTPDGKEVDVGEGVGFTLMRARPLALVPLLRK*

 

>CYP792A4v2 e_gw1.54.99.1|Selmo1 97% to e_gw1.47.87.1|Selmo1

MEHITVFFAFLASFFLVIFCYDRSKSRSSHVMPPSPRAFPILGHIPLLASTSRGPHLILFDLAKKLGPIFYLRLGYTPTI

VISSAKIAQEILKSHDRTFSSRPSLTFAEAILPDDLVFARYGARWRELRKICTLELFTARRVGSFAAVRQVEMEKFLAML

SQNLGRTVNMTQELTVLTLEIMQTLVFGTSRTFDAKDFLHLIRQGNELGGSLHIGDYIPSLKWMDPSLPKLRILADNFHG

LLQAHIEEHRSSIAKQGHGGESFLDVLLSLDNMSDLTIRCLMLDAVSAGLDTTATAIGWALTELLLHPQILAKAQKELDD

VIPASSAMVSEADIPKLKYLGAIVKETLRKHPPAPLMVPRESTAECKVTGYMIPAKTQVLINLYAIGRDPKIWENPLEFI

PERMSSEFNAAVELMTFGFGRRSCPGMNLGLTAVHLVLANLLYRFNWTTPDGKEVDVGEGVGFTLMRARPLALVPLLRK*

 

>CYP792A10P fgenesh2_pg.C_scaffold_16000364|Selmo1 62% to 71Z2 Heme region fragment

identical to parts of e_gw1.47.87.1|Selmo1

MVFPILTSTSPNSQVDLLLSFCQQLKFSSVVLVGHDDGELLPLIAAAKILKSLSSTQVVIKDVVLIVVSSSREVISPFAR

VLLHTSLGRHILRPLLCPEMASRHAWHDASKLTSKMMELYKAIFFSQTCYWTKLRRPLRKVFVNLSSVAHIASYSGGIQY

SDTRAYCQSKLANFFHAKELAIRF

KLEEAGYTIPAKTHG

CPGMNLGMTAVHFVLANLLYRFNWTTPDG

KEVHAHAGSRSS

TCIGSTSPQVMKHIDWNKRRHFRIEAHCTRIHGRLGASNLTLAQNMEGAPAEVFMEVEPNNTGMLEFFSPELLSLEEQEA

KASELKQDACLEQSSSTKEADMQPASTEIAAPDEPVRGKANLDAKEEESKQQREGKSAGLEAEDDMEDQHPDGPGDPLLR

SWDSQSHNRQACRTRLPGIQETREDHLGEEPQNGNANQRPREALREIDEEFRGFVHGDLSVALARRLLWLTVMA*

 

$$$$$$

 

>CYP792A5 fgenesh1_pm.C_scaffold_313000001|Selmo1 92% to e_gw1.47.87.1|Selmo1

MEHITVFFAFLASFFLVIFYYDRSKSRSSHVMPPSPRAFPILGHIPLLASNSRGPHLILFDLAKKLGPIFYLRLGYTPTI

VISSAKIAQEILKSHDRTFSSRPSLTFAEAIFPDDLIFARYGARWRELRKICTLELFTARRVGSFAAVRQGEMEKFLAML

SQNLGRTVNITQEVTVLTLEIMQTLVFGTSRTFGANDFVRLVHQANELGGRLHIGDYVPWLKWMDLSLPKLRTLATKFHA

LLQAHIEEHRSSIAKQGHGGESFLDVLLSLDNMSDLTIRCLMLDAVSAGLDTTATAIGWALTELLLHPQILAKAQKELDD

VIPASSTMVSEADIPKLKYLGAIVKETLRKHPPAPLMVPRESTAECKLEEAGYMIPAKTQVLINLYAIARDPKIWENPLE

FIPERMSSEFNAAVELMTFGFGRRSCPGMNLGLTAVHLVLANLLYRFNWTTPDGKEVDVGEGVGFTLMRARPLALVPVLR

K*

 

>CYP792A3 gw1.47.81.1|Selmo1 94% to e_gw1.47.87.1|Selmo1

MEHITAFFAFLAS FFLVIFYYDRSKSRSSHVMPPSPRAFPILGHIPLLASNSRGPHLILFDLAKKLGPIFYLRLGYTPTIVISSAKIAQEILK

SHDRTFSSRPSLTFAEAILPDDLIFARYGARWRELRKICTLELFTARRVGSFAAVRQVEMEKFLAMLSQNLGRTVNITQE

VTVLTLEIMQTLVFGTSRTFGAKDFVRLVHQGNELGGRLHIGDYVPWLKWMDLSLPKLRTLATKFHALLQAHIEEHRSSI

AKQGHGGESFLDVLLSLDNMSDLTIRCLMLDAVSAGLDTTATAIGWALTELLLHPQILAKAQKELDDVIPASSAMVSEAD

IPKLKYLGAIVKETLRKHPPAPLMVPRESTAECKVTGYMIPAKTQVLINLYAIARDPKIWENPLEFIPERMSSEFNAAVE

LMTFGFGRRSCPGMNLGLTAVHLVLANLLYRFNWTTPDGKEVDVGEGVGFTLMRARPLALVPLLRK*

 

>CYP792A6 gw1.16.152.1|Selmo1 93% to e_gw1.47.87.1|Selmo1

MEHITAFFAFLAS FFLVIFYYDRSNSRSSHVMPPSPRAFPILGHIPLLASNSRGPHLILFDLAKKLGPIFYLRLGYTPTIVISSAKITQEILK

SHDRTFSSRPSLTFAEAILPDDLIFARYGARWRELRKICTLELFTARRVGSFAAVRQAEMEKFLAMLSQNLGRTVNITQE

VTVLTLEIMQTLVFGTSRTFGANDFVRLVHQGNELGGRLHIGDYVPWLKWMDLSLPKLRTLATKFHALLQAHIEEHRSSI

AKQGHGGESFLDVLLSLDNMSDLTIRCLMLDAVSAGLDTTATAIGWALTELLLHPQILAKAQKELDDVIPASSAMVSEAD

IPKLKYLGAIVKETLRKHPPAPLMVPRESTAECKVTGYTIPAKTQVLINLYAIGRDPNIWENPLEFIPERMSSEFNAATE

LMTFGFGRRSCPGMNLGLTAVHLVLANLLYRFNWTTPDGKEVDVGEGVGFTLMRARPLALVPLLRK*

 

>CYP792A2v1 gw1.47.82.1|Selmo1 92% to e_gw1.47.87.1|Selmo1

MEHITAFFAFLAS

FFLVIFYYDRSKSRSSHVMPPSPRAFPILGHIPLLASNSRGPHLILFDLAKKLGPIFYLRLGYTPTLVISSAKIAQEILK

SHDRTFSSRPSLTFAEAILPDDLIFARYGARWRELRKICTLELFTARRVGSFAAVRQVEMEKFLAMLSQNLGRTVNITQE

VTVLTLEIMQTLVFGTSRTFGANDFVRLVHQANELGGRLHIGDYVPWLKWMDLSLPKLRTLATKFHALLQAHIEEHRSSI

AKQGHGGESFLDVLLSLDNMSDLTIRCLMLDAVSAGLDTTATAIGWALTELLLHPQIFAKAQKELDDVIPASSTMVSEAD

IPKLKYLGAIVKETLRKHPPAPLMVPRESTAECKVTGSMIPAKTQVLINLYAIARDPKIWENPLEFIPERMSSEFNAAVE

LMTFGFGRRSCPGMNLGLTAVHLVLANLLYRFNWTTPDGKEVDVGEGVGFTLMRARPLALVPVLRK*

 

>CYP792A1v1 e_gw1.47.85.1|Selmo1 92% to e_gw1.47.87.1|Selmo1

MEHITAFFTFLASFILVIFYYDRSKSRSSHVMPPSPRAFPILGHIPLLASNSRGPHLILFDLAKKLGPIFYLRLGYTPTL

VISSAKIAQEILKTHDRIFSSRPSLTFAEAILPDDLIFARYGARWRELRKICTLELFTARRVGSFAAVRQAEMEKFLAML

SQNLRRTVNMTQELSVLTLEIMQTLVFGTSRTFGANDFLRLAHQANELGGRLHIGDYIPWLKWMDLSLPKLRTLATKFHA

LLQAHIEEHRSSIAKQGHGGESFLDVLLSLDNMSDLTIRCLMLDAVSAGLDTTATAIEWALAELLLHPQILAKAQKELDD

VIPASSAMVSEADIPKLKYLGAIVKETLRKHPPAPLMVPRESTTDCKVTGYTIPAKTQVLINLYAIARDPNIWENPLEFI

PESMSSEFNAAVELMTFGFGRRSCPGMNLGLAAVHLVLANLLYRFNWTTPDGKEVDVGESGSRSCVLVHLHWFHFSASNE

TY*

 

>CYP792A1v2 e_gw1.54.91.1|Selmo1 93% to e_gw1.47.87.1|Selmo1

MEHITAFFAFLASFILVIFYYDRSKSRSSHVMPPSPWAFPILGHIPLLASNSRGSHLILFDLAKKLGPIFYLRLGYTPTL

VISSAKIAQEILKTHDRIFSSRPSLTFAEAILPDDLVFARYGARWRELRKICTLELFTARRVGSFAAVRQAEMEKFLAML

SQNLRRTVNMTQELSVLTLEIMQTLVFGTSRTFGANDFLRLAHQANELGGRLHIGDYIPWLKWMDLSLPKLRTLATKFHV

LLQAHIEEHRSSIAKQGHGGESFLDVLLSLDNMSDLTIRCLMLDAVSAGLDTTATAIEWALTELLLHPQILAKAQKELDD

VIPASSAMVSEADIPKLKYLGAIVKETLRKHPPAPLMVPRESTTDCKVTGYTIPAKTQVLINLYAIGRDPSIWENPLEFI

PERMSSEFNAAVELMTFGFGRRSCPGMNLGLTAVHLVLANLLYRFNWTTPDGKEVDVGEGVGFTLMRARPLVLVPLLRK*

 

>e_gw1.14.836.1|Selmo1 89% to gw1.16.152.1|Selmo1

DAVSAGLDTTCHSDRMALTELLLHPQILAKAQKGLDDVIPASSAIVSEADISKLKYLVAIVKETLRKHPPAPLMVPREST

AECKVTGYAVPAKTQLLINLYAIGRDPNIWENPLEFIPERMSSEFNAAVELMTFGFGRRSCPGMKLGMISFLPIFSTS*

 

>fgenesh2_pg.C_scaffold_37000101|Selmo1 very similar to e_gw1.47.85.1|Selmo1

with some errors, pseudogene?

MEKFLAMLSQNLGRTVNMTQEVTVLTLEIIQTLVFGTSRTFGANDFLRLVRQGNELSGRLHIGDYVPWLKWMDLSLPKLT

IAKQGHGGESFLDVLLSLDNIAGLDTTATAIEWALIELLLHPQILAKAQKELDDVIPASSTMVSEADIPKLKYLGAIVKE

SLRKHPPPPLIVPRESTAECKLEEAGYMIPAKTQVLINLYAIGRDPNIWENPLEFIPERMSSEFNAAVELMTFGFGRRSC

PGMNLGLTAIHLVLANRSTGQHRMVKRWTWVRGSGSRSCGLVHLHWFHFSASSQTY*

 

>CYP792A7 fgenesh2_pg.C_scaffold_37000101 annotated manually, still missing N-terminal

RRYFCGRSDLGRKEIDDVAPDHLLVAQGWRSFPCRAPAKALKHLILFDLGPILYLRLGYTPTLVISSAKIAQEILKTHDR

TFSSRPSLTFAEAILPDDLIFARYGARWRGLGKICTLELFTARRVGSFAAVRQAEMEKFLAMLSQNLGRTVNMTQEVTVL

TLEIIQTLVFGTSRTFGANDFLRLVRQGNELSGRLHIGDYVPWLKWMDLSLPKLTIAKQGHGGESFLDVLLSLDNMSDLT

IRCLMLVRLGAGLDTTATAIEWALIELLLHPQILAKAQKELDDVIPASSTMVSEADIPKLKYLGAIVKESLRKHPPPPLI

VPRESTAECKVAGYMIPAKTQVLINLYAIGRDPNIWENPLEFIPERMSSEFNAAVELMTFGFGRRSCPGMNLGLTAIHLV

LANRSTGQHRMVKRWTWVRGSGSRSCGLVHLHWFHFSASSQTY*

 

>CYP792A8v2 fgenesh1_pm.C_scaffold_14000031|Selmo1 91% to e_gw1.47.87.1|Selmo1

MEHITAFFTFLASFFLVIFYYDRSKSRSSHVMPPSPRPFPILSHIPLLASNSRGPHLILFDLAKKLGPIFYLRLGYTPTL

VISSAKIAQEILKTHDRTFSSRPSLTFAEAILPDDLVFARYGARWRELRKICTLELFTARRVGSFAAVRQAEMEKFLAML

SQNLGRTVNMTQEVTVLTLEIMQTLVFGTSRTFGANDFLRLVRQGNELSGRLHIGDYVPWLKWMDLSLPKLRTLATKFHA

MLQAHIEEHRSSIAKQGHGGESFLDVLLSLHNMSDLTIRCLMLDAMSAGLDTTATAIEWALTELLLHPQILAKAQKELDD

VIPASSAIVSEADIPKLKYLGAIVKETLRKHPPAPLMVPRESTAECKLEEAGYMIPAKTQVLINLYAIGRDPNIWENPLE

FIPERMSSEFNSAVELMTFGFGRRSCPGMNLGLTAVHLVLANLLYRFNWTTPDVQIVMILANAQGFGHHKRV*

 

>CYP792A8v1 fgenesh2_pg.C_scaffold_1000223|Selmo1 89% to e_gw1.47.87.1|Selmo1

MPPSPRAFPILGHIPLLASNSRGPHLILFDLAKKLGLIFYLRLGYTPTLVISSAKIAQEILKTHDRTFSSRPSLTFAEAI

LPDDLIFARYGTRWRELRKICTLELFTARRVGSFAAVRQAEMEKFLAMLSQNLGRTVNMTHELSVLTLEIMQTLVFGTSR

TFGANDFLRLVHQANELGGRLHIGDYVPWLKWMDISLPKLRTLATKFHALLQAHIEEHRSSIAKQGHGGESFLDVLLSLD

NMSDLTIRCLMLDAVSAGLDTTATAIEWALIELLLHPQILAKAQKELDDVIPASSAIVSEADIPNLKYLGAIVKKSLRQH

PPAPLMVPRESTAECKLEEAGYMIPAKTQVLINLYAIGRDPNIWENPLEFILERMSNEFNAAVEPMTFCFGRRSCPGMNL

GLTAVHLVSLQVQLDNTGW*

 

>CYP792A9 fgenesh2_pg.C_scaffold_54000102|Selmo1 91% to e_gw1.47.87.1|Selmo1

MGKICTLELFTARRVGSFAAVRQVEMEKFLAMLSQNLGRTVNITQEVTVLTLEIMQTLVFGTRRTFGANDFVRLVHQGNE

LGGRLHIGDYVPWLKWMDLSLPKLRTLATKFHALLQAHIEEHRSSIAKQGHGGESFLDVLLSLDNMSDLTIRCLMLDAVS

AGLDTTATAIGWALTELLLHPQILAKAQKELDDVIPASSAMVSEADIPKLKYLGAIVKETLRKHPPAPLMVPRESTAECK

LEEAGYMIPAKTQVLINLYAIGRDPKIWENPLEFIPERMSSEFNAAVELMTFGFGRRSCPGMNLGLTAVHLVLANLLYRF

NWTTPDGKEVDVGEGVGFTLMRARPLALVPLLRK*

 

$$$$$$

 

>CYP794A1 e_gw1.74.75.1|Selmo1 39% to CYP75B1 in CYP71 clan

MGAFGLLLYLRNKMKKIQGNKQQLPPSPQSLPIIGHLHHFVSSGKEPHQLFQSLAAVHGPIFSLRLGYMNVVVVSDRSTA

KQVLKTNDLALASRPKLISVKHALYNFQDVVFSDYTKELREIRKFLAMELLSAKKLDMFTNVKEDELSWLVLTLANASEQ

LNTFKMRDYLVGLTYNVITRMLMGKRYYGAPPDDKEYEEGVAFKKVVDDAIKIGVAGSIADFFPQLEFLDWKVSQAKKVQ

RELDKFLQRMLDEHRVPNRGNSQEDFLDMILEASFMSDDRIKATESMTLLHLQDLITGGTDSSSSFLEWTLAELIMHPQV

LAKAQEEIDTVVGHGRKVKESDIPRMPYLQAVIKEGFRLHSPVPLLVPHYANQECSINGYTIPCNTTVFVNTYAMGRDPK

VWDNPLEFDPERFLSGPHKEVEVLGQNVNFELLPFGSGRRSCPGSALGNSIVHFTLATLLHCYDWKAGDKIDFAESSGAA

KIMKFPLCVQPTPRLQIQDMYVTNQYTNPIHM*

 

No allele found

 

$$$$$$

 

>CYP796B1v1 gw1.7.227.1|Selmo1 37% to CYP75B1 in CYP71 clan

MFWAVHIVVFLLTA

FILKQWLSSISLNLPPGPRGLPLIGHFHLLAMGKIPHIALQQLSKRFGPLFHLRLGSVPVFVVSSPEMAKEFLKNHDTEF

AYRPRNNVVSIVMDSRSMSFSPYGDYWKKLRKLCATEIFTAKRMSMNTQIIRDELWELSGELLRASKAGQVVGVRPHLRA

LSFNVMTRILMKKTYFGSKASGDPAIAAEASNFIAMIDEILEVGAAFSITDYFPYLSWLDLVARRAKVAGDKMNGFLQKV

LDEQRPGEVPDFVEVTRSHIGNDLVSLRALLMDLLLGGSETSSTVTEWALAELLHHPDWMVKAQQEIESVVGRTRMVEEG

DISKLEVLNAIIKESFRLHPPVSLLIPHASVEAQNVAGYDISKNAMLIVNVYAIGRDPRVWSDPLEFQPQRFIGSSIGVN

GQDFELLPFGSGKRACPGLHLGLRNVQLVLSNLLHGFEWKFPGSPKDQTMDEAMGNISFMAHTLKAKITPRLNESLY

RLT*

 

>CYP796B2v2 e_gw1.53.138.1|Selmo1 97% to gw1.7.227.1|Selmo1

MFWAVHIVVFLLTAFILKQWLSRISLNLPPGPRGLPLIGHFHLLAMGKLPHIALQQLSKRFGPLFHLRLGSVPVFVVSSP

EMAKEFLKNHDTEFAYRPRNNVVSIVMDSRSMSFSPYGDYWKKLRKLCATEIFTAKRMSMNTQIIRDELWELSGELLRAS

KAGQVVGVRPHLRALSFNVMTRILMKKTYFGSKASGDPAIAKEASNFIAMIDEILEVGAAFSITDYFPYLSWLDLVSRRA

KTAGDKMNGFLQKVLDEQRPGEVPDFVEVTRSHIGNDVVSLRALLMDLLLGGSETSSTVTEWALA

 

>CYP796B2v1 gw1.7.229.1|Selmo1 98% to gw1.7.227.1|Selmo1

MFWAVHIVVFLLTA

FILKQWLSSISLNLPPGPRGLPLVGHFHLLAMGKLPHIALQQLSKRFGPLFHLRLGSVPVFVVSSPEMAKEFLKNHDTEF

AYRPRNNVVSIVVDSRSMSFSPYGDYWKKLRKLCATEIFTAKRMSMNTQIIRDELWELSGELLRASKAGQVVGVRPHLRA

LSFNVMTRILMKKTYFGSKASGDPAIAAEASNFIAMIDEILEVGAAFSITDYFPYLSWLDLVARRAKVAGDKMNGFLQKV

LDEQRPGEVPDFVEVTRSHIGNDVVSLRALLMDLLLGGSETASTVTEWALAELLHHPDWMVKAQQEIESVVGRTRMVEEG

DISKLEVLNAIIKESFRLHPPVSLLIPHASVEAQNVAGYDIPKNAMLIVNVYAIGRDPRVWSDPLEFQPQRFIGSSIGVN

GQDFELLPFGSGKRACPGLHLGLRNVQLVLSNLLHGFEWKFPGSPKDQTMDEAMGNISFMAHTLKAKITPRLNESLY

RLT*

 

>CYP796B1v2 gw1.53.67.1|Selmo1 99% to gw1.7.227.1|Selmo1

FILKQWLSRISLNLPPGPRGLPLIGHFHLLAMGKIPHIALQQLSKRFGPLFHLRLGSVPVFVVSSPEMAKEFLKNHDTEF

AYRPRNNVVSIVMDSRSMSFSPYGDYWKKLRKLCATEIFTAKRMSMNTQIIRDELWELSGELLRASKAGQVVGVRPHLRA

LSFNVMTRILMKKTYFGSKASGDPAITAEASNFIATIDEILEVGAAFSITDYFPYLSWLDLVARRAKVAGDKMNGFLQKV

LDEQRPGEVPDFVEVTRSHIGNDLVSLRALLMDLLLGGSETSSTVTEWALAELLHHPDWMVKAQQEIESVVGRTRMVEEG

DISKLEVLNAIIKESFRLHPPVSLLIPHASVEAQNVAGYDIPKNAMLIVNVYAIGRDPRVWSDPLEFQPQRFIGSSIGVN

GQDFELLPFGSGKRACPGLHLGLRNVQLVLSNLLHGFEWKFPGSPKDQTMDEAMGNISFMAHTLKAKITPRLNESLY

 

>CYP796B6v2 e_gw1.53.65.1|Selmo1 91% to gw1.7.227.1|Selmo1

MLWAVALFLITAFILKHWLSSKSFNLPPGPRGLPLIGHFHLLGRLPHISLQQLSKRYGPLFHLRLGSVPVFVVSSPEMAK

EFLKNHDTEFAYRPRNNAVSIVMDCRSMSFSPYGDYWKKLRKLCATEIFTAKRVSMNTQIIRDELWELSGELLRASKAGQ

VVGVRPHLRALSFNVMTRILMKKTYFGSKASGDPAIAKEASNFIAMIDEILEVGAAFSITDYFPYLSWLDLVARRAKVAG

DKMNGFLQKVLDEQRPGEVPDFVEITRSHIGNDAGNLRALLMDLLLGGSETSSTVTEWALAELLHHPDWMVKAQQEIESV

VGRTRMVEEGDISKLEVLNAIIKESFRLHPPIALLVPHASIEAQKVAGYDIPKNATLLVNVYAIGRDPQVWSDPLEFQPQ

RFIGSNIGVSGQDFELLPFGSGKRSCPGLALGLRNVQLVLSNLLHGFEWEFPGSPKDQPMGEAMGIVNFMAHTLKARITP

RLHESAYTTLQLTE*

 

>CYP796B7v2 gw1.53.130.1|Selmo1 90% to gw1.7.227.1|Selmo1

MFWAVTLFLFSAFILRQWLSSISLNLPPGPRGLPLIGHFHLLAMGKLPHIALQQLSKRFGPLFHLRLGSVPVFVVSSPAM

AKEFLKIHDTEFAYRPRNNTASIIFDFRSMSFSPYGDYWKKLRKLCATELFTAKRVSLNAQIIRDELWDLSRELSRASKA

GQVVGVRSHLRALSFNVMTRILMKKTYFGSKASGDPAIAEDASNFIGMIDEFLEVGAEFSITDYFPYLSWLDLVARRAKV

AGDKMNGFLQKVLDEQRPGEVPDFVEITRSHIGNDAANLKALLMDLLLGGSETSSTVIEWALAELLHHPDWMIKAQQEIE

NVVGHTRMVEEADISKLEVLNAIIKESFRLHPPVSLLIPHASVEAQNVAGYDIPKNATLIVNVYAIGRDPQVWSDPLEFQ

PQRFIGSSIGVNGQDFELLPFGSGKRSCPGLLLGIRNVQLVLSNLLHGFEWKFPGSPKDQPMDEATAVVNYMAHTLKARI

TPRLNESAY

 

>CYP796B7v1 gw1.7.407.1|Selmo1 89% to gw1.7.227.1|Selmo1

MFWAVTLFLFSAFILRQWLSSISLNLPPGPRGLPLIGHFHLLAMGKLPHIALQQLSKRFGPLFHLRLGSVPVFVVSSPAM

AKEFLKIHDTEFAYRPRNNTASIIFDFRSMSFSPYGDYWKKLRKLCATELFTAKRVSLNAQIIRDELWDLSRELSRASKA

GQVVGVRSHLRALSFNVMTRILMKKTYFGSKASGDPAIAEDASNFIGMIDEFLEVGAEFSITDYFPYLSWLDLVARRARV

AGDKMNGFLQKVLDEQRPGEVPDFVEITMSHIGNDAANLKALLMDLLLGGSETSSTVIEWALAELLHHPDWMIKAQQEIE

NVVGHTRMVEEADISKLEVLNAIIKESFRLHPPVSLLIPHASVEAQNVAGYDIPKNATLIVNVYAIGRDPQVWSDPLEFQ

PQRFIGSSIGVNGQDFELLPFGSGKRSCPGLLLGLRNVQLVLSNLLHGFEWKFPGSPKDQPMDEATAVVNYMAHTLKARI

TPRLNESAYTTLKLTQE*

 

>CYP796B4v1 e_gw1.7.221.1|Selmo1 88% to gw1.7.227.1|Selmo1

MLWAVALFLITAFILKQWLSSKSFNLPPGPRGLPLIGHFHLLGRLPHISLQQLSKKFGPLFHLRLGSVPVFVVASPAMAK

EFLKNHDTEFAYRPRNNVASIVVNCKGISFAPYGDYWKKLRKLCATELFTAKRVSMNTHIIRDELWELSREFLRASKAGQ

VVGVRSHLRALSFNVMTRILMKKTYFGSKASGDPAIAKEASNFIAMIDEILEVVAAFSITDYFPYLSWLDLVPRRAKMAG

DKMNGFLLKVLDEQRPGEVPDFVEITRNHIGNDVVNLRALLMDLLLGGSETSSTVTEWALAELLHHPDWMVKAQQEIESV

VGHTRMVEEGDISKLEVLNAIIKESFRLHPPIALLVPHASIEAQKVAGYDIPKNTTLLVNVYAIGRDPQVWSDPLEFQPQ

RFIGSNIGVNGHDFELLPFGSGKRSCPGLALGLRNVQLVLSNLLHGFEWEFPGSPKDQPMGEAMGIVNFMAHTLKARITP

RLHESAYTTLQLTE*

 

>CYP796B3v1 gw1.7.225.1|Selmo1 88% to gw1.7.227.1|Selmo1

MLWAVALFLITA

FILKQWLSSKSLNLPPGPRGLPLIGHFHLLGRLPHISLQQLSKKFGPLFHLRLGSVPVFVVASPAMAKEFLKNNDTEFAY

RPRNNVASIVMNCRSMSFSPYGDYWKKLRKLCATELFTAKRVSMNTHIIRDELWEVSREFLRASKAGHVVGVRSHLRALS

FNVMTRILMKKIYFGSKASSDPAIAKEASNFIAMIDENLKVAAAFSITDYFPYLSWLDLVARRAKMAGDKMNGFLQKVLE

EQRQGEVPDFVEITRNHIGNDVVNLRALLMDLLLGGSETSSTVTEWALAELLHHPDWMVKAQQEIESVAGHTRMVEEGDI

SKLEVLNAIIKETFRLHPPVALLVPHASIEAQKVAGYDIPKNATLLVNVYAIGRDPQVWSDPLEFQPQRFIGSNIGVNGQ

DFELLPFGSGKRSCPGLSLGLRNVQLVLSNLLHGFEWEFPGSPKDQPMGEAMGIVNFMAHTLKARITPRLHESAY

ITLQSTE*

 

>CYP796B3v2 fgenesh2_pg.C_scaffold_53000139|Selmo1 89% to e_gw1.53.62.1|Selmo1

MFWAVALFLFSAFILKQWLSSKSLNLPPGPRGLPLIGHFHLLGRLPHISLQQLSKRYGPLFHLRLGSVPVFVVSSPEMAK

ESMSFSPYGDYWKKLRKLCATEIFTAKRVSMNTQIIRDELWELSGELLRASKAGQVVGVRPHLRALSFNVMTRILMKKTY

FGSKASGDPAIAKEASNFIAMIDEILEVGAAFSITDYFPYLSWLDLVSRRAKVAGDKMNGFLQKVLDEQRPGEVPDFVEI

TRSHIGNDAVNLRALLMVSYESMIFSVELT*

 

>CYP796B4v2 e_gw1.53.62.1|Selmo1 87% to gw1.7.227.1|Selmo1

MLWAVVLFLITAFILKQWLSSKSLNLPPGPRGLPLIGHFHLLGRLPHISLQQLSKKFGPLFHLRLGSVPVFVVASPAMAK

EFLKNNDTEFAYRPRNNVACIVVNCKSLSFSPYGDYWKKLRKLCATELFTAKRVSMNTHIIRDELWELSREFLRASNAGQ

VVEVRSHLRALSFNVMTRILMKKIYFGSKASGDPAIAKEASNFIAMIDENLEVAAAFSITDYFPYLSWLDLVARRAKMAG

DKMNGFLQKVLDEQHPGEVPDFVEITKNHIGNDVVNLRAVLMDLLLGGSETSSTVTEWTLAELLHHPDWMVKAQQEIESV

VGRTRMVEEGDISKLEVLNAIIKESFRLHPPISLLVPHASIEAQKVAGYDIPKNTTLLVNVYAIGRDPQVWSDPLEFQPQ

RFIGSNIGVNGQDFELLPFGSGKRSCPGLALGLRNVQLVLSNLLHGFEWEFPGSPKDQPMGEAMGIVNFMAHTLKARITP

RLHESAYTTLQLTE*

 

>CYP796B5 e_gw1.7.596.1|Selmo1 87% to gw1.7.227.1|Selmo1

MLWAVALFLITAFILKQWLSSKSFNLPPGPRGLPLIGHFHLLGRLPHISLQQLSKKFGPLFHLRLGSVPVFVVASPAMAK

EFLKNNDTEFAYRPRNNVASIVVNCKSISFSPYGDYWKKLRKLCATELFTAKRVSMNTHIIRDELWELSREFLRASKAGQ

VVGVRSHLRALSFNVMTRILMKKIYFGSKASGDPAIAKEASNFIAMIDENLEVAAAFSITDYFPYLSWLDLVARRAKMAG

DKMNGFLQKVLDEQRPGEVPDFVEITRNHIGNDMVNLRSLLMVSLVFSDLLLGGSETSSTVTEWALAELLHHPDWMVKAQ

KEIESVVGHTRMVEEGDISKLEVLNAIIKETFRLHPPVALLVPHASIEAQKVAGYDIPKNATLLVNVYAIGRDPQVWSDP

LEFQPQRFIGSNIGVNGQDFELLPFGSGKRSCPGLSLGLKNVQLVLSNLLHGFEWEFPGSPKDQPMGEAMGIVNFMAHTL

KARITPRLHESAYTTLQLIE*

 

>CYP796B6v1 gw1.7.1059.1|Selmo1 90% to gw1.7.227.1|Selmo1

MLWAVALFLITAFILKHWLSSKSFNLPPGPRGLPLIGHFHLLGRLPHISLQQLSKRYGPLFHLRLGSVPVFVVSSPEMAKEFLKNHDTGFAYRPRNNAVSIVMDCRSMSFSPYGDYWKKLRKLCATELFTAKRVSMNTQIIRDELWGLSGELLRASKAGQVVGVRPHLRALSFNVMTRILMKKTYFGSKASGDPAIAKEASNFIAMIDEILEVGAAFSITDYFPYLSWLDLVAGRAKVAG

DKMNGFLQKVLDEQRPGEVPDFVEITRSHIGNDAGNLRALLMDLLLGGSETSSTVTEWALAELLHHPDWMVK

AQQEIESVVGRTRMVEEGDISKLEVLNAIIKETFRLHPPIALLVPHASMEAQKVAGYDIPKNAMLLVNVYAIGRDPRVWC

DPLEFQPQRFMGSNIGVSGQDFELLPFGSGKRSCPGLPLGLRNVQLVLSNLLHGFEWEFPGSPKDQQMGEVTGI VNFMAHTLKARITP

RLHESAYTTLQLTE*

 

 

>CYP796B8v1 e_gw1.14.364.1|Selmo1 81% to e_gw1.53.65.1|Selmo1

MFWAVVLLLLTALIFKQWLSSKSLNLPPGPRGLPLIGHFHLLGRLPHISLQQLSKKFGPLLHLRLGSVPLVVVSSPAMAK

AFLKTHDTEFAYRPRNNVVSIVTDYKTITFAHGDYWKKLRKLCTTELFTATRVSMNTQIIRDELWELSRELLRASEAGQV

VGVRSHLKVLNFNIMTRILMKKSYFGAKASGDPAIAKEALDFMDMIDEILEVGASFSITDYFPYLSWLDLVAGRARVAGH

KMNGFLQKVLDEQRPGEVPDFVEITRSCLGNNAFNLKALLLDLLVAGSETSSTVSEWALA

 

>CYP796B8v1 e_gw1.14.364.1 manually annotated

MFWAVVLLLLTALIFKQWLSSKSlnlppgprglpligHFHLLGRLPHISLQQLSKKFGPLLHLRLG

svplvvvsspAMAKAFLKTHDTEFAYRPRNNVVSIVTDYKTITFAHGDYWKKLR

KLCTTELFTATRVSMNTQIIRDELWELSRELLRASEAGQVVGVRSHLKVLNFNIMTRILM

KKSYFGAKASGDPAIAKEALDFMDMIDEILEVGASFSITDYFPYLSWLDLVAGRARVAG

HKMNGFLQKVLDEQRPGEVPDFVEITRSCLGNNAFNLKALLL

DLLVAGSETSSTVSEWALAELLHHPDWIVKAQQEIESVVGRKRMVEEADISKLEVVNAII

KETFRlhpplslllphasiaahKVAGYDIPKNTMLLVNVYAIGRDPQVWSDPLEFQPQRF

IGSNMGVHGQDFELLPFGSGKRSCLGLPLGLRTVQLVLSNLLHGFEWDFSSSEKD

QPMGEVMGFVNFMAHALKARIRPRLDEDAYSTLKLTLK*

 

>CYP796B8v2 e_gw1.37.226.1|Selmo1 98% to e_gw1.14.364.1|Selmo1

MFWAVVLLLLTALIFKQWLSSKSLNLPPGPRGLPLIGHFHLLGRLPHISLQQLSRKFGPLLHLRVGSVPLVVVSSPAMAK

AFLKTHDTEFAYRPRNNVVSIVTDYKTITFAHGDYWKKLRKLCTTELFTATRVSMNTQIIRDELWELSRELLRASEAGQV

VGVRSHLKVLNFNIMTRILMKKSYFGAKASGDPAIAKEALDFIDMIDEILEVGASFSITDYFPYLSWLDLVAGRARVAGH

KMNGFLQKVLDEQRPGEVPDFVEITRSCLGNDAFNLKALLLDLLVAGSETSSTVSEWALA

 

$$$$$$

 

>CYP797E5 e_gw1.43.55.1|Selmo1 43% to 92A9 IN CYP71 CLAN

MEFPVYFLVALVVCFLGRSLLQSRKRLPPSPWGLPLIGHVHHLSALPHQSLQNLSRKLGGIMYLRLGMTPVIVISSPDLA

KEALRSNDSSFGFRPYLLVGEYLTYNFKGIGLSNGDHWKNMRKICITELFSVKRLESFRGLRLAEVSHLVSRLAQASKSQ

SVVNVRELLTDFNVNIVSQMLMSKRFFENKNLGGEEVEEVRQLREFLEELTRFALKFHISEFVPAWLRWIDWNIPHARKL

VAKQEKFFEKIIQEHKSSQKSRPVMDFMDILLQHQEDEEAAKATFMELLAAGTDTSACTTEWALLELLNNPEIMRKAQEE

LDTVVGRDRMVTESDLHKLLYLEDIVKETFRFHPPGPLLPRMSTQACVLGESFDIPKGATTIINFYAIGRDPRVWDKPEK

FWPERFQGSTIDVKGQDFELIPFGSGRRSCPGMLLGLKSVYLTLANLIHGFNWEPVARGGSYNMDEAFMSVIWPKLALQA

KVTSM*

 

>CYP797E3v2 e_gw1.125.26.1|Selmo1 90% to e_gw1.43.55.1|Selmo1

NKGFMEFPVYFLVALVVCFLGRSLLQSRKRLPPSPWGLPLIGHLHHLSMLPHQSLQNLSRKLGGIMYLRLGMIPAIVISS

PDLAKEALRSNDSSFGFRPYLLVGEYLTYNFKGIAFSNGDHWKNMRKICITELFSVKRMESFQGMRLAEVSHLVSRLAQA

SKSQSVVNVRELVTDFNFNIVSQMLMSKRFSGNMNLGGEEIEEARQLREVLQELARFTLKFHISEFIPAWLRWIDWSIPH

ARKIVAKQEKFFEKIIQEHKSSQKSRPVMDFMDILLQHQGDEEVAKATLVVSE*

 

>CYP797E3v1 e_gw1.43.151.1|Selmo1 98% to e_gw1.14.364.1|Selmo1

81% to e_gw1.53.65.1|Selmo1

NKGFMEFPVYFLVALVVCFLGRSLLQSRKRLPPSPWGLPLIGHVHHLSRLPHQSFQNLSRKLGGIMYLRLGMTPAIVISS

PDLAKEALRSNDSSFGFRPYLLVGEYLTYNFKGIGLSNGDHWKNMRKICITELFSVKRLESFRGLRLAEVSHLVSRLAQA

SKSQSVVNVRELVTDFNFNIVSQMLMSKRFFGNKNLGGEEIEEARQLREVLEVPHK*

 

>CYP797E3v1 e_gw1.43.151.1 manually annotated

MEFPVYFLVALVVCFLGRSLLQSRKRLPPSPWGLPLIGHVHHLSRLPHQSFQNLSRKLGGIMYLRLGMTPAIVISSPDLA

KEALRSNDSSFGFRPYLLVGEYLTYNFKGIGLSNGDHWKNMRKICITELFSVKRLESFRGLRLAEVSHLVSRLAQASKSQ

SVVNVRELVTDFNFNIVSQMLMSKRFFGNKNLGGEEIEEARQLREVLEVPHKKSWRFHISEFVPAWLRWIDWNIPHARKI

VAKQEKFFKKIIQEHKSSQKSRPVMDFMDILLQHQEDEEVAKATLMVSELSSSFSQELLAAGTDTSACTTEWALLELLNN

PEIMRKAQEELDTVVGRDRMVTESDLHKLLYLEDIVKETFRLHPPAPLLMPRMSTQACVLGESFDIPKGATTIINFYAIG

RDPRVWDKPEKFWPERFQGSTIDVKGQDFELIPFGCGRRICPGMLLGLKSVYLTLANLIHGFNWEPVVRGGSYNMDEAFM

SVIWPKLPLQAKVTSL*

 

>fgenesh2_pg.C_scaffold_43000172|Selmo1 61% to e_gw1.125.9.1|Selmo1 premature stop codon, maybe pseudogene.

MAWMIPAIVISSPDLAKQVFKAEDSTFSFRPYLLVGEHSGYNFKGIALASGNHWKSMRGICTTELFTVKCIDSFFWVRME

ELSYFVSSLAQACKDQSIVDAREHLTGLTLKVQTRILMSKRFPGENLSGDELAEARVFKDYDNTKFLLCFPHDIWIFIAK

PTPLCMRLSLFLLPEFPMTKHSRGGFDNLLVISSVLKQSIHEIRCGVGFVGFVFVDDLLEEFVLLGSNSFGLWYVPVEPR

WYKLTYMELESKLD*

 

>CYP797E2 fgenesh2_pg.C_scaffold_43000172 manually annotated

MAWMIPAIVISSPDLAKQVFKAEDSTFSFRPYLLVGEHSGYNFKGIALASGNHWKSMRGICTT

ELFTVKCIDSFFWVRMEELSYFVSSLAQACKDQSIVDAREHLTGLTLKVQTRILMSKRFP

GENLSGDELAEARVFKD

LIDESVKFAFQFHISEFIPSWLNWNIPQAKRVAAKQDEFLQKIINEHKANKSHPT

TDFMDTLLEHRRDDQEVVKATLVEILAAGIETSACTV

EWALLELL

KNPDIMRKAQEELGVVI

GGDGMVLESDFP*LTYLEAIVKETFRIHPSMPLLVPRMSMQAC

KLVSWVNHLKFDVTTIVNFYSIGRDPKVWENPTKVWPQRFPVG

FRLAIDVKGHDFELIPFGAGRRMSLGKTVYLTLGNMLHGYDWRRL

PGKRYGFDETFGAVSWPKLSLQVRVTPRQAKIAK*

 

>CYP797E4v1 fgenesh2_pg.C_scaffold_43000173|Selmo1 pseudogene

TGGKWHDAKGGGLPRFTVSGHPDSFLWVGMEELSYLMSSLAQACKDRCVVDVREHLMILT

FNIQTRILTSKRFFGENLSDNELAEARVFKELIDESVKFAFQFHISEF (0)

ELLAAGTDTSTCRVEWALLELLNNPDVMRKGQEEL

DVVIGGDGMVLKLTYLETIVKETFRIKGATTIVIFYSVGRDPKFGTKFWSERFLGLAIDV

KGQDFELIPFGAGRRICPGMSLGLKTIYLTLGNLLHDFNPDVLFH

 

 

>CYP797E4v2 fgenesh2_pg.C_scaffold_125000028|Selmo1 42% to CYP76C1 in CYP71 clan

99% to fgenesh2_pg.C_scaffold_43000173|Selmo1

MCAVGKEGWGRRRHTPGGMGGYQAAHPCRCPGSFAGRSHHRQRCSNWWDQGGARPTGGKWHDAEGGGLPRFTVSGHPDSF

LWVGMEELSYLMSSLAQACKDRCVVDVREHLMILTFNIQTRILTSKRFFGENLSDDELAEARVFKELIDESVKFAFQFHI

TELLAAGTDTSTCRVEWALLELLNNPDVMRKGQEELDVVIGGDGMVLKLTYLETIVKETFRIKGATTIVIFYSVGRDPKF

GTKFWSERFLGLAIDVKGQDFELIPFGAGRRICPGMSLGLKTIYLTLGNLLHDFNPDVLFH*

 

 

$$$$$$

 

>CYP787A1v2 e_gw1.46.125.1|Selmo1 40% to 71A21 in CYP71 clan, 43% to 92A11

extend N-term

MNWFLLAFACILTAVISVSWWLMLKSRLRLPPGPMALPIVGHLHLLLKLPHQSFHKLSHKFGPIMTIKLGNKTAIVISSK

KAAKEILTSYDRVFASRPVLISPQSLCYNSKNISCCKYGPYWREMRKICTTELFSSKRLSSFQNTRLEETQNLLQRVAEQ

LKVPINMKIELSTLTLNVITRMAIGKKFRHGEFSEDAEPLNVILEAVRLMGAVNLGDYIPFLKRLDPGGYIPRLKKTSKK

IDCILQRLVDDHREEKVKSGDLVDVLQSVGIEDSAIKAVILDILAGGTDTTAVTTEWALSELLRNPECLRKVQQEIHVIV

GDNRLVNENDLHHLHYLKAVVKETFRLHPAAPMMAPHESIEACTLKGYTIPAKTWLLINAWSMGRDPAQWDSPEEFMPER

FINSSIDVKGCDFELIPFGAGRRMCVGMSLALCMVELTLARLVQAFHWALPDGSTMNMEERQGVIVARKHPLIAVANRRL

PPEVYINTL*

 

>CYP787A1v1 e_gw1.1.394.1|Selmo1 98% to e_gw1.46.125.1|Selmo1 44% TO CYP92A11, 45% to 92A9

EU032591.1 = MRNA, FE470773.1 = EST

VERY SIMILAR TO FE498320

 

M  P  T  S  C  C  K  M  K  L  P  G  T  F  V  F  V  I  G  S  L  L

F  T  L  L  V  V  A  C  Q  A  L  D  H  L  S  T  S  P  G  T  Q 

MNWFLLTFACILTAVISVSWWL

MLKSRLRLPPGPMALPIVGHLHLLLKLPHQSFHKLSHKFGPIMTIK LGNKTAIVISSKKAAKEILTSYDRVFASRPVLIS

PQSLCYNSKNISCCKYGPYWREMRKICTTELFSSKRLSSFQNTRLEETQNLLQRVAEQLKVPLNMKIELSTLTLNVITR M

AIGKKFRHGECSEDAEPLNVILEAVRLMGAVNLGDYIPFLKRLDPGGYIPRLKTTSKKIDCILQRLVDDHREEKVKSGDL

VDVLQSVGIEDSAIKAVILDILAGGTDTTAVTTEWALSELIRNPDCLRKVQQEIHVIVGDSRLVNENDLHHLHYLKAVVK

ETFRLHPAAPMMAPHESIEACTLKGYTIPAKTWLLINAWSMGRDPAQWDSPEEFMPERFINSSIDVKGCDFELIPFGAGR

RMCVGMSLALCMVELTLARLVQAFHWALPDGSTMNMEERQGVIVARKHPLIAVANRRLPPEVYINTL*

 

>FE498320 mRNA Selaginella

MNSYSCCKMKLPGTFVFVMVSLLFTLLVVACQALDHLSTSPGTQ

MNWFLLAFACILTAVISVSWWLMLKSRLRLPPGPMALPIVGHLHLLLKLPHQSFHKLSHK FGPIMTIK

 

>SM117.6 CYP787A1v1 100% to e_gw1.1.394.1|Selmo1 except one boundary diff (remove K)

N-term longer, probably correct.

MNWFLLTFACILTAVISVSWWL

MLKSRLRLPPGPMALPIVGHLHLLLKLPHQSFHKLSHKFGPIMTIKLGNKTAIVISSKKAAKEILTSYDRVFASRPVLISPQSLCYNSKNISCCKYGPYWREMRKICTTELFSSKRLSSFQNTRLEETQNLLQRVAEQLKVPLNMKIELSTLTLNVITRMAIGKKFRHGECSEDAEPLNVILEAVRLMGAVNLGDYIPFLKRLDPGGYIPRLKTTSKKIDCILQRLVDDHREEKVKSGDLVDVLQSVGIEDSAIKAVILKDILAGGTDTTAVTTEWALSELIRNPDCLRKVQQEIHVIVGDSRLVNENDLHHLHYLKAVVKETFRLHPAAPMMAPHESIEACTLKGYTIPAKTWLLINAWSMGRDPAQWDSPEEFMPERFINSSIDVKGCDFELIPFGAGRRMCVGMSLALCMVELTLARLVQAFHWALPDGSTMNMEERQGVIVARKHPLIAVANRRLPPEVYINTL

 

$$$$$$

>CYP787A2v1 gw1.93.63.1|Selmo1 63% to e_gw1.46.125.1|Selmo1

LPPGPWGLPLIGHLHHLIHLPHQSLHHLSRKYGPVMSIKLGNKTAIVVSSKQAAKEVLTSFDKVFASRPCLISPESLCYG

SRDIACCEYGPYWRQMKKLCMTHLFTAKRLEDFRSIRLEETLELLRDIASNQARPVDMKSKLSMLTFNVITRMTFTKRFY

DRWSAASDPRFVEVILEAVSLMGAVNIGDYIPWLSWLDLGGYHKRLEKTSKEIDEVLQRLIDQHREAA

 

>CYP787A2v1 gw1.93.63.1 manually annotated

MSLITLISIIVLIVTWFIKWTSVRKDLPPGPWGLPLIGHLHHLIHLPHQSLHHLSRKYGP

VMSIKLGNKTAIVVSSKQAAKEVLTSFDKVFASRPCLISPESLCYGSRDIACCE

YGPYWRQMKKLCMTHLFTAKRLEDFRSIRLEETLELLRDIASNQARPVDMKSKLSMLTFN

VITRMTFTKRFYDRWSAASDPRFVEVILEAVSLMGAVNIGDYIPWLSWLDLGGYHKRLEK

TSKEIDEVLQRLIDQHREAALPLRDDPGDLIHTFLSLGVDDKSMKGVIL

QDILAGGTDTTAVTTEWALSELIRNPGTLQELRQEIQNIVGDERLVEESDLQ

KLHYLRAVIKETFRLHPAAPLMAPHESIDDCELQGYKIPRKTWLMVNLWSLGRDPRSWES

PEAFKPERFLGSSIDVKGNDFELIPFGSGRRICAGMSLALIMVGLTLARLVQAFDWSLPG

NEEMNMEESQGVIMRRRKPLVVSAKWRLNMQS*

 

$$$$$$

 

>CYP791B1v1 estExt_fgenesh2_pg.C_00766|Selmo1 35% to 92A11 in CYP71 clan

METWIAPLAVLFGLSVALLLKSWILRQPSGGAGCSLPPSPRALPLIGHLHLVLGKHLHRAFGEIAREHGPCVFLKFGSSP

HLVISSAQAAREAIRVRDSTYSSRPFLSPAARAEEMALAVAKLVEASRGPMPRTVSLTQVISDVTYGMILRKVVGNGHRR

NEEALRFKHLLKEVFVAAGEFYVGDTMPWLQWLDLRKAAHAKRLYKQVDEYMQRLVDEQRRKGGDIGDDFISIMLRNELF

SKSDSFMKAIVLDMIGAGTDTSAVTIEWAMAELINNPRIMSRLLEELHSVVGPSSLKVEEAHLDKLVYLDAVVKETLRLH

PPAAILIFQAAQPCQVMDYFVPEGTRVFINNYEIARDERCWEEPLKFKPERFVERNIDIVGVRDFEMLPFGSGRRGCPGI

QLGLRVVHFVLANLVHGFEWKNPSGKELDMSEGSGLTLPRAVPLELTISSRI*

 

>CYP791B1v2 e_gw1.8.676.1|Selmo1 95% to estExt_fgenesh2_pg.C_00766|Selmo1

METWIAPLAVLFGLSVALLVKSWILRPPSGGAGCSLPPSPRALPLIGHLHLVLGKHLHRAFGEIAREHGPCVSLKFGSSP

YLVISSAQAAREAIRVRDSTYSSRPFLTPGQCKIFGADGILWTPYGEYWRNVRKLCTLELLTLRQIQRSQAARAEEMALA

VAKLVEASRGPMPGTVNLTEVISDVTYGMILRKVVGNGHRRNEEALRFKHLLKEVFVAMGDFYVGDIMPWLQWLDLRKAA

HAKRLYKQVDEYMQRLVDEQRRKGADIGDDFISIMLRNELFSKSDSFMKAIVLDMIGAGTDTSAVTIEWAMAELINNPSV

MSRLLEELHSVVGPSSLKVEEAHLDKLVYLGAVVKETLRLHPPGAILIFQAAQPCQVMDYFVPEGTRVFINNYEIARDER

CWEEPLKFKPERFVERNIDIVGLRDFEMLPFGSGRRGCPGIQLGLRVVHFVLANLVHGFEWKNPSGKELDMSEGSGLTLA

RAVPLELTISPRI*

 

$$$$

 

>CYP791B2v1 estExt_fgenesh1_pm.C_80016|Selmo1 97% to estExt_fgenesh2_pg.C_00766|Selmo1. N-terminal modified

METWIAPLAVLFGLSVALLVKSWILRPPSGG

AGCSLPPSPRALPLIGHLHLVLGKHLHRAFGEIAREHGPCVFLKFGSSPHLVISSAQAAREAIRV

RDSTYSSRPFLTPGKIFGADGILWTPYGEYWRNVRKLCTLELLTLRQIELSQAARAEEMALAVAKLVKASRGPMPRTVNL

TQVISDVTYGMILRKVVGNGHRRNEEALRFKHLLKEVFVAAGDFYVGDTMPWLQWLDLRKAAHAKRLYKQVDEYMQRLVD

EQRRKGADIGDDFISIMLRNELFSKSDSFMKAIVLAMIGAGTDTSAVTIEWAMAELINNPRIMSRLLEELHSVVGPSSLK

VEEAHLDKLVYLGAVVKETLRLHPPGAILIFQAAQPCQMMDYFVPEGTRVFINNYEIARDERCWEEPLKFKPERFVERNI

DIVGVRDFEMLPFGSGRRGCPGIQLGLRVVHFVLANLVHGFEWKNPSGKELDMSEGSGLTLPRAVPLELTISSRI*

 

>CYP791B2v2 SM1583323 98% (5 aa diffs) to estExt_fgenesh1_pm.C_80016|Selmo1

N-terms not the same

METWIAPLAVLFGLSVALLVKSWILRPPSGG

AGCSLPPSPRALPLIGHLHLVLGKHLHRAFGEIAREHGPCVFLKFGSSPHLVISSAQAAREAIRVRDSTYSSRPFLTPGKIFGADGILWTPYGEYWRNVRKLCTLELLTLRQIELSQAARAEEMALAVAKLVKASRGPMPRTVNLTQVISDVTYGMILRKVVGNGHRRNEEALRFKHLLKEVFVAAGDFYVGDTMPWLQWLDLRKAAHAKRLYKQVDEYMQRLVDEQRRKGGDIGDDFISIMLRNELFSKSDSFMKAIVLDMIGAGTDTSAVTIEWAMAELINNPRIMSRLLEELHSVVGPSSLKVEEAHLDKLVYLDAVVKETLRLHPPAAILIFQAAQPCQVMDYFVPEGTRVFINNYEIARDERCWEEPLKFKPERFVERNIDIVGVRDFEMLPFGSGRRGCPGIQLGLRVVHFVLANLVHGFEWKNPSGKELDMSEGSGLTLPRAVPLELTISSRI*

 

$$$$$$

 

>CYP796A1v1 gw1.0.529.1|Selmo1 97% to e_gw1.8.277.1|Selmo1

MASLVNATAALQDEGPASNTIRATLTIALVAAVIAWWAIAKSRYGLKNLPPGPRGLPIIGHFHLIGRLPHVSLQQLSAKFGPLMSLRFGFVPVVVVSSPAMA

REILKTHDTAFADRPYKIAANFIFYGQRSISWSSYGDHFKKARKLCATELFTARRVTSFTHVIRDELWKLSGELRAASAS

GEVVKLRRHLRGLSFNLMTRILMKKVYFGPGASTDESALQEAKEFVNIIDSVLTVGGAFAITDFFPGTKWIDWTVPAAKA

ASDKLNSFLTKVLDEQRPGEVPDFVALTKSYFDGPDQMKYTKALLVDMFLGGSETSSTVVEWAMAELLHYPKVIAKAQEE

LERVVGRERMIEESDLPKLEYFSALVKEVFRLHPPLTMMVPHTTAQNQKVAGYDIAKNSMIFVNVFAIGRDPSVWSNPLE

FNPDRFMGTSFNVHGHDFELLPFGSGKRGCPGLPLGLRNVQLVLSNLLHGFDWSYAGDIEKHQMTEAMAVVNFMEHPINV

RASPRLDDATYKTLSINT*

 

>CYP796A1v2 e_gw1.8.277.1|Selmo1 42% to 92A12 in CYP71 clan

MASLVNATAALQDEGPASNTIRATLTIALVAAVIAWWAIAKSRYGLKNLPPGPRGLPIIGHFHLIGRLPHVSLQQLSANF

GPLMSLRFGFVPVVVVSSPAMAREFLKTHDTAFADRPYKIAANFIFYGQRSISWSSYGDHFKKARKLCATELFTARRVTS

FTHIIRDELWKLSGELRAASASGEVVKLRRCLRGLSFNLMTRILMKKVYFGPGASTDESALQEAKEFVNIIDSVLTVGGA

FAITDFFPGTKWLDWTVPAAKAASDKLDSFLTKVLDEQRPGEVPDFVALTKSYFDGPDQMKYTKALLVDMFLGGSETSST

VVEWAMAELLHYPKVIAKAQEELERVVGRERMIEESDLPKLEYFNAVTKEVFRLHPPLTMMVPHTTAQNQKVAGYDIAKN

SMIFVNVFAIGRDPSVWSNPLEFNPDRFMGTSFNVHGHDFELLPFGSGKRGCPGLPLGLRNVQLVLSNLLHGFDWSYAGD

IEKHQMTEAMAVVNFMEHPINVRVSARLEDATYKTLSINT*

 

$$$$$$

 

>CYP797B10v2 e_gw1.52.118.1|Selmo1 38% to 92A9, in CYP71 clan

MDLVTITAGCLLILLFLWNSSAKFRLNLPPGPWGFPLIGHLHLFTGGKPQHKVFQALSDKYGPIVSLRFGMVPTALIS

SSSLMRELFTTQDNNFSSKPYLVAGEYIGYNFMGLGTCPYGEDYKNSRKLCTMELLTTKAIDSFSWMRSKELASLLDALV

LKSDSVNVRSIISTFIFNTITQNLISKRYFEYHNGPMDPETVEFKEVAMQVLDFIFKPSFSNFVPWYLRWMDWELPYYKQ

VHASQDRFIQKIVEEHKHSTRENKDFLDIMLQFYGPEKETQVKANLIEMISAGTDATRIICEWMLAAMMENPRVMRKAQE

ELQQVVGDSRMVQESDLPKLEYFQMIIKETFRRYPAGILLSPRIASQDTKIGGYDIPKGTTLLLHAWALGMDPSVWENPT

EFLPERFVGSTDVKGVQDFNLLPFGCGRRKCPGMPLGLRTVHFLVANLVHGFDWSYVPGTVPSMEETPTGACQLKTPLEA

VATMRLPKHAYTLV*

 

>CYP797B10v1 e_gw1.7.404.1|Selmo1 100% to e_gw1.52.118.1|Selmo1

MDLVTITAGCLLILLFLWNSSAKFRLNLPPGPWGFPLIGHLHLFTGGKPQHKVFQALSDKYGPIVSLRFGMVPTALIS

SSSLMRELFTTQDNNFSSKPYLVAGEYIGYNFMGLGTCPYGEDYKNSRKLCTMELLTTKAIDSFSWMRSKELASLLDALV

LKSDSVNVRSIISTFIFNTITQNLISKRYFEYHNGPMDPETVEFKEVAMQVLDFIFKPSFSNFVPWYLRWMDWELPYYKQ

VHASQDRFIQKIVEEHKHSTRENKDFLDIMLQFYGPEKETQVKANLIEMISAGTDATRIICEWMLAAMMENPRVMRKAQE

ELQQVVGDSRMVQESDLPKLEYFQMIIKETFRRYPAGILLSPRIASQDTKIGGYDIPKGTTLLLHAWALGMDPSVWENPT

EFLPERFVGSTDVKGVQDFNLLPFGCGRRKCPGMPLGLRTVHFLVANLVHGFDWSYVPGTVPSMEETPTGACQLKTPLEA

VATMRLPKHAYTLV*

 

$$$$$$

 

>CYP782A1v1 estExt_Genewise1Plus.C_40491|Selmo1 35% to 92A14 in CYP71 clan

MEGHLAFAAIILGFLLFVLRARKSRDRAALPPGPFQWPLIGCLPSFPFHHRHRGFLELSKKFGPIVTMPIGSSKIFLVHG

KDLAMEVLRFKDAQFSSRPLSMTGKYIGFEHSDPNLCPLNENWRVVRKAFSNELMAPSRLSSQAWLRREEVLKIVDSLLG

ITGHGRDWASVDVRKIAEGVVGRIIMRMLFGDHYLGKNIDNPDAGRITRELEREFEKYLAEGNFLWGELNLADYFPALGI

FDLQGLEGRFKRLMSKLEPLFTMIIQEHRKNTVMIQDEKGKDVIDVLLQNQLSDKQIMGILSDALLPGIGTTSAAVEWAM

AELAANPHTLSRAQQELDSVVGRSRLMDESAIPSLPYLQAIAKEVLRLHPSAPLDDPHLNEEESSLGGYAIPAKSTIFVN

LWALGRDDRLWSDASRFDPDRFLGTEIGVHGSHFELLPFSSGRRRCPAHALAMIKLQHIVGALVHGFDWSSAGAVDLIEG

NGIIASPRTPLRLRARRRLDDEAY*

 

>CYP782A1v3 e_gw1.9.183.1|Selmo1 98% to estExt_Genewise1Plus.C_40491|Selmo1

MEGHLAFAAIILGFLLFVLRARKSRDRAALPPGPFQWPLIGCLPSFPFHQRHRGFLELSKKFGPIVTMPIGSSKIFLVHG

KDLAMEVLRFKDAQFSSRPLSMTGKYIGFEHSDPNLCPLNENWRVVRKAFSNELMAPSRLSSQAWLRREEVLKTVDSLLG

ITGHGRDWASVDVRKIAEGVVGRIIMRMLFGDHYLGKNIDNPDAERITRELEREFEKYLAEGNFLWGELNLADYFPALGI

FDLQGLEGRFKRLMSKLEPLFTMIIQEHRKNTVMIQDEKGKDVIDVLLQNQLSDKQIMGILSDALLPGIGTTAAAVEWAM

AELASNPHTLSRAQQELDSVVGRSRLMDESAIPSLPYLQAIAKEVLRLHPSAPLDDPHLNEEESSLGGYAIPAKSTIFVN

LWALGRDDRLWSDASRFDPDRFLGTEIGVHGSHFELLPFSSGRRRCPAHALAMIKLQHIVGALVHGFDWSSAGAVDLIEG

DGIIAGPRTPLRLRARRRLDDEAY*

 

$$$$$$

 

>CYP797B5 e_gw1.2.288.1|Selmo1 38% to CYP92A11 in CYP71 clan

MDLALAVSFAISIALWGLWLLKARSNLPPSPWGLPLIGHLHLLAGMPPHKALQRMANKYGPIISLRLGMIPTVVISSPEL

AKEVFTTHDLNFASRPYMVFGEYFSYSSVGLVSSPHGKLWRNTRKLCTTELFTAQRIDSFSWVRREELSRALEGILKAHG

NDKPVEVRKVASVFAFNITSRIVMSKRYFGDENVDADAMEFKELNDNVLELTINPCLSNLVPWYLRWLDWQIPRYKRIHA

KQDKFLQKIVDEHKETTRKCKDFLDIMLDFFGAGTQGETYVKANLMEMLIGGTDTTSTASEWLMAVLMHDPRVMAKLREE

LDRVVRNTRMVQESDLPKLEYLQLVLKETLRRYPPGAIIMPHISSQASNVGGFHVPKGTTLLVNSWAIGMDPAVWENPTQ

FHPERFLGSSIDVKGQNFELLPFGSGRRKCPGMAMGLRAVELLVANLIHGFDWSFVPGTTPSMEDVFRSAIQLKTPLQAM

ASPRFPKDVYINQTSHL*

 

>CYP797B7 e_gw1.2.286.1|Selmo1 98% to e_gw1.2.288.1|Selmo1

MDLALAVSFGIFIALWGLWLLKARSNLPPSPWGLPLIGHLHLLAGMPPHKALQRMANKYGPIISLRLGMIPTVVISSPEL

AKEVFTTHDLNFASRPYMVFGEYFSYSSVGLVSSPHGKLWRNTRKLCTTELFTAQRIDSFSWVRREELSRALEGILKAHG

NDKPVEVRKVASVFAFNITSRIVMSKRYFGDENVDADAMEFKELNDNVLELTINPCLSNLVPWYLRWLDWQIPRYKRIHA

KQDKFLQKIVDEHKETTRKCKDFLDIMLDFFGAGTQGETYVKANLMEMLIGGTDTTSTASEWLIAVLMHDPRVMAKLREE

LDRVVGNTRMVQESDLPKLEYLQLVLKETLRRYPPGAIIMPHISSQASNVGGFHVPKGTTLLVNSWAIGMAPAVWENPTQ

FHPERFLGSSIDVKGQNFELLPFGSGRRKCPGMAMGLRAVELLVANLIHGFDWSFVPGTTPSMEDVFRSAIQLKIPLQAM

ASPRFPKDVYINQTSHL*

 

>CYP797B6 gw1.2.171.1|Selmo1 96% to e_gw1.2.288.1|Selmo1

HKALQRMANKYGPIISLRLGMIPTVVISSPELAKEVVTTHDLNFAYRPYMVFREYFSYSSVGLVSSPHGKLWRNTRKLCT

 

>CYP797B8 fgenesh2_pg.C_scaffold_2000335|Selmo1 99% to e_gw1.2.286.1|Selmo1

MDLALAVSFAIFIALWGLWLLKARSNLPPSPWGLPLIGHLHLLAGMPPHKALQ RMANKYGPIISLRLGMIPTVVISSPEL

AKEVFTTHDLNFASRPYMVFGEYFSYSSVG LEMLIGGTDTTSTASEWLIAVLMHDPRVMAKLREELDRVVGNTRIVQESD

LPKLEYLQLVLKETLRRYPPGAIIMPHISSQASNVGGFHVPKGTTLLCYSAQDPIVSHGKSKVPKGCLHQSDITSLVTTK*

 

>fgenesh2_pg.C_scaffold_102000125|Selmo1

73% to fgenesh2_pg.C_scaffold_2000335|Selmo1

MPMDASGIHICGEAWPARVGMHLPPSFHVVWNARTE

RIANKYGPIISLRLGMILISSPELTKEVFTTDDLNFASRPYIVLAQQFSYNFAG

AVEGLEQREEQVQDLKGDQGLEAGLEADEAEAYSLDFAPDDACDHFNALKDSMKTFDYLRLLEQLKMVLS

KSLRELEDLECLWELDSERHSRVWHGSKSDVEIANTHMLCYVLPNYTRIVEYTSDNEIHQTRRFVSPMNLALLGHYDKFN

VSTSGAT*

 

>CYP797B19 e_gw1.110.74.1|Selmo1 68% to e_gw1.2.286.1|Selmo1

MALESFRGDAQAELYTKASLLVRTPFFLDNRPYAINFQETLLGGTETTGVTCEWIMAAVMHNPQVLTNLQEELQRVVGST

RMARESDISKLEYLQAVIKETFRRYPPATLLMPRTAHKATTIGGYHIPKGTTLLVNSWAIGMDPAVWEDPTQFLPDRFLG

IPIDIKGHDFELIPFGSGRRKCPGMALGLRAVELLVANLIHGFHWSFVPGMTLSMEDECHSVSQLKIPLQAIAVPRLPKE

VYANI*

 

>CYP797B19 e_gw1.110.74.1 manually annotated

MAVIFGVCFASSIFLLVVWRILSSKlnclppgpcglplIGHLHMLRGMPPYKALESLSRKYGPIMS

LRLGMIPAVVISSKDLAREFFNAHDANFSNRPYMIIGDPRYGFVSLATSPYIGRHWKNI

SKLYTRMLFTAKCIDSFSWVRSDELSHVLDFVLKSSDRSIAVDVRVLSSTFLFNIMSRIL

MSKRYFGDSGVDEDAVEFKQVTQEVMSLILKPCVSNFVPSYLRWLDWQIPRYKQV

RAKQDKFMQKVVDEHKKTTRESKDLVDMALESFRGDAQAELYTKASLLVRTPFFLDN

tgVTCEWIMAAVMHNPQVLTNLQEELQRVVGSTRMARESDISKLEY

LQAVIKETFRRYPPATLLMPRTAHKATTIGGYHIPKGTTLLVNSWAIGMDPAVWEDPTQF

LPDRFLGIPIDIKGHDFELIPFGSGRRKCPGMALGLRAVELLVANLIHGFHWSFVPGMTL

SMEDECHSVSQLKIPLQAIAVPRLPKEVYANI*

 

$$$$$$

 

>CYP797B20v1 estExt_Genewise1.C_1100223|Selmo1 84% to e_gw1.2.288.1|Selmo1

40% to 92A9 in CYP71 clan

MPPHRAFQRIAKKYGPITSLRLGMIPTVVISSQELAKEIFTTHDLNFASRPYLVLGDHFSYNFSGIGTSPYGELWRNTRK

LCTMELFTAKCIDSFSWVRRDELSRTLEWILKDHGDDKPVEVRKVASVFSFNITSRILMSKRYFGDENVDAHAMEFKELN

DKVLELAINPCISNLVPWYLRWLDWQIPRYKRIHAKQDEFLQKIVEEHKETTRECKDFLDIMLDFFGAGTQGETYVKANL

IEMLMAGTDTITTVSEWLMGAVMHNPRVMAKLHEELDSVVGNTRMVQESDLQKLEYLQIVLKESLRRYPPGALLIPRISS

QAATVGGFHVPKGTTLLVNAWAIGMDPAVWENPTQFHPERFLGSSIDVKGQNFELLPFGSGRRQCPGMGMGLRSVELLVA

NLIHGFDWSFVPGTTPSMEDVFFTTAQLKTPLQAMATPRLPKEVYIKV*

 

>SMDN839545 2 aa diffs to estExt_Genewise1.C_1100223|Selmo1 Jing-Ke

longer N-term probably correct

MDLALVVSSAAFITLLVLWFWKSSSNLPPGPWGLPLIGHLHLLAG

MPPHRAFQRIAKKYGPITSLRLGMIPTVVISSQELAKEIFTTHDLNFASRPYLVSGDHFSYNFSGIGTSPYGELWRNTRKLCTMELFTAKCIDSFSWVRRDELSRTLEGILKDHGDDKPVEVRKVASVFSFNITSRILMSKRYFGDENVDAHAMEFKELNDKVLELAINPCISNLVPWYLRWLDWQIPRYKRIHAKQDEFLQKIVEEHKETTRECKDFLDIMLDFFGAGTQGETYVKANLIEMLMAGTDTITTVSEWLMGAVMHNPRVMAKLHEELDSVVGNTRMVQESDLQKLEYLQIVLKESLRRYPPGALLIPRISSQAATVGGFHVPKGTTLLVNAWAIGMDPAVWENPTQFHPERFLGSSIDVKGQNFELLPFGSGRRQCPGMGMGLRSVELLVANLIHGFDWSFVPGTTPSMEDVFFTTAQLKTPLQAMATPRLPKEVYIKV*

 

>CYP797B4 e_gw1.11.441.1|Selmo1 100% to estExt_Genewise1.C_1100223|Selmo1

MHNPRVMAKLHEELDSVVGNTRMVQESDLQKLEYLQIVLKESLRRYPPGALLIPRISSQAATVGGFHVPKGTTLLVNAWA

IGMDPAVWENPTQFHPERFLGSSIDVKGQNFELLPFGSGRRQCPGMGMGLRSVELLVANLIHGFDWSFVPGTTPSMEDVF

FTTAQLKTPLQAMATPRLPKEVYIKV*

 

>CYP797B12 e_gw1.37.336.1|Selmo1 96% to estExt_Genewise1.C_1100223|Selmo1

MLIAGTDTTTTVSEWLMGAVMHNPRVMAKLHEELDSVVGNTRMVQESDLQKLEYLQIVLKESLRRYPPGALLMPRISRQA

ATVGGFHVPKGTTLLVNAWAIGMDPAVWENPTQFHPERFLGSSIDVKGHNFELLPFGSGRRKCPGMGMGLRSVELLVANL

IHGFNWSFVPGTTPSMEDVFSTTAQLKTPLQAMATPRLPKEVYIKV*

 

>CYP797B12 e_gw1.37.336.1 manually annotated

MDLALAVSSAAFITLLVLWFLKPSSNlppgpwglplighlhllagMPLHRAFQRIAKKYG

PITSLRLGMIPTVVISNQELAKEIFTTHDLNFASRPYLVSGDHFSYNFSGPATSPYGELW

RNTRKLCTIELFTAKCIDSFSWVRRDELSRTLEGILKDHGDDEPVEVRKVASVFSFNITS

RILMSKRYFGDENVDAHAMEFKELNDKVLELVINPCISNLVPWYLRWLDWQIPRYKRIHA

KQDEFLQKIVEEHKETTRECKDFLDIMLDFFGAGTQGETYVKANLM

EMLIAGTDTTTTVSEWLMGAVMHNPRVMAKLHEELDSVVGNTRMVQESDLQKLEYLQ

IVLKESLRRYPPGALLMPRISRQAATVGGFHVPKGTTLLVNAWAIGMDPAVWENPTQFHP

ERFLGSSIDVKGHNFELLPFGSGRRKCPGMGMGLRSVELLVANLIHGFNWSFVPGTTPSM

EDVFSTTAQLKTPLQAMATPRLPKEVYIKV*

 

>CYP797B11v1 e_gw1.37.350.1|Selmo1 95% to estExt_Genewise1.C_1100223|Selmo1

MDLALAVSSAAFITLLVLWFLKPSSNLPPGPWGLPLIGHLHLLAGMPLHRAFQRIAKKYGPITSLRLGMIPTVVISNQEL

AKEIFTTHDLNFASRPYLVSGDHFSYNFSGPATSPYGELWRNTRKLCTIELFTAKCIDSFSWVRRDELSRTLEGILKDHG

DDEPVEVRKVASVFSFNITSRILMSKRYFGDENVDAHAMEFKELNDKVLELVINPCISNLVPWYLRWLDWQIPRYKRIHA

KQDEFLQKIVEEHKETTRECKDFLDIMLDFFGAGTQGETYVKANLMVRFAKLLLDCLFLMLQMPRRC*

 

>CYP797B11v1 e_gw1.37.350.1

MDLALAVSSAAFITLLVLWFLKPSSNlppgpwglplighlhllagMPLHRAFQRIAKKYG

PITSLRLGMIPTVVISNQELAKEIFTTHDLNFASRPYLVSGDHFSYNFSGPATSPYGELW

RNTRKLCTIELFTAKCIDSFSWVRRDELSRTLEGILKDHGDDEPVEVRKVASVFSFNITS

RILMSKRYFGDENVDAHAMEFKELNDKVLELVINPCISNLVPWYLRWLDWQIPRYKRIHA

KQDEFLQKIVEEHKETTRECKDFLDIMLDFFGAGTQGETYVKANLM

EMLIAGTDTTTTVSEWLMGAVMHNPRVMAKLHEELDSVVGNTRMVQESDLQKLEYLQ

IVLKESLRRYPPGALLMPRISRQAATVGGFHVPKGTTLLVNAWAIGMDPAVWENPTQFHP

ERFLGSSIDVKGHNFELLPFGSGRRKCPGMGMGLRSVELLVANLIHGFNWSFVPGTTPSM

EDVFSTTAQLKTPLQAMATPRLPKEVYIKV*

 

>CYP797B11v2 e_gw1.691.2.1|Selmo1 100% to e_gw1.37.350.1|Selmo1

MDLALAVSSAAFITLLVLWFLKPSSNLPPGPWGLPLIGHLHLLAGMPLHRAFQRIAKKYGPITSLRLGMIPTVVISNQEL

AKEIFTTHDLNFASRPYLVSGDHFSYNFSGPATSPYGELWRNTRKLCTIELFTAKCIDSFSWVRRDELSRTLEGILKD

 

>CYP797B3 e_gw1.11.633.1|Selmo1  96% to e_gw1.37.350.1|Selmo1

MDLALVVSSAAFITLLVLWFWKSSSNLPPGPWGLPLIGHLHLLAGMPPHRAFQRIAKKYGPITSLRLGMIPTVVISSQEL

AKEIFTTHDLNFASRPYLVSGDHFSYNFSGIGTSPYGELWRNTRKLCTMELFTAKCIDSFSWVRRDELSRTLEGILKDHG

DDKPVEVRKVASVFSFNITSRILMSKRYFGDENVDAHAMEFKELNDKVLELAINPCISNLVPWYLRWLDWQIPRYKRIHA

KQDEFLQKIVEEHKETTRECKDFLDIMLDFFGAGTQGETYVKANLIVSFAKLLLDCLFLMLQMPRRC*

 

>CYP797B13 e_gw1.87.42.1|Selmo1 90% to estExt_Genewise1.C_1100223|Selmo1

MDLALAVSFLIFIALLILWFLKAGSNLPPGPWGLPLIGHLHLLAGMPPHRALQRIANKYGPITSLRLGMIPTVVISSQEL

AKEVFTAHDLNFASRPYLAFWKHLIYNFSGGSSSPYGELWRNTRKLCTMELFTAKCIDSFSWVRRDELSRALEGILKAHG

DGKPVEVRKVASVFSFNVTSRILMGKRYFGDENVDAHAMEFKELNDNVLELAINPCVSNLVPWYLRWLDWQIPRYKRIHA

KQDEFLQKIVEEHKERTRECKDFLDIMLDFFGAGTQGETYVKANLMVSFLQNFSLID*

 

>CYP797B13 e_gw1.87.42.1 manually annotated

MPPHRALQRIANKYGPITSLRLGMIPTVVISSQELAKEVFTAHDLNFASRPYLAFWKHLI

YNFSGGSSSPYGELWRNTRKLCTMELFTAKCIDSFSWVRRDELSRALEGILKAHGDGKPV

EVRKVASVFSFNVTSRILMGKRYFGDENVDAHAMEFKELNDNVLELAINPCVSNLVPWYL

RWLDWQIPRYKRIHAKQDEFLQKIVEEHKERTRECKDFLDIMLDFFGAGTQGETYVKANLM

EMFIAGTDTTTTVSEWLMGAVMHNPRVMAKLHEELERVVGNTRMVQESDLQKLEYLQ

IVLKESLRRYPPGALLLPRISRQAANVGGFHIPKGTTLLVNTWAIGMDPAVWENPTQFHP

ERFLGSSIDVKGHNFELLPFGSGRRKCPGMGMGLRSVELLVANLIHGFNWSFVPGTMPSM

EEVYRSALKLETPLQAMASPRLPQEVYTKF*

 

>CYP797B14v1 e_gw1.102.86.1|Selmo1

MDLALAVSSTTFIALLVLCFLKACSNLPPGPWGLPLIGHLHLLVRMPLHRALQHIANKYGPITSLRLGMIPTVVISSQEL

AKEVFTTHDLNFASRPYLVVGDHFSYNFSGISTSPYGELWRNTRKLCTMELFTAKCIDSFSWVRRDELSRALEGILKAHG

DGKPVEVRKVASVFSFNVTSRILMSKRYFGDE

 

>CYP797B14v1 e_gw1.102.86.1 manually annotated

MDLALAVSSTTFIALLVLCFLKACSNlppgpwglplighlhllVRMPLHRALQHIANKYG

PITSLRLGMIPTVVISSQELAKEVFTTHDLNFASRPYLVVGDHFSYNFSGISTSPYGELW

RNTRKLCTMELFTAKCIDSFSWVRRDELSRALEGILKAHGDGKPVEVRKVASVFSFNVTS

RILMSKRYFGDENVDAHAIEFKKLNNNVFELGINPCVSNLVPWYLRWLDWQIPRYKRIHA

KQDEFLQKIVEEHKETTRECKDFLDIMLDFFGAGTQGETYVKANLM

EMFIAGTDTTTTASEWLMGAVMHNPRVMAKLHEELDRVVGSTRMVQESDL

QKLEYLQIVLKESLRRYPPGALLIPRISRQAATVGGFHVPKGTTLLVNAWAIGMDPAVWE

NPTQFHPERFLGSSIDVKGQNFELLPFGSGRRKCPGMGMGLRSVELLVANLIHGFNWSFV

PGTTPSMEEVFLTTVQLKTPLQAMATPRLPKEVYINYVE*

 

>CYP797B14v2 e_gw1.11.259.1|Selmo1 98% to e_gw1.102.86.1|Selmo1

88% to e_gw1.11.633.1|Selmo1

MDLALAVSSTTFIALLVLCFLKARSNLPPGPWGLPLIGHLHLLVRMPLHKALQHIANKYGPITSLRLGMIPTVVISSQEL

AKEVFTTHDLNFASRPYLVVGDHFSYNFSGISTSPYGELWRNTRKLCTMELFTAKCIDSFSWVRRDELSRALEGILKAHG

DGKPVEVRKVASVFSFNVTSRILMSKRYFGDE

 

>CYP797B14v2 e_gw1.11.259.1 manually annotated

MDLALAVSSTTFIALLVLCFLKARSNlppgpwglplighlhllVRMPLHKALQHIANKYG

PITSLRLGMIPTVVISSQELAKEVFTTHDLNFASRPYLVVGDHFSYNFSGISTSPYGELW

RNTRKLCTMELFTAKCIDSFSWVRRDELSRALEGILKAHGDGKPVEVRKVASVFSFNVTS

RILMSKRYFGDENVDAHAMEFKKLNSNVLELGINPCVSNLVPWYLRWLDWQIPRYKQIHA

KQDEFLQKIVEEHKETTRECKDFLDIMLDFFGAGTQGETYVKANLM

EMLIAGSDTTTTVSEWLMVAVMHNPRVMAKLHEELDRVVGSTRMVQESDL

QKLEYLQIVLKESLRRYPPGALLIPRISRQAATVGGFHVPKGTTLLVNAWAIGMDPAVWE

NPTQFHPERFLGSSIDVKGQNFELLPFGSGRRKCPGMGMGLRSVELLVANLIHGFNWSFV

PGTTPSMEEVFLTTVQLKTPLQAMATPRLPKEVYINYVE*

 

>CYP797B15 fgenesh2_pg.C_scaffold_11000130|Selmo1 83% to e_gw1.11.259.1|Selmo1

MDLALAVSSTIFIALLVLCFLKARSNLPPGDHFSYNFSGIATSPYGELWRNTRKLCTMELFTAKCIDSFSWVRRDELSRA

LEGILKAHGDGKPVEGDVKANLMVFLMLQMPRRC*

 

>CYP797B15 fgenesh2_pg.C_scaffold_11000130 manually annotated

MDLALAVSSTIFIALLVLCFLKARSNLPPGPWGLPLIAY

LLLLVRMPPHRALQHIAKKYGPITSLRLGMIPTVVISSQELAKEVFTTHDLNFASRRP

LLPGDHFSYNFSGIATSPYGELWRNTRKLCTMELFTAKCIDSFSWVRRDELSRALEGILK

AHGDGKPVEVRNVASVFSFNVTSRILMSKRYFGDENVDAHAMEFKKLNDNVLELGINPCV

SNLVPWYLRWLDWQIPRYKRIHAKQDEFLQKIVEEHKETTRECKDFLDIMLDFFGAGRRKGESHGK

TNAQEMLIASTDTTTTASEWLMVAVMHNPRVMAKLHEELDRVVGSTQESDLQKLEYLQ

IVLKESLRRYPPGPLLMPRISRQAATVGGFHVPKGTTLLVNAWAIGMDPAVWENPTQFHP

ERFLGSSIDVKGQNFELLPFGSGRRKCPGMGMGLRSVELLVANLIHGFNWSFVPGTTPSM

EEVFLTTVQLKTPLQAMAKVLCVGGFKNSDCSLGRP*

 

$$$$$$

 

>CYP797B18 e_gw1.110.25.1|Selmo1 62% to e_gw1.11.633.1|Selmo1

MAVIFGVCFASSIFLLVVWRILSSKLNCLPPGPCGLPLIGHLHMLRGMPPYKALESLSRKYGPIMSLRLGMIPAVVISSK

DLAREFFNAHDANFSNRPYMIIGDPRYGFVSLATSPYIGRHWKNISKLYTRMLFTAKCIDSFSWVRSDELSHVL

 

>CYP797B18 e_gw1.110.25.1 manually annotated

MAVIFGVCFASSIFLLVVWRILSSKlnclppgpcglplIGHLHMLRGMPPYKALESLSRKYGPIMS

LRLGMIPAVVISSKDLAREFFNAHDANFSNRPYMIIGDPRYGFVSLATSPYIGRHWKNI

SKLYTRMLFTAKCIDSFSWVRSDELSHVLDFVLKSSDRSIAVDVRVLSSTFLFNIMSRIL

MSKRYFGDSGVDEDAVEFKQVTQEVMSLILKPCVSNFVPSYLRWLDWQIPRYKQV

RAKQDKFMQKVVDEHKKTTRESKDLVDMALESFRGDAQAELYTKASLLVRTPFFLDN

tgVTCEWIMAAVMHNPQVLTNLQEELQRVVGSTRMARESDISKLEY

LQAVIKETFRRYPPATLLMPRTAHKATTIGGYHIPKGTTLLVNSWAIGMDPAVWEDPTQF

LPDRFLGIPIDIKGHDFELIPFGSGRRKCPGMALGLRAVELLVANLIHGFHWSFVPGMTL

SMEDECHSVSQLKIPLQAIAVPRLPKEVYANI*

 

$$$$$$

 

>CYP791C1v1 e_gw1.1.476.1|Selmo1 40% to 92A11 in CYP71 clan

MRIVLGTSSATVDKETSTVKELIAEAFVSTGEFLVGDYLPWLSLLDTKKKSRMKALKEQMSSYLQKQIEEHHNQNDKSAD

FMTLMLQSPEIGSNDLAGLQLEKLLQDMIAGGTDTSAITVEWALAELLKHPDLMAKAQEELDNVLGRKSQVQGGHLPKLE

YLAAVIKETLRLHPPGPLLIHETTQNCQLKNVFVPQKTLAFINLYALGRDESTWVDPLKFDPNRFIDKKNDGCGHDFGDY

LPFGAGRRGCPGMHLALTVVSVTLASLLYGFNWKMPDGMSFEHLDMSEGAGFTIPRALPLKLVPLPR*

 

>CYP791C1v1 e_gw1.1.476.1 manually annotated

MEFHYWSLSIFSLLAILGTVWCLVRILYPSKRYKGL

PCPRMFPVIGHLHLLRRDPHRVLLALAREFGRCMYLKLGQYPCLVLSSAEVTKEALQGHD

IAFSSRPALSAARIFGFNGSGVLWAPYGEHLKMVRKLCILELLTPRRVDSFESIRAEERS

RFVSQLRDIANRNEAADLTAMLLNMTLNIMMRIVLGTSSATVDKETSTVKELIA

EAFVSTGEFLVGDYLPWLSLLDTKKKSRMKALKEQMSSYLQKQIEEHHNQNDKSADF

MTLMLQSPEIGSNDVAIKAVIAV

QDMIAGGTDTSAITVEWALAELLKHPDLMAKAQEELDNVLGRKSQVQGGHLPKLEYLA

AVIKETLRLHPPGPLLIHETTQNCQLKNVFVPQKTLAFINLYALGRDESTWVDPLKFDP

NRFIDKKNDGCGHDFGDYLPFGAGRRGCPGMHlaltvvsvtlasllYGFNWKMPDGMSFE

HLDMSEGAGFTIPRALPLKLVPLPR*

 

>CYP791C1v2 gw1.106.51.1|Selmo1 99% to e_gw1.1.476.1|Selmo1

LLIHETTQNCQLKNVFVPQKTLVFINLYALGRDESTWVDPLKFDPNRFIDKKNDGCGHDFGDYLPFGAGRRGCPGMHLAL

TVVSVTLASLLYGFNWKMPDGMSFEHLDMSEGAGFTIPRALPLKLVPL

 

$$$$$$

 

>CYP786A1v1 e_gw1.42.52.1|Selmo1 43% to 92A11 in CYP71 clan

MAAQASSTAALSLLWSLLVAIWKKTLGKLFFRDDRHQQDHMPPGPRPLPVIGNLHQLLGRPPHQALLDLSKRHGPLMFLR

LGCVPTFVASSAEAAREFLHTHDLVFASRPRYAVARELTYNFADIMWAPYGDHWRHLRKVCSLELFSGKRVDSFERLRKE

EISSALATVEEAARASSVVDLRAVLSDITLYSILRMATSQEFGGKKKQLSRFERRVKETIEHAVEMIGALNVGDYLPSLR

WMDLQGYGRRARKLHALQDAFFQSLIDRKRQYQGRGGAGAGGVDDLLDVLLASQEKNALTDDTIKAVIQDVIGAGSDTAW

VTCEWAMAELLRHPTAMRRAQREIDAVVGRDRVVEESDLPGLNFLHAIVKETLRLHPPSPVILYESTMPCVSSAGYRIAQ

GARLLVNVYAISRDANSWERALDFWPERFEEGAKKGVDVRGQNFELIPFGSGRRICPGMGMGLRMVQCVLARLLQGFDWE

KVGEIDMREKFGLAMPKLVPLQAIPCPRRS*

 

>CYP786A1v2 e_gw1.88.42.1|Selmo1 99% to e_gw1.42.52.1|Selmo1

MAAQASSTAALSLLWSLLVAIWKKTLGKLFFRDDRHQQDHTPPGPRPLPVIGNLHQLLGRPPHQALLDLSKRHGPLMFLR

LGCVPTFVASSAEAAREFLHTHDLVFASRPRYAVARELTYNFADIMWAPYGDHWRHLRKVCSLELFSGKRVDSFERVRKE

EISSALATVEEAARASSVVDLRAVLSDITLYSILRMATSQEFGGKKKQLSRFERRVKETIEHAVEMIGALNVGDYLPSLR

WMDLQGYGRRARKLHALQDAFFQSLIDRKRQYQWRGGAGAGGVEDLLDVLLASQEKNALTDDTIKAVIQDVIGAGSDTAW

VTCEWAMAELLRHPAAMRRAQREIDAVVGRDRVVEESDLPGLNFLHAIVKETLRLHPPSPVILYESTMPCVSSAGYRIAQ

GARLLVNVYAISRDANSWERALDFWPERFEEGAKKGVDVRGQNFELIPFGSGRRICPGMGMGLRMVQCVLARLLQGFDWE

KVGEIDMREKFGLAMPKLVPLQAIPCPRRS*

 

>CYP786A2 e_gw1.42.487.1|Selmo1 97% to e_gw1.42.52.1|Selmo1

MWAPYGDHWRHLRKVCSLELFSGKRVDSFERVRKEEISSALATVEEAARASSVVDLRAVLSDITLYSSLRMATSQEFGGK

KKQLSRFERRAKETIEHAVEMIGALNVGDYLPSLRWMDLQGYGRRARKLHALQDAFFQSLIDRKRQYQGRGGAGAGGVDD

LLDVLLASQEKNALTDDTIKAVIQDVIGAGSDTAWVTCEWAMAELLRHPAAMRRAQREIDAVVGRDRVVEESDLPGLNFL

HAIVKETLRLHPPSPVILYESTMPCVSSAGYRIAQGARLLVNVYVISRDANSWERALDFWPERFDEGAKKGVDVRGQNFE

LIRFGSGRRICPGMGMGLRMVQCVLARLLQGFDWEKMGEIDMREKFGLAMPKLVPLHAIPCPRRSSFSRSNFCLN*

 

>CYP786A2 e_gw1.42.487.1 mannually annotated

MAIHLWSLLVAIWKKTLGKLFFRDDRHQQDHTPLGPRPLPVIGNLHQLLGRPPHQAGALH

TKRHGPLMFLRLGCVPTFVASSAEAAREFLHTHDLVFASRPRYAVARELTYNFADIMWAP

YGDHWRHLRKVCSLELFSGKRVDSFERVRKEEISSALATVEEAARASSVVDLRAVLSDIT

LYSSLRMATSQEFGGKKKQLSRFERRAKETIEHAVEMIGALNVGDYLPSLRWMDL

QGYGRRARKLHALQDAFFQSLIDRKRQYQGRQEKNALTDDTI

KAVIQVFLKNPNLFATLIPRSLRGTQDVIGAGSDTAWVTCEWAMAELLRHP

AAMRRAQREIDAVVGRDRVVEESDLPGLNFLHAIVKETLRLHPPSPVILYESTMPCVSSA

GYRIAQGARLLVNVYVISRDANSWERALDFWPERFDEGAKKGVDVRGQNFELIRFGSGRR

ICPGMGMGLRMVQCVLARLLQGFDWEKMGEIDMREKFGLAMPKLVPLHAIPCPRRSSFSRSNFCLN*

 

$$$$$$

 

>CYP781B1v1 fgenesh1_kg.C_scaffold_42000004|Selmo1 39% to 92A11 in CYP71 clan

MARKYGPVMSFRLGVRPHIIISSPEMARQVLKEHDVEFASRPLFSTISRLVSHNFQDLIFAPHGERWKMLRRVCGTELFT

ASKVSHFASTRKRELGAFGAIVEASAKDGHEFDLSSMLHEYFTNLMTCVLFGRKFYGTDTPLTPEAEAYKASWAIQAKES

RRLFAGDYIPAMRWLDTLRGTQNRLKNEVLPARSRFLEAVIEEHAKDFDPENPRDFVDVMLTLGGEDKLSNDQIIALLQD

LLLAGTGTSKGTIEWAISELIVNPRVQEKAHEELDRVVGRDRPLEESHLNDLPYIQAIVKEVFRKRPIAPLGVPHYNDRE

VTLAGYTIPAHTTVLVNIWAIHHDPSVWSDPELFLPERFLGSDHSVLGNDFDLLPFSSGRRRCVGIPLAMPHVTLTLAYL

LHRWSWRSPLGKPIEMAELAGAGIAGVASPRIVCASHR*

 

>CYP781B1v2 fgenesh1_kg.C_scaffold_67000005|Selmo1

99% to fgenesh1_kg.C_scaffold_42000004|Selmo1

MARKYGPVMSFRLGVRPHIIISSPEMARQVLKEHDVEFASRPLFSTISRLVSHNFQDLIFAPHGERWKMLRRVCGTELFT

ASKVSHFASTRKRELGAFGAIVEASAKDGHEFDLSSMLHEYFTNLMTCVLFGRKFYGTDTLLTPEAEAYKASWAIQAKES

RRLFAGDYIPAMRWLDTLRGTQNRLKNEVLPARSRFLEAVIEEHAKDFDPENPRDFVDVMLTLGGEDKLSNDQIIALLQD

LLLAGTGTSKGTIEWAISELIVNPRVQEKAHEELDRVVGRDRPLEESHLNDLPYIQAIVKEVFRKRPIAPLGVPHYNDRA

VTLAGYTIPAHTTVLVNIWAIHHDPSIWSDPELFLPERFLGSDHSVLGNDFDLLPFSSGRRRCVGIPLAMPHVTLTLAYL

LHRWSWRSPLGKPIEMAELAGAGIAGVASPRIVCASHR*

 

>CYP781B2 SM1580825 65% to fgenesh1_kg.C_scaffold_42000004|Selmo1 new Jing-Ke

not in downloaded set from JGI

MSKISQRISMDSLLYSSVWYYWTTCLCLAIAFFALFNLYSRKKAHSNLPPRPFSWPLVGSLPSLGRSRHRSLHRLAKKYGPIMYMELGSRPHVIISSPAMAREVLKDHDVEFASRPQFHTFFKNVSHDYNDLVFAPHGERWKMLRRVSGTEIFAAGRVNHFSGIRKRELAAFASIIEKSAAAGEAFDLTALLHELFTNLMTSVLFGQKFYNSDTPVTREAEAYRAVWDTIIAESERLYIGDFIPALRWVDKVKRSEHRLKNQIIPAVENFLNAIVKQHKESFVAENPPRDFVDVMLSLGGENKLDDMAIIALLQTLLLAGTNTSKGTVEWAMAEMIRCPGVQKKAHEELDRIVGRNRCLEESDLKDLPYIQAIVKEVLRLHPLATTGLPHSNPATAQLAGYTIPANTTLLVNIWGIHHDPANWSDPESFCPERFLGSDHNVLGSHFDLIPFGSGRRRCVGIPLAIPHVSLTLAYLLHRFEWRMPDGQEIDMEEKTGLATMPAKHRIVCATVRK*

 

$$$$$$

 

>CYP786B1v1 e_gw1.11.384.1|Selmo1 37% to 75B1 in CYP71 clan, 41% to 92A7

MNLFAAAAFLVIGLVYWFVNRQRPSTPPGPWKLPVVGNLHQLLGKQPHRVITELSKKYGHLMSLRLGSVQAVVASSSQTA

KIFLQTHDVIFSSRPEVANAKLLTYGFSDIMWAPYSQQWRELRKLSVLELFTAKRLESFQGIRRDETLNMIHRLLKLARE

KKVVNFRDAATELSWSIIGTMVSNRQEFVNLEEGLKVKSSLDRALQLAGAFNLADYIPFFRAFDVQGFRQQSQILHEQLD

FFFQGLVDSHRRQERPPNASEDFIDVLLSIQKQNGVEYVSDDTIKATIQDIFAAGTDTSSMTLEWALTELVRHPRSLQKA

QDEISFIVGNDRMVSEADIPKLQFLQAVVKETLRLHPPGPLLQHQSMEDCKVGPYSFPAGTRVIINVYGISRDPSLWEQP

LEFDPWRFLDKPTASIDMKGQHFEFIPFGSGRRICPGLAMGVRTVELALAQSLHCFHWHSPDDRVPDIEEVCGMTLPKKN

PLLLAPSPRLADAVYGEIQRM*

 

>CYP786B1v2 e_gw1.110.37.1|Selmo1 99% to e_gw1.11.384.1|Selmo1 = Jing-Ke SM1726.1 100%

MNLFAAAAFLVIGLVYWLANRQRPSTPPGPWKLPVVGNLHQLLGKQPHRVITELSKKYGHLMSLRLGSVQAVVASSSQTA

KIFLQTHDAIFSSRPEVANAKLLTYGFSDIMWAPYSQQWRELRKLSVLELFTAKRLESFQGIRRDETLNMIHRLLKLARE

KKVVNFRDAATELSWSIIRTMVSNRQEFVNLEEGLKVKSSLDRALQLAGAFNLADYIPFFRAFDVQGFRQQSQILHEQLD

FFFQGLVDSHRRQERPPNASEDFIDVLLSIQKQNGVEYVSDDTIKATIQDIFAAGTDTSSMTLEWALTELVRHPRSLQKA

QDEISFIVGNDRMVSEADIPKLQFLQAVVKETLRLHPPGPLLQHQSVEDCKVGPYSFPAGTRVIINVYGISRDPSLWEQP

LEFDPWRFLDKPTASIDMKGQHFEFIPFGSGRRICPGLAMGVRTVELALAQSLHCFHWHSPDDRVPDIEEVCGMTLPKKN

PLLLAPSPRLADAVYGEIQRM*

 

$$$$$$

 

>CYP797F1v1 e_gw1.1.364.1|Selmo1 97% to e_gw1.16.155.1|Selmo1

MEFLVYVLLGSVFLFYLLVRPFLQPRKLLPPSPRGLPFIGHLHLLGRQPHISLQELSNKFGDIVCLRLGLVPAILISSSA

AAREALKTHDQTFSGRPYFLLGDYVYSSKSMVLSPPNEHWRRMKKLFNAELFTANRLASFLEVRREELASMVSFLIDNQS

RVVNVRELVRSYTFNTITRIVMSKRFFGEKNTVNEEEAMEFMEVMEEIIKFGFAFHISELVPAWLRWIDWKIPAVKRIAA

REDIVIQKILDEHRKTKSSRGTKDFLDILLEHDTKGDGGGNDLDNARGTIMELVGAGTYTTACVIEWAILELLRNPDVLE

KAQHELESIVGQTNRLVEESDIEHLTYLQAIVKETFRLHPPAPLLLRMSTQECVISNYHIPKGANTFVNVYAIGRDPGLW

ENPMEFWPERFVGSSMDVRGQDFELIPFGAGRRTCAGLTLGLKVVQVGLANLLHGFDWSCVAGRDYNVAESSVSVIWPKK

PLEAIVILKSR*

 

>CYP797F1v2 e_gw1.16.155.1|Selmo1 37% to 75B1 in CYP71 clan

MEFLVYVLLGSVFLFYLLVRPFLQPRKLLPPSPRGLPLIGHLHLLGRQPHISLQELSNKFGDIVCLRLGLVPAILISSSA

AAREALKTHDQTFSGRPYFLLGDYVYSSKSMVLSPPNEHWRRMKKLFNAELFTANRLASFLEVRREELASMVSFLIDNQS

RVVNVRELVRSYTFNTITRIVMSKRFFGEKNTVNEEEAMEFMEVMEEIIKFGFAFHISELVPAWVRWIDWKIPAVKRIAA

RENIVIQKILDEHRKTKSSRGTKDFLDILLENDTEGDGGGNDLDNARGTIMELVGAGTYTTACVIEWVILELLRNPDVLE

KAQHELESIVGQTNRLVEESDIEHLTYLQAIVKETFRLHPPAPLLLRMSTQECVISNYHIPKGANTFVNVYAIGRDPGLW

ENPMEFSPERFVGSSMDVRGQDFELIPFGAGRRTCAGLTLGLKVVQIGLANLLHGFDWSCVAGRDYDVAESSVSVIWPKK

PLEAMVTPKSR*

 

$$$$$$

 

>CYP781A1 estExt_Genewise1Plus.C_100834|Selmo1 38% to 75B1 in CYP71 clan

MFWIGWLCVAAAGALLASLGNVYSHWQKLPPGPWGWPIVGCLFCVSRRNLHRSFAELATKYGPIVYLNMGSRATVVISSP

EVARAVFREHDVQFASRPRYSTPFKHISQNFKDLVFAPYGGRWKNLRKICSTELFTASKVNMFGGIRKAELHDFCNSIAM

RAAAGEEVNLSVCFQELLTNLMSSVLFGKKFYTSDLPPVAEAAAYRATWGMLTQESGKIYLGDYIPALHWLDRLRGKDQR

IRKTIIPALQGLLNSVIEERRKQLRRDKPRDFVDVMVALNDQKSLSNDEIVAIIQDMLLAGTGTTRSTLEWGFSELVRHP

EVQRRAQEELDRVVGRERYVQESDLSGLPYIQALVKEIMRLHPAAPLGLPHFNSCPVSLAGYTIPANSTLHVNIWTICRD

SSSWERAHEFRPERFLGSCHNLLGQHFELIPFSSGRRRCAGINLALLHVSLTLAYLLHRFEWRPPPGVDVSEIDMSETTG

LACFRTVPLRVSVRPRLELP*

 

>SM1583574 4 aa diffs to estExt_Genewise1Plus.C_100834|Selmo1 Jing-Ke

100% to e_gw1.29.388.1|Selmo1 partial allele seq below

MFWIGWLCVAAAGALLASLGNVYRHWQKLPPGPWGWPIVGCLFCVSRRNLHRSFAELATKYGPIVYLNMGSRATVVISSPEVARAVFREHDVQFASRPRYSTPFKHISQNFKDLVFAPYGGRWKNLRKICSTELFTASKVNMFGGIRKAELHDFCNNIAMRAAAGEEVNLSVCFQELLTNLMSSVLFGKKFYTSDLPPVAEAAAYRATWGMLTQESGKIYLGDYIPALHWLDRLRGKDQRIRKTIIPALQGLLNSVIEERRKQLRRDKPRDFVDVMVALNDQKSLSNDEIVAIIQDMLLAGTGTTRSTLEWGFSELVRHPEVQRRAQEELDRVVGRERYVQESDLSGLPYIQALVKEIMRLHPAAPLGLPHFNSCPVSLAGYTIPANSTLHVNIWAICRDPSSWERAHEFRPERFLGSCHNLLGQHFELIPFSSGRRRCAGINLALLHVSLTLAYLLHRFEWRPPPGVDVSEIDMSETTGLACFRTVPLRVSVRPRLELS*

 

>e_gw1.29.388.1|Selmo1 99% to estExt_Genewise1Plus.C_100834|Selmo1

MLLAGTGTTRSTLEWGFSELVRHPEVQRRAQEELDRVVGRERYVQESDLSGLPYIQALVKEIMRLHPAAPLGLPHFNSCP

VSLAGYTIPANSTLHVNIWAICRDPSSWERAHEFRPERFLGSCHNLLGQHFELIPFSSGRRRCAGINLALLHVSLTLAYL

LHRFEWRPPPGVDVSEIDMSETTGLACFRTVPLRVSVRPRLELS*

 

$$$$$$

 

>scaffold_51 (-) strand new no model

558020 PSPSFRLPLIGHLHFLGRLPHQSLQALAKKHGTIFYL*LGIIP 557892

 

>scaffold_99 possible allele to 51:1189452-1189857

5379 IDTIVGKECLVAERGFDKLEYL 5314

5297 PAPLLIHMSTEACKVAGYDIPKGTSTFVNCYTIGRDPAVREDAL*FRMERFLG 5139

5136 NLIDIKGQDFGLGQRMCLGMSLGLKTAQLLLFNLIHAFNWSFVPDKGMDCY 4984

 

>scaffold_51 1192219-1196603 (+) strand pseudogene

includes part of model gw1.51.182.1 [Selmo1:18555]

1192219 PYGDYWKNM*KLCAMELFTIRHINSFLWVRTEELHEML 1192332

1196329 ASQNCKLGGFDVPKGATTFLHVYAIGRDPAVWDEPFKFMLERFFKNX 1196469

1196469 LDVKSQDYGLLPFDSCHRGCQGMXXXXXXX 1196537

1196559 QLLVSNLIHSFNWSF 1196603

 

>scaffold_99 possible allele to 51:1192219-1196603

2 aa diffs

177837 FDVPKGATTFLHVYAIGRDSAIWDE 177911

 

>fgenesh2_pg.C_scaffold_51000158|Selmo1 99% to e_gw1.99.33.1|Selmo1

REVISED SEQ 36% TO CYP83B1 PSEUDOGENE (&) = FRAMESHIFT

91% e_gw1.99.33.1|Selmo1

1283685 PP*AVGLSLLGHLHHLAGIPFLSLHALSKQYGPIFFMK

MGTVPAVVISSSVLAKEVLRSQDQTFTSRPYILVRDYGLYHFQGIGPVPYNDH (&)

MQKLCATDLFTPKKIDSFLPIRLEEITGMFSALRGAGAHKAVDMRNMLSTFTFNVMTRILMNKRFFEYG (&)

EDEEHIDGEAKQFKDIVFETADQGLQFHISEFILHWLKWIDWKVPELKRLHVKKDKFLQNILD

 

>CYP797H2Pv1 fgenesh2_pg.C_scaffold_51000161|Selmo1 1331425-1332958 (-) strand

86% to fgenesh2_pg.C_scaffold_99000007|Selmo1

98% to e_gw1.51.93.1|Selmo1

revised seq. 38% to 75B1 pseudogene

93% to e_gw1.51.93.1|Selmo1

MEFAQYAVVLLITLLF (&)

RLNLPPSPW (&)

GLPLIGHLHLLGRMLHLSFQALSTKYGPIVFLRLGMVPAVVISSPELVKEVLKIQDANFA

SRPYLIMGEYNFYNFRDIGFVPYGDYWKRMRKLCATELFTVKRIESFQGVRTREMRGVLS

ELVNAADFQKPINMSTS*QHVFNVVMQILMSKRFFEYGEHEAEMSSEAEDFKHIVFEIT

EQMLQFHISEFVPAFMRRIDWKIPEMKRIHARQDKFLQRILDAHKARLESNTSQPKDFMD

TMLQSLKSEGARGEEQSQRYRSKLLS

ELLSGGDTSASLIEWTLLELMHNPLILQKAQEEIDTVVGKECLVAESDFDKLEYLQA

IVKEAFRIHPPAPLLIHMS (&)

T*ACKVAGYDILKGTSTFVNGYAIGRDPAVWEDALKFKPERFLGNSIDVKGQDFELLPFG

AGRRMCPGMSLGLKTAQLLLFNLIHSFDWSFVPGKGMDCYELKEQSGTVLWLETPLEVVV

SSRVPKAI*

 

>CYP797H1Pv2 scaffold_99 fgenesh2_pg.C_scaffold_99000007

possible allele to fgenesh2_pg.C_scaffold_51000161

161955 MEVAQYAVVLLITLL 161911

161878 GLPLIGHLHLLGRILHLSFQTLSTKYGPIVFLRLGMVPAVVISSLELVKE 161729

161728 VLKIQDANFALGPYLTMGEYNY 161663

161665 NFRDIGFVLYCDYWKSMRKLCATELFTVKRIESFQG 161555

161556 VRTRETHGVLSELVNAADYQKPINM 161482

161463 YVFHVVMQILMSKPFFEYREHEAEMSSKGKDFKHIVFEITEQMLQFHISE 161314

161313 FVPAFMRRIDWKI 161275

161275 PEMMRIHARQDKFFKRIIDDHKARLESETSQPKDFMDTMLQSLKSEGARG 161126

161125 EE 161120

161062 ELLSGRDTSASLIEWTLLELMHNPLVLQ 160979

160960 TVVGKERLVAERGFDKLEYL 160901

160851 ACKVAGYDIPKGTPTFVICFTIGRDPAVWEDALRFKPER 160735

160734 FLGNLIDIKGQDFGL 160690

 

>CYP797H1Pv1 fgenesh2_pg.C_scaffold_99000007 manually annotated

MEVAQYAVVLLITLLGLPLIGHLHLLGRILHLSFQTLSTKYGPIVFLRLGMVPAVVISSLELVKEVLKIQDANFALGPYLTMGEYNYNFRD

IGFVLYCDYWKSMRKLCATELFTVKRIESFQG

VRTRETHGVLSELVNAADYQKPINMRHLLTAYVFHVVMQILMSKPFFEYREHEAEMSSKG

KDFKHIVFEITEQMLQFHISEFVPAFMRRIDWKIQR

MMRIHARQDKFFKRIIDDHKARLESETSQPKDFMDTMLQSLKSEGARGEESVKAIVT

QELLSGRDTSASLIEWTLLELMHNPLVLQRPRKRFTVVGKERLVAERG

FDKLEYLPAPLLIHMSTEACKVAGYDIPKGTPTFVICFTIGRDPAVWEDALRFKPERFLGNLI

DIKGQDFGLGQRMCLTLMTTWTCHVS*

 

>CYP797H1Pv1 fgenesh2_pg.C_scaffold_99000007|Selmo1

MEGLPLIGHLHLLGRILHLSFQTLSTKYGPIVFLRLGMVPAVVISSLELVKEVLKIQDANFALGPYLTMGEYNYNFRDIG

FVLYCDYWKSMRKLCATELFTVKRIESFQAYVFHVVMQILMSKPFFEYREHEAEMSSKGKDFKHIVFEITEQMLQFHISE

FVPAFMRRIDWKIQR*

 

>CYP797H1Pv1 fgenesh2_pg.C_scaffold_99000007 manually annotated pseudogene

MEVAQYAVVLLITLLGLPLIGHLHLLGRILHLSFQTLSTKYGPIVFLRLGMVPAVVISSLELVKEVLKIQDANFALGPYL

TMGEYNYNFRDIGFVLYCDYWKSMRKLCATELFTVKRIESFQGVRTRETHGVLSELVNAADYQKPINMRHLLTAYVFHVV

MQILMSKPFFEYREHEAEMSSKGKDFKHIVFEITEQMLQFHISEFVPAFMRRIDWKIQRMMRIHARQDKFFKRIIDDHKA

RLESETSQPKDFMDTMLQSLKSEGARGEESVKAIVTQELLSGRDTSASLIEWTLLELMHNPLVLQRPRKRFTVVGKERLV

AERGFDKLEYL &

W  A  I  V  K  V &

PAPLLIHMSTEACKVAGYDIPKGTPTFVICFTIGRDPAVWEDALRFKPERFLGNLIDIKGQDFGLGQRM

CLTLMTTWTCHVS*

 

 

>CYP797H2 fgenesh2_pg.C_scaffold_51000163|Selmo1

97% to fgenesh2_pg.C_scaffold_51000169|Selmo1

MEFLACAIALVFFIYVLVWGIP

GGGHRRLNLPVSPSGSLPLIGHLHLFGRKPHLSLLALSNKYGPIFSLRLGMVPSVVVA

SAHLAKELFKTQDVTFSSRPYFMPGEYSFYNFLDMGFAPYGDYWKNMRKLCATELFTIRRIDSFLWVRTEELREMLSALL

DSSLDCKPVNMRDMVTTCLFNVVTRILMSKRFYTFVGDEATMDDDAREFKSLLLSITDQALDFHISEFVPPWLRGIDWKI

PRLKKLQAKIDSFLQKIVDEHKLGVDSGKEDFMHIMLEYLKDEPYCEDSVKANSMELISGGTDTSAAVIEWAILELLHHP

EMLRKAQEEMDVVVGNSRLVGEADIAQLQYMQAVIKETFRLHPPIPLLPRMASHDCKLGGFDVPKGATTFLHVYAIGRDP

AVWDEPLKFMPERFLGNSLDVKGQDYELLPFGSGRRGCPGMILGLRTVQLLVSNLIHSFDWSFAGERGGEAFPLEERDTA

GTVIWTKTPLQVVATPRLRKEVLLG*

 

>scaffold_99

163598 MEFLACAMALVFFIYVLVWGIPGGGHRRLNLTVSPVG 163708

163727 LFGRKPHLSLLALSNKYGPIFSLRLGMVP 163813

 

>scaffold_99 possible allele to fgenesh2_pg.C_scaffold_51000163 95%

166643 HRRLNLPVSPSGSVPLIGHLHLFGRKPHLSV 166735

166739 PIFSLRLGMVPSVVVASAHLAKELFK 166816

166816 TQDFTFSSRPYFMPGEYSFYNFLDMGFA 166899

WKNM 166910

166913 ELCATELFTIRRMDSFLWVRTEELREMLSALLDSSLDCKPVNMRDMVTTC 167062

167063 LFNVVTRILMSKRFYTFVGDEATMDEDAREFKSLLLSITDQAIHFH 167200

167375 EPYCEDSVKANSM 167413

 

 

>CYP797H3 fgenesh2_pg.C_scaffold_51000164|Selmo1 86% to e_gw1.51.93.1|Selmo1

1360865-1361408 (+) strand

revised seq pseudogene 1360683-1361976

HLHAALGKNATPFIPGTLSKYGPIVFLHLGMVPAVVISSPELAKEVLKTRMQI

FASRPYLIMGEYNFYNFRGFVPMATTSMRKLCATELFTVKRIESF

QGVRTREMRGVLSALVNAADYQ

RHLLTTYVFNVVMQILMSKRFFE

DGEHEAEMSSEAKDFKHIVFEITEQMLQFHISEFVPAFMRQIDWKIPEIYARQD

KFLQRIIDHHKARLDSETSQPIDFMDIMLQSLKSEGTRGEE*VKAIV

ELLSGGDTSASLIEWTLLELMHNPLILQKAQEEIDTVVGKERLVAESDFDKLEYL

LLLIHMSAEACKVAGYDIPKGTSTIVNGYAIGGGPAVWEDAL*FKPERFLGNSIDIKGQDFE

MLLLNLIHALDWSFVPGKGMDCYELKEQSGIVL*LET

 

>scaffold_99 possible allele of fgenesh2_pg.C_scaffold_51000164 84%

but better match to fgenesh2_pg.C_scaffold_51000161

161855 ASLGKNPTPFIPDTLHK 161805

161809 TKYGPIVFLRLGMVPAVVISSLELVKEVLKIQDANFALGPYLTMGEYNY 161663

161617 SMRKLCATELFTVKRIESFQG 161555

161556 VRTRETHGVLSELVNAADYQ 161497

161481 RHLLTAYVFHVVMQILMSKPFFEYREHEAEMSSKGKDFKHIVFEITEQML 161332

161331 QFHISEFVPAFMRRIDWKI 161275

161266 MRIHARQDKFFKRIIDDHKARLESETSQPKDFMDTMLQSLKSEGAR 161129

161128 GEE 161120

161062 ELLSGRDTSASLIEWTLLELMHNPLVLQ

160960 TVVGKERLVAERGFDKLEYL 160901

160875 LLIHMSTEACKVAGYDIPKGTPTFVICFTIGRDPAVWEDAL 160753

160749 FKPERFLGNLIDIKGQDF 160696

 

>CYP797H4v1 e_gw1.51.102.1|Selmo1 scaffold_51 1362312-1363852 (+) strand

MGTLLYVIILLAFVYVLRKYLLHLKLPPSPWGLPLLGHLHHLAGIPFLSLHALSKQYGPILFMKLGTVPAVVISSSVLAK

EVLRSQDQMFASRPYILVGDYGLYHFQGIGPVPYNDHWKMMRKLCATELFTPKRIDSFLPIRLEEITGMFSALRGAGAHK

AVDMRNMLSIFTFNVMTRILMNKRFFEYGEDEEHIDGEAKQFKDIVFETADQGLQFHISEFIPHWLRWIDWKVPELKRLH

AKKDKFLQNILDQHKDMASTKEHKDFMDIMLQNLEHRGAAREDFIKAVVL (0)

ELTIAGTDTSACIVEWTLLELLHNPRVLSK

LKEELDAMVGSSSHMVEEPDFQNLDYLNAVIKEAFRLHPPLPLLIPHMSTQTCTIAGFHVPKNAFSFVNEYPYRKKAGVW

EKADEFWPERFLGKSVDVRGQDFELLPFGSGRRACAGMQLGLKTVQLLVSNLVHAFDWSFVPGKPSEDYLLQERHGTVNW

IKTPLQVCVVPRTR*

 

>CYP797H4v2 scaffold_99 e_gw1.99.33.1|Selmo1

allele to e_gw1.51.102.1|Selmo1 100%

7797 PSPWGLPLLGHLHHLAGIPFLSLHALSKQYGPILFMKLGTVPAVVISSSV 7946

7947 LAKEVLRSQDQMFASRPYILVGDYGLYHFQGIGPVPYNDHWKM 8075

8076 MRKLCATELFTPKRIDSFLPIRLEEITGMFSALRGAGAHKAVDMRNMLSI 8225

8226 FTFNVMTRILMNKRFFEYGEDEEHIDGEAKQFKDIVFETADQGLQFHISE 8375

8376 FIPHWLRWIDWKVPELKRLHAKKDKFLQNILD 8471

 

>CYP797H5 scaffold_51 = e_gw1.51.93.1|Selmo1 40% to 75b1 in CYP71 clan

(-) strand

1388479 MEFAQYAVVLLITLLFLVLSFKR 1388411

1388410 RLNLPPSPWGLPLIGHLHLLGRMLHLSFQALSTKYGPIVFLRL 1388282

1388281 GMVPAVVISSPELAKEVLKIQDANFASRPYLIMGEYNFYNFRDIGFVPYG 1388132

1388131 DYWKRMRKLCATELFTVKRIESFQGVRTREMRGVLSELVNAADYQKPINMRHLLTT 1387964

1387963 YVFNVVMQILMSKRFFEYGEHEAKMSSEAEDFKHIVFEITEQMLQFHISE 1387814

1387813 FVPAFMRRIDWKIPEMKRIHARQDKFLQRILDDHKARLESETSQPIDFMD 1387664

1387663 IMLQSLKSEGARGEESVKAIVT (0) 1387598

1387550 ELLSGGDTSASLIEWTLLELMHNPLILQKAQEEIDTVVGKERLVA 1387416

1387415 ESDFDKLEYLQAIVKEAFRIHPPAPLLIHMSTE 1387317

1387316 ACKVAGYDIPKGTSTFVNGYAIGRDPAVWEDALQFKPER 1387200

1387199 FLGNSIDVKGQDFELLPFGAGRRMCPGMSLGLKTAQLLLFNLIHSFDWSF 1387050

1387049 VPGKGMDCYELKEQSGTVLWLETPLEVVVSSRLPKPI* 1386936

 

>CYP797H6 fgenesh2_pg.C_scaffold_51000169|Selmo1 40% to 75B1 in CYP71 clan

MVAASRIVEHQIRWDCAGENIQELQEIFLPIPGRIRGKDIAVKDEFVFLVLDHPPRSVHGVLKRLHARI

GGGHRRLNLPV

SLSRSLPLIGHLHLFGRKPHLSLLTLSNKYGPIFSLRLGMVPSVVVASAHLAKELFKAQDVTFSSRPYFMPGEYSFYNFL

DMGFAPYGDYWKNIRKLCATELFTIRRIDSFLWVRTEELHEMLSALLDSSLDCKPVNMRDMVTTCLFNVITRILMSKRFY

TFVGDEATMDDDAREFKSLLLSITDQALDFHISEFVPPWLRGIDWKIPRLKKLQAKIDSFLQKIVDEHKLGVDSGKEDFM

HIMLEYLKDEPYCEDSVKANSMELICGTDTSAAVIEWAILELLHHPEMLRKAQEEMDVVVGNSHLVGEADIAQLQYMQAV

IKETFRFHPPIPLLPRMASHDCKLGGFDVPKGATTFVHVYAIGRDPAVWDEPLKFMPERFLGNSLDVKGQDYELLPFGSG

RRGCPGMILGLRTVQLLVSNLIHSFDWSFAGERGGEAFPLEERDSAGTVIWTKTPLQVVATPRLRKEVLLG*

 

>CYP797H7 scaffold_51 = fgenesh2_pg.C_scaffold_51000170|Selmo1

very similar to e_gw1.51.93.1|Selmo1

with some errors, pseudogene?

Revised seq

1393905 MEVAQYAVVLLITLLF LVLSFQASLICLQ (&) 1393819

1393819 GLPLIGHMHL 1393790

        STKYGPIMFLRLG

1393754 VVISSSELAKEVLKIQDANFASRPYLIMGEYNFYNFRDIGFVPYGDYWKR 1393605

1393604 MRKLCATELFTVKRIESFQGVRTREMRGVLPELVNAANFQKPINMSTS 1393461

1393452 YVFNVVMQILMSKRFFEYG*DEQRG 1393378

1393377 KDFKHIVFEITERMLQFHISEFVLAFMRRIDWKIPEMMRIHARQDKFFKR 1393228

1393227 IIDDHKARLESKTSQ 1393183

1393182 TMLQSLKSEGARGEDSVKA

1393085 ELLSGRDTSASLIERTLLELMHNPLVLQRPRKRL 1392984

1393002 KAQEEIDTVVGKERLVAE 1392949

        RNWSTLGNRQGPAPLLIHMSTE

1392882 ACKVAGYDIPKETPTFVNCYTIGRDPAVW 1392796

1392796 DALRFKPERFLGNLIDIKSQDFRL 1392725

        GQRMCLGMS

1392697 KTAQLLLFNLIHSFDWSFVPGKGMDCYELKEQSGTVLWLETPLEVVVSSRLPKPI* 1392530

 

>scaffold_51 1403309-1403380 (+) strand pseudogene

1403309 FDVPKDATTFLHVYAIGRDPATWD 1403380

 

>scaffold_51 1414418-1414731 (-) strand pseudogene

1414702 HISEFVPPWL 1414731 (+) strand

1414702 EPYCEDSVKANSM (0)

1414615 ELISGGTDTSAAVIKWSILELLHHPEMLGKAQEEM

        GNSCLVGEDNIVQLHYVQVVIKETFCLHPRI 1414418

 

>scaffold_99 85% to scaffold_51 1403309-1403380, possible allele

113114 EPYCKDSVK 113088

113028 ELISGGTDTSVVVIKWSILELLHHPKMLGKAQ 112933

112940 KLKEEMVNSCLVGEANIAQLQYMQAVIKE 112854

112855 KLQYVQAMIKETFCLYP 112805

 

>e_gw1.51.187.1|Selmo1 (-) strand pseudogene

77% to fgenesh2_pg.C_scaffold_51000163|Selmo1

revised seq, note: yellow is (+) strand

1417817 MGFLACAIAL (&)

        FIYVLVWGIPGGGHRRLNLXX 1417734

1417726 SPSGSLPLIGPLX 1417691

1417695 LFGRKPHLSLLALSNKYGPIFSLRLGMVP 1417609

1417456 SVVVASAHLAKELFKTQDVXXXXXXXX 1417512

1417517 MPGEYSFYNFLDMGVAPYGDYWKNMRKLCA 1417606

1417460 TELFTIRRMDSFLWVRTEELREMLSALLDSSLDCKPVNM 1417344

1417343 RDMVMTCLFNVVTRILMSKRFYTFVRDEATMDD 1417245

        XXXXXXXXXXXXXXXXXXX

1417190 RCIGWKIPRLKKLQAKIDS 1417246

        XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

 

>fgenesh2_pg.C_scaffold_51000173 [Selmo1:421441] 1417517-1419037 (+)

only the first 31 aa is a P450 seq.

MPGEYSFYNFLDMGVAPYGDYWKNMRKLCAT

GTIPSRREKIGPYLLDSARRERWGFLPKRCDLTTTGSTC

TIKKLPAVEHLFALTSFKLPEIPCSLSFQRHPDYMSITKEANEWAFKCMRRDFSPEEKKCLVQWKVPMFT

CLSTPHAPKANMLASAKFAWLTAFLDDPFDDNEVAGGALATSYLDTLLSLCYGTASLAEVPDILAYRACH

DLMEDLRSLFKPELFRRTVSTVEGWARSILSDDLTHEYELYRRTNVFILPLIYAMGASFDDEDVESLDYI

RAQNAMLDHMWMVNDVFSFPKEFYKKKFNNLPAVLLLTDPSVQTFQDAVNTTCRMIQDKEDEFIYYRDIL

ASVPEWEESFPEVPGCSLLHNPSESGVPLCEQPLPWHG*

 

>scaffold_51 1419689-1420168 (+) strand pseudogene

includes gw1.51.173.1

1419689 EVAQYAVVLLITLLLLVLSFK 1419751

1419745 FQALLICLQGLPLIGHLHL 1419801

1419835 LSTKYGPIVFLRLGMV 1419882

1419889 VVISSSELVREVLKIQDANFASRPYLTMGEYSY 1419987

1419985 YNF*DIGFVLYGDYWKSMRKLCATELFTIKRIESFQG 1420095

1420094 VQMRETRGVLSELVNAANYQKPIVM 1420168

 

 

>e_gw1.99.33.1|Selmo1 37% to 92A11 in CYP71 clan

MGTLLYVIILLAFVYVLRKYLLRLKLPPSPWGLPLLGHLHHLAGIPFLSLHALSKQYGPILFMKLGTVPAVVISSSVLAK

EVLRSQDQMFASRPYILVGDYGLYHFQGIGPVPYNDHWKMMRKLCATELFTPKRIDSFLPIRLEEITGMFSALRGAGAHK

AVDMRNMLSIFTFNVMTRILMNKRFFEYGEDEEHIDGEAKQFKDIVFETADQGLQFHISEFIPHWLRWIDWKVPELKRLH

AKKDKFLQNILDQHKDMASTKGHKDFMDIMLQNLEHRGAAREDFIKAVVLELTIAGTDTSACIVEWTLLELLHNPRVLSK

LKEELDAVVGSSSHMVEEPDFQNLDYLNAVIKEAFRLHPPLPLLIPHMSTQTCTIAGFHVPKNAFTFVNVYSIGRERGVW

ERADEFWPERFLGKSVDVRGQDFELLPFGSGRRACAGMQLGLKTVQLLVSNLVHAFDWSFVPGKPSEDYLLQERHGTVNW

IKTPLQVCVVPRTR*

 

>e_gw1.225.4.1|Selmo1 94% to e_gw1.99.33.1|Selmo1 C-term

MSTQTCTIAGFHVPKNAFTFVNVYSIRRERGVWERADEFWQERFLVKSVDVQGQDFELLPFGSGRRACAGMQLGLKTVQL

LVSNLVHAFDWSFVPGKPSEDYLLRECHGTINWIKTPLQVCVVPRTSS*

 

$$$$$$

 

>CYP791A1v1 e_gw1.7.405.1|Selmo1 41% to 92A11 in CYP71 clan

MEGLFQIGTAAIFLSWIAWSLFFAPRTRIYRGNLPPSPGFALPIIGHLHLLGNLPHVSFIELAKRYGPCLMLKLGSYPSL

LISSPEFAREALKVNDIVFSSRPSLAASRILADNAAGILWAPYGQEWRNLRKLCSLELLTSRRIEESRPVRAAEVAAAMA

RAKEISKAGICVNLTSLLEDLTFDIMRVWVMGSSESSRSSAGVYKRVMKESFVAGGEVHVGDYVPWLWWLDLAKVARMKR

VHGEIDDIIQKEIDEHCGKRSGSDDFITATLRNNEICRTDRDRKGLITDVIGGSTDTSALTVEWAMAELINNPRSLERAQ

DELLQTFGKNSLVEEDRLEELEFLTAVVKETLRLHPTAPILIYETTHECQLERYTIPPKTRVFINIYGIARSEASWSDPL

AFKPERFLGSGAIDVRGRDFEVLPFGSGRRGCPGIQLGFTMVMLVLANLLHGFHWSLPPGLSRLDMSEESGLTIPRAIPL

ELLAVPRLDARSYSV*

 

>CYP791A2v1 gw1.112.69.1|Selmo1 95% to e_gw1.7.405.1|Selmo1

NLPPSPGFALPIIGHLHLLGKLPHVSFIELAERYGPCLMLKLGSYPCLLISSPEFAREALKVNDIAFSSRPSLAASRILG

DNAAGILWAPYGQQWRNLRKLCSLELLTSRRIEESRPVRAAEV

 

>CYP791A2v1 gw1.112.69.1 manually annotated 94% to CYP791A1v1

MEGLLQIGTAAIFLSWIAWSLFFAPRTRIYRGNLPPSPGFALPIIGHLHLLGKLPHVSFIELAERYGPC

LMLKLGSYPCLLISSPEFAREALKVNDIAFSSRPSLAASRILGDNAAGILWAPYGQQWRN

LRKLCSLELLTSRRIEESRPvraaevaaamaraKEISKAGICVNLTSLLADLTFDIM

RVCVTGssessrssAGVYKRAMKESFVAGGEVHVGDYVPWLWWLDLAKVARMKRV

HGeiddiiqkeideHRGNSSGSDDFITATLRNDEICRTDRDRKGLIS (0)

DVIGGGTDTSALTVEWAMAELINNPRSLERAQDELLQTFGKNSLVEEDRLEEL

EFLTAVVKETLRLHPPAPILIYETTHECQLERYTIPPKTRVFINIYGIARSEASWSDPL

AFKPERFLGSGAIDVRGRDFEVLPFGSGRRGCPGIQLGFTMVMLVLANMLHGFHWSLPP

GLSRLDMSEESGLTIPRAIPLELLAVPRLDARSYPV*

 

>CYP791A2v2 fgenesh2_pg.C_scaffold_24000217|Selmo1 98% to gw1.112.69.1

with one frameshift

MEGLFQIGTAAIFLSWIAWSLFFAPRTRIYRGNLPPSPGFALPIIGHLHLLGKL

PHVSFIELAERYGPCLMLKLGSYPCLLISSPEFAREALKVNDIVFSSRPSLAASRILGDN

AAGILWAPYGQQWRNLRKLCSLELLTSRRIEESRPVRAAEVAAAMARAKEMSKAGICVNL

TSLLADLTFDIMRVCVMGSSESSRSSAGVYKRAMKESFVAGGEVHVGDYVPWLWWLDLAK

VARMKRVHGEIDDIIQKEIDEHRGNSSGSDDFITATLRNDEICRTDRDRKGLIS (0)

DVIGGGTDTSALTVEWAMAELINNPRSLERAQEELLQTFGRNSLVEED

RLEELEFLTAVVKETLRLHPPS &

ILIYETTHECQLERYTIPPKTRVFINIYGIARSEASWSD

PLAFKPERFLGSGAIDVRGRDFEVLPFGSGRRGCPGIQLGFTMVMLVLANLLHGFHWSLP

PGLSRLDMSEESGLTIPRAIPLELLAVPRASILFEIYQRKYF*

 

$$$$$$

 

>CYP790A1 SMCN2 40% to e_gw1.7.405.1|Selmo1 new Jing-Ke not in JGI P450 downloaded set

MDSLLLELPLVAFIVSLFCFILNRFSRSKQQFSLPPSPPALPVIGHLHLIGDLPHHSMLELSKKYGEFMFLKLGSLNTLVVSSPDAAKIVLKTLDPEFAMKPEHLEAKYASYGGRGIIFAQYGEHWRQARKLCTVQLLSTKRVESAEPNRKLEMGLLLADLWKCADDGAVVNLTNKLSDFAFNVMLKMVTGKSHSSSASSRDEEEQARSIKEGLMEFVREGTGMHIATFFPWLTWVDKQVYKLASVHKRVDKILESEIDRHREKLGKSQPSMQHENFIDVMLMDSDANDAHIKAMTVDMLAASTDTASITSEWAISELLNHPAALAKVQAELDEVIGQERTMQESDIRSLTYLQAVINETLRLHPPVPIYPRENSAQACMISAKWGVPARTRVFINAYAIGRDETLWKEAHRFKPERFLEEKVGIDARGQDFELIPFGAGRRMCPGMQLGHTNVMLAVGSLLHAFNWIIPGADNGTGKVDMQEHFGMTVARAAPLQLLPVPRLPAHALALKPGI*

 

$$$$$$

 

>CYP790C1 SM116.5 95% to SM1584064, 47% to e_gw1.7.405.1|Selmo1 new Jing-Ke

not in JGI P450 downloaded set

MEFLRLALAFLKALVFKLGCMSKSSSKSFSLPPSPRAVPLLGHLHLLGKLPHQSLQKLASRYGDVMLLKLGSHRTLVISSAEAARAVLKTHDHVFSSRPSTVAGKIFGYGGAGLVWAPYGEHWRTVRKLCTLELLTAKRVETSHPVRKREMAFVLDELSRHQQSDKQLEPVDLTTKLSDLTFNIMTRMVMNKSYLTGTSAEKEAAVRFKDLITEAFVVGTSCLSDSFSWLAWVDPQARKMERIHQQQDAYLSKQIAEHRQQPGSNGDFLDVMLAMEELSDTSIKSLSQDMLGAGTDTTAVTVEWALSELVKDPALLRRAQEELTEMVGDKAMVDESDLPKLRYLQAVVKETLRLHPAGPLLLPHESAEACVLENYTIPAKTRVIVNAYAIARDSRWWDEPLKFDPERFLEKCQGMDVRGQSFEYLPFGSGRRGCPGVTLGMTTVMFILANLIHAFDWKLASGEEMDMTEAFGVTVPRASPLKLVPSSLNLEFPPKFKS

 

$$$$

 

>CYP790C2 SM128.2 new Jing-Ke 44% to e_gw1.63.102.1|Selmo1, 64% to SM1584064

MEFLWIGFASFIALVFLKLVSGNRGSRSKSPPSPPGLPILGHLHLLGKLPHQSLQKLSQRHGGLMLVKLGVHNTLVPSTTEAARELLKTQDHVFSSRPRTIAGENFGYGGAGMVWAAYGDHWRSVRKLCTLELLTAKRVEMFQQVRKAEMSMLLKEIQSSQMSSVELTSKLLDLTFNFMTRMVMNRSYSSGSSAERELAVRFKDLITEAFTVAGSNTLADFFPYLGWMDGQAKKICAIHKQLDEYLAKQIVEHRQQPGTNRDFLDMMLARKDLSDTSIKALCLDMIAAGTDTAAVTVEWALAELVNNPAMMLQVQEELKEVVGENRALDETDLPKLTFLQAIVKETLRLHPPGPLSIPHQSIQACELEGYVIPAGTHALVNVYAIARDPRWWDEPLKFDPERFLRQPDIDVRGQSFELLPFGSGRRSCPGILLGTTTVQFVLGSLLHAFDWAAPDGKELDMAEKFGLSVPRASPLRLVPCTRLNPQAYI

 

$$$$$$

 

>CYP790B1v1 SM179.4 44% to e_gw1.7.405.1|Selmo1 Jing-Ke new seq not in JGI P450 downloaded set

MVMEQVCTKPQLPPQLPPSPTGLPFIGHLHLLGKLPHQSLLKLAQQYGDVMFLKLGKVNTLVVSSSDSAKEVLNTQDHIFGSRPKTTFSETIGYGGAGLAFANGENWKSTRKVCMYEVLTTKRVESFHPIRKFEVSLFMNELLKASREGSAVDLSSKLSDLTFNVISTMVLGKSYSASALSEAEKKETMFFKETLDEAAIMAGFHAGDYLPIPDWMDTQVNKIKQLQRDLDQFIQKEVESHRQRRDPGQAPRDFVDVLLSNSHISDTSIKALIV (0)

DMVGGGTESSAVSVVWALAELIKNPRLMERAQRELKEVVGEDRSLEESDIPNLPFLQAIVKETMRLHPPGPLLIPHESTEECEIGGYTVPARTRTVVNIYAIARDEDNWEDPLNFDPDRFMGSNIDLKGRHFEYLPFGSGRRICPGLMLAMATVQFILGSVLHGFNWRLPSGQTIDDLDMSESFGLTVPKAVPLKLVPSPRLEPQIYVKSLSS

 

>CYP790B1v1 e_gw1.14.326.1|Selmo1

MVMEQVCTKPQLPPQLPPSPTGLPFIGHLHLLGKLPHQSLLKLAQQYGDVMFLKLGKVNTLVVSSSDSAKEVLNTQDHIFGSRPKTTFSETIGYGGAGLAFANGENWKSTRKVCMYEVLTTKRVESFHPIRKFEVSLFMNELLKASREGSAVDLSSKLSDLTFNVISTMVLGKSYSASALSEAEKKETMFFKETLDEAAIMAGFHAGDYLPIPDWMDTQVNKIKQLQRDLDQFIQKEVESHRQRRDPGQAPRDFVDVLLSNSHISDTSIKALIV (0)

DMVGGGTESSAVSVVWALAELIKNPRLMERAQRELKEVVGEDRSLEESDIPNLPFLQAIVKETMRLHPPGPLLIPHESTEECEIGGYTVPARTRTVVNIYAIARDEDNWEDPLNFDPDRFMGSNIDLKGRHFEYLPFGSGRRICPGLMLAMATVQFILGSVLHGFNWRLPSGQTIDDLDMSESFGLTVPKAVPLKLVPSPRLEPQIYVKSLSS

*

 

>CYP790B1v2 e_gw1.37.203.1|Selmo1 99% to e_gw1.14.326.1|Selmo1

54% to e_gw1.7.405.1|Selmo1

MVMEQVCTKPQLPPQLPPSPTGLPFIGHLHLLGKLPHQSLLKLAQQYGDV

MFLKLGKVNTLVVSSSDSAKEVLNTQDHIFGSRPKTTFSETIGYGGAGLAFANGENWKST

RKVCMYEVLTTKRVESFHPIRKFEVSLFMNELLKASREGSAVDLSSKLSDLTFNVISTMV

LGKSYSASALSEAEKKETMFFKETLDEAAIMAGFHAGDYLPIPDWMDTQVNKIKQLQRDL

DQFIQKEVESHRQRRDPGQAPRDFVDVLLSNSHISDTSIKALIV (0)

DMVGGGTESSAVSVVWALAELIKNPRLMERAQRELKEVVGEDRSLEESDIPNLPFLQ

AIVKETMRLHPPGPLLIPHESTEECEIGGYTVPARTRTVVNIYAIARDEDNWEDPLNFDP

DRFMGSNIDLKGRHFEYLPFGSGRRICPGLMLAMATVQFILGSVLHGFNWRLPSGQTIDD

LDMSESFGLTVPKAVPLKLVPSPRLEPQIYVKSLSS*

 

$$$$$$

 

>CYP797G2v1 estExt_fgenesh1_kg.C_260005|Selmo1 98% to estExt_Genewise1Plus.C_340233|Selmo1

MDVFTASILLILILLPLLGFYFRQSWLKPPLPPSPSSGLPLIGHLHLLGKLPHQSFQALAEKHGPIFSLRFGFRHAVVIS

STDLAKEVLRVHDATFASRPSNVGMNIGFYKYLMGGAPYGDLWKQLRRLYSVELLTSKRIDSFLPLRLEELSLMLSGLAR

AHERNEAVDMRNLLTCFTFNTITRILMNKRYFQHQGEELHGIDSSEASVFKAILVELSETALQFRISALLPSYLRWIDWS

VYWIRRLHAKQDQFLQKIIDEHKNEKNTSTSSKDIMDMMLGLLAEDPRGEDIVKAAMTELVSGGTDTSATVIEWALAEIL

HRAPRVLGKAHDELDAVVGRSRMVDEADLPRLPYLQAIIKENFRLHPPAPLLVPHMPTHESNLAGYRVLGGTTTFVNVYA

IGRDPALWDEPLEFRPERFLGSSVDVKGQDFELLPFGSGRRACPGMGLGLRTVQLALANLIHGFHWSAAEENALEEAGGA

VIWVKTPLKAMASPRLPVEVLAWN*

 

>CYP797G2v2 estExt_Genewise1Plus.C_340233|Selmo1 38% to CYP81F3, 38% to 75B1 in the CYP71 clan

same as Jing-Ke SM1583029 100%

MDVFTASILLILILLPLLGFYFRQSWLKPPLPPSPSSGLPLIGHLHLLGKLPHQSFQALAEKHGPIFSLRFGFRHAVVIS

STDLAKEVLRVHDATFASRPSNVGLDIGFYKYFMGGAPYGDLWKQLRRLYSVELLTSKRIDSFLPLRLEELSLMLSGLAR

AHERNEAVDMRNLLTCFTFNTITRILMNKRYFQHQGEELHGIDSSEASVFKAILVELSETALQFRISALLPSYLRWIDWS

VYWIRRLHAKQDQFLQKIIDEHKNEKNTSTSSKDIMDMMLGLLAEDPRGEDIVKAAMTELVSGGTDTSATVIEWALAEIL

HRAPRVLDKAHDELDAVVGRSRMVDEADLPRLPYLQAIIKENFRLHPPAPLLVPHMPTHESNLAGYRVLGGTTTFVNVYA

IGRDPALWDEPLEFRPERFLGSSMDVKGQDFELLPFGSGRRACPGMGLGLRTVQLALANLIHGFHWSAAEENALEEAGGA

VIWVKTPLKAMASPRLPVEVLAWS*

 

$$$$$$

 

>CYP797G1v1 e_gw1.26.173.1|Selmo1 76% to estExt_Genewise1Plus.C_340233|Selmo1

MNKRYFQHQGEELQGIDSSEASVFKAVLSEITEISLQFHISEFVPAYLRWMDLSVYHMRRLHADQDKFLQKIVDEHKYEK

NKSSKDFMDLMLELFDGDPKGDNMIKAAMTELVSAGTETSATTVEWTFGEILHRAPHVLTKAHEELDSVVGRSRLVDEAD

LPRLPYLQAIIKEAFRLHVPVPLLVPHMSMHEASLDGYHVPKGATTIVNAYAIGRDPALWDNPLEFRPERFLGSSMDVKG

QDFELLPFGSGRRACPGMGLGLKTVQLALANLIHGFDWKASGQNALEEAAGAVIWLKTPLEAVGSPRLQVEVLTSCHI*

 

>CYP797G1v1 e_gw1.26.173.1 manually annotated

MDLVTAFIVLLVILLPILRGLFQRSRLPPSPSFglplighlhllgRMPHQSLQALAKKHGSILFLRLGIIPAVVVSSVD

LAKEVLKNQDLTFASRPYFLVGEDVGYHFMGMSLAGYGDHWKKLRRLYTLELFTAKRIDSFLSLRL

EELSHMLSAVLYAHEKNQAVNMRNLLTCFTFNTITRILMNKRYFQHQGEELQGIDSSEAS

VFKAVLSEITEISLQFHISEFVPAYLRWMDLSVYHMRRLHADQDKFLQKIVDEHKYEK

NKSSKDFMDLMLELFDGDPKGDNMIKAA

LQELVSAGTETSATTVEWTFGEILHRAPHVLTKAHEELDSVVGRSRLVDEADLPRLPYLQ

AIIKEAFRLHVPVPLLVPHMSMHEASLDGYHVPKGATTIVNAYAIGRDPALWDNPLEFRP

ERFLGSSMDVKGQDFELLPFGSGRRACPGMGLGLKTVQLALANLIHGFDWKAS

GQNALEEAAGAVIWLKTPLEAVGSPRLQVEVLTSCHI*

 

>CYP797G1v2 fgenesh2_pg.C_scaffold_55000176|Selmo1 80% to e_gw1.26.173.1|Selmo1

MRNVFTCFTFNIITRILMNKRAFIKDEHKYEKHKSSKKDFIDLMLELLDGVPKGEDMVKAAITELVSAGTETSATTLEWT

FAEILHHAPHVLTKTQVELDTVVGCSRLVDKAVLPRLPYLQAIIKEAFQLHPPVPLLVPHMSI*

 

$$$$$$

 

>CYP797C1v1 gw1.24.101.1|Selmo1 34% to 71A22 in CYP71 clan

90% to fgenesh2_pg.C_scaffold_40000077|Selmo1

89% to fgenesh2_pg.C_scaffold_89000080|Selmo1

PLIGHLHLITKQPHRSLQALSKKYGPIMFLKLGMIPSIIVSSPEMAKEALMNNGLAFASRPYLLISEIIGYDFQSIGIHY

SEHSRRLRKMCVTELIAPQKLESSLWVRFQELSRAFRILQKSNEEKVAVDMRYLFSTFTFNAFTMILMSKRYFGDTTDDN

DQHREIKHVINEIFSLAIKFHITEFVPSYLRCFLEWLDPTIPQFKRLHERQDKFMKKIIKEHKEPTARPKDFMDALLESF

SAEDTVKAFITELLLASDSTAVAAEWVMAQLLHNPHVLEKAQFELNLVVGPNRLVQESDFSKLEYLQAIIKETLRLCPPG

PLLIPRSSDEACTIGGYYVPKGSTLFVNAFAIGRDPSIWERPTEFMPERFLGRSVDFKGQHFDLIPFGSGRRMCPGMPLA

LKALELLLANLVHGFDW

 

>CYP797C1v1 gw1.24.101.1 manually annotated

MELALSSFALPFLLLVLTGALSILVTSWDKKKNLPPSPGWALPLIGHLHLITKQPHRSL

QALSKKYGPIMFLKLGMIPSIIVSSPEMAKEALMN

NGLAFASRPYLLISEIIGYDFQSIGIHYSEHSRRLRKMCVTELIAPQKLESSLWVRFQE

LSRAFRILQKSNEEKVAVDMRYLFSTFTFNAFTMILMSKRYFGDTTDDNDQHREIKHVI

NEIFSLAIKFHITEFVPSYLRWLDPTIPQFKRLHERQDKFMKKIIKEHKEPTARPK

DFMDALLESFSAEDTVKAFITVSSLHILLLASDSTAVAAEWVMAQLLH

NPHVLEKAQFELNLVVGPNRLVQESDFSKLEYLQAIIKETLRLCPPGPLLIPRSSDEACT

IGGYYVPKGSTLFVNAFAIGRDPSIWERPTEFMPERFLGRSVDFKGQHFDLIPFGSGRRM

CPGMPlalkalelllanlVHGFDWSFPPGEIQTLEDCFETTlllksplkllAVPRHSASVYAEI*

 

>CYP797C1v2 gw1.112.68.1|Selmo1 98% to gw1.24.101.1|Selmo1

TAVAAEWVMAQLLHNPHVLEKAQLELNLVVGPNRLVQESDFSKLEYLQAIIKETLRLCPPGPLLIPRSSDEACTIGGYYV

PKGSTLFVNAFAIGRDPSIWESPTEFMPERFLGRSVDFKGQHFDL

 

>CYP797C2v1 fgenesh2_pg.C_scaffold_40000077|Selmo1 90% to gw1.24.101.1|Selmo1

MCVTELIAPQKLDSSLWVRLQELSRAFRILQQSYEEKVAVDMRYLFSTFTFNAFTMILMSKRYFGDTTDDHDQHMELKHV

INEIFSLTIKFHITEFVPSHLRRFFEWVDPTIPQFKRLHEKQDKFMKKIIEEHKESTDRPKDFMDALLESFDAEATVKAF

ITELLLASDSTAVAAEWVMAQLLHNPHVLEKAQLELNLVVGPNRLVQETHLVCCSPLLPWKAFSSSLLSRLPKVFGSASL

LVAPQAFLAPCSGKR*

 

>CYP797C4v1 fgenesh2_pg.C_scaffold_89000080|Selmo1 89% to gw1.24.101.1|Selmo1

MCVTELIAPQKLDSSLWVRLQELSRAFRILQQSYEENVAVDMRYLFSTFTFNAFTMILMSKRYFGDTTDDHDQHMELKHV

INEIFSLTIKFHITEFVPSHLRRFFEWVDPTIPQFKRLHEKQDKFMKKVIEEHKEPTDRPKDFMDALLESFNAEDTVKAF

ITELLLASDSTAVAAEWVMAQLLHNPHVLEKAQLELNLVVGPNRLDSSSVLFATEAFGSSLLSRLPKVFGILERDEVANS

ALHHAVDHTNQLHKQNSYNLGDGFI*

 

>CYP797C3v2 fgenesh2_pg.C_scaffold_69000014|Selmo1

97% to fgenesh2_pg.C_scaffold_40000078|Selmo1

MSRRFFGDASKGDADSIKFRRSIHQSLSLAIKFHITEFVPAYLRGFLEWLDPSIPHFKKLHEIQDRFLQKVLEEHKESRQ

STKDFMDIMLENFKEEGSGGENVVKAVITDLILASDSTGVAAEWAMAQLLHNPSVMEKAQIELNLVVGPNRLVEELL*

 

>CYP797C3v2 fgenesh2_pg.C_scaffold_69000014 manually annotated

MELALSSFLLPFLLLVLTGALSILVTLWDKKKNLPPSPGWALPLIGHLHLIRKQPHRSLQALSKKYGPIMFLKLGMVPSII

VSSPEMAKEALTNNGLAFASRPYLLVSEIIGYNFQNIGIHYSEHSRRLRKMCVTELIAP

QKLDSSLWVRLQELSRAFRILQQSYEEKVAVDMRYLFSTFTFNAFTMILMSKRYFGDTTD

DHDQHMELKHVINEIFSLTIKFHITEFVPSHLRWVDPTIPQFKRLHEKQDKFMKK

IIEEHKESTDRPKDFMDALLESFDAEATVKAFITVSSLHILLLASDST

AVAAEWVMAQLLHNPHVLEKAQLELNLVVGPNRLVQESDFSKLEYFQAIIKETLRLCPPG

PLLIPRSSDVACTIGGYYVPKGSTLFVNAFAIGRDPSIWERPTEFMPERFLGRSVDFKGQ

HFDLIPFGSGRRMCPGMPlalkalelllaNFVHGFYWSFPPGEIQTLEDCFETTLVLKSP

LKLLAVPRHSASVYAEI*

 

>CYP797C3v1 fgenesh2_pg.C_scaffold_40000078|Selmo1

97% to fgenesh2_pg.C_scaffold_69000014|Selmo1

97% to fgenesh2_pg.C_scaffold_89000081|Selmo1

60% to gw1.24.101.1|Selmo1

MSRRFFGDASKGDADSIKFRRSIHQSLSLAIKFHITEFVPAYLRGFLEWLDPSIPHFKKLHEIQDRFLQKVLEEHKESRR

GTKDFMDIMLENFKEEGSGGENVVKAVITDLILASDSTGVATEWAMAQLLHNPSVMEKAQIELNLVGKVYTLEDTFETAL

LLKTPLEVTLTIA*

 

 

>CYP797C5v1 fgenesh2_pg.C_scaffold_89000081|Selmo1

MSRRFFGDASKGDADSIKFRRSIHQSLSLAIKFHITEFVPAYLRGFLEWLDPSIPHFKKLHEIQDRFLQKVLEEHKESRQ

STKDFMDIMLENFKEEGSGGENVVKAVITDLILASDSTGVAAEWAMAQLLHNPSVMEKAQIELNLVVGPNRLVEELL*

 

>CYP797C5v1 fgenesh2_pg.C_scaffold_89000081 manually annotated

MITILFLYISMPLSKKIKLMESTLLLLLLLFLIMGFTALRRNNNNLPPSPGWAIPLVGHL

YLVGMQAHRSLQALSQKCGPIMYLKLGLVPSIIVSSPEMAKEALKDN

GLAFASRPYLLINELVGYNSVGIGIRYGEHTKRLRKICTVEFLTTQRIDSFSWVRSEEL

SRAFRVLLKSRERKAAVNLRELLSTFTFNAVTEILMSRRFFGDASKGDADSIKFRRSIHQ

SLSLAIKFHITEFVPAYLRGFLEWLDPSIPHFKKLHEIQDRFLQKVLEEHKESRQSTKDF

MDIMLENFKEEGSGGENVVKAVITVDLILASDSTGVAAEWAMAQLLHNPSVMEKAQIELNL

VVGPNRLVEESDFSKLEYFQAIIKE

TMRLCPPGPLLIPRSSDEACKIGGYHIPKGSTLFINAFAMGRDPRIWEHPTKFMPERFLG

SSTDIKGQHFELIPFGSGRRICPGMPLGLRTLQLILSNLLHGFDWSFVQGKVYTLEDTFE

TALLLKIPLEVMATPRHSLDVYKVF*

 

$$$$$$

 

>CYP784A1 e_gw1.74.110.1|Selmo1 37% to 706A2, 43% to 92A11 in CYP71 clan

MLFGQKLEAAKTVVGLVEKTASLSLLINIGELFPLMDWLDLHGIYKIMKKEILPDIKKVLGEIIEQRNGTRKEGQEARDI

LDVLLTLKDDDGVSEASVMALLMDMITAGLESSQNVAEFSIAESLNHPHIIQRAQQELDAVVGRKRLVREEDLVKLPYVQ

GIVKETLRMHPPGPLGIPHANPKPVSIAGYTVPANCKVLVNMWAIGRDPACWDRAEEFLPERFINSDYDVAGNHFHFIPF

SAGRRICVGYPLAMRSIPLVVATLLHSFEWKRQDGNSLETAKGLLSIKLASKINLSGHPRLDESAYY*

 

>CYP784A1 e_gw1.74.110.1 manually annotated

MELLDLVIASCILALSCTWLMSFRKPQGRLPPGPLSIPLFGSIFSLKQPLHEHF

IHLSKKYGPLIYLKVGMCDLLVANNSAMAKEVLQTHDVEFAYRPDTRSFRLFSLGYKDLL

FAPYGDSWKKLRKVSTTHMFTSSKLNISARQRETELLSIIRSIKTSFDSGNSVELRDLV

AEYNTNVICLMLFGQKLEAAKTVVGLVEKTASLSLLINIGELFPLMDWLDLHGI

YKIMKKEILPDIKKVLGEIIEQRNGTRKEGQEARDILDVLLTLKDDDGVSEASVMALLMVMF

TAGLESSQNVAEFSIAESLNHPHIIQRAQQELDAVVGRKRLVREEDLVKLPYVQGIV

KETLRMHPPGPLGIPHANPKPVSIAGYTVPANCKVLVNMWAIGRDPACWDRAEEFLPERF

INSDYDVAGNHFHFIPFSAGRRICVGYPLAMRSIPLVVATLLHSFEWKRQDGN

SLETAKGLLSIKLASKINLSGHPRLDESAYY*

 

>scaffold_51 = gw1.51.183.1 1189452-1189857 (-) strand

76% to e_gw1.51.93.1|Selmo1

1189857 IETVVGKECLLAERGFDKLEYL 1189792

1189775 PAPLLIHMSAKACKVAGYNIPKGTSTFANCYTIGRDPTVWEDALRFKTER 1189626

1189625 FLGNLIDIKRQD 1189590

1189589 FGLGQRMCLGMSLGLKTAQLLLFNLIHAFDWSFVPDKGMDCYKLNK 1189452

 

 

$$$$$$

 

>fgenesh2_pg.C_scaffold_54000202|Selmo1 57% to e_gw1.47.107.1|Selmo1 in CYP71 clan possible false positive

 

MEVFKPLRAEGILQVLKSITRQEGSVVSIWNRLPVLNVNNIAQMAFHKQVIGHPMFERFLMVLEESLDLAAVSVPGEFLD

PYGTVAKMKALINEIYQMIVDEHKLKRKVNYNAGPDDRVDILLAEGVDENTIKGMVMWALSSLINTPSCMEKAQEELDRV

ARDSRVQEEDLDELVYLKAKETFRLHPPLPLLLPRESTQKCNRAGSQPMGIPEQFKPEGFLESSIVIVGTIYRPWWSSPL

LVYSRL*

 

>e_gw1.37.196.1|Selmo1 48% to e_gw1.37.336.1|Selmo1  possible false positive

LLVNVWVVQMDPTVWENPTLLLPNHFIGSGLEPRLWAHQKEMPLGFEHYGAGRISSMASIGNLCLGQKLIYPLIS*

 

$$$$$$

 

>e_gw1.75.73.1|Selmo1

93% to estExt_Genewise1Plus.C_21159|Selmo1

93% to estExt_fgenesh2_pg.C_750058|Selmo1

93% to CYP92/75   precursor fam.   Selaginella moellendorffii

88% to estExt_Genewise1.C_750113|Selmo1

NFELLPFGSGRRICSGLSLGVAPWFRTLARLVHGFEWKVSGKELSMDEISEGVAVRRKVPLEVFATPRLASHAYL*

 

>CYP787D1 estExt_Genewise1Plus.C_21159|Selmo1 94% to estExt_fgenesh2_pg.C_750058|Selmo1

92% to estExt_Genewise1.C_750113|Selmo1 41% to 92A11

MASFVALFLLTLSLGLLWRILTKIVDRSLPPGPPRVPLLGHLHLLGVLPHKSLSDLSSRYGPV

MLLWFGFAPTLVVSSPDAAREVLCTQDLAFASRPKISIAKYMFYNSKDLGWTSYGPYWRLMRKVTTVELFTAKRLEESRM

VRHAQVSKLIGFIVNNGQNGKASVNMKFLLSILNLNVVSLITFGREFPAGSVELIEEVMQLMGSFVLGDCFPFLSWLGSP

VIRKMISAHTKLDQLLQEIVDEHKSKFKSSERARDFVDVLLSLEDQGEIDIQCVKAMIMDMMLAGTETSAITTEWALSEL

MNNPTCMIKAQKEIDTIVGRERMVVEADLCKLSYINSVVNEVFRLHLPAPMLLPRHSTQDCLVNGYKIPKNSRVLVNVWS

IARDPSLWESPNLFNPDRFAESSISFKGKNFELLPFGSGRRICPGLSLGVAMVSHTLARLVHGFEWKVSGKELSMDEISE

GVAVRRKVPLEVFATPRLASHAYL*

 

>CYP787D1 SM1582340 Jing-Ke 100% to estExt_Genewise1Plus.C_21159|Selmo1

Longer N-term probably correct

MASFVALFLLTLSLGLLWRILTKIVDRSLPPGPPRVPLLGHLHLLGVLPHKSLSDLSSRYGPV

MLLWFGFAPTLVVSSPDAAREVLCTQDLAFASRPKISIAKYMFYNSKDLGWTSYGPYWRLMRKVTTVELFTAKRLEESRMVRHAQVSKLIGFIVNNGQNGKASVNMKFLLSILNLNVVSLITFGREFPAGSVELIEEVMQLMGSFVLGDCFPFLSWLGSPVIRKMISAHTKLDQLLQEIVDEHKSKFKSSERARDFVDVLLSLEDQGEIDIQCVKAMIMDMMLAGTETSAITTEWALSELMNNPTCMIKAQKEIDTIVGRERMVVEADLCKLSYINSVVNEVFRLHLPAPMLLPRHSTQDCLVNGYKIPKNSRVLVNVWSIARDPSLWESPNLFNPDRFAESSISFKGKNFELLPFGSGRRICPGLSLGVAMVSHTLARLVHGFEWKVSGKELSMDEISEGVAVRRKVPLEVFATPRLASHAYL*

 

>CYP787D4v1 estExt_Genewise1.C_750113|Selmo1

MASIVALFLLTLSFGLLWRILTKIVDRSLPPGPPRVPLLGHLHLLGVLPHKSLSDLSRRYGP

MLLWFGFAPTLVVSSPDAAREVLCTQDLAFASRPKISIAKYMFYNGKDLAWTSYGPYWKLMRKVTTVELFTAKRLEESRM

VRHTQVSKLIDFIVNNGQNGKASINMKVLLSILNLNVVSSITFGREFHAGSVELIEEVLRLMGSFVLGDYFPFLSWLGSP

AIRKMISAHTKLDQLLQEIVDEHKSKVKSSERARDFVDVLSSLEDQGEIDVQCMKAVIMDMIVAGTETSSITTEWALSEL

MNSPTCMIKAQKEIDTIVGRERMVVEADLCKLSYIHNVVNEVFRLHPPGPMLLPRHSTQDCLVNGYKIPKNSRVLVNVWS

IARDPSLWESPNLFKPDRFVESSISFKGKNFELLPFGSGRRICPGLSLGVAMVSYTLACLVHGFKWKVSGKELSMDEISD

GVSVRRKVPLEVFATPRLASHAYL*

 

>CYP787D3v1 estExt_fgenesh2_pg.C_750058|Selmo1 98% to CYP92/75   precursor fam.   Selaginella moellendorffii

MASIVALFLLTLSFGLLWRILTKIVDRSLPPGPPRVPLLGHLHLLGVLPHKSLSDLSRRYGP

MLLWFGFAPTLVVSSPDAAREVLCTQDLAFASRPKISVAKYVFYNSKDLGWTTYGPYWRLMRKVTTVELFTAKRLEESRM

VRHTQVSKLIDFIVNNGQNGKASINMKVLLSILNLNVVSSITFGREFHAGSVEVIEEVMRLMGSFVLGDCFPFLSWLGSP

VIRKMISAHTKLDQLLQEIVDEHKSKFKSSERAGDFVDVLLSLEDQGEIDVQCVKAMIMDMILAGTETSAITTEWALSEL

MNSPTCMIKAQKEIDTIVGRERMVVEADLCKLSYIHNVVNEVFRLHPPAPLLLPHHSTQDCLVNGYKIPKNSRVLVNVWS

IARDPSLWESPNLFKPDRFAESSISFKGKNFELLPFGSGRRICPGLSLGVAMVSYTLARLVHGFEWKVSGKELSMDEISE

GVAVRRKVPLEVFATPRLASHAYL*

 

>CYP787D3v2 e_gw1.111.64.1|Selmo1 100% to SMDN837695

MASIVALFLLTLSFGLLWRILTKIVDRSLPPGPPRVPLLGHLHLLGVLPHKSLSDLSSRYGPVMLLWFGFAPTLVVSSPD

AAREVLCTQDLAFASRPNISITKYMFYNGKDLGWTSYGPYWRLMRKVTTVELFTAKRLEESRMVRHTQVSKLIDFI

 

>CYP787D3v2 e_gw1.111.64.1 manually annotated 100% to SMDN837695

MASIVALFLLTLSFGLLWRILTKIVDRSLPPGPPRVPLLGHLHLLGVLPHKSLSDLSRRYGPV

MLLWFGFAPTLVVSSPDAAREVLCTQDLAFASRPKISIAKYMFYNGKDLAWTSYGPYWKLMRKVTTVELFTAKRLEESRMVRHTQVSKLIDFIVNNGQNGKASINMKVLLSILNLNVVSSITFGREFHAGSVELIEEVMRLMGSFVLGDCFPFLSWLGSPVIRKMISAHTKLDQLLQEIVDEHKSKFKSSERAGDFVDVLLSLEDQGEIDVQCVKAMIMDMILAGTETSAITTEWALSELMNSPTCMIKAQKEIDTIVGRERMVVEADLCKLSYIHNVVNEVFRLHPPAPLLLPHHSTQDCLVNGYKIPKNSRVLVNVWSIARDPSLWESPNLFKPDRFAESSISFKGKNFELLPFGSGRRICPGLSLGVAMVSYTLARLVHGFEWKVSGKELSMDEISEGVAVRRKVPLEVFATPRLASHAYL*

>CYP787D3v2 SMDN837695 95% to SM1582340, 98% to estExt_fgenesh2_pg.C_750058|Selmo1

all but one diff in one small segment, N-term is longer, probably correct

MASIVALFLLTLSFGLLWRILTKIVDRSLPPGPPRVPLLGHLHLLGVLPHKSLSDLSRRYGPV

MLLWFGFAPTLVVSSPDAAREVLCTQDLAFASRPKISIAKYMFYNGKDLAWTSYGPYWKLMRKVTTVELFTAKRLEESRMVRHTQVSKLIDFIVNNGQNGKASINMKVLLSILNLNVVSSITFGREFHAGSVELIEEVMRLMGSFVLGDCFPFLSWLGSPVIRKMISAHTKLDQLLQEIVDEHKSKFKSSERAGDFVDVLLSLEDQGEIDVQCVKAMIMDMILAGTETSAITTEWALSELMNSPTCMIKAQKEIDTIVGRERMVVEADLCKLSYIHNVVNEVFRLHPPAPLLLPHHSTQDCLVNGYKIPKNSRVLVNVWSIARDPSLWESPNLFKPDRFAESSISFKGKNFELLPFGSGRRICPGLSLGVAMVSYTLARLVHGFEWKVSGKELSMDEISEGVAVRRKVPLEVFATPRLASHAYL*

 

>CYP787D2 e_gw1.75.28.1|Selmo1 99% to e_gw1.111.64.1|Selmo1 100% to SMDN837695

94% to estExt_Genewise1.C_750113|Selmo1

MASIVALFLLTLSFGLLWRI

LTKIVDRSLPPGPPRVPLLGHLHLLGVLPHKSLSDLSSRYGPVMLLWFGFAPTLVVSSPD

AAREVLCTQDLAFASRPNISITKYMFYNGKDLGWTSYGPYWRLMRKITTVELFTAKRLEE

SRMVRHTQVSKLIDFIVNNGQNGKASINMKFLLSILNLNVVSSITLGREFHAGSVELIEE

VMRLMDSFVLGDCFPFLSWLGSPVIRKMISAHTKLDQLLQEIVDEHKSKFKSSERARDFV

DVLLSLEDQGEIDVQCVKAMIM (0)

DMIIAGTETSAITTEWALSELM

NSPTCMIKAQKEIDTIVGREWMVVEADLCKLSYIHNVVNEVFRLHPPAPMLLPHHSTQDC

LVNGYKIPKNSRVLVNVWSIARDPSLWESPNLFNPDRFAESSISFKGKNFELLPFGSGRR

ICPGLSLGVAMVSYTLARLVHGFEWKVSGKELSMDEISEGVAVRRKVPLEVFATPRLASH

AYL

 

>CYP787C1v1 Scaffold_60 100% to Jing-Kes SM413.4

new 51% to estExt_fgenesh2_pg.C_750058|Selmo1

81969 MAALVVTLLIVLLPLLLWWLRIYQ 82040

82041 SKKNVAPGPLAIPLLGHLHLLGRHPHKALSILSKKFGSVMSINLGSVPTL 82190

82191 VISSPDAAKTILSTQDIFFASRPRTAAAKFIFFNARDMVWCEYGSYWRTM 82340

82341 KKVSTLELFTAKRVEESKKLRMEEISRLVTSIAREGDNGRVAIDMNAKLS 82490

82491 MTNMNLVSFMAFSQRFEESSFVELLQEAIDLVTSFVPSDYFPYLSWMDDY 82640

82641 LGTVPKMKAVQGKLDKIFQAIIDEHRRVNGEKQRAPDLVDVLLSLDEVDD 82790

82791 NDRKGLIM (0) 82814

82867 DMFGAGIDTSSITTEWALSELIRNPACMLKAQREIDQAVGFDRAVNEDDL 83016

83017 LNLGYVRAIAKETFRLHPPVPLLIPHESTQESLVNGLRVPARTRATVNVW 83166

83167 SIGRDPRWWERPEVFDPDRFAARSVIDVKGQHFELLPFGSGRRMCPAMGL 83316

83317 GLAMVELSLARLIQGFEWNLPAGLQELNMEEEFGVTLRKRVHLSALAMPR 83466

83467 LKAELY 83484

 

>CYP787C1v2 Scaffold_0 = allele of SM413.4 (96%) (-) strand)

1516573 MAALVVTLLIVLLPLLLWWLRIYQSKKNVAPGPLAIPLLGHLHMLGRHPH 1516424

1516423 KALSSLSKKFGSVMSINLGSVPTLVISSPDAAKTILSTQDIVFASRPRTA 1516274

1516273 AAKFIFFNARDMVWCEYGSYWRTMKKVSTLELFTAKRVEESKKLRMEEIS 1516124

1516123 RLVTSIAREGDNGRVAIDMNAKLSMTNMNLVSFMAFSRKFEESSFVELLQ 1515974

1515973 EAIGLVTGFVPSDYFPYLGWMDDYLGTVPKMKAVQGKLDTIFQAIIDEHR 1515824

1515823 CVNAEKQRAPDLVDVLLSLDEVDDNDRKGMIM (0) 1515728

1515661 DMFGGGVDTASITTEWALSELIRNPACMLKAQREIDQAVGFDRAVNEDDL 1515512

1515511 LNLGYVRAIAKETFRLHPPVPLLVPHESTQECLVNGLRIPARTRATVNVW 1515362

1515361 SIGRDPRWWERPEMFDPDRFAARSVIDVKGQHFELLPFGSGRRMCPAMGL 1515212

1515211 GLAMVELSLARLIQGFEWNLPAGLQELNMEEEFGVTLRKRVHLSALAMPR 1515062

1515061 LKAELY 1515044

 

$$$$$$

 

>CYP787C2v1 SM1581020 51% to estExt_fgenesh2_pg.C_750058|Selmo1 Jing-Ke new model not in downloaded set from JGI (on scaffold_0 from 1514368-1512841, (-) strand)

MEDMAALIVALLIVLLPLLWWWLCSKKNVAPGPLAIPLLGHLHLLGRHPH KSLCSLSKKYGSVMSIDLGSVSTLVISSPDAAKAILSTQDIFFASRPRTAAAKHIFFNARDMVWCEYGSYWRTMKKVCTLELFTAKRVEESKKLRVEEISRLVTSIAREGDNGRVAIDMNAKLSMTNMNLVSFMAFSRRFEESSFVELLQEAIGLVTGFVPSDYFPYLGWMDDYLGTVPKMKAVQGKLDKIFQAIIDEH

RCVNAEKQRAPDLVDVLLSLDEVDDNDRKGLIM

DMFGAGVDTASITTEWALSELIRNPACMLKAQREIDQAVGFDRAVNEDDLLNLGYVRAIAKETFRLHPPVPLLVPHESTQECLVNGLRVPARTRATVNVWSIGRDPRWWERPEVFDPDRFAARSAIDVKGQHFELLPFGSGRRMCPGMGLGLAMVELSLARLIQGFEWTLAPKLQKLDMEEEFGMTLRRRVPLRALAIPRMKAELYGGIC*

 

>CYP787C2v2 This seq is downstream of SM413.4 686bp.  There is no filtered model for

This seq or SM413.4, 18 aa diffs (96%) to SM1581020 (frameshift AFTER DEHSK)

Scaffold_60 = allele of SM1581020 (on scaffold_0 from 1514368-1512841)

84170 MEDMAALIVALLIVLLPLLWWWLCSKKNVAPGPLAIPLLGHLHLLGRHPH 84319

84320 KSLCSLSKKYGSVMSIDLGSVSTLVISSPDAAKAILSTQDIFFASRPRTA 84469

84470 AAKHIFFNARDMVWCEYGSYWRTMKKVCTLELFTAKRVEESKKLRVEEIS 84619

84620 RLVTSIAWEGDNGRVGIDMNAKLSMTNMNLVSFMAFSRRFEESSFVDLLQ 84769

84770 EAIGLVTGFVPSDYFPYLGWMDDYLGTVPKMKAVQGKLDKIFQAIIDEHSK 84922

84921 NAEKQRAPDLVDVLLSLDEVDDNDRKGLIM (0) 85010

85060 DMFGAGIDTSSITTEWALSELIRNPACMLKAQREIDQAVGFDRAVNEDDL 85209

85210 SNLGYVRAIAKETLRLHPPVPLLVPHESTQECMINGFRVPARTRATVNVW 85359

85360 SIGRDPRWWERPEVFDPDRFAARSAIDVKGQHFEPLPFGSGRRMCPGMGL 85509

85510 GLAMVELSLARLIQGFEWTLAPGLQELDMEEEFGVTLQRRVPLRALAIPR 85659

85660 MKAELYGGIC 85689

 

$$$$$$

 

>fgenesh2_pg.C_scaffold_41000202|Selmo1

53% to estExt_fgenesh2_pg.C_750058|Selmo1 mid region

MKAAHKKLDKVLQRITDEHKSKLKPVRKGDGKPLDKVDNQAPDLIDVMLSLDDFDNDCLKGMITDVLAGGTDTAAIAMEW

ALSELIRNQPCMAKAQDEIDLIVGGGRDVNEDDLSKLKYLKAVVKETFRLHPPAPLRLKVVFGSDGHLQKKRIEV*

 

$$$$$$

 

>fgenesh2_pg.C_scaffold_188000009|Selmo1 30% to 92A9 rice mid region, CYP71 clan only partial sequence

MEMGLLLADLRKCAEDGAVVNLTNRLSDFAFNVMLKKVTGKSHSSSASSRDEEEQARSVKEGLMEFVREGTGMHIATFFP

WLKWVDKQVYKLATVHKRVDKILQSEIDWHREKLGKSQASMQQQDFIDVMLMESDANDQILLVLCCHEDNLVQWNLGHGF

SLATVS*

 

$$$$$$

 

>CYP785A9v1 estExt_fgenesh1_kg.C_820002|Selmo1 1 aa diff to estExt_Genewise1Plus.C_820077|Selmo1

98% to fgenesh1_pm.C_scaffold_142000016|Selmo1

38% to 92A11 in CYP71 clan

MELLSSIPAFLQENCYSLLLVLLLVIVTSRWFFRKPSDLPPGPFSLPVIGCLHLIGPLPHVSLHELSRKYGGIMHLKFGT

VPFVVVSSEEAAKELYKYRGLEFASKVPTIAGRHFGNDFNGIVYAEYTPQLKLYRKIVNTHLLSATRLKVYDKIRREEQC

SLARSIVSAEGTPIKLRDKFHNLNVNIITYMLFGERFYGAHARNTAALDAFADAVIESLRLSGVFNISDFIPAIKWLDVQ

RLEKRYKQLIAKVNDYLLSVLQDHRRNPRKYRRDEPVPFIDILLSLDSTEEEVSDITKLSLLFDMLLGAVDTSALSLEWA

ITELLRHPSVMEKARKDIDSVVGSNRLVEDSDLDQLPFIAAIAKETLRLHQLAPLALPKVVQGGPSKLGGYTIPNGTCAF

VNFHSLGIDPAHWKDPMKYRPERFLEADIDVFGQDYNLLPFGSGRRMCPGAKLGFDTLQIGIATLVQGFEWKLAKGQDPA

EINMDETYGLVCHKTQPLIAVPKARLERSVYSS*

 

>CYP785A9v2 fgenesh1_pm.C_scaffold_142000016|Selmo1

MELLSSIPAFLQENCYSLLLVLLLVIVTSRWFFRKPSDLPPGPFSLPVIGCLHLIGPLPHVSLHELSRKYGGIMHLKFGT

VPFVVVSSEEAAKELYKYRGLEFASKVPTIAGRHFGNDFNGIVYAEYTPQLKLYRKIVNTHLLSATRLKVYDKIRREEQC

SLARSIVSAEGTPIKLRDKFHNLNVNIITYMLFGERFYGAHARNTAALDAFVDAVIESLRLSGVFNISDFIPAIKWLDVQ

RLEKRYKQLIAKVNDYLLSVLQDHRRNPRKYRSDEPVPFIDVLLSLDSTEEEVSDITKLSLLFDMLLGAVDTSALSLEWA

ITELLRHPSAMEKARKDIDSVVGSNRLVEDSDLDQLPFIAAIAKETLRLHQLAPLALPKVVRGGPSKLGGYTIPNGTCAF

VNFHSLGIDPAHWKDPMKYRPERFLEADIDVFGQDYNLLPFGSGRRMCPGAKLGFDTLQIGIATLVQGFEWKLAKGQDPA

DINMDETYGLVCHKTQPLIAVPKARLERSVYSS*

 

>CYP785A10v1 estExt_Genewise1Plus.C_820077|Selmo1 same as Jing-Ke SM1581610 100%

MELLSSIPAFLQENCYSLLLVLLLVIVTSRWFFRKPSDLPPGPFSLPVIGCLHLIGPLPHVSLHELSRKYGGIMHLKFGT

VPFVVVSSEEAAKELYKYRGLEFASKVPTIAGRHFGNDFNGIVYAEYTPQLKLYRKIVNTHLLSATRLKVYDKIRREEQC

SLARSIVSAEGTPIKLRDKFHNLNVNIITYMLFGERFYGAHARNTAALDAFADAVIESLRLSGVFNISDFIPAIKWLDVQ

RLEKRYKQLIAKVNDYLLSVLQDHRRNPRKYRRDEPVPFIDVLLSLDSTEEEVSDITKLSLLFDMLLGAVDTSALSLEWA

ITELLRHPSVMEKARKDIDSVVGSNRLVEDSDLDQLPFIAAIAKETLRLHQLAPLALPKVVQGGPSKLGGYTIPNGTCAF

VNFHSLGIDPAHWKDPMKYRPERFLEADIDVFGQDYNLLPFGSGRRMCPGAKLGFDTLQIGIATLVQGFEWKLAKGQDPA

EINMDETYGLVCHKTQPLIAVPKARLERSVYSS*

 

>CYP785A11P gw1.49.98.1|Selmo1 88% to estExt_fgenesh1_kg.C_820002|Selmo1

85% to estExt_Genewise1Plus.C_820077|Selmo1

86% to fgenesh1_pm.C_scaffold_142000016|Selmo1

GYTIPNHTCAFVNFHSLCIDLAH*K

NPMKYQPERFLEADIDMFRQDYNLLPFGSGRQMCPGTKLGFDTLQIGTATLVQGFEWKLAKGQDPAEINMDKTYDLVCHK

MQPLIAVPKAQLERAI

 

$$$$$$

 

>fgenesh2_pg.C_scaffold_50000058|Selmo1 possible pseudogene fragment

42% to 92A11 in CYP71 clan

MKNALPRRCANGLESAYIAQARSSSWKHGPASSILRRTPELPPYDTEATLALTPRRYISLSFVMHQDIVGDRNPLLPVPV

TNPACLKWMLTVCKSKMNAATHLKHLKQDRFASMGRDETSFGSKTIVIVWTDHLVPNSDRYNLLRRSLRSSSWCLSAREH

CILRAASESLLILPATVYEYALRAPLTLAKTTVHRSMDIDKRGYLLGTYCSLGRGKPFPNDLVKPGIGGFLGVAKDTCDT

SQAIHSRAKSGRGSFQLASLLQWLSLAFLKRLSSVCLKPAGTEFCSLLDGRKQLLTVAIETGRHRASPCWSFCGRFWRLR

SLEADASHGPLCAECDSQVWNQGPPFRTFTELVLIHITYRWAGSQFTLGEGIALQSARESKAPGMDWGDLWKTITMLRRS

AWLSREAALGDITAVCPFKLFRTMQHEGVRPDKVTFLLDVCNRSSLSPLGFLQRRCSKYLPGTGTKMLTLRPGGRDEPGR

RQDRRIFDSCASLCEQGVRAHEARNSPLSGTLRGRMAASTGCRRRIYQRTEMASLEDAKLVPSSSPPPPRCPHRRIYKVL

PGPPPRLPSPPPPPPSPPPPPPSPPPPSPPPPSPPPPPPSPPPPSPPPPSPPPPTLRFRGRVAARTPPLPVHTCEEQLLQ

KEPIKSLFKKFLGIAIHNEKIKKDQLNQGVMKNLLQHASGCIDFFPTRFACYSHHRGVYGCVARAGEARKLHFTPPFMHK

LPSHDLAQLLQNTVQQVKSIPRVETTKVPWTAAIPGSGEPSQLFFQARRQCQAQKRPSDSFWNIGLCQGSSCGEAWDTFV

ARGICQAIASLEIRKLLYQSAPVPGMKVLMCFPGELKARSTRRIIEPQRSLIPFYQNYDLPLRMNLLYCCCGLLPPPCFT

SEASRLVYFMICHVAKFC

PNQTRILINAYMIRCDKTTWREIDPDRFLGSCVDVKGQLLPFGSGRRSCPGIHLEILIHVFD

WGGLDPASLAMSELLD*

 

$$$$$$

 

>gw1.37.173.1|Selmo1 84% to fgenesh2_pg.C_scaffold_11000221|Selmo1

50% to 703A3 in CYP71 clan possible pseudogene fragment

DMFAARTDSSVVPSEWLLAAVLQKPRGLARAQEELDRVVGNARILRESSCNTL

 

>fgenesh2_pg.C_scaffold_11000221|Selmo1

MAVHEKSYKVCTNLLPSPWGSALAQRNILSGVVSSQELVKERFTLVNFVPWYLRWLVGGFPSTKDMFAARTDSSVVPSDW

LLAAVLQKPRGLTQAQEELDRVVGNGRILRESDFSKLEYLGAIIKDTFRR*

 

$$$$$$

 

>e_gw1.33.157.1|Selmo1 94% to gw1.5.535.1|Selmo1

ETLRICPPGPLLIPRSSDESCKIRGYHIPKGTALFTLAMGRDPRIWEPPPRSVYTLR*

 

>gw1.5.535.1|Selmo1 57% to 81F2 in CYP71 clan

ETLRICPPGPLLIPRSSDESCKIRGYHIPKGTALFTLAMGRDPRIWEHPTKFMPERF

 

$$$$$$

 

 

CYP72 clan sequences (70 sequences in 21 bins) [15% of the P450 sequences]

 

>1 CYP779E9v1 estExt_fgenesh1_pm.C_10041|Selmo1 98% to e_gw1.16.569.1|Selmo1

MEAQWILSACIALFTAALWRFMTVYWWRPRAIAAQLKKQGIRGPPPTLMAGQMLEIRKTMAAIRDHDMETFSQDIVHRVQ

PGFHKWNNQYGKRFVYWWGTEPRISVSEPEIVREALSKKFSHFEKSDMSVWFLTMFLGRGLVSVTGEEWSHHRRLVAPAF

FHERIKQMTGTIATCASVMLDRWEAMMQQNPEIEISAEARKLTGDVISHTAFGTSYLKGQRVFVILTKEIPDLFPILFRF

SWILPGVRFLPLPVNLKLWKFHQELDSLITGIIDERRESVKCGRSDSYGNDLLGLMLKECDSSNSKFTNKDLIEECKTFY

FAGHETTASLLTWTLMLLGGYPEWQDRARAEVHEVCGTETPDGENVSKLKLIGAILYETLRLYPPAVEMTRECMVETWLQ

DLHVPKGVTLAFQVIGMHHDKELWGEDATEFNPDRFKDGISNACKHPNAFIPFSLGPRVCVGQSFAMIEAKVILAMILQR

FSFRLSPNYRHNPAMKFGLKPIHGVPLVLETVGRFQES*

 

>CYP779E9v2 e_gw1.16.569.1|Selmo1 42% to CYP735A2, 42% to CYP709C1

MEAQWILSACVALFTAALWRFMTVYWWRPRAIAAQLKKQGIRGPPPTLMAGQMLEIRKTMAAIRDHDMESFSQDIVHRVQ

PGFHKWNKQYGKRFVYWWGTEPRISVSEPEIVREALSKKFSHFEKSDMSVWFLTMFLGRGLASVTGEEWSHHRRLVAPAF

FHERIKQMTGTIATCASVMLDRWEAMMQQHPEIEISAEARKLTGDVISHTAFGTSYLKGQRVFVILTKEIPDLFPILFRF

SWILPGFRFLPFPVNLKLWKFHQELDSLITGIIDERRESVKCGRSDSYGNDLLGLMLKECDSSNSKFTNKDLIEECKTFY

FAGHETTASLLTWTLMLLGGYPEWQDRARAEVHEVCGTETPDGENVSKLKLIGAILYETLRLYPPAVEMTRECMVETWLQ

DLHVPKGVTLAFQVIGMHHDKELWGEDATEFNPDRFKDGISNACKHPNAFIPFSLGPRVCVGQSFAMIEAKVILAMILQR

FSFRLSPNYRHNPAMKFGLKPIHGVPLVLETVGRFQES*

 

$$$$$$

 

>13 CYP779E3v1  estExt_Genewise1Plus.C_120760|Selmo1 43% to 709C5

MEGRWILSICIVLFTAALWRFVTVYWWRPRAIAAQLKKEGIQGPPPRFMVGQIAEIQNMRSAIKDHDMESFSHDIFHRVH

PALLKWRKQYGKRFVFWWGTEPRISVSEPEIVREVLSKKFSQFDKSEAGLRLANLFLGRGLVSVTGEEWSHHRRLVAPAF

FHERIKQMTGTIAGCASRMLDQCEATMEQNPEIEISGEVRKLTGDVISHTAFGTSYLKGQRVFEILSKKIPELLPKLVSF

SWIPGFRFLPLPINLRMWKLHQELDSLITGIIDERRNSVKSGGSNTYGNDLLGLMLKECDSSSNFTSRDLIEECKTFYIA

GHETTATLLTWTLMLLGGYPEWQERARAEVHEVCGNEIPDGESVSRLKLVGMILYETLRLYPPAIEMTRECMEESWLQDL

HVPKGVSVSFPIAGLHQDKELWGEDAGQFNPDRFKDGISSACKHPNAFMPFSFGPRVCVGQSFAMIEAKVILAMILQRFS

FRLSPNYRHNPAMKFGLKPIHGVPLVLSKM*

 

>CYP779E3v2 estExt_Genewise1Plus.C_150304|Selmo1 98% to estExt_Genewise1Plus.C_120760|Selmo1

MEGRWILSICIVLFTAALWRFVTVYWWRPRAIAAQLKKEGIQGPPPRFMVGQIAEIQNMRSAIKDHDMESFSHDIFHRVH

PALLKWRKQYGKRFVFWWGTEPRISVSEPEIVREVLSKKFSQFDKSEAGLRLANLFLGRGLVSVTGEEWSHHRRLVAPAF

FHKRIKQMTGTIAGCASRMLDQCEATMHQNPEIEISGEVRKLTGDVISHTAFGTSYLKGQRVFEILSKKIPELLPKLVSF

SWIPGFRFLPLPINLRMWKLHQELDSLITGIIDERRNSVKSGGSNTYGNDLLGLMLKECDSSSNFTRRDLIEECKTFYFA

GHATTATLLTWTLMLLGGYPEWQERARAEVHEVCGNEIPDGESVSRLKLVGMILYETLRLYPPAIEMTRECVEESWLQDL

HVPKGVSVSFPIAGLHQDKELWGEDAGQFNPDRFKDGISSACKHPNAFMPFSFGPRVCVGQSFAMIEAKVILAMILQRFL

FRLSPNYRHNPAMKFFFLKPIHGVPLVLSKM*

 

$$$$$

 

>CYP779E5v1 e_gw1.12.695.1|Selmo1 96% to estExt_Genewise1Plus.C_120760|Selmo1

missing N-term 15 aa

AALW*FVTV &

YWWRPRAIAVQLKKEGIQGPPPRFMVGQIPEIQNMRSAIKDHDMESFSHDIFHRVHPALLKWRKQYGKRFVFWWRTEPRI

LVSEPEIVREVLSKKFSQFDKSEAGLRLANLFLGGGLVSVTGEEWSHHRRLVAPAFFHERIKQMTSTIAGCASRMLDQCE

ATMEQNPEIEISGEVRKLTGDVISHTAFGTSYLKGQRVFEILSKKIPELVPKLVSFSWIPGFRFLPLPINLQLWKLHQEL

DSLITGIIDERRNSVKSGGSNTYGNDLLGLMLKECDSRSNFTSRDLIEECKTFYIAGHETTATLLTWTLMLLGGYPEWQE

RARAEVHEVCGNDIPDGESVSRLKLVGMILYETLRLYPPVNEMTRECVEECWLQVLHIPKGVSVSFPIVGLHQDKELWGE

DAGQFNPDRFKDGISSACKHPNAFMPFSFGPRVCVGQSFAMIEAKVILAMILQRFSFRLSPNYRHNPAMKFGLKPIHGVP

LVLGKM*

 

>15 CYP779E5v2 e_gw1.15.285.1|Selmo1 98% to estExt_Genewise1Plus.C_120760|Selmo1

MEGRWILSICIVLFTVALWRFVTVYWWRPRAIAAQLKKEGIQGPPPRFMVGQIAEIQNMRSAIKDHDMESFSHDIFHRVH

PALLKWRKQYGKRFVFWWGTEPRISVSEPEIVREVLSKKFSQFDKSEAVLRLANLFLGRGLVSVTGEEWSHHRRLVAPAF

FHERIKQMTGTIAGCASRMLDQWEATMEQNPEIEISGEVRKLTGDVISHTAFGTSYLKGQRVFEILSKKIPELVPKLVSF

SWIPGFRFLPLPINLRMWKLHQELDSLITGIIDERRNSVKSGESNTYGNDLLGLMLKECDSSSNFTSRDLIEECKTFYIA

GHETTATLLTWTLMLLGGYPEWQERARAEVHEVCGNEIPDGESVSRLKLVGMILYETLRLYPPAIEMTRECVEESWLQDL

HVPKGVSVSFPIAGLHQDKELWGEDAGQFNPHRFKDGISSACKHPNAFMPFSFGPRVCVGQSFAMIEAKVILAMILQRFL

FRLSPNYRHNPAMKFGLKPIHGVPLVLGKM*

 

$$$$$

 

>14 CYP779E4v1 fgenesh2_pg.C_scaffold_12000349|Selmo1 97% to estExt_Genewise1Plus.C_120760|Selmo1

MEGRWILSICIVLFTAALWRFVTVYWWRPRAIAAQLKKEGIQGPPPRFMVGQIPEIQNMRSAIKDHDMESFSHDIFHRVH

PALLKWRKQYGKRFVFWWGTEPRILVSEPEIVREVLSKKFSQFDKSEAGLRLANLFLGGGLVSVTGEEWSHHRRLVAPAF

FHERIKQMTSTIAGCASRMLDQCEATMQQNPEIEISGEVRKLTGDVISHTAFGTSYLKGQRVFEILSKKIPELVPKLVSF

SWIPGFRFLPLPINLRLWKLHQELDYLITGIIDERRNSVKSGGSNTYGNDLLGLMLKECDSSSNFTSRDLIEECKTFYIA

GHETTATLLTWTLMLLGGYPEWQERARAEVHEVCGNDIPDGESVSRLKLVGMILYETLRLYPPVNEMTRECVEECWLQVL

HVPKGVSVSFPIVGLHQDKELWGEDAGQFNPDRFKDGISSACKHPNAFMPFSFGPRVCVGQSFAMIEAKVILAMILQRFS

FRLSPNYRHNPAMKFGLKPIHGVPLVLSKM*

 

>CYP779E4v2 estExt_Genewise1.C_150325|Selmo1 97% to estExt_Genewise1Plus.C_120760|Selmo1

MEGRWILSTCIVLFTAALWRFVTVYWWRPRAIAAQLKKEGIQGPPPRFMVGQIAEIQNMRSAIKDHDMESFSHDIFHRVH

PALLKWRKQYGKRFVFWWGTEPRILVSEPEIVREVLSKKFSQFDKSEAGLRLANLFLGGGLVSVTGEEWSHHRRLVAPAF

FHERIKQMTSTIAGCASRMLDQCEATMQQNPEIEISGEVRKLTGDVISHTAFGTSYLKGQRVFEILSKKIPELVPKLVSF

SWIPGFRFLPLPINLRLWKLHQELDSLITRIIDERRNSVKSGGSNTYGNDLLGLMLKECDSSSNFTSRDLIEECKTFYIA

GHETTATLLTWTLMLLGGYPEWQERARAEVHEVCGNEIPDGESVSRLKLVGMILYETLRLYPPVNEMTRECVEECWLQVL

HVPKGVSVSFPIVGLHQDKGLWGEDAGQFNPDRFKDGISSACKHPNAFMPFSFGPRVCVGQSFAMIEAKVILAMILQRFS

FRLSPNYRHNPAMKFGLKPIHGVPLVLSKM*

 

$$$$$

 

>11 CYP779E1v1 fgenesh2_pg.C_scaffold_12000323|Selmo1 95% to estExt_Genewise1Plus.C_120760|Selmo1

MEGSWILSTCIVLFTAALWRFVTVYWWRPRVIAAQLKKEGIQGPPPRFMVGQIAEIQNMRSAIKDHDMGSFSHDIFHRVH

PSLLKWRKQYGKRFVFWWGTEPRISVSEPEIVREVLSKKFSQFDKSEAGLRLANLFLGRGLVSVTGEEWSHHRRLVAPAF

FHERIKQMTGTITGCASRMLDQWEATRQQNPEIEISGEVRKLTGDVISHTAFGTSYLEGQRVFEILSKKFPELMPKLVSF

SWIPGFRFLPLPINLRLWKLHQKLDSLITGIIDERRNSVKSGGSNTYGNDLLGLMLKECDSSTNFTSRDLIEECKTFYIA

GHATTATLLTWTLMLLGGYPEWQERARAEVHEVCGNEIPDGESVSRLKLVGMILYETLRLYPPVVEMTRECVEESWLQDL

HVPRGVSVSFPIAGLHQDKELWGEDAGQFNPDRFKDGISSACKHPNAFMPFSFGPRVCVGQSFAMIEAKVILAMILQRFS

FRLSPNYRHNPAMKHGLKPTHGVPLVLSKM*

 

>CYP779E1v2 e_gw1.15.275.1|Selmo1 95% to estExt_Genewise1Plus.C_120760|Selmo1

MEGSWILSTCIVLFTAALWRFVTVYWWRPRVIAAQLKKEGIQGPPPRFMVGQIAEIQNMRSAIKDHDMGSFSHDIFHRVH

PSLLKWRKQYGKRFVFWWGTEPRISVSEPEIVREVLSKKFSQFDKSEAGLRLANLFLGRGLVSVTGEEWSHHRRLVAPAF

FHERIKQMTGTITGCASRMLDQWEATRQQNPEIEISGEVRKLTGDVISHTAFGTSYLEGQRVFEILSKKFPELMPKLVSF

SWIPGFRFLPLPINLRLWKLHQELDSLITGIIDERRNSVKSGGSNTYGNDLLGLMLKECDSNTNFTSRDLIEECKTFYIA

GHATTATLLTWTLMLLGGYPEWQERARAEVHEVCGNEIPDGESVSRLKLVGMILYETLRLYPPVVEMTRECVEESWLQDL

HVPRGVSVSFPIAGLHQDKELWGEDAGQFNPDRFKDGISSACKHPNAFMPFSFGPRVCVGQSFAMIEAKVILAMILQRFL

FRLSPNYRHNPAMKHGLKPIHGVPLVLSKM*

 

$$$$$

 

>CYP779E8v1 estExt_fgenesh1_pm.C_120070|Selmo1 96% to estExt_Genewise1Plus.C_120760|Selmo1

MEGRWILSICIVLFTAALWRFVTVYWWRPRAIAAQLKKEGIQGPSPRFMVGQIAEIQNMRSAIKDHDMESFSHDIFHRVH

PALLKWRKQYGKRFVFWWGTEPRISVSEPEIVREVLSKKFSHFDKSEARLRFTNLFLGRGLASVTGEEWSHHRRLVAPAF

FHERIK (0)

(Seq gap)

GQRVFEILSK

KIPELLPKLVSFSWIPGFRFLPLPINLQLWKLHQELDSVITGIIDERRNSVKSGGSNTYGNDLLGLMLKECDSS

SNFTSRDLIEECKTFYIAGHETTATLLTWTLMLLGGYPEWQERARAEVHEVCGNEIPDGESVSRLKLVGMILYETLRLYP

PAIEMTRECVEESWLQDLHVPKGVSVSFPIIGLHQDKELWGEDAGQFNPDRFKDGISSACKHPNAFMPFSFGPRVCVGQA

FAMIEAKVILAMILQRFLFRLSPNYRHNPVTKFGLKPMHGVPLVLSKM*

 

>18 CYP779E8v2 estExt_fgenesh2_pg.C_150170|Selmo1 95% to estExt_Genewise1Plus.C_120760|Selmo1

MEGRWILSICIVLLTAVLWRFVTVYWWRPRAIAAQLKKEGIQGPPPRLMVGQIAEIQNMRSAIKDHDMESFSHDIFHRVH

PALLKWRKQYGKRFVFWWGTEPRISVSEPEIVREVLSKKFSQFDKSEARLRFTNLFLGRGLVSVTGEEWSHHRRLVAPAF

FHERIKQMTGTIAGCASRMLDQWEATRQQNPEIEISGEVRKLTGDVISHTAFGTSYLKGQRVFEILSMKIPELLPKLVSF

SWIPGFRFLPLPINLRLWKLHQELDSLITGIIDERRNSVKSGRSNTYRNDLLGLMLKECDSSSNFTSRDLIEECKTFYIA

GHETTATLLTWTLMLLGGYPEWQERARAEVHEVCGNEVPDGESVSRLKLVGMILYETLRLYPPAIEMTRECVEESWLQDL

HVPKGVSVSFPIVGLHQDKELWGEDAGQFNPDRFKDGISSACKHPNAFMPFSFGPRVCVGQAFAMIEAKVILAMILQRFL

FRLSPNYRHNPVIKFGLKPMHGVPLVLSKM*

 

>fgenesh2_pg.C_scaffold_53000099|Selmo1 97% to e_gw1.15.285.1|Selmo1

4 aa diffs to estExt_fgenesh1_pm.C_120070

MVGQIAEIQNTRSAIKDHDMESFSHDIFHRVHPALLKWRKQY

 

AFGTSYLKGKRVFEILSKKIPELLPKLVSFSWIPGFRF

LPLPINLRLWKLHQELDSLITGIIDERRNSVKSGESNTYGNDLLGLMLKECDSSSNFTSRDLIEECKTFYLAGHETTATL

LTWTLMLLGGYPEWQERARAE

 

VGMILYETLRLYPPAIEVIRECVEESWLQDLHVPKGVSVSFPITGLHQDKELWGEDAGQ

FNPDRFKDGFSSACKHPNAFMPFSFGQRVCVGQPFAMIEAKVILAMILQCSGFTELPP*

 

$$$$$

 

>16 CYP779E6v1 estExt_Genewise1Plus.C_120779|Selmo1 94% to estExt_Genewise1Plus.C_120760|Selmo1

MEERWILSICIILFTAVLWRFVTVYWWRPRAIATQLKKEGIQGPPPRFMVGQIAEIQNMRSAIKDHDMESFSHDVFHRVH

PALLKWQKQYGKRFVFWWGTEPRISVSEPEIVREVLSKKLSQFDKSEAELRLANLFFGRGLVFVTGEEWSHHRRLVAPAF

FHERIKQMTGTIAGCASRMLDQWEATRQQNPEIEISGEVRKLTGDVISHTAFGTSYLKGQRVFEILSKKVPELVPRLISF

SWIPGFRFLPLPVNLRLWKLHQELDSLITGIIDERRNSVKSGRSNTYGNDLLGLMLKECDSSSNFTSRDLIEECKTFYIA

GHETTATLLTWTLMLLGGYPEWQERARAEVHEVCGNEIPDDESVSRLKLVGMILYETLRLYPPANEVTRECVEESWLQDL

HVPKGVSVSFAIAGLHQDKELWGEDAGQFNPDRFKDGISRACKHPNAFMPFSFGPRVCVGQSFAMIEAKVILAMILQRFL

FRLSPSYRHNPAMKFGLKPMHGVPLVLSKM*

 

>CYP779E6v2 e_gw1.15.471.1|Selmo1 90% to estExt_Genewise1Plus.C_120760|Selmo1

MDGRWILSICIVLFTAALWRFVTVYWWNPRAIVAQLKKEGIQGPPPRFMVGQIAEIQNMRSAIKDHDMESFSHDVFHRVH

PALLKWQKQYGKRFVFWWGTEPRISVSEPEIVREVLSKKFSQFDKSEAELRLANLFFGRGLVFVTGEEWSHHRRLVAPAF

FHE& (3 aa deletion)

QMTGTIAGCASRMLDQ &

W &

EATRRKNPEIEISGEVRQITGDVISHTAFGTSYLKGQRVYEILSKKVPELVPKLISFSW

IPGFRFLPLPVNLRMWKLHQELDSLITGIIDERRNSVKSGRSNIYRNDLLGLMLKECDSSSNFTSRDLIEECKTFYIAGH

ETTATLLTWTLMLLGGYPEWQERARAEVHEVCGNEIPDGESVSRLKLLGMILYETLRLYPPANEVTRECVEESWLQDLHV

PKGVSVSFAIAGLHQDKELWGDDAGQFNPDRFKDGISRSCKHPNAFMPFSFGPRVCVGQSFAMIEAKVILAMILQRFLFR

LSPSYRHNPAMKFGLKPIHGVPLVLSKM*

 

$$$$

 

>17 CYP779E7v1 fgenesh2_pg.C_scaffold_12000361|Selmo1 94% to estExt_Genewise1Plus.C_120760|Selmo1

MEGRWILSTCIVLFTAALWRFVTVYWWRPRATAAQLKKEGIQGPPPRLMVGQIAEIQNMRSAIEDHDMESFSHDIFHRVY

PALLKWRKQYGKRFVFWLGTEPRISVSEPEIVREVLSKKFSQFDKSEAGLRFANLFLGRGLVSVTGEEWSHHRRLVAPAF

FHERIKQMTGSIAGCASRMLDQWEATRQQNPEIEISGEVRKLTGDVISHTAFGTSYLKGQRVFEILSKKIPELVPKLFSF

SWIPGFRFLPLPINLRLWKLHQELDSLITGIIDERRNSVKSGRSNTYGNDLLGLMLKECDSSSNFTSRDLIEECKTFYLA

GHETTAILLTWTLMLLGGYPEWQERARAEVHEVCGNEIPDGESVSRLKLVGMILYETLRLYPPVVEMTRECVEESWLQDL

HVPRGVSVSFPIVGLHQDKELWGEDAGQFNPHRFKDGISSACRHPNAFMPFSFGPRVCVGQSFAMIEAKVILAMILQRFL

FRLSPNYRHNPAMKFGLKPMHGVPLVLSKM*

 

>CYP779E7v2 e_gw1.15.281.1|Selmo1 95% to estExt_Genewise1Plus.C_120760|Selmo1

MDGRWILSTCIVLFTTALWRFVTVYWWRPRATAAQLKKEGIQGPPPRLMVGQIAEIQNMRSAIKDHDMESFSHDIFHRVY

PALLKWRKQYGKRFVFWLGTEPRISVSEPEIVREVLSKKFSQFDKSEAGLRFANLFLGRGLVSVTGEEWSHHRRLVAPAF

FHERIKQMTGSIAGCASRMLDQWEATRQQNPEIEISGEVRKLTGDVISHTAFGTSYLKGQRVFEILSKKIPELVPKLFSF

SWIPGFRFLPLPINLRLWKLHQELDSLITGIIDERRNSVKSGRSNTYGNDLLGLMLKECDSSSNFTSRDLIEECKTFYLA

GHETTAILLTWTLMLLGGYPEWQERARAEVHEVCGNEIPDGESVSRLKLVGMILYETLRLYPPVVEMTRECVEESWLQDL

HVPRGVSVSFPIVGLHQDKELWGEDAGQFNPDRFKAGISSACKHPNAFMPFSFGPRVCVGQSFAMIEAKVILAMILQRFL

FRLSPNYRHNPAMKFGLKPIHGVPLVLSKM*

 

$$$$$

 

>12 CYP779E2v1 e_gw1.15.463.1|Selmo1 93% to estExt_Genewise1Plus.C_120760|Selmo1

MEGRWILSTCIVLFTAALWRFLTVYWWRPRAIAAQLKKEGIQGLPPRFMVGQIAEIQNMRRAIKDHNMESFSHDIFHRVH

PALLKWQKQYGKRFVFWWGTEPRILVSEPEIVREVLSKKFSQFDKSVGGLRVANLFLGRGLVCVTGEEWGHHRRLVAPAF

FHERIKQMTGTIARCTFRMLDQWEATRQQNPEIEISGEVRKLTGDVISHTAFGTSYLEGQRVFEILSKKIPELVPKLISF

SWIPGFRFLPLPINLQLWKLHQELDSLITGIIDERRNSVKSGGSNTYGNDLLGLMLKECDSSSNFTSSDLIEECKTFYIA

GHETTAALLTWTLMLLGGYPEWQERARAEVHEVCGNEIPDGESVSRLKLVGMILYETLRLYPPVVEMTRECVEESWLQDL

HVPKGVSVSFPIVGLHQDKELWGEDAGQFNPDRFKDGISSACKHPNAFMPFSFGPRVCVGQSFAMIEAKVILAMILQRFL

FRLSPNYCHNPAMKFGLKPIHGVPLVLSKM*

 

>CYP779E2v2 fgenesh2_pg.C_scaffold_12000345|Selmo1 93% to estExt_Genewise1Plus.C_120760|Selmo1

M  E  G  R  W  I  L  S  T  C  I  V  L  F  T

A  A  L  W  R  F  V  T  V  Y  W  W  R  P  R  A  I  A  A  Q  L  K  K  E

G  I  Q  G  L  P  F  R  F  M  V  G  Q  I  A  E  I  Q  N  M  R  R  AIK&

MESFSHDIFHRVHPALLKWRKQYGKRFVFWWGTEPRISVSEPEIVREVLSKKFSQFD

KSEGGLRVANLFLGRGLVCVTGEEWGHHRRLVAPAFFHERIKQMTGTIAGCTFRMLDQWEATRQQNPEIEISGEVRKLTG

DVISHTAFGTSYLEGQRVFEILSKKIPELVPKLISFSWIPGFRFLPLPINLQLWKLHQELDSLITGIIDERRNSVKSGGS

NTYGNDLLGLMLKECDSSSNFTSSNLIEECKTFYIAGHETTAALLTWTLMLLGGYPEWQERARAEVHEVCGNEIPDGESV

SRLKLVGMILYETLRLYPPVVEMTRECVEESWLQDLHVPKGVSVLFPIVGLHQDKELWGEDAGQFNPDRFKDGISSACKH

PNAFMPFSFGPRVCVGQSFAMIEAKVILAMILQRFLFRLSPNYRHNPAMKFGLKPIHGVPLVLCKM*

 

$$$$$

 

>2 CYP779A1v1 estExt_Genewise1.C_30845|Selmo1 41% to 709C9

MRKLEAALRGQGLKGPPPIFLAGNVVEILFRREAARNKGMDGISHDIVAHVSPDVAAWSKLYGKPYLIRWLSEPRVVVFD

PDSIREILSKQFDKFEKSEQQLEFVLDFIGAGLVGLNGNKWSHHRSVLSPAFHTQRLKAMLSSMTNCTEKLVEKWSRRVG

HAKGLETEVEVQQDLKRLAADVISHTSFGSNYEKGERVFQGLTLLGVLLVRCFHNSWLPFFRYLPTKLNFQIWKLRREID

GTLLSLIRERRIAAAKLGERSSHPYGSDLLGLILEEGETGGKSVKFPEQAIVDECKTFYLAGHETSSSLLAWALLLLATH

PDWQEKARAEVQQHFPNGVDDGETLSKLKVVGMIILETLRLYPAAGEMNRASSHDTVLSNGIKLPRGTGITIPILSLQHD

PELWGPDANEFRPERFANGTTKACKHPNAFLGFSFGPRVCIGQGLAVMEAKVVLAMLLQNFSFRLSPNYRHNPTVQIVIQ

SFTGIQLLVQKI*

 

>CYP779A1v2 estExt_fgenesh2_pg.C_250220|Selmo1 98% to estExt_Genewise1.C_30845|Selmo1

MWGSLALALAICVFLERICRSGLKLWHMRKLEAALRGQGLKGPPPIFLAGNVVEILFRREAVRNKGMDGISHDIVAHVSP

DVAAWSKLYGKPYLVRWLSEPRVVVFDPDSIREILSKQFDKFEKSEQQLEFVLDFIGAGLVGLNGNKWSHHRSVLSPAFH

TERLKAMLSSMTKCTEKLVEKWSRRVGQAEGLETEVEVQQDLKRLAADVISHTSFGSNYEKGERVFQGLTLLGVLLVRCF

HNSWLPFFRYLPTKLNFQIWKLRREIDGTLLSLIRERRIAAAKLGERSSHPYGSDLLGLILEEGETGGKSVKFPEQAIVD

ECKTFYLAGHETSSSLLAWALLLLATHPDWQEKARAEVQQHFPNGVDDGETLSKLKVVGMIILETLRLYPAAGEMNRAST

HDTVLSNGIKLPRGTGITIPILSLQHDPELWGPDANEFRPERFANGTTKACKHPNAFLGFSFGPRVCIGQGLAVMEAKVV

LAMLLQNFSFRLSPNYRHNPTVQIVIQSFTGIQLLVQKI*

 

$$$$$$

 

>e_gw1.25.135.1|Selmo1 possible false possitive

MTEQEALDNSVTFLLAGHETTAAVLSWSLYLLALNPQWQHRAREEVSQVLGSSSPSPSPLSSTVLAWEHLSKLKTIGLIL

MEAVRLFPPQPLIGRSCVRENHLGDIRVPPGLEVIVPVAAIHRSEELWGRDAADFRPDRFENGIKSACSHPLAYLPFGSG

PRTCVGQSLAMTEAKAVLAMVLLRFNWELSGSYRHEPDVTLNLQPKFGMPLLLTLLEQTS*

 

>e_gw1.3.706.1|Selmo1 40% to 709C1, 98% to e_gw1.25.135.1|Selmo1

MKEVLVPAASTSRSDHHGNRLVEIFRDSSAMTEQEALDNSVTFLLAGHETTAAVLSWSLYLLALNPQWQHRAREEVSQVL

GSSWPSPSPLSSTVLAWEHLSKLKTIGLILMEAVRLFPPQPLIGRSCVRENHLGDIRVPPGLEVIVPVAAIHRSEELWGR

DAADFRPDRFENGIKSACSHPLAYLPFGSGPRTCVGQSLAMAEAKAVLAMVLLRFSWELSGSYRHEPDVTLNLQPKFGMP

LLLTLLEQTA*

 

$$$$$$

 

>fgenesh2_pg.C_scaffold_9000021|Selmo1 36% to 709C9 partial fragment

MPRICRQDLVEMNGLITDALCRNLPAFYLKEQLKKMVGAMLQKQLEAVLLGVIAQRRETIKQGSKSYGDDLLGLMLTESE

SENQRQNECKTFYLAGHESTASLLSWTVMLLAVYPDWQERARAEVGMILNETLRLYSPVIAFFRACFHDTWVQDLFVPKG

AAVTFPALAIRHGKELWGPDANDFDPERFKDGIFNACKHPRTLSFLPRPSSVRRPVVRIDGSQSRISEGVPWTTAHTQHA

MKQGPRWAASLGVAEGAFPQHETSPLTPQSKTWISCPRVDWAGTKQPLALQSAVDLCGIRAGSISRFSGLWFPISKLEMP

IILKTFSACPRICIPVPKSRSAPCPELPLLQSRDLPV*

 

>fgenesh2_pg.C_scaffold_50000123|Selmo1    partial fragment

96% to fgenesh2_pg.C_scaffold_9000021|Selmo1

MHAQDLPPGSRGDEWAHYRHVVLESPSILSQRAAQENGWSDGELHVRHACLTGLCKIDRFCVVRSGSLVITLWFKLQKQL

EAVLLGVIAQRRETVKQGSKSYGDDLLGLMLTESESENQRQNECKTFYLAVHESTASLLSWTMMLLAVYPDWQERARAEV

GMILNETLRLYPPVIAFFRACFQDTWVQDLFVPKGAAVTFPALAIRHGKELWGPDANDFDPERFKDGIFNACKHPRTLSF

LPRPSSVRRPVVRIDGSQSRISEGVPWNTAHTQQAMKQGPRC*

 

$$$$$$

 

>4 CYP779C1v1 e_gw1.3.1146.1|Selmo1 41% to 72A15, 40% to 709E1, CYP72 clan

MAVWLWTIAALCIALVWKGAAKLLLKPWILEAKLRQQGIRGPPRSILSGNVYEIFQMRARTEAECIQGPITHDIVEYVQP

HLLHWAKLYGLPLLWWWGTEPGVVLTDLDMIKEVLYNKSGAFWSPEWQRKFQVDILGRGLAVVNGDEWAFRRRILAPAFH

AEKIKASNCEMLEKWNALTEGKDEPIELEVCKELTTLTSDIISRAAFGSSYKKGHKVFELLDQVGGLTCFPLAKRFTHCH

SMLPICKLNREIKTANSKLRSTLEEIVQARRDQKLAGEIDNYGSDLLGIMLDEVDAGHHDDKTGLSFTTDSLMEECKTFY

IAGQETSAKWLAWTMMLLAANPSWQEQAREEVRQVCQSQAPDAESLSKLKIVGMVLNESLRLYPPAVFNVRSCYKDAKLG

HLSFPEGSGVIIPILYLLHDKDIWGDDANEFNPQRFADGISSASKSRHSCAFLPFSQGQRVCLGQSFAQIEAKVAMAMIL

QRFSFRLSPTYRHSPVHRLALQPQHGLPLLLGRP*

 

>CYP779C1v2 e_gw1.87.292.1|Selmo1 98% to e_gw1.3.1146.1|Selmo1

MAVWLWTIAALCIALVWKGAAKLLLKPWILEAKLRQQGIRGPPRSILSGNVYEIFQMRARTEAECIQGPITHDIVEYVEP

HLLHWAKLYGLPLLWWWGTEPGVVLTDLDMIKEVLYNKSGAFWSPEWQRKFQVDILGRGLAVVNGDEWAFRRRILAPAFH

AEKIKASNCKMLEKWNALTVGKDEPIELEVCKELTTLTSDIISRAAFGSSYKKGHKVFELLDQVGGLTCFPLAKRFTHCH

SMLPICKVNREIKTANSKLRSTLEEIVQARRDQKLAGEIDNYGSDLLGIMLDEVDAGHHDDKTGLSFTTDSLMEECKTFY

IAGQETSAKWLAWTMMLLAANPSWQEQAREEVRQVCQSQAPDAESLSKLKIVGMVLNESLRLYPPAVFNVRTCYKDAKLR

HLSFPEGSGVIIPILYLLHDKDIWGDDANEFNPQRFADGISSASKSHHSCAFLPFSQGQRVCLGQSFAQIEAKVAMAMIL

QRFSFRLSPTYRHSPVHRLALQPQHGVPLLLGRP*

 

$$$$$$

 

>3 CYP779C2v1 estExt_Genewise1Plus.C_870041|Selmo1 40% to 72A13, 40% to 709C5, CYP72 clan

MWLWTIAALCVALVWKAVTKPLLKPWILEAKLRRQGIRGPPRSILSGNVKHIFDIRTRVEAKCIEGPITHDIMEYVQPHH

LQWAKLYGQPLRWWWGSEPGVVLTDLDMIKEVLYNKAGAFWNSNWQRQLQIDLLGRGMAVVNGDEWALRRRILAPAFHAD

KIKLMVGGMRDCVADMLAKWNALTEGKEEPIELEVCKELITLTSDIISRAAFGSSYKQGHRVFELLDQVGELVYRKFSSL

WIQSKLPFSKINRDIKAVNAEVRSTLEEIVQVRKDQTAAGEIEGYGSDLLGVMLKEVDAEHYDAKTGLSFTIDGLMEECK

TFYIAGQETSAKWLAWTMMLLAINPSWQERAREEVRQVCQSQAPDAESLSKLKIVGMVLNESLRLYSPAVAIVRSCFKDA

KLGHLSFPEGSGVIIPILYLLHDKDIWGDDANEFRPERFADGISSASKTQHLFAFLPFSQGQRVCLGQSFAHTEAKIAVA

MILQRFSFQLSPNYRHSPVHRIALQPLHGMPLLLQRLDD*

 

>CYP779C2v2 fgenesh2_pg.C_scaffold_3000573|Selmo1 96% to estExt_Genewise1Plus.C_870041|Selmo1

MAPLWLWTIAALCVGLVWKAVTKLLLKPWILEAKLRRQGIRGPPRSILSGNVKHIFEIRTHVEAKCIEGPITHDIMDYVQ

PHHLQWAKLYGQPLRWWWGSEPGVVLTDLDMIKEVLYNKAGAFWNSNWQRQLQIDLLGRGMAVVNGDEWALRRRILAPAF

HADKIKASERKSLQSSSLDIKSCSSCYKQGHRVFELLDQVGELVYRKFSSQWIQSKLPFSKINRDIKAVNAEVRSTLEEI

VQVRKDQTAAGEIEGYGSDLLGVMLKEVDAEHYDAKTGLSFTIDGLMEECKTFYIAGHNTSAK*

 

$$$$$$

 

>fgenesh2_pg.C_scaffold_15000176|Selmo1 48% to CYP709C3, 49% to CYP709B2

88% to estExt_Genewise1Plus.C_120760|Selmo1

MQQNPEIESLERCVSPTSNQPPTVEASSGVGFSDHWDHRRALELSESRGSNTYGNDLLGLMLKECDSSSNFTSRDLIEEC

KTFYIAGHETTATLLTWTLMLLGGYPEWQECARAEVYEVCGNEIPDGESVSRLKLIPKLNFLMVGMILYETLRLYPPVVE

MTRECVEESWLQDLHVPRGVSVSFPIVGLHQDKELWGEDAGQFNPDRFKDGISSACKHPNAFMPFSFGLRLCVGQSFAMI

EAKVILAMILQQFLFRLSPNYRHSPAMKFGLKPIHGVPLVLGKCD

ACSWHWKSRSYLHCSWIQLNETERASRLYHGLRMKMNQFHKTCEAMKQCPVE*

 

>fgenesh1_kg.C_scaffold_23000015|Selmo1 47% to 709B2

92% to estExt_Genewise1Plus.C_120760|Selmo1

VEERWSLSTCIVLFTAALWRFVTVYWWRPRVIAAQLKKEGIQGPPPRFMVGQIAEIQNMRSAIKDHDMESFSHDIFHRVH

PALLKWRKQYGKRFV

SGGELNQGNRSRSLRS*GKFCLRSFLSLINRRPGCGSRTCSLVVDWFLLLERNGVITADS*HRHS

FMNVLNS*CRYNRRVCISHA*SMGSYEAAESRD*NLWRGA*AHRRRYLPYSIWN*LSQRAEGFRDIV*ENPRATAQAHQL

FLDCRLQVSPSSNQPPTVETSS

VDSLITRIIDERRNSMKSGGSNTYGNDLLGLMLKECDSSSNFTSRDLIEEYKTFYIAG

HETTAILLTWALMLLGGYLEWQECVRAEVHEVCGNEIPDGESVSRLKLVGMILYKTLRLYPPAIEMTKECVEESWLQDLH

VPKGVSVSFPIIGLHQDKELWGEDAGQFNPDRFKDGISRACKHPNAFMPFSFGPWPVVCNDRSQSHSGYNTTAILVPAFT

ELLP*

SWDEV*LEAYAWSAACTQ*

 

$$$$$$

 

>7 CYP775B1v1 e_gw1.9.465.1|Selmo1 98% to e_gw1.50.177.1|Selmo1

MLLLAAPMLVFLASLLVILVWSASVAFRYVHLRKSLLEQGLDGPPPKFLIGNMHQVSEMRELATSKDMRVGDHDLLPRIC

PHFTYWSAIYGKRFLFWWGMEPRITVVEPEMIKEILSTKAEHFGKSLLLKKGGVLLLGNGMVYANGESWAHRRRIVGPAF

HAEMLKKMVPEMVASTSQMLGQWSQIIDNKSSRRSGDGSSAEIDINYYLSMATADVIARTAFSSTSSHEKGKRVFQLLTC

LQKVFAQSNRFLWLPCNRMLPTAANRRASRIKRDMERALRELVLERRAGRQKHGYGSDFLGLMLSESERDKSEAAAAAQQ

FDTPELVEECKTIFFTGHETTSALLTWTLMLLALNPEWQQRGRAEVMEHLPSKSSVPDADVLPKLKILGMILNEVLRLYP

PAPALVRESLVDLSIQDVKYPRGTTFWIPIVALHHSKDVWGDDALHFNPARFADGVAAACKLQHQKLWSFMPFSLGPRAC

LGQSFAMMEAKVVLAMILQRFEFKISPNYRHAPVTAITLKPRYGMQLMLAHYNIEDGEKSPG*

 

>CYP775B1v2 e_gw1.50.177.1|Selmo1 40% to 735A2, CYP72 clan

MLLLAAPMLVFLASLLVILVWSASVAFRYVHLRKNLLEQGLDGPPPKFLIGNMHQVSKMRELATSKDMRVGDHDLLPRIC

PHFTYWSAIYGKRFLFWWGMEPRITVVEPEMIKEILSTKAEHFGKSLLLKKGGVLLLGNGMVYANGESWAHRRRIVGPAF

HAEMLKKMVPEMVASTSQMLGQWSQIIDNKSSRRSGDGSSAEIDINYYLSMATADVIARTAFSSTSSHEKGKRVFQLLTC

LQKVFAQSNRFLWLPCNRMLPTAANRRASRIKRDMERALRELVLERRAGRQKHGYGSDFLGLMLSESERDKSEAAAAAQQ

FDTPELVEECKTIFFTGHETTSALLTWTLMLLALNPEWQQRGRAEVMEHLPSKSSVPDADVLPKLKILGMILNEALRLYP

PAPALVRESLVDLSIQDVKYPRGTTFWIPIVALHHSKDVWGDDALHFNPARFADGVAGACKLQHQKLWSFMPFSLGPRAC

LGQSFAMMEAKVVLAMILQRFELKISPNYRHAPVTAITLKPKYGMQLMLAHYSIEDGEKSPG*

 

$$$$$$

 

>20 CYP778B1v1 e_gw1.13.765.1|Selmo1 35% to 735A1, CYP72 clan

MWLVLLAVLAGLLLILWFQCCSFLVYHLWRPKVLEKVMSAQGVTGPPQKNLLTQIWELPDMEQVSHDIVPHAIPFHHARL

QKCGPLHINWWRVEPRVELADIDLMRKALLKGPEFFGKSPVLGMIADDIFGGGVFDASGRDWVEQRRVVVPVFHADKIKG

MVRTMYENTQSFLENWVTLIRNGGTGEKALDVFPEFVELTAPIIGQAAFGASSSTSIAIVKLLRLLFALQWQQVRYASLP

FLPTNRERWRIKREIHRLLRVEIDSRRALTRENCAASHGSDLLGTMLDSNWDDELIITESKTFYTTGHMSLTSLYSWVML

LLAVNPEWQEKARVEVLELVAREGPLDNAQALDKLKLVEMIIMETMRLYPAFPIIPRIALEDCYVDHLFIPKGLAVSVHN

TVIQHSAEMWGEDANEFNPGRFANGSLAASKHPMAFMPFSFGARACVGRAYSQVQAKVVVASLLQRFRWSLSPDYRHNPV

AAGLLLPKNGVPIVLKLLDSKTIVTNGMKATGERS*

 

>CYP778B1v2 e_gw1.66.334.1|Selmo1 94% to e_gw1.13.765.1|Selmo1

MWLVLLAVLAGSLLIIWFQCCSFLVYHLWRPKVLEKVMSAQGVTGPPQKNLLTQIWELPDMEQVSHDIVPHAIPLHHACL

QKYGPLHMNWWRVEPRVELADIDLMRKALLKGPEFFGKSPVLGMMADDIFGGGVFDASGRDWVEQRRVVVPVFHADKIKG

MVRTMYENTQNFLENWETLVRNGGTGEKALDVFPEFVELTALIIGQAAFGTSSSTSIAIVKLLRLLFALQSQQVRYVSLP

FLPMNRERWRIKREIHRLLHVEIDSRRAFTRENCAASHGSDLLGTMLDSNWDDELIITESKTFYTTGHMSLTSLYSWVML

LLAVNPEWQEKARVEVLELVAREGPLDNAKALDKLKLVEMTIMETLRLYPAFLIIPRVALRDCYVDHIFIPKGLAVSVHN

TVIQHSAEMWGEDANEFNPGRFANGSLAASKHPMAFMPFSFGPRACVGRAYSQVQAKVVVASLLQRFRWSLSPDYRHNPM

AAGTLLPKNGVPIVLKLLDSKTIVSNEGNRREILT*

 

>CYP778B2v1 e_gw1.13.461.1|Selmo1 86% to e_gw1.13.765.1|Selmo1  partial sequence

LYSWVMLLLAMNPEWQEKARVEVLELVAKEGPLDNAKALERLKLVEMLIMETLRLYPPIPIIPRVALKDCYVDHLFIPKG

LAVSVHNTVIQHSAEMWGEDANEFNPGRFANGSVAACKHPMAFMPFSFGARACIGRVYSQVQAKIVVAFLLQRFRWSMSP

DYRHNPIVAGTLVPKNGVPIVLTLLGAKGD*

 

$$$$$$

 

>8 CYP779A2v1 estExt_Genewise1.C_100136|Selmo1 37% to CYP735A2, CYP72 clan

MAALLVLGVVGICAALLWRLARPWRRSRRIEGILKQQGLKGPPPKFLAGNSGQQYQMRIENQGKVMETCHDIVAHVTPEV

VLWSSKYGKPYLTRSLDVPDVTFFDPDCAREILSRQFENFPKSSDQVQVVIDVVGHGVLGLEGGQEWSQRRNVLSPAFHT

LKLKAMYARIRACSEKLVAKWKTCVPHGQAELEVAHDLKKLAADLISHVAFGANYEKGEQVFRGLTVLGDLALEAQSYFW

LPLFSYYPCPLNRKIWKVKREIDRTVMSLIHERRRSSGNYGDDLLGLILEESDKSAGFSDKVVVDECKTFFLAGHETTGS

LLGWTLFMLALNPDWQNRARAEVQEHFKENSQVGALDKLKLVGMILYETLRLYPAISEVQRVASKDTVLGGIKVPEGTQV

TIPLLWLHHDPELWGADANEFNPERFSQGAAKASKHPSAYMPFVMGPRVCIGQTLALLEAKVAIATLLSNFAFSPASSYR

HSPRMHVIIDAPRGIQLVVHKLSE*

 

>CYP779A2v2 estExt_fgenesh2_pg.C_140284|Selmo1 97% to estExt_Genewise1.C_100136|Selmo1

MAALLVLSVVGICAALLWRFARPWRRSRRIEGILKQQGLKGPPPEFLAGNSGQQYQMRIENQGKVMETCHDIVAHVTPEV

VLWSSKYGKPYLTRSLDVPDVTFFDPDCAREILSRQFENFPKSSLQVQVVVDVVGHGVLGLEGGQEWSQRRNVLSPAFHT

LKLKAMYARIRECSEKLVAKWKTCVPHGQAELEVSHDLKKLAADLISHVAFGANYEKGEQVFHGLTVLGDLALEAQSYFW

LPLFSYYPCSLNRKIWKVKREIDMTVMSLIHERRRSSGNYGDDLLGLILEESDKSTGFSDKVVVDECKTFFLAGHETTGS

LLGWTLFLLALNPDWQNRARAEVQEHFKENSQVGALDKLKLVGMILYETLRLYPAVSEVQRVASKDTVLGGIKVPEGTQV

TIPLLWIHHDPELWGADANEFNPERFSQGAAKASKHPSAYMPFVMGPRVCIGQTLALLEAKVAIATLLSNFAFSPASSYK

HSPRMHVIIDAPRGIQLVVHKLSE*

 

$$$$$$

 

>e_gw1.137.23.1|Selmo1 61% to 72A17, 91% to e_gw1.19.689.1|Selmo1 bad sequence

91% to estExt_Genewise1Plus.C_1370087|Selmo1

MPTSSIHSASLTVWPTPPSTRLHFSRVCFGQGLALMEAKVALAMILHRFSFEISPSYQHSPVLRLTLTPKHGMPLLLSR

 

>22 CYP779D1v1 e_gw1.19.689.1|Selmo1

MEGIGKAVWTGALLVLLALVAKLWRSIVTRYWLEPRSLDTRIRSQGIQGPPRTFLAGNMLQVMKMRDTPKERDMAGLNHD

IVEHVLLDYHQWSKEYGKMYFYWWATEPRIMVTEPELIREVLAKKVTQFEKSDMMVSAVASIIGRGLIAVNGNEWSHHRR

VVAPAFYLEKLKKMVPRIGLCALEMLDRWEEALREQPEIEMSSEFSKLTADIISHTAFGSSYLKGQKVFETLRAIPEELS

KVDRYNYVPGKSMNPFSELNRAIRNGQKKVNNLLLEIVHARQQLKDSGASSNYGSDLLGLMLDEVDSSRSFSGSGIKPAL

AFTSESLIEECKTFYVAGHETTAKLITWAMMLLATNPTWQERARAEVLEVCKSGVPDSEAASKLKIVGMVLNETLRLYPP

AVFLVRTAMEDTKLGNLIVPEGTGVLVPILSILHDKEVWGEDANEFNPQRFADGVANASKHPFAFLPFSHGPRVCLGQGF

ALMEAKVALTMILHRFSFEISPSYQHSPVLRLTLTPKHGMPLLLSRRGV*

 

>CYP779D1v2 estExt_Genewise1Plus.C_1370087|Selmo1 98% to e_gw1.19.689.1|Selmo1

MEGIGKAVWTGALLVLLALVAKLWRSIVTRYWLEPRSLDTRIRSQGIQGPPRTFLAGNMLQVMKMRDTPKERDMAGLNHD

IVEHVLLDYHQWSKEYGKMYFYWWATEPRIMVTEPELIREVLAKKVTQFEKSDMMVSAIASIIGRGLIAVNGDEWSHHRR

VVAPAFYLEKLKKMVPRIGLCALEMLDRWEEALREQPEIEMSSEFSKLTADIISHTAFGSSYLKGQKVFETLRAIQEELS

KVDRYNYVPGKSMNPFSELNRAIRNGQKKVDNLLLEIVHARQQLKDSGASSNYGSDLLGLMLDEVDSSRSFSGSGIKPEL

AFTSESLIEECKTFYVAGHETTAKLITWAMMLLATNPTWQERARAEVLEVCKSGVPDSEAASKLKIVGMVLNETLRLYPP

AVFLVRTAMEDTKLGNLMVPEGTGVLVPILSILHDKEVWGEDANEFNPQRFADGVANASKHPFAFLPFSHGPRVCLGQGF

ALMEAKVALTMILHRFSFEISPSYQHSPVLRLTLTPKHGMPLLLSRRGV*

 

>fgenesh2_pg.C_scaffold_19000184|Selmo1 98% to e_gw1.19.689.1|Selmo1

MMLLATNPTWQERARAEVGMVLNETLRLYPPAVFLVRTAMEDTKLGNLIVPEGTGVLVPILSILHDKEVWGEDANEFNPQ

RFADGVANASKHPFAFLPFSHRPRVCLGQGFALMEAKVALTMILHRFSLEISPIQMPHTGICIQERGCCHQVLDWHCIEE

LFSHLDPALLAMPANGDVPGETICIKAISNLIVRMGSLKT*

 

$$$$$$

 

>23 CYP779D2v1 estExt_Genewise1Plus.C_190497|Selmo1 40% to 735A1 in CYP72 clan

MEGIGKAVWTGALLVLLALVAKLWRSIVTRYWLEPRSLDTRIRSQGIEGPPRTFLAGNMLQVMKMRDTAKERDMAGLNHD

IVEHVLLDYHQWSKEYGKMYFYWWAMEPRIMVTEPELIREVLAKKATQFEKSDMVVSAIVSIIGRGLVALNGDEWSYHRR

VVAPAFYLEKLKKMVPRIGQCALEMLDRCEETLREQPEIEMSGEFSKLAADIISHTAFGSSYLKGQKVFQFLRAIPEQHS

KIDRYNYLPGKRFLPFPANFRLRKLYSDLDSLLLALIKERRDQSGQSHDLLGLMLAEAGNSSFDDRAVMEECKTFYLAGH

ETTASLLTWSMMLLALHPEWQERARVEAQEAFGGATPEADSISKLKLINMILHESLRLYPPVVFFMRACFENTTLGDILV

PKGVGITFPVLAIHHDKELWGEDAHEFNPERFKDGVAKASKHPNAFLAFSLGPRVCVGQSFALMEAKIALATILQRFRFR

LSPSYRHCPVFKVTLRPRHGLPLVMEKI*

 

>CYP779D2v2 e_gw1.137.32.1|Selmo1 98% to estExt_Genewise1Plus.C_190497|Selmo1

MEGIGKAVWTGALLVLLALVAKLWRSIVTRYWLEPRSLDTRIRSQGIEGPPRTFLAGNMLQVMKMRDTAKERDMAGLNHD

IVEHVLLDYHQWSKEYGKMYFYWWAREPRIMVTEPELIREVLAKKVTQFEKSDMVVSAIVSIIGRGLVALNGGEWSHHRR

VVAPAFYLEKLKKMVPRIGLCALEMLDRCEETLREQPEIEMSGEFSKLAADIISHTAFGSSYLKGQKVFQFLRAIPEQHS

KIDRYNYLPGKRFLPFPANFRLRKLYGDLDSLLLALIKERRDQSGQSHDLLGLMLAEAGNSSFDDRAVMEECKTFYLAGH

ETTASLLTWSMMLLALHPEWQERARVEAQEAFGGVTPEADSISKLKLINMILHESLRLYPPVVYFMRACFEDTTLGDILV

PKGVGITFPVLAIHHDKELWGEDAHEFNPERFKDGVAKASKHPNAFLAFSLGPRVCVGQSFALMEAKIALATILQRFRFR

LSPSYRHCPVFKVTLRPRHGLPLVMEKI*

 

>fgenesh2_pg.C_scaffold_61000064|Selmo1

parts are 87% to estExt_Genewise1Plus.C_190497|Selmo1

MKMRDSAKERDMTGLNHDIVEHVMPPVVQGIRSPRNSPTTGGWCSSSHPRPKGNCGLHSSHHDTHDFNPERFKDGACKHS

NAFLALSLDPRACVGQAFALIEAKIALPPFSSASGFDCRHRIAGYGLPLIMVKI*

 

$$$$$$

 

>24 CYP779D3v1 estExt_fgenesh2_pg.C_190185|Selmo1 89% to estExt_Genewise1Plus.C_190497|Selmo1

40% to 735A1 in CYP72 clan

MGHFMEGIGKAVWTGVLLVLLALVAKLWRSIVTRFWLEPRSLDARIRSQGIEGPPRTFMAGNMLQVMKMRDTGKERDMEG

LNHDIVKHVLLDYHQWSKEYGKRYCYWWATEPRIMVTEPELIREVLAKKVTQFEKSDIMVSGLVSIVGRGLVAVRGDEWS

YHRRVVAPAFYLEKLKKMVPRIGLCALEMLDRLEEALREQPEIEMSSEFSKLTADIISHTAFGSSYLKGQKVFETLRAIP

EQLSKVDRYNYIPGKRFLPFPANFRLRKLYSDLDSLLLALIKERRAQSGQSHDLLGLMLAECGNSSFDDRAVMEECKTFY

FAGHETTATLLTWSITLLALHREWQERARAEAQEVCEGATPEADSISKLKLINMILHETLRLYPPVVVMMRSCFEDTILG

DILVPKGAAVSFPILAIHHDKELWGEDAHEFNPERFKDGVTKASKHPNAFMPFSLGPRVCVGQSFVLMEAKIALATILQR

FRFRLSPSYRHCPVFKLTLRPRHGLPLVMEKI*

 

>CYP779D3v2 estExt_fgenesh2_pg.C_1370032|Selmo1 88% to estExt_Genewise1Plus.C_190497|Selmo1

97% to estExt_fgenesh2_pg.C_190185|Selmo1

MGHFMEGIGKAVWTGALLVLLALVAKLWRSIVTRFWLEPRSLDARIRSQGIEGPPRTFMAGNMLQVMKMRDTGKERDMEG

LNHDIVKHVLLDYHQWSKEYGKRYCYWWATEPRIMVTEPELIREVLAKKVTQFEKSDIMVSELVSIVGRGLVAVTGDEWS

YHRRVVAPAFYLEKLKKMVPRIGLCALEMLDRWEEALREQPEIEMSSEFSKLTADIISHTAFGSSYLKGQKAFETLRAIQ

EELSKVNRYNYIPGKRFLPFPANFRLRKLYSDLDSLLLGLIKERRAQSGQSHDLLGLMLAECGNSSFDDRAVMEECKTFY

FAGHETTAILLTWSIMLLALHPEWQERARAEAQEVCEGATPEADSISKLKLINMILHETLRLYPPVGVMMRSCFEDTILG

DILVPKGAAVSFPILAIHHDKELWGEDAHEFNPERFKDGVTKASKHPNAFMPFSLGPRVCVGQSFVLMEAKIALATILQH

FRFRLSPSYRHCPVFKLTLRPRHSLPLVMEKI*

 

>fgenesh2_pg.C_scaffold_590000001|Selmo1 69% to estExt_fgenesh2_pg.C_190185|Selmo1

MKSKYGSIELLEESCKLGKYSARVVRGMIKGELGLRTKEKIWELRDGCRKAWELGFNSLRPVCIDKSLLELLDAVNQKAK

GPLSQQKQKVYRGTHLLENKRNLTRPEQRPKRNWAGFVRIWWNVLVLKYRKYRRMVHHI

DADKISELKLVGMILNETLRLYPPVIAFFRACFQDTWVQDL

CCRLPRPSNSPRQGTLGTRCQRFRPRTLQRWHLQRLQVS

PNAFMPFSLGPRVCVGQLFALMEAKV

ASLKAFHGIPLILNTLLSGSHRHPAHLMELMRLLLDLLRPSTWYLATF*

 

$$$$$$

 

>26 CYP779B1v1 e_gw1.29.321.1|Selmo1 41% to 72A21 IN CYP72 CLAN

MVFVIPVLATGLVGVIVYALLWKFWIAPSRKEAVLRKQGIKGPSLGPPQLFKGGNKDEVLKRRFSKRKFTLEFDGAHDIL

SHVLPDIHSFSKKYEMPYMYWWGNELRMTVTDPEVVRWVLSKNPQSFGKSASIQATLIKLLGYGLVASNGEHWAQHRRVV

GPAFHLEKLKNIMAGTMVDCTSKVLSRWDNDGEFEIDVEKEFSFLAADVISHTAFGSSFEKGRRIFHLLNLQAELLTKIA

FSPMQWMPFGRLHPLRENLQLWEVQKELDAILLGLVKDRRKSASYGRDLLGLMLEQSQDNPAFKDDKLVGECKTFYIAGQ

ETTATLLTWAMYLLSQHREWQDRARKEVLEVCKEDEINAEALNKLKLVGMILNETLRLYPPIPIIQRGTFNDTTMGDKIS

IPKGIVLVIPILAMHHDKEQWGGDAHEFNPERFARGASKACKHPNAFMPFSFGPRVCIGQTFALIEAKIALAMILRRFSA

SLSPNYQHCPVSGVTLKPLHGMQLTFIRR*

 

>CYP779B1v2 fgenesh1_pm.C_scaffold_332000001|Selmo1 96% TO e_gw1.29.321.1|Selmo1

MELDMVFVIPVLATGLVGVIVYALLWKFWIAPSRKEAVLRKQGIKGPSLGPPQLFKGGNKDE

 

FDGDHDILSHVLPDIHSF

SKKYEMPYMYWWGNELRMTVTDPEVVRWVLSKNPQSFGKSASIQATLIKLLGYGLVASNGEHWAQHRRVVGPAFHLEKLK

NIMAGTMVDCTSKVLSRWDNDGEFEIDVEKEFSFLAADVISHTAFGSSFEKGRRIFHLLNLQAELLTKIAFSPMQWMPFG

RLHPLRENLQLWEVQKELDAILLGLVKDRRKSASYGRDLLGLMLEQSKDNPAFKDDKLVGECKTFYIAGQETTATLLTWA

MYLLSQHREWQDRARKEVLEVCKEDEINAEALNKLKLVGMILNETLRLYPPIPIIQRGTFNDTTMGDKISIPKGIVLVIP

ILAMHHDKEQWGGDAHEFNPERFARGASKACKHPNAFMPFSFGPRVCIGQTFALVEAKIALAMILRRFSASHSPNYQHCP

VSGVTLKPLHGMQLTFTRR*

 

$$$$$

 

>9 CYP779B2v1 e_gw1.10.477.1|Selmo1 95% TO e_gw1.29.321.1|Selmo1

MVLVIQLLATGLVGVIVYALLWKFWIAPSRKEAALRKQGIKGPSLGPLQLFKGGNKDEVLKQRFSKRKFTLEFDGTHDIL

SHVLPDIHSFSKKYGMPYMYWWGNELRMTVTDPEVVRWVLSKNPQSFGKSASIQATLVKLLGYGLVASNGEHWAQHRRVV

GPAFQLEKLKNIMTGTMANCTSKVLSRWDNDGEFEIDVEKEFSFLAADVISHTAFGSSFEKGRRIFHLLNLQAELLTKIA

FSPMQWMPFGRENLQLWEVQKELDAILLGLVKDRRKSVSYGRDLLGLMLEQSQDNPAFKDDKLVGECKTFYIAGQETTAT

LLTWAMYLLSQHREWQDRARKEVLEVCKEDEINAEALNKLKLVGMILNETLRLYPPLPIIQRGTFNDTTMGDKISIPKGI

VLVIPILAMHHDKEQWGGDAHEFNPERFARGASKACKHPNAFMPFSFGPRVCIGQTFALIEAKIALAMILRRFSASLSPN

YQHCPVSGVTLKPLHGMQLTFTRR*

 

>CYP779B2v2 e_gw1.29.317.1|Selmo1 96% TO e_gw1.29.321.1|Selmo1

MVLVIQLLATGLVGVIVYALLWKFWIAPSRKEAALRKQGIKGPSLGPLQLFKGGNKDEVLKQRFSKRKFTLEFDGTHDIL

SHVLPDIHSFSKKYGMPYMYWWGNELRMTVTDPEVVRWVLSKNPQSFGKSASIQATLVKLLGYGLVASNGERWAQHRRVV

GPAFQLEKLKNIMAGTMVDCTSKVLSRWDNDGEFEIDVEKEFSFLAADVISHTAFGSSFEKGRRIFHLLNLQAELLTKIA

FSPMQWMPFGRENLQLWEVQKELDAILLGLVKDRRKSASYGRDLLGLMLEQSKDNPAFKDDKLVGECKTFYIAGQETTAT

LLTWAMYLLSQHREWQDRARKEVLEVCKEDEINAEDLNKLKLVGMILNETLRLYPPLPIIQRGTFNDTTMGDKISIPKGI

VLVIPILAMHHDKEQWGGDAHEFNPERFARGASKACKHPNAFMPFSFGPRVCIGQTFALIEAKIALAMILRRFSASLSPN

YQHCPVSGVTLKPLHGMQLTFTRR*

 

$$$$$$

 

>10 CYP775A1v1 fgenesh1_pm.C_scaffold_10000087|Selmo1 41% to CYP735A2 in CYP72 clan

MQGLEGPRPKFLVGNMDEITRMKETAFHQPMEIGDHNLLQRICPYYLEWSKLYGRTFVFWWGTEPRITVTRPDMIKEILY

SKAAHFGKSALQRKGGAVLLGNGLIMANGSDWAHRRAIVCRAFKMDKIKEMVPSMLESTKNLIRRWDAHLELNGGAPCEV

DAYRDLAVVTADIIATTAFGSSYSDGIKLFHTLTSIQKLFVQSNKYLWLPGSRLLPTRTNRKIRKLQREMQALLQDLIKA

RLSSPSLGTDLLALMLSAVEEDPGNKVQSSKFKFTIQQLIEECQTFFFVGHETTLMLVTWAMMLLCLHPEWQDLARKEAR

QVLQESNRVVNADTLAKLKTVGMIINETLRLYPPAPNLVRAALQDTCVGDLYVPKGTTFWIPILALHQDKHLWGEDAHEF

RPQRFSQGVSRACKTYDFLPFSSGPRICVGQSFAIMEAKLILAMILQHYHLGLSPRYKHSPVSSVTLKPGLGMQLMIKRC

D*

 

>CYP775A1v2 fgenesh2_pg.C_scaffold_29000144|Selmo1

99% to fgenesh1_pm.C_scaffold_10000087|Selmo1

MDPLQLLPLLLVVIAAAATALSWGAKKVAEFLWRPVHLRRLLRMQGLEGPRPKFLVGNMDEITRMKETAFHQPMEIGDHN

LLQRICPYYLEWSKLYGRTFVFWWGTEPRITVTRPDMIKEILYTKAAHFGKSALQRKGGAVLLGNGLIMANGSDWAHRRA

IVCRAFKMDKIKEMVPSMLESTKNLIRRWDAHLELNGGAPCEVDAYRDLAVVTADIIATTAFGSSYSDGIKLFHTLTSIQ

KLFVQSNKYLWLPGSRLLPTRTNRKIRKLQREMQALLQDLIKARLSSPSLGTDLLALMLSAVEEDPGNKVQSSKFKFTIQ

QLIEECQTFFFVGHETTLMLVTWAMMLLCLHPEWQDLARKEARQVLQESNRVVNADTLAKLKTVGMIINETLRLYPPAPN

LVRAALQDTCVGDLYVPKGTTFWIPILALHQDKHLWGEDAHEFRPQRFSQGVSRACKTYDFLPFSSGPRICVGQSFAIME

AKLILAMILQHYHLGLSPRYKHSPVSSVTLKPGLGMQLMIKRCD*

 

$$$$$$

 

>25 CYP774A1v1 estExt_fgenesh1_kg.C_240013|Selmo1 32% to 735A2 in CYP72 clan

MEDFLWKILCSCGVFLVVWLLVPAARSLWHAWRFRCFYAKQGIPGPPFRLIVGNIPEIRKLFNSVPKFETSFHAATKFRV

IPDLATFQQTYGRISVHELGSTTRILVADTELVKQVLMSRSSSYIKADLSRQILRAVVGRGVVVTDGDFWRQQRKILNPA

FKLAYLKGLMRHMSGAGEDLARKWSSRETTRIDAHREMAALTLDVITRASFGATIGGTNTGYAAFECLDRLLSTGLLYMN

SYKRLIPGYSFLPTRENLHLRRSEQYVNTLLRDIIRNRWAEKTRNPDENGKPVYDLLDMMLEAVENKSPTMTMDQLLDEC

KTIFFAGHSTTALTLTWSLIMLSVHQEWQQRARDEIFAAHKRCGGRDLSAEDLSSLEVVGWIIHEVLRLFPPVSTVTRQC

HQAHEIGEFSILPGTLVLCPLALLLQSKEDWGDDVSEFNPERFINKKTKDISEFMAFGAGPRMCLGMNFALIEARLLLSL

LLAKFSFTLAEDYVHAPGSPVSMKPVYGAPLLVKKL*

 

>CYP774A1v2 estExt_fgenesh1_kg.C_690008|Selmo1 99% to estExt_fgenesh1_kg.C_240013|Selmo1

MEDFLWKILCSCGVFLVVWLLAPAARSLWHAWRFRCFYAKQGIPGPPFRLIVGNIPEIHKLFNSVPKFETSFHAATKFRV

IPDLATFQQTYGRISVHELGSTTRILVADTELVKQVLMSRSSSYIKADLSRQILRAVVGRGVVVTDGDFWRQQRKILNPA

FKLAYLKGLMRHMSGAGEDLARKWSSRETTRIDAHREMAALTLDVITRASFGATIGGTNTGYAAFECLDRLLSTGLLYLN

SYKRLIPGYSFLPTRENLHLRRSEQYVNTLLRDIIRNRWAEKTRNPDENGKPVYDLLDMMLEAVENKSPTMTMDQLLDEC

KTIFFAGHSTTALTLTWSLIMLSVHQEWQQRARDEIFAAHKRCGGRDLSAEDLSSLEVVGWIIHEVLRLFPPASTVTRQC

HQAHEIGEFSILPGTLVLCPLALLLQSKEDWGDDVSEFNPERFINKKTKDISEFMAFGAGPRMCLGMNFALIEARLLLSL

LLAKFSFTLAEDYVHAPGSPVSMKPVYGAPLLVKKL*

 

$$$$$$

>CYP777A1v1 fgenesh1_pm.C_scaffold_85000002|Selmo1 37% to 734A1 in CYP72 clan

MDRVVWVGLIAAACWIAVLKLVELVVKSWWRRRRICQVMEGQGIRGPPCNLLDGNYSEIKRMQAEAAAVDMPALTHDIVA

RVFPFQHKCTQLYGKHFLHWWGQDPIIHITEPELIVEVLSLKFGHWQKSSQLRRAMEFLFGKGLLVAVGEDWVRQRHAVN

SALSAEKIKCFVEVVICCVKPMVRKWEQRVEEGGEAEVEVKQDMLDMATEIILRSSFGDECYDEARRYPELVYRLLGLTS

KSSPFNSLIPSFVPTKKNQLLKEIEQCFYRVVATHTQQRNTILSSLLGCAARSSLSVQHVIDECKNIVFAGHETTAHMLT

WTMMLLGLHPEWQQRAFEEVAEVCKGRDPTSDTLSKLRVMNMIVNESLRLYPPGAQTAREALKDMKLGDRITIPAGVSVA

INIVEVHRSVEMWGDDALEFKPQRFAEGVSRACKQPVGGYLPFLLGPRVCVGQGLALMEAKLALVLILQRLSWRLSPNYR

HAPIVALTLQPQHGMQLVISPRRTHDR*

 

>28 CYP777A1v2 e_gw1.180.33.1|Selmo1 99% to fgenesh1_pm.C_scaffold_85000002|Selmo1

MDRVVWVGLVAAACWIAVLKLVELVVKSWWRRRRICQVMEGQGIRGPPCNLLDGNYSEIKRMQAEAAAVDMPALTHDIVA

RVFPFQHKCTRLYGKHFLHWWGQDPIIHITEPELIVEVLSLKFGHWQKSSQLRRAMEFLFGKGLLVAVGEDWVRQRHAVN

SALSAEKIKCFVEVVICCVKPMVRKWEQRVEEGGEAEVEVKQDMLDMATEIILRSSFGDECYDEARRYPELVYRLLGLTS

KSSPFNSLIPSFVPTKKNQLLKEIEQCFYRVVATHTQQRNTILSSLLGCAARSSLSVQHVIDECKNIVFAGHETTAHMLT

WTMMLLGLHPEWQQRAFEEVAEVCKGRDPTSDTLSKLRVMNMIVNESLRLYPPGAQTAREALKDMKLGDRITIPAGVSVA

INIVEVHRSVEMWGDDALEFKPQRFAEGVSRACKQPVGGYLPFLLGPRVCVGQGLALMEAKLALVLILQRLSWRLSPNYR

HAPIVALTLQPQHGMQLVISPRTHDR*

 

$$$$$$

 

>CYP776A1v1 estExt_fgenesh2_pg.C_130176|Selmo1 98% to fgenesh2_pg.C_scaffold_48000168|Selmo1

MAMEWWSAIIAALALAKSIALNLVIARVVGFVFSLCRLHVFVRRRLAKQGILGPKPSWLAGNAVEMKRLVASATSADMKS

TSNDISARLLPFHHKHAQTYGKRFLAWSVGWEPFVSISEPELIHEILNSTDFEKSGIQNRFMMPLFGRGLVMATGKAWDH

QRRLLNPAFYVERIKGFLPTINFCASGLVQEWKGLIRSSSSNVVEVDVHSVLTSVTADIIARTSFGHEFTHREEYVRLER

ELEVCVLNQPAFCLIPGYRYLPTKQNRKLWEITRKIRSYLYELIDARLATGKDHFGDDILGLLLAATFSSSPSSTKKVPP

MSKDVLIDDCKTLFFAGHESSADLVTWSMMLLALNPEWQARARSEVLQVLDGCEVLTSEMLPKLKLIGNILSETLRLYPA

AVAIRRKAVKDVVFTKGKLVIPKGVCAEVPILRVHHDPELWGDDVLEFNPDRFSKSEAVAAGSYLPFGWGPRICIGRNFA

LAEAKVVLSTLLDNFEWEISPSYRHSPRAGVTLYPQHGMQLLLRQLPQN*

 

>19 CYP776A1v2 fgenesh2_pg.C_scaffold_48000168|Selmo1 36% to 735A2 in CYP72 clan

MAMEWWSAIIAALALAKSIALNLVIARVVGFVFSLCRLHVFVRRRLAKQGILGPKPSWLAGNAVEMKRLVASATSADMKS

TSNDISARLLPFHHKHAQTYGKRFLAWSVGWEPFVSISEPELIHEILNSTDFEKSGIQNRFMMPLFGRGLAMATGKAWDH

QRRLLNPAFYVERIKGFLPTINFCASGLVQEWKGLIRSSSSNVVEVDVHSVLTLVTADIIARTSFGHEFTHKEEYVRLER

ELEVCVLNQPAFCLIPGYRYLPTKQNRKLWEITRKIRSYLYELIDARLATGKDHFGDDILGLLLAATFSSSPSSTKKVPP

MSKDVLIDDCKTLFFAGYESSADLVTWSMMLLALNPEWQARARSEVLQVLDGCEVLTSEMLPKLKLIGNILSETLRLYPA

AVAIRRKAVKDVVFTKGKLVIPKGVCAEVPILRVHHDPELWGDDVLDFNPDRFSKSEAVAAGSYLPFGWGPRICIGRNFV

LAEAKVVLSTLLDNFEWEISPNYRHSPRAGVTLYPQHGMQLLLRQLPQN*

 

$$$$$$

 

>27 CYP773A1v1 e_gw1.59.173.1|Selmo1 98% to e_gw1.109.86.1|Selmo1

new family most like CYP709 and CYP721

MDLIWNVVTAGVSLIATICVWQLARDFLWRPRRLLQAFKQQGVLGPVPRLFLGNLDQVRELMAVEVVKSSTGEIRDDNHG

GVVAKVLPYYAAWSRSYGETFLVWWGSQPRLMISDPELMKEVLCDKSGSLDRDPGQHAARDLFGDGIALLTMNERWSQKR

KMVSLAFHNEKLKLMIDAMVACVEENLKQWKTTEGPVDVASKLRDITQDVLCRTAFGTSYAAGKEVFEMQIEQQYIHLEW

QGQVHLPGFRFLPTSANRRRWTLKQQIDSKLRKIVVNRLKESSVSGSYGKDLLGLMLAAKDGVLDFNNGKKLDIQVTMQD

VIDECKTFFFTGQETSAALLAWTMLLLALNPDWQTRLRQEVCQVCGQVSAPNTLEMLGNLKSMTMVINEALRMYPPVPLL

NRYTHNKVKLKELVIPKGTLLLVPLIVINYNEKFWGVDAKSFNPDRFVSQQQRPFLPFSVGPRTCVGQSFAMIETKIILA

MILRKFKFELSETYVHSPFQVLTLQPKFGMPMNLLANQ*

 

>CYP773A1v2 e_gw1.109.86.1|Selmo1 38% to 735A2 in CYP72 clan

MDLIWNVVTAGVSLIATICVWQLARDFLWRPRRLLQAFKQQGVLGPVPRLFLGNLDQVRELMAVEVAKSSTGEIRDDNHG

GVVAKVLPYYAAWSRSYGQTFLVWWGSQPRLMISDPELMKEVLCDKSGSLDRDPGQHAARDLFGDGIALLTMNERWSQKR

KMVSLAFHNEKLKLMIDAMVACVEENLKQWKTTEGPVDVASKLRGITQDVLCRTAFGTSYAAGKEVFEMQIEQQYIHLEW

QGQVHLPGFRFLPTSTNRRRWTLKQQIDSKLRQIVVNRLKESSVSGSYGKDLLGLMLAAKDGVLDFNNGKKLDIQVTMQD

VIDECKTFFFTGQETSAALLAWTMLLLALNPDWQTRLRQEVCQVCGQVSAPNTLEMLGNLKSMTMVINEALRMYPPVPLL

NRYTHNKVKLKELVIPKGTLLLVPLIVINYNEKFWGGDAKSFNPNRFVSQQQRPFLPFSVGPRTCVGQSFAIIETKIILA

MILRKFTFELSETYVHSPFQVLTLQPKFGMPMNLLANQ*

 

 

$$$$$$

 

>29 CYP778A2v1 fgenesh2_pg.C_scaffold_130000004|Selmo1 30% to CYP734 in CYP72 clan

98% to fgenesh2_pg.C_scaffold_130000008|Selmo1 100% except for indel

MDVISVLLVALVLAFSVLWMVCSFLMRYYWVASALRPVMEKQGIRGSPNPPNPIFDVFYGKPDMKEISHDILPHVLPWAA

QHIKFYGNVHLNWWLREPRIVISEPKIIWDLLMKKHKDFVKSHFIKVFSDDIFHKGLFHANGEDWARQRQIVAPRYYIDE

VKAMVGAVNNATSQVMAKWEAFVKDSGDVERELDVQVEFMNLNVDVVARTTLG

L  E  N  S  D  F  Q  N I  L  K  Y  S  I  T  L  L  N  L  Q  D (1)

D  I  V  V  Q  ALIPFGINVERWKVRKQFNDLVRKQ

V  R  E  R  R  K  R  T  T  G  N  N  V  D  F  I  G  M  L  L  D  N  P

 

DVREDVIVAELKTLYATGFISLAPLLSFTMLMLALYPDWQEKARQEVDQVLDGEVVSPKDVSKLTTIEMILRETLRLYPTMPLIAR

VCIKDTMLGDVFIPKGLGVSVNVVALHHDRDLWGDDVNEFNPSRFKNGTATAAKHPMAFMPFAYGVRTCIGRAFSEMQCK

IIIANILQRFEVKLSPNYRHHPVITGPLIPKHGMPVILKPRRNF*

 

>CYP778A2v2 e_gw1.269.2.1|Selmo1 100% to fgenesh2_pg.C_scaffold_130000004|Selmo1

96% to fgenesh2_pg.C_scaffold_7000212|Selmo1

95% to fgenesh2_pg.C_scaffold_4000053|Selmo1

94% to fgenesh2_pg.C_scaffold_9000313|Selmo1

96% to fgenesh2_pg.C_scaffold_130000008|Selmo1

93% to e_gw1.53.305.1|Selmo1

MLLDNPDVREDVIVAELKTLYATGFISLAPLLSFTMLMLALYPDWQEKARQEVDQVLDGEVVSPKDVSKLTTIEMILRET

LRLYPTMPLIARVCIKDTMLGDVFIPKGLGVSVNVVALHHDRDLWGDDVNEFNPSRFKNGTATAAKHPMAFMPFAYGVRT

CIGRAFSEMQCKIIIANILQRFEVKLSPNYRHHPVITGPLIPKHGMPVILKPRRNF*

 

>CYP778A3v2 fgenesh2_pg.C_scaffold_130000008|Selmo1 96% to e_gw1.269.2.1|Selmo1

MDVISVLLVALVLAFSVLWMVCSFLMRYYWVASALRPVMEKQGIRGSPNPPNPIFDVFYGKPDMKEISHDILPHVLPWAA

QHIKFYGNVHLNWWLREPRIVISEPKIIWDLLMKKHKDFVKSHFIKVFSDDIFHKGLFHANGEDWARQRQIVAPRYYIDE

VKAMVGAVNNATSQVMAKWEAFVKDSGDVERELDVQVEFMNLNVDVVARTTLGLIPFGINVERWKVRKQFNDLVHVREDV

IVAELKTLYATGFISLAPLLSFTMLMLALYPDWQEKARQEVDQVLDGEVDQVLDGEVVSPKDVSKLTTIEMILRETLRLY

PTMPLIARVCIKDTMLGDVFIPKGLGVSVNVVALHHDRDLWGDDVNEFNPSRFKNGTATAAKHPMAFMPFAYGVRTCIGR

AFSEMQCKIIIANILQRFEVKLSPNYRHHPVITGPLIPKHGMPVILKPRRNF*

 

>6 CYP778A3v1 fgenesh2_pg.C_scaffold_7000212|Selmo1 96% to e_gw1.269.2.1|Selmo1

MDVISVLLVALVLALSVLWMVCSFLMRYYWVASALRPVMEKQGIRGSPNPPNPIFDVLYGKPDMKEISHDILPHVLPWAA

QNIKFYGNVHLNWWLREPRIVISEPKMIWDLFMKKHKDFVKSHFIKVFSDDIFHKGLFHANGEAWARQRQIVAPRYYIDE

VKAMVGAVNNATSQVMAKWEAFVKDSGDVERELDVQVEFMCLNVDVVARTTLGLKNNDFQNILKYNITLLKLQDDQETWS

WLPFARLIPFGINVERWKVRKQLNDLVRKQVREQRKKTTEGNNVDFIGKLLDKPDVREDVIVAELKTLYATGFISLAPLL

SFTMLMLALHPSWQEKARQEVDQVLDGEVVSPKDVSKLTTIEMILQETLRLYPTMPLITRVCIKDTMLGDVFIPKGLGVS

VNVVALHHDRELWGDDVNEFNPSRFKNGTATAAKHPMAFMPFAYGVRTCIGRAFSEVQCKVIIANILQRFEVKLSPNYRH

HPVITGPLIPKHGMPVILKPRRNF*

 

>5 CYP778A1v1 fgenesh2_pg.C_scaffold_4000053|Selmo1 95% to e_gw1.269.2.1|Selmo1

MDVISVLLVALVLALSVLWMVCSFLMRYYWVPSALRAVMEKQGIRGSPNPPNPIFDVFDGKPDMKEISHDILPHVLPWAA

QNMKFYGNVHLNWWLREPRIVISEPKMIWDLFMKKHKDFVKSHFIKLLSDDIFHKGLFLANGEAWARQRQIVAPRYYIDE

VKAMVRAVNNATSQVMAKWEAFVKDSGDVERELDVQVEFMCLNVDVVARTTLGLEDNDFQNILKYNITLLKLQNDQETWS

WLPFARLIPFGINVERWKVRKQLNDLVRKQVRERRKKMTEGNNIDFIGKLLDNPDVREDVIVAELKTLYATGFISLAPLL

SFTMLMLALYPSWQEKARQEVDQVLDGEVVSPKDVTKLITIEMILQETLRLYPTMPLIARVCIKDSMLGDVFIPKGLGVS

VNVVALHHDRDLWGDDVNEFNPSRFKNGTATAAKHPMAFMPFAYGVRTCIGRAFSEVQCKVIIAIILQRFEVKLSPNYRH

HPVITGPLIPKNGMPVILKPRQNF*

 

>CYP778A1v2 fgenesh2_pg.C_scaffold_9000313|Selmo1 94% to e_gw1.269.2.1|Selmo1

MDVISVLLVALVLALSVLWMVCSFLMRYYWVPSALRAVMEKQGIRGSPNPPNPIFDVFDGKPDMKEISHDILPHVLPWAA

QNMKFYGNVHLNWWLREPRIVISEPKMIWDLFMKKHKDFVKSHFIKLLSDDIFHKGLFLANGEAWARQRQIVAPRYYIDE

VKAMVRAVNNATSQVMAKWEAFVKDSGDVERELDVQVEFMCLNVDVVARTTLGLEDNDFQNILKYNITLLKLQNDQETWS

WLPFARLIPFGINVERWKVRKQLNDLVRKQVRERRKKMTEGNNIDFIGKLLDNPDVREDVIVAELKTLYATGFISLAPLL

SFTMLMLALYPSWQEKARQEVDQVLDGEVVSPKDVTKLITIEMILQETLRLYPTMPLIPRVCIKDSMLGDVFIPKGLGVS

VNVVALHHDRDLWGDDVNEFNPSRFKNGTATAAKHPMAFMPFAYGVRTCIGRAFSEVQCKVIIAIILQRFEVKLSPNYRH

HPVITGPLIPKNGMPVILKPRQNF*

 

$$$$$

 

>21 CYP778A4v1 e_gw1.53.305.1 manually annotated

MDVISVLLVALVLALSVLWMVCSFFMRYYWLASALRPVMEKQGIRGSPNPPNPIFDVLYGKPDMKEISHDILPHVLPWAAQNMKFYGNVHLN

WWLREPRIVISEPKMIWDLFMKKHKDFIKSHFIKVFSDDIFHKGLFHADGEAWARQRQIV

ATLYCINKVKVMVETVNNATSQVMAKWEAFVKESGDMERELDVQV

EFMCLNVDVVARTTLGLEDNDFQNILKYNITLLKLQNDQETWSWLPFARLIPFGI

NVERWKVRKQLNDLVRKQVRERRKKTTEGNNVDFIGKLLDNPDVREDVIVAE

LKTLYATGFISLAPLLSFTMLMLALHPSWQEKARQEVDHVLDGGFVSPKDVSKLTTV

EMILRETLRLYPTMPLITRLCIKDTMVGDVSIPKGLGVSVNVVALH

HDPDLWGDDVNEFNPSRFKNGTATAAKHPMAFMPFAYGVRTCIGRAFSEVQCKVIIANIF

QRFEVKLSPNYRHHPVITGPLIPKHGMPVILKPRRNF*

 

>CYP778A4v1 e_gw1.53.305.1|Selmo1 93% to e_gw1.269.2.1|Selmo1

MVETVNNATSQVMAKWEAFVKESGDMERELDVQVEFMCLNVDVVARTTLGLENNDFQNILKHINCTDLRKILWCRPIPFG

INVERWKVRKQLNDLVRKQVRERRKKTTEGNNVDFIGKLLDNPDVREDVIVAELKTLYATGFISLAPLLSFTMLMLALHP

SWQEKARQEVDHVLDGGFVSPKDVSKLTTIEMILRETLRLYPTMPLITRLCIKDTMVGDVSIPKGLGVSVNVVALHHDPD

LWGDDVNEFNPSRFKNGTATAAKHPMAFMPFAYGVRTCIGRAFSEVQCKVIIANIFQRFEVKLSPNYRHHPVITGPLIPK

HGMPVILKPRRNF*

 

$$$$

 

>e_gw1.13.535.1|Selmo1 72% to e_gw1.13.461.1|Selmo1, 40% to 735A2 in CYP72 clan

LYPPIAIIPRMALKDCYVDHLFIPKGLAVNVHNAVIHHSAEMWGEDSHEFNPDRFANGSLAACKHPMAFMALSFGARACV

GRAYSQVQAKIIVASLLQIPVELVARLSSQPHRVPIVLTLLGAKKD*

 

$$$$$$

 

CYP74 clan sequences (17 sequences in 7 bins) [4% of the P450 sequences]

 

>1 CYP74J1 e_gw1.118.29.1|Selmo1 47% to CYP74A1 arab., 48% to 74A6v2 NO INTRONS

MASFLSDRSTTLSSSGVGARGCWIASKSRPATNFRYQLHSSAWKATALSPTKRIQREIPGSYGLPLLGSISDRFNYFYFQ

GTEEFFRSRAEKYQSTVFRVNMPPGPPFFPDPRVIVLLDQQSFPALFDVSKVSKRDVFTGTYKPSADFNGGYRILSYLDA

DEPRHAQIKAFCFDMLKSRAKSIVPGMDFAACRCFDRWEKELRAKQAPELVSSIEEICLAFLTRALMDHDATGASGLSTE

TIKKWLAPQIAPVALLDAIPPPIMELLHVFPLPFAVVKKDYEAIVSYFSAHSTALLDLAATHGVPRDEALHNLIFMVCFN

TFGGLIRLLPEVVQRVHESGVAKELSNEVAAAVRDAGGRLTARSIDGMPLLHSVVYECLRFQPPVPFQYARARQDMVIES

HKEAFRVKKGEMLCGFQPFATRDGVVFDRPNEFLPRRFMGDDGAKLLKYVLWSNGPQTENPSVDNKHCAGKDFIVLVTRL

FLAEFFLRYESFQLDGQSIKSLSRRSPST*

 

No allele found

 

$$$$$$

 

>CYP74K3v1 estExt_Genewise1Plus.C_380386|Selmo1 53% to e_gw1.118.29.1|Selmo1, 46% to 74A1

MSNDRNLEVKREVPGEYGAPILGAVLDRLDRFYGKNFFEKRRDEYGSTVFRVNMPPGPPFFPDSKVIALLDQKSFPVLFD

LTKVSKKDVFTGTYVPSTGFTGGYRVLPYLGQEEPKHAQLKSYCMDILSSNHDRWIPELRAAAAAGYAEWDAERNKPKKS

GGLLGGIIALRFLTKTVLDKDATEGNALTETGIKLWTAPQIAPVLNAGLPAVIQEPLLHTAPIPFIIVAPEYQKIVRFFK

ANGERAVSLAVPHGIDPDEALHNLIFFICFNTFGGLTILWPALFKHVSDFNEFDLQAELREEVRRAVGGGGLDAAALGGM

PLLQSTVYEVLRIEPPVQSQYGRAKVDFVLETHVEAFKIKAGEMLYGYQPLVTRDPVVFEEPEKFKPRRFMGEEGQRLLE

HVFWSNGPETGSPSVDNKQCPGKNFVVLVTRILFADFFLHYDSFKLGDVSISGTSSVYPCTELKKRA*

 

>2 CYP74K3v1 estExt_Genewise1Plus.C_380386_JKW_manual

Selmo1/scaffold_38:1324135-1325795

43% to CYP74A6 corrected seq has no introns

MSNDRNLEVKREVPGEYGAPILGAVLDRLDRFYGKNFFEKRRDEYGSTVFRVNMPPGPPFFPDSKVIALLDQKSFPVLFD

LTKVSKKDVFTGTYVPSTGFTGGYRVLPYLGQEEPKHAQLKSYCMDILSSNHDRWIPELRAAAAAGYAEWDAERNKPKKS

GGLLGGIVSGLFPDDPLELNPVLGK

IALRFLTKTVLDKDATEGNALTETGIKLWTAPQIAPVLNAGLPAVIQEPLLHTAPIPFIIVAPEYQKIVRFFK

ANGERAVSLAVPHGIDPDEALHNLIFFICFNTFGGLTILWPALFKHVSDFNEFDLQAELREEVRRAVGGGGLDAAALGGM

PLLQSTVYEVLRIEPPVQSQYGRAKVDFVLETHVEAFKIKAGEMLYGYQPLVTRDPVVFEEPEKFKPRRFMGEEGQRLLE

HVFWSNGPETGSPSVDNKQCPGKNFVVLVTRILFADFFLHYDSFKLGDVSISGTSSVYPCTELKKRA*

 

 

> CYP74K3v2 estExt_fgenesh2_pg.C_630172|Selmo1 99% to estExt_Genewise1Plus.C_380386|Selmo1

MSNDRNLEVKREVPGEYGAPILGAVLDRLDRFYGKNFFEKRRDEYGSTVFRVNMPPGPPFFPDSKQHHDRWIPELRAAAA

AGYAEWDAERNKPKKSGGLLGGIVSGLFPDDPLELNPVLGKIALRFLTKTVLDKDATEGNALTETGIKLWTAPQIAPVLN

AGLPAVIQEPLLHTAPIPFIIVAPEYQKIVRFFKANGERAVSLAVPHGIDPDEALHNLIFFICFNTFGGLTILWPALFKH

VSDFNEFDLQAKLREEVRRAVGGGGLDAAALGGMPLLQSTVYEVMRIEPPVQSQYGRAKVDFVLETHVEAFKIKAGEMLY

GYQPLVTRDPVVFEEPEKFKPRRFMGEEGQRLLEHVFWSNGPETGSPSVDNKQCPGKNFVVLVTRILFADFFLHYDSFKL

GDVSISGTSSVYPCTELKKRA*

 

$$$

 

>3 CYP74K2v1 fgenesh1_kg.C_scaffold_38000017|Selmo1 98% to estExt_Genewise1Plus.C_630406|Selmo1

Selmo1/scaffold_38:1295485-1296993

42% to CYP74A6 no introns

MSNDRNLEVKRDVPGEYGAPILGSVLDQLDRFYGKNFFEKRRDEYGSTVFRVNMPPGPPFFPDSKVIALLDQKSFPVLFD

LTKVSKKNVFTGTYVPSTGFTGGYRVLSYLGQEEPKHAQLKSYCMDILSSNHDRWIPELRAAAAAGYDEWDAELNKPKKS

GGLLGGIVSGLLPDDPPELNPVLGKIALRFLTKTVLDKDATEGNALTETGIKLWIAPQIAPVLNAGLPAVIQEPLLHTAP

IPFIIVAPEYHKIVRFFKANGERAVSLAVPHGIDPDEALHNLVFFICFNTFGGLTILWPALFKHVSDFDEFDLQAELREE

VRRAVGRGGVDAAALGAMPLLQSTVYEVLRIEPPVQSQYGKAKVDFVLETHVEAFKIKAGEMLYGYQPLVTRDPVVFEEP

EKFKPRRFMGEEGQRLLEHVFWSNGPETSSPSVDNKQCPGKNFVVLVTRILFADFFLHYDSFKLGDAFISGTSSVYPFTE

LKKRA*

 

>CYP74K2v2 estExt_Genewise1Plus.C_630406|Selmo1 95% to estExt_Genewise1Plus.C_380386|Selmo1

98% to estExt_fgenesh1_kg.C_380015|Selmo1

MSNDRNLEVKRDVPGEYGAPILGSVLDRLDRFYGKNFFEKRRDEYGSTVFRVNMPPGPPFFPDSKVIALLDQKSFPVLFD

LTKVSKKNVFTGTYVPSTGFTGGYRVLSYLGQEEPKHAQLKSYCMDILSSNHDRWIPELRAAAAAGYAEWDAELNKPKKS

GGLLGGIVSGLLPDDPPELNPVLGKIALRFLTKTVLDKDATDGNALTETGIKLWLAPQIAPVLNAGLPAVIQEPLLHTAP

IPFIIVAPEYQKIVRFFKANGERAVSLAVPHGIDPDEALHNLVFFICFNTFGGLTILWPALFKNVSDFDEFDLQAELREE

VRRAVGRGGVDAAALGAMPLLQSTVYEVLRIEPPVQSQYGKAKVDFVLETHVEAFKIKAGEMLYGYQPLVTRDPVVFEEP

EKFKPRRFMGEEGQRLLEHVFWSNGPETSSPSVDNKQCPGKNFVVLVTRILFADFFLHYDSFKLGDASISGTSSVYPFTE

LKKRA*

 

$$$

 

>4 CYP74K1 estExt_fgenesh1_kg.C_380015|Selmo1 no introns

Selmo1/scaffold_38:1285922-1287481

95% to estExt_Genewise1Plus.C_380386|Selmo1

98% to fgenesh1_kg.C_scaffold_38000017

95% to estExt_Genewise1Plus.C_380386_JKW_manual

MSNDRNLEVKRDVPGEYGAPILGSVLDRLDRFYGKNFFEKRRDEYGSTVFRVNMPPGPPFFPDSKVIALLDQKSFPVLFD

LTKVSKKDVFTGTYVPSTGFTGGYRVLSYLGQEEPKHAQLKSYCMDILSSNHDRWIPELRAAAAAGYAEWDAELNKPKKS

GRLLGGLVSGLLPDDPPELNPVLGKIALRFLTKTVLDKDATEGNALTETGIKLWIAPQIAPVLNAGLPAVIQEPLLHTAP

IPFIIVAPEYQKIVRFFKANGERAVSLAVPHGIEPDEALHNLVFFICFNTFGGLTILWPALFKNVSDFDEFDLQAELREE

VRRAVGRGGVDAAALGAMPLLQSTVYEVLRIEPPVQSQYGKAKVDFVLETHVEAFKIKAGEMLYGYQPLVTRDPVVFEEP

EKFKPRRFMGEEGQRLLEHVFWSNGPETGSPSVDNKQCPGKNFVVLVTRILFADFFLHYDSFKLGDAFISGTSSVYPFTE

LKKRA*

 

$$$$$$

 

>5 CYP74L1v1 e_gw1.13.341.1|Selmo1 43% to 74A5, CYP74 clan no introns

MEVPGSYGVPWLSAIKDKLDFHYIQGEVEFFKSRVKKYKSTVLKVNFIPTPPGFPNPAGIALLDQRSFPVLFDNSKVEKR

DVFVGSYKPSDAFTGGVRTLAYLDTEEEKHARLKEFVFQILKSTGPRFLSEFEAEMASALAGVEAEMESGTKNSIAVSSK

LLDLAFNFMVKAVTGGADPSSQFGSYGPLLMQLWIGVQFAPISPRTQLPAVIEELLLRSFPLPPLIVRWPYDRIAGFLSD

NATALIDMGEKQFGLDREEALHNLVFVVGVNGFLGFSRMLPSLLFYVASQSEAFQQRLGGEIRGAMGDDGSARKFMAAVE

RMPLLKSTVLEVMRIAPPVLYQYGRARREFVVESGDGREFLIRKGELLGGSQALVCRDPTVFDSPDEFVPDRFLGAQGRE

LERCVFWSNGRNTDSTSSANKQCGAKDFVETIGRLFVAQLYLRYESIELGPDSKPDSPVIKSLRKISVATRTGNKVSA*

 

>CYP74L1v2 e_gw1.48.185.1|Selmo1 98% to e_gw1.13.341.1|Selmo1

MEVPGSYGVPWLSAIKDKLDFHYIQGEVEFFKSRVKKYKSTVLKVNFIPTPPGFPNPAGIALLDQRSFPVLFDNSKVDKR

DVFVGSYKPSDAFTGGVRTLAYLDTEEEKHARLKEFVFQILKSTGPRFLSEFEAEMASALAGVEAEMESGTKNSIAVSSK

LLDLAFNFMVKAVTGGADPSSQFGSYGPLLMQLWIGVQFAPISPRTQLPAVIEELLLRSFPLPPLIVRWPYDRIAGFFRD

NATALIDMGEKQFGLDREEALHNLVFVVGVNGFLGFSRMLPSLLFYVASQSEAFQQRLGGEIRGAMGDDGSARKFMAAVE

RMPLLKSTVLEVMRIAPPVLYQYGRARREFVVESGDGREFLIRKGELLGGSQALVCRDPTVFDSPDEFVPDRFLGAQGRE

LERCVFWSNGRNTDSTSSANKQCGGKDFVETIGRLFVAQLYLRYESIKLGPDSKPESPVIKSLRKISVATRTGNKVSA*

 

$$$$$$

 

>6 CYP74L2v1 e_gw1.20.297.1|Selmo1 98% to fgenesh1_pm.C_scaffold_86000049|Selmo1

3 aa diffs to fgenesh2_pg.C_scaffold_20000018 plus cyan region

55% to e_gw1.13.341.1 no introns

MASSGSSNLPT

KEVPGSYGLPVLGAQKDNLDFLHLQGEVEFFKSRVAKYNSTVFKVNFIPGNPAFPDPRGIALLDQSSFP

VLLDSSKVDKTNVFTGSYKASDDFTGGYRVLSYLDTTDPKHATLKNFAFEVLKRNGRKFLPEFQSAFHAAFDAAESELSS

GKNKADMAPLLNQLAFQFLAK

SIVNVDPLTTKLADQGPTHLLRWI

GIQFAPVAPGNSTPLPGFAEDVVIRTAPLPFLLVK

ADYDKLCEFFQLATEMLDMGEKEFGLSREEAVHQLLFLVGMNSWFGFSARVLPNLLYRVGTLGAEFQKRLGDEIRAAIDV

SDPAGSFYGALEKMPLLKSTVLEVFRFDPPVLYQYGRPREDMVVESHDAKFVIKKGQLLGGSQALVCRDPKVFEEPDQLI

PDRFVGKEELQANVFWSNGRNTKSPTADDKQCAGKNFVETIARFYLVQLFARYKTFELSEDSTLNTPFLKSFARN*

 

>CYP74L2v2 fgenesh1_pm.C_scaffold_86000049|Selmo1 45% to CYP74A5 rice

6 aa diffs to e_gw1.20.297.1

M

KEVPGSYGLPVVGAQKDNLDFLHLQGEVEFFKSRVARYNSTVFKVNFIPGNPAFPDPRGIALLDQSSFPVLLDSSKVDK

TNVFTGSYKASDDFTGGYRVLSYLDTTDPKHATLKNFAFEVLKRNGRKFLPEFQSAFHAAFDAAESELSSGKNKADMAPL

LNQLAFQFLAK

SIVNVDPLTTMLADQGPTHLLRWI

GIQFAPVAPGNSTPLPGFAEDVVIRTAPLPFLLVKADYDKLCEFF

QLAAEMLDMGEKEFGLSREEAVHQLLFLVGMNSWFGFSARVLPNLLYRVGTLGAEFQKRLGDEIRAAIDVGDPAGSFYGA

LEKMPLLKSTVLEVFRFDPPVLYQYGRPREDMVVESHDAKFVIKKGQLLGGSQALVCRDPKVFEEPDQLIPDRFVGKEEL

QANVFWSNGRNTKSPTADDKQCAGKNFVETIARFYLVQLFARYKTFELSEDSTLNTPFLKPFARN*

 

$$$

 

>7 CYP74L3 fgenesh2_pg.C_scaffold_20000018|Selmo1 94% to fgenesh1_pm.C_scaffold_86000049|Selmo1

nearly identical to e_gw1.20.297.1

note yellow will match if a frameshift & is allowed remove ARLTSSVG

MASSGSSNLPTKEVPGSYGLPVVGAQKDNLDFLHLQGEVEFFKSRVARYNSTVFKVNFIPGNPAFPDPRGIALLDQSSFP

VLLDSSKVDKTNVFTGSYKASDDFTGGYRVLSYLDTTDPKHATLKNFAFEVLKRNGRKFLPEFQSASHAAFDAAESELSS

GKNKADMAPLLNQLAFQFLAK

SIVNVDPLTTKLADQGPTHLLRWX &

GIQFAPVAPGNSTPLPGFAEDVVIRTAPLPFLLVKADYDKLCEFFQLATEM

LDMGEKEFGLSREEAVHQLLFLVGMNSWFGFSARVLPNLLYRVGTLGAEFQKRLGDEIRAAIDVSDPAGSFYGALEKMPL

LKSTVLEVFRFDPPVLYQYGRPREDMVVESHDAKFVIKKGQLLGGSQALVCRDPKVFEEPDQLIPDRFVGKEELQANVFW

SNGRNTKSPTADDKQCAGKNFVETIARFYLVQLFARYKTFELSEDSTLNTPFLKSFARN*

 

 

$$$$$$

 

>8 CYP74M1v1 estExt_Genewise1Plus.C_400042|Selmo1 38% to CYP74A1, CYP74 clan no introns

MSASGKEKPLKDVPGSYGVPVVGALKDRLDFYWFQGEVEFYKSRMEKNQSTVFRVNFPPGPPGFPEGHGIVLLDQVSYSV

LLDNAKVDKRDTLIGSYMPDLAFTGGYRTLPYLDTAEEKHTTYKSLMFEILHESAQRFGPELSSAFDRTAQEWEAKIAKD

GSVESLSTAGNMVIQFLYKTITHQDPMATMGDDPHSVYMAWTGVQFAGIAYTNLPHITEELLMHSFQLPFFPIKKKYEQI

VEFFRSAGSGLLDLAVTKYGLDREEALHNLVFSFGINTRLGLLKMFPPILFFIARAGAEFQARLKQEIRGRMKKREDAAS

IQALGDLKLVKATVLEVFRLMPSIFVAFGRARQDLEVESHDARYKIKKGELLGTHQYFVMRDPVVFKDPHSFVPDRFMGS

EGAALLPHIVWSNGRETDSPTPTNKQCPGKNQAELIAVQFIAEMFLRYDSWEVTQESSVSATKLDVHLCKLVKRS*

 

>CYP74M1v2 estExt_Genewise1Plus.C_890047|Selmo1 98% to estExt_Genewise1Plus.C_400042|Selmo1

MPASGKEKPLKDVPGSYGVPVVGALKDRLDFYWFQGEVEFYKSRMAKNQSTVFRVNFPPGPPGFPEGHGIVLLDQVSYSV

LLDNAKVDKRDTLIGSYMPDLAFTGGYRTLPYLDTAEEKHTTYKSLMFEILHESAQRFGPELSSAFDRTAQEWEAKIAKD

GSVESLSTAGNMVIQFLYKTITHQDPMATMGDDPHSVYMAWTGVQFAGIAYTSLPHITEELLMHSFQLPFFPIKKKYEQI

VEFFRSAGSGLLDLAVTKYGLDREEALHNLVFSFGINTRLGLLKMFPPILFFIARAGAEFQARLKQEIRGRIKKRKDAAS

IQALGDLKLVKATVLEVFRLMPSIFVAFGRARQDLEVESHDARYKIKKGELLGTHQYFVMRDPVVFKDPHSFVPDRFMGS

EGAALLPHIVWSNGRETDSPTPTNKQCPGKNQAELIAVQFIAEMFLRYDSWEVTQESSVSATKLDVHLCKLVKRS*

 

$$$$$$

 

>9 CYP74M2v1 e_gw1.20.113.1|Selmo1 97% to e_gw1.62.73.1|Selmo1 no introns

MENEEAKISGSVKAVPGGYGLPFFGAMRDRLELYWFQGDVEFFKRRIEKYKSTVFRTNFAPGPPGYQNPRGVALLDHKSF

QVMLDNSKVDKSDTFFGTAMPSVAFTGGYRALPYLDTTEEKHTLYKRMLIELLHVKFSSMVTEYSKAFAETSATWDLAVA

KSGKAEVGDSSGRMVVNFLLKSITGHQDPASIIGSDPHSTFQTWSFVQFAGTVVGVLPHFVEELTYHSFSLPSMLVKSKY

AALCKFFRNYATEALDLAESKYGLDREEAVHQLVFCFGVNARVGLMKKIPVMVYYIAKMGPEFQARLADEVRSAISEQGG

GGFTVKALSGMPLLKSTVLEAFRLMPSTFFVYGRAREDIVVESHDALYKVGKGELLGAHWYYVLRDPKVFEDPQRFNPER

FMGKQGEALFPQLVWSNGRQDQTPGENDKQCPAKDYAVMLTSQFVAEMFLKYDAFEITEDSTIDTTSLKVAFKSLKSRAQ

ISS*

 

>CYP74M2v2 e_gw1.62.73.1|Selmo1 38% to 74A4 in CYP74 clan

MENEEAKISGSVKAVPGGYGLPFFGAMRDRLELYWFQGDVEFFKRRIEKYKSTVFRTNFAPGPPGYQNPRGVALLDHKSF

QVMLDNSKVDKSDTFFGTAMPSVAFTGGYRALPYLDTTEEKHTLYKRLLIELLHMKFSSMVTEYSKAFAETSATWELAVA

KSGKAEVGDSSGSMVVNVLLKSITGHQDPASIIGSDPHSTFQTWSFVQFAGTVVGVLPHFVEELTYHSFSLPSMLVKSKY

AALCKFFRNYATEALDLAESKYGLDREEAVHQLVFCFGVNARVGLMKKIPVMVYYIAKMGPEFQARLANEVRSAISEQGG

GGFNVKALSGMPLLKSTVLEAFRLMPSTFFVYARAREDIVVESHDALYKVGKGELLGAHWYYVLRDPKVFEDPQRFNPER

FMGKQGEALFPQLVWSNGRQDQTPGENDKQCPAKDYAVMLTSQFVAEMFLKYDAFEITDDSTIDTTSLKVAFKSLKKRTQ

ISS*

 

$$$$$$

 

>10 CYP74M3v1 e_gw1.4.256.1|Selmo1 57% to e_gw1.62.73.1|Selmo1 in CYP74 clan

56% to estExt_Genewise1Plus.C_400042

57% e_gw1.20.113.1|Selmo1 no introns

MSKPAAAAPSDPSKPSKPLKEVPGSYGLPVLGAVKDRLDFYWFQGDTEFFRIRMEQHKSTVFRVNYSPGPPGYPDSRGII

LLDQKSFSVLLDNSKVDKSDTLLGPYIPNLAFTGGYRVLPYLDTSEAKHTAYKDLIFELLHVNSSRIIPEYNKVFAETAG

SWEERIAKSGKAEVFASSDSMITKFLLRTIVHKDPAEPGPASLGPKFRDTYQLWTGVNFAGIAHTPLPHFLEELLFHTFR

LPPFLVKKQYKALANFYRTHATEVLDLAEKKYGLDREETVHQLILILGINARLGLHKMIPALIYYLGLLGEDFQAKIAAE

VRSAVHKNRAQGEEGVNITTQALLEMPLLRSTVLETLRLTPSIFYIYGRAREDMVIESHDAAFQIKKGELLGGHQYFVMR

DPEVFEEPHKFVADRFLGERGKAVLPYLVWSNGRETESPSSSNKQCPAKDVAELITMQFVAEMFLRYDSFEITKDSFINT

TELNVHLKSLKKRSV*

 

>CYP74M3v2 e_gw1.9.482.1|Selmo1 98% to e_gw1.4.256.1|Selmo1

MSKPAAAAPSDPSKPSKPLKEVPGSYGLPVLGAVKDRLDFYWFQGDTEFFRIRMEQHKSTVFRVNYSPGPPGYPDSRGII

LLDQKSFSVLLDNSKVDKSDTLLGPYIPNLAFTGGYRVLPYLDTSEAKHTAYKDLIFELLHVNSSRIIPEYNKVFAETAG

SWEERIAKSGKAEVFASSDAMITRFLLRTIVHKDPAEPGPASLGPKFRDTYQLWTGVNFAGIAHTPLPHFLEELLFHTFR

LPPFLVKKQYKALANFYRTHATEALDLAEKKYGLDREETVHQLILILGINARLGLHKMIPALIYYLGLLGEDFQAKIAAE

VRSAVHKNRAQGEEGVNITTQALLEMPLLRSTVLETLRLTPSIFYMYGRAREDMVIESHDAAFQIKKGELLGGHQYFVMR

DPEVFEEPHKFVADRFLGERGKAVLPYLVWSNGRETESPASSNKQCPAKDVAELITMQFVAEMFLRYDSFEITKDSFINT

TELNVHLKSLKKRSV*

 

$$$$$$

 

CYP85 clan sequences (76 sequence in 26 bins) [17% to the P450 sequences]

 

>CYP88E1v2     Selaginella moellendorffii

            traces 720209121, 914912278, 964564232, 915149048,

 

            914932586, 724435101, 915047783

            47% to 88A4, 46% to Ginkgo CYP88A12

            45% to 88A14, 43% to 88A1, 42% to 88A13,

            36% to 88D1, 34% to 88C1, 33% to 88B1

MNLKWAIAIATVAAATFFE

LLRNFNRFWYEPKLKPGQAPLPPGSLGWPIFGNMASFLRAFKSHNPDSFITKYLHK (2)

YDRTGVYKAFLFWQPTVLATTPETCKVVLSRDSLFETGWPSSTRRLIGTRSFAGVTGEE

HLKLRRLTEPALSNPKALEDYIPRMSSNIKSCLEEWSCQERTLLLREMRK (0)

YAFRTIHDILFSKDSGLDVEEVSSLYYEGNQGIRSLPINLPGTSYNRALK (0)

ARKKLDVLLHRVLNKRRFSEKPEKTDTLSLLMDATDENGKHLDDKQ

IVDLLVMYLNAGHDSTAHLILWLLIFLLKHEIVYDKVK

EEQELIASQKPLGDSLSLSDVKKMSYLSR (0)

VINETLRVANISPMVFRRAVTDVEVNG

FTIPKGWYVEPWLRQVHMDPAVHSNPQNFDPDRWAV (1)

IRPFTHLPFGLGSRTCPGNELAKLEACIIVHHLVLGYE (2)

VKPLNPDCEVTFLPHPRPKDYFPVQVRRRR*

 

>CYP88E1v2 gw1.161.7.1|Selmo1 one intron diff and 1 aa diff to 88E1

LRNFNRFWYEPKLKPGQAPLPPGSLGWPIFGNMASFLRAFKSHNPDSFITKYLHKYDRTGVYKAFLFWQPTVLATTPETC

KVVLSRDSLFETGWPSSTRRLIGTRSFAGVTGEEHLKLRRLTEPALSNPKALEDYIPRMSSNIKSCLEEWSCQERTLLLR

EMRKYAFRTIHDILFSKDSGLDVEEVSSLYYEGNQGIRSLPINLPGTSYNRALKARKKLDVLLHRVLNKRRFSEKPEKTD

TLSLLMDATDENGKHLDDKQIVDLLVMYLNAGHDSTAHLILWLLIFLLKHEIVYDKVKEEQELIASQKPLGDSLSLSDVK

KMSYLSRVINETLRVANISPMVFRRAVTDVEVNGFTIPKGWYVEPWLRQVHMDPAVHSNPQNFDPDRWARNEVRPFTHLP

FGLGSRTCPGNELAKLEACIIVHHLVLGYDVKPLNPDCEVTFLPHPRPKDYFPVQVRR

 

>CYP88E1v2 e_gw1.161.7.1|Selmo1 46% to CYP88A4, 98% to e_gw1.28.126.1|Selmo1

MNLKWAIAIATVAAATFFELLRNFNRFWYEPKLKPGQAPLPPGSLGWPIFGNMASFLRAFKSHNPDSFITKYLHKYDRTG

VYKAFLFWQPTVLATTPETCKVVLSRDSLFETGWPSSTRRLIGTRSFAGVTGEEHLKLRRLTEPALSNPKALEDYIPRMS

SNIKSCLEEWSCQERTLLLREMRKYAFRTIHDILFSKDSGLDVEEVSSLYYEGNQGIRSLPINLPGTSYNRALKARKKLD

VLLHRVLNKRRFSEKPEKTDTLSLLMDATDENGKHLDDKQIVDLLVMYLNAGHDSTAHLILWLLIFLLKHEIVYDKVKEE

QELIASQKPLGDSLSLSDVKKMSYLSRVINETLRVANISPMVFRRAVTDVEVNGFTIPKGWYVEPWLRQVHMDPAVHSNP

QNFDPDRWARNEVRPFTHLPFGLGSRTCPGNELAKLEACIIVHHLVLGYDVKPLNPDCEVTFLPHPRPKDYFPVQVRRRR

*

 

>19 CYP88E1v1 e_gw1.28.126.1|Selmo1 96% to 88E1

MNLKWAIAIATVAAATFFELLRNFNRFWYEPKLKPGQAPLPPGSLGWPIFGNMASFLRAFKSHNPDSFITNYLHKYDRTG

VYKAFLFWQPTVLATTPETCKVVLSRDSLFETGWPSSTRRLIGTRSFAGVTGEEHLKLRRLTEPALSNPKALEDYIPRMS

SNIKSCLEEWSCQERTLLLKEMRKYAFRTIHDILFSKDSGLDVEEVSSIYYEVNQGIRSLPINLPGTSYNRALKARKKLD

VLLHRVLNKRRFSEKPEKTDTLSLLMDATDENGKHLDDKQIVDLLVMYLNAGHDSTAHLILWLLIFLLKHEIVYDKVKEE

QELIASQRPVGESLSLSDVKKMSYLSRVINETLRVANISPMVFRRAVTDVEVNGFTIPKGWYVEPWLRQVHMDPAVHSNP

QNFDPDRWARNEVRPFTHLPFGLGSRTCPGNELAKLEACIIVHHLVLGYDMKPLNPDCEVTFLPHPRPKDYFPVQVRRRR*

 

$$$$$$

N-term of CYP88 like gene aa 96-160 70% to e_gw1.88.172.1|Selmo1

VLASTPEACKFVLSKDSFETGWPERTIGVMGRYSFAGYLKLQKLTESAMNSPKALQQYM

PLMNTHHLKSTRKRILPNALQNLCILQIADSPHIHNQAL*

 

>33 CYP88E2v2 e_gw1.88.172.1|Selmo1 61% to CYP88E1

MILGVAVVAVTALLTFSSFFNKWYYEPVLKPGQPPLPPGSLGWPVFGNMAAFLRAFKSGRPDTFMAHYVAKYNRVGFYKA

FLFWQPT VLAATPEACKFVLSKDSFETGWPESAVELMGRNSFAGLTGESHFKLRKLTEPAVNSPKALEQYV PLIVNNIKA

CLARWSAQDKIVLLTEMRRFTFLTVLHILYGKDSSLDVDETFSLYYIVNQGIRALPINFPGTAYNKALKARRKLIKLIQD

VINQRRASGKPQETNILSLLMDQLDDKGEALEDAQIIDVLNMYMNAGHDSTAHVIMWLMIFLKRNPDVLEKVKTEQDGIA

KCISEGEMLNLSDIKRMRYLSSV VDETLRLANISPMVFRRALVDVEFNGFTIPKGWHAEAWLRQVHMDPHVHPDPEKFDP

ERWEKYGASPFTFMPFGMGNRTCPGNELAKLQIFIVVHYFVTGYR WTALNPNSKVSYLPHPRPRDFYSVRVSKLL*

 

>24 CYP88E2v1 fgenesh2_pg.C_scaffold_42000205|Selmo1 61% to 88E1 Selaginella

MEVA

MILGVAVVAVTALLTFSSFFNKWYYEPVLKPGQPPLPPGSLGWPVFGNMAAFLRAFKSGRPDTFMAHYVAKYNRVG

FYKAFLFWQPTVLAATPEACKFVLSKDSFETGWPESAVELMGRNSFAGLTGESHFKLRKLTEPAVNSPKALEQYVPLIV

NNIKACLARWSAQDKIVLLTEMRR

FTFLTVLHILYGKDSSLDVDETFSLYYIVNQGIRALPINFPGTAYNKALK

ARRKLIKLIQDVINQRRASGKPQETNILSLLMDQLDDKGEALEDAQIIDVLNMYMNAGH DSTAHVIMWLMIFLKQNPDVLEKVK

TEQDGIAKCISEGEMLNLSDIKRMRYLSS

VVDETLRLANISPMVFRRALVDVEFN

GFTIPKGWHAEAWLRQVHMDPHVHPDPEKFDPERWEKYGASPFTFIPFGMGNRTCP

GNELAKLQIFIVVHYFVTGYR*

 

$$$$

 

>34 CYP716N1 estExt_fgenesh2_pg.C_480139|Selmo1 32% to CYP728, 34% to 716A2 in CYP85 clan

MSQALFFVLLFVISVIWFTFTNRNRKRKHASLPPGNMGLPFIGETLPFLRSLVSNQPWEFFRVREAKYGKVYKTRLFGMP

VVVVSPPVGTRFMFADTNHTLITKSWPVPVIKLFPESAFVRPDASGSRQLITSFLGPECMKRYVTSTSVIVQKHLDSWPT

GELVRVYPLIKRCLFSIVCNMYLGLTDEKEVMELMEPFEKVIHGIISIPVNLPGTAFHRAKLGQKEICNILEKHIAKRRI

NSQLSPARDQDLLSMLLSTRSKEGTAMTDNEITHNILGLLVSGHELSASSISMTIKSLVENQTVYKEMKRVHCEIGSFKR

PREPLEPLDLKQMKYSWRVVQESLRLRPTAPAVARKTLTDVELEGYTIPKGWQMFSAVYNSHTTPEFFPDPLKFDPSRFE

RAGPNPYTYFPFGGGPRICGGIEQVKMHSLVILHHITTRFDWTLMEPDEPIKISPVAVPAHGLPLELRLV*

 

$$$$$$

 

>fgenesh2_pg.C_scaffold_3000006|Selmo1 87% to e_gw1.88.172.1|Selmo1

pseudogene

MGGGNKWHSCVGDIKSHAGFGWMCLLPSLQALRVAQVYW

YNRVGFYKAFLFWQPTVLAATPEVCKFVLSKDSFETGWPES

AVALMGRNLFAGLTGGSHMKLRKFTKHAVNNPKALKQYVPLIV

NNINALQVDLHSCRLNTRRAWVALSLMVSVHLLSSDFQVI

WHAEGQVHMDPNVHPDPEKFDLECCEKYGTSP

SRSYPLGLKIGLVLVTSLPNFNSNLQCHPLLHYWLQSTYEKLKLL

EFYKQCVRIVQGMRNSFVALLDYSTMLTRLE*

 

>fgenesh2_pg.C_scaffold_12000196|Selmo1

96% to fgenesh2_pg.C_scaffold_177000009|Selmo1

84% to fgenesh2_pg.C_scaffold_1000082|Selmo1

83% to fgenesh2_pg.C_scaffold_260000002|Selmo1

75% to e_gw1.88.172.1|Selmo1

MLNLLDIRRMCYLSSVVNETVRLAKISPMVFRSALLNLEFNDKYIWIHPDPEKFNPSGRSLEDMHSFYDHGPNVENSSII

KKSCNLAFNLSHFWHKTISNAMHQELAGNYDLQNFQEDNLKIGNVLES*

 

>fgenesh2_pg.C_scaffold_177000009|Selmo1

MINLLDIRRMRYLSSVVNETLRLAKISPMVFRRALLDLEFNKIWSISIHVHTLWDGKSNLQTCQASNLHCSPLLRYYRMK

LKDKKILKGRLAKSLEDMHSFYDHGPNVENSSIIKKSCSLAFNLSHFWHKTISNAMHQELAGNYDLQNFQEGRRFTLITA

SNYQDPMFLLFLHLSKSNADNFKIGNVLKS*

 

>fgenesh2_pg.C_scaffold_159000012|Selmo1

95% to fgenesh2_pg.C_scaffold_177000009|Selmo1

MLNLLYIRRVPYLSSVVNETLRLAKMSPMVFRRALLDLEFNRGLPWIQQQSFLLNRMKLKDEKILKGRLAKSLEDMHSFY

DHGPNVENSSIIKKSCSLAFNLSHFWHKTISNAMHQELAGNYDLQNFQEGMRFTVITASNYQEVVQAQCSSLEGFPGLKG

NAMLLVVGIRV*

 

>fgenesh2_pg.C_scaffold_1000082|Selmo1

MLNLLYIRRMRYLSSVVNETLRLAKISPMVFRRALLDLEFNDKYIWIHPDPEKFNPAGRNMEHLHSRSYPLGWEIKLTNL

PSFKSSLSSITSFLQVDCLGSQQQSFLLNRMKLKDKKILKGRLAKSLEDMHSFYDHGPNVENSSIIKKI*

 

>fgenesh2_pg.C_scaffold_260000002|Selmo1

MLNLLYIRRMRYLSSVVNETLRLAKISPMVFRRALLGLEFNDKYLWIHPDPEKFNPAGRNMEHLHSRSYPLGWEIKLTNL

PSFKSLLSSITSLLQVDCLGSQQQSFLLNRMKLKDEKILKGRLAKSLEDMHSFYDHGPNVENSSIIKKI*

 

$$$$$$

 

>13 CYP88F1v1 e_gw1.52.57.1|Selmo1 41% to 88A4 in the CYP85 clan

98% to e_gw1.7.590.1|Selmo1

MDLWLPSIAVALIIVLISCILNFNSWFYAPKLRPGSPPLPPGSLGWPVFGNMGDFLQAFKSSNPESFVGGFISKYGCGGL

YKAFLFRQPTILATSAEVCKTVLCNHDVFEIGWPERVVKELLGLKVLSAVTGDDHLKLSKLVKPALSSPKAIQHQMPCIE

ENVKKLLDEWADRGNIVFLDEARMFTLKTIHEILVGEDTGIDFKQVSGLFHTMNKGLRALPLNFPGTAYSNAVKARATLA

NDFWRIFYERKESKKRGGDTLSMLLDATDEGGQPLEDDQIVDLIMSFMNGGHESTAHLVTWLAILLKEHPAVYQRLKAEQ

DEIALKKMPGESLTLADMRSMTYMSRVIDETLRLINISPFVFRKVLSDVQLNGYTIPRGWFVEAWLRQVHMDPLVHKNPR

EFDPDRWINEKPQPHTYVAFGLGNRKCPGSNLSKIQSSIIIHHLITKYNWEPLNPHYKLVYLPHPRPADHYPVKITKRAL

V*

 

>CYP88F1v2 e_gw1.7.590.1|Selmo1

MAVALIIVLISCILNFNSWFYAPKLRPGSPPLPPGSLGWPVFGNMGDFL

QAFKSSNPESFVAGFISKYGCGGLYKAFLFR

QPTILATSAEVCKTVLCNHDVFEIGWPERVVKDLLGLKVLSAVTGDDHLKLSKLVKPALSSPKAIQHQMPCIEENVKKLL

DEWADRGNIVFLDEARMFTLKTIHEILVGEDTGIDFKQVSGLFHTMNKGLRALPLKFPGTAYSNAVKARATLANDFWRIF

YERKKSRKRGGDTLSMLLDATDEGGQPLEDDQIVDLIMSFMNAGHESTAHLVTWLAILLKEHPAVYQRLKAEQDEIALKK

LPGESLTLADIRSMTYMSRVIDETLRLINISPFVFRKVLSDVQLNGYTIPRGWFVEAWLRQVHMDPLVHKNPREFDPDRW

INEKPQPHTYVAFGLGNRKCPGSNLSKIQSSIIIHHLITKYNWEPLNPHYKLVYLPHPRPADHYPVKITKRALV*

 

>SMCYP88 CYP88F1v2 4 aa diffs to e_gw1.7.590.1|Selmo1 Jing-Ke, differs at yellow N-term

MLRSLDLDRHHCH

QAFKSSNPESFVAGFISKYGCGGLYKAFLFRQPTILATSAEVCKTVLCNHDVFEIGWPERVVKDLLGLKVLSAVTGDDHLKLSKLVKPALSSPKAIQHQMPCIEENVKKLLDEWADRGNIVFLDEARMFTLKTIHEILVGEDTGIDFKQVSGLFHTMNKGLRALPLKFPGTAYSNAVKARATLANDFWRIFYERKKSRKRGGDTLSMLLDATDEGGQPLEDDQIVDLIMSFMNGGHESTAHLVTWLAILLKEHPAVYQRLKAEQDEIALKKMPGESLTLADMRSMTYMSRVIDETLRLINISPFVFRKVLSDVQLNGYTIPRGWFVEAWLRQVHMDPLVHKNPREFDPDRWINEKPQPHTYVAFGLGNRKFPGSNLSKIQSSIIIHHLITKYNWEPLNPHYKLVYLPHPRPADHYPVKITKRALV

 

 

$$$$$$

 

>estExt_fgenesh2_pg.C_520040|Selmo1 50% to 88A4

1 aa diff from e_gw1.7.590.1|Selmo1

MSRVIDETLRLINISPFVFRRVLSDVQLNAFV

ALRDTLQLKSVPVGLPLRPGTHVIKLSTIFLEEDTKRYDLVVERMRVF

YLKRVLLPNPLEAVANSTTVVGFRGAEPHRRCRPHPPVGGRGTTERRRRVSTSSLPPTPLPGLYPPGLYDGSKTLLHSFG

VVSSSAIIPGEIRNHLKPKDLLDFVALERSSPSLLRAIVYCQSGLTNGFTRSLTKGLQGAIEATAALATNCINPKSIINH

DFLVIVLVVGGVEQFFLAEKCGPGEECGINITLVRSLGEYTNAKLLNFDCEDTPLELHELMRILENHDPQYSHHDKNCWE

YAMNTTRKLLMECHRRSGKAQFCERAEVVGGEIAVAQAQGMSS*

 

$$$$$$

 

>CYP90E1v2 Selaginella moellendorffii

          Traces 721005955 914792662 1322561598 869252186

          39% to 90A1 Arab. 34% to 763B1

MISSSTAWAWTSLAGVAGVFWLAALVYWRSWRFRKLQRLPPGSMGWPLIGELVPYVTI

VRSETPFRFTRERESK (2?)

YGPVFKTSLLTGKTVMITDVEGVKFVLHNEGVLFETGYPRSLKDVLGEH

AMLFQHGDLQKRMHAMLKRFVSSTPLKKHLTREMELLTMQGMSTWSRGQRILLQDEIQR (0)

ITHDFLMKQLFGLEPGKLSTTILKEFHTLMAGIIGIPMMIPGTPYFKAMK

AREKLSKIIMDMVATRRAKPDIEHKDILNALIEEVKQEDGDMEKIIIDN

VLVNIANAENVPAVVIALAVKNLSETPKALEQIR (0)

EENLAIRKGKDPSEGLSWNEYMSLEFTQA (0)

VFNETLRLANGAQGVMRKALKDVEYR (1)

GYIIPKGWTVLPYFLNIHFDENMFPNSAKFHPWRWLE (0)

KNIPPSYVLPFGGGSRLCPGQELAKVQTAVFLHHLVTQFK (2)

WDAEPEKVINFPMISTRNHVPVVLYDLN*

 

>CYP90E1v2 fgenesh1_pm.C_scaffold_41000045|Selmo1 100% to 90E1 except for one boundary

MISSSTAWAWTSLAGVAGVFWLAALVYWRSWRFRKLQRLPPGSMGWPLIGELVPYVTIVRSETPFRFTRERESKYGPVFK

TSLLTGKTVMITDVEGVKFVLHNEGVLFETGYPRSLKDVLGEHAMLFQHGDLQKRMHAMLKRFVSSTPLKKHLTREMELL

TMQGMSTWSRGQRILLQDEIQRITHDFLMKQLFGLEPGKLSTTILKEFHTLMAGIIGIPMMIPGTPYFKAMKAREKLSKI

IMDMVATRRAKPDIEHKDILNALIEEVKQEDGDMEKIIIDNVLVNIANAENVPAVVIALAVKNLSETPKALEQIREENLA

IRKGKDPSEGLSWNEYMSLEFTQAVFNETLRLANGAQGVMRKALKDVEYRGYIIPKGWTVLPYFLNIHFDENMFPNSAKF

HPWRWLEKNIPPSYVLPFGGGSRLCPGQELAKVQTAVFLHHLVTQFK

WDAEPEKVINFPMISTRNHVPVVLYDLN*

 

>22 CYP90E1v1 fgenesh2_pg.C_scaffold_35000039|Selmo1 97% to 90E1

MISSSTVWAWTSLAGVAGVFWLAALVYWRSWRFRKLQRLPPGSMGWPLIGELVPYVTIVRSETPFRFTRERESKYGPVFK

TSLLTGKTVMITDVEGVKFVLHNEGVLFETGYPRSLKDVPGEHAMLFHHGDLQKRMHAMLKRFVSSTPLKKHLTREMELL

TKQGMRTWSRGQRILLQDEIQRITHDFLMKQLFGLEPGKLSTTILKEFHTLMAGIIGIPMMIPGTPYFKSMKAREKLSKI

IMDMVATRRAKPDIEHKDILNALIEE

V  K  Q  E  E &

D  V  E  K  I  I  I  D  N  V  L  V  N  I  A  N  A  E

NVPAVVIALAVKNLSETPKALEHIREENLAIRKGKDPSEGLSWNDYMSLEFTQA

VFNETLRLANGAQGVMRKALKDVEYRGYIIPKGWTVLPYFLNIHFDENMFPNSAKFHPWRWLEKNIPPSYVLPFGGGSRL

CPGQELAKVQTAVFLHHLVTQFK (2)

WDAEPEKVINFPMISTRNHVPVVLYDLN*

 

>CYP90E2v1 estExt_Genewise1.C_330361|Selmo1 89% to CYP90E1

LPGELVPYVTIARSETPFRFTRERERK ()

Y  G  P  V  F  K  T  S  L  L  T  G  K  T  I

MITDVEGVKFVLHNEGVLFETGYPQSLKDVLGERAMLFHHGDLQKRMHAMLKRFVSSTPLKKYLTREMELLTKQGMSTWS

RGQRILLQDEIQRITHDFLMKQLFGLEPGKLSTTILEEFNTLMAGIIGVPMMIPGTPYFKAMKAREKLSQIIMDMVAARR

ARPDIEHKDILNALIEEVKEEDGDVEK

IIIDNVLVNIANAEGIPAIVIAFAVKNLSETPKALEHIREENLAIKRGKDSNE

GLSWNDYMSLEFTQAVFNETLRLANGAQGVMRKALKDVEYRGYIIPKGWTVLPYFLNIHFDENMFPNPTKFHPWRWLEKN

IPSTYVLPFGGGSRLCPGQELARVQTAVFLHHFVTQFKWDAEPETVINFPKISTRNHVPVVLYDLH*

 

>21 CYP90E2v2 fgenesh1_pm.C_scaffold_129000008|Selmo1 88% to CYP90E1

nearly identical to estExt_Genewise1.C_330361|Selmo1

M  I  P  S  S  T  A  W  A  W  T  S  L  A  G  A  A  G  V  F  W  L  A

A  I  V  Y  W  R  S  W  R  F  R  K  L  Q  R  L  P  P  G  S

MGWPLIGELVPYVTIARSETPFRFTRERESKYGPVFKTSLVTGKTIMITDVEGVKFVLHNEGVLFETGYPQSLKDVLGER

AMLFHHGDLQKRMHAMLKRFVSSTPLKKYLTREMELLTKQGMSTWSRGQRILLQDEIQRITHDFLMKQLFGLEPGKLSTT

ILEEFNTLMAGIIGVPMMIPGTPYFKAMRAREKLSQIIMDMVAARRARPDIEHKDILNALIEE

V  K  E  E  D  G  D  V  E  K

IIIDNVLVNIANAEGIP

AIVIALAVKNLSETPKALEHIREENLAIKRGKDSNEGLSWNEYMSLEFTQAVFNETLRLANGAQGVMRKALKDVEYRGYI

IPKGWTVLPYFLNIHFDENMFPNPTKFHPWRWLEKNIPSTYVLPFGGGSRLCPGQELAKVQTAVFLHHLVTQFKWDAEPE

TVINFPKISTRNHTPVVLYDLH*

 

>CYP90E3v2 e_gw1.78.162.1|Selmo1 82% to CYP90E1

MVWTSIAGIAGALWLVALVYWRSWRFRKLERLPPGSMGWPLIGELIPYVTIARSEAPYIFPMEREKKYGTVFKTSLLTGK

TIMITDVEGVKFVLHNEGVLFESGYPRSLKDVLGEHAMLFQHGELHKRMHAMLKRFVSSTPLKKHLTREMELLTKQGMST

WSRGTKILLQDEIQRITHDFLMKQLFGLEPGKLSATIFEEFNRLMGGIIGIPLMIPGTPYHRAMKARKKLTKIISGMVAF

RRSRPDIEHKDILNALIEEIKQEERDADQIIVDNALINIANAEGIPAVIIAFAVKNLSENPKALEQIREENLAIRKGKDP

SEGLTWNEYMSLDFTHAVFNETLRLANGAQGVMRKALKDVEFRGYVIPKGWTVLPYFLNIHFDEKMFPQPTKFHPWRWLE

KSIPSSYVLPFGGGARLCPGQELAKVQTAVFLHHFVTQFRWEAEPEKVINFPKISTKNHLPVVLHDL*

 

>32 CYP90E3v1 estExt_Genewise1.C_680079|Selmo1 75% to 90E1

MVDSRIMVWTSIAGIAGALWLVALVYWRSWRFRKLERLPPGSMGWPLIGELIPYVTIARSEAPYIFPMEREKKYGTVFKT

SLLTGKTIMITDVEGVKFVLHNEGVLFESGYPRSLKDVLGEHAMLFQHGELHKRMHAMLKRFVSSTPLKKHLTREMELLT

KQGMSTWSRGTKILLQDEIQRITHDFLMKQLFGLEPGKLSATIFEEFNRLMGGIIGIPLMIPGTPYHRAMKARKKLTKII

SGMVAFRRSRPDIEHKDILNALIEEIKQEERDADQIIVDNALINIANAEGIPAVIIAFAVKNLSENPKALEQIREENLAI

RKGKDPSEGLTWNEYMSLDFTHAVFNETLRLANGAQGVMRKALKDVEFRGYVIPKGWTVLPYFLNIHFDEKMFPQPTKFH

PWRWLEVLSTTSHSCNFATWLQQRSIPSSYVLPFGGGARLCPGQELAKVQTAVFLHHFVTQFRWEAEPEKVINFPKISTK

NHLPVVLHDL*

 

>SMCYP90 CYP90E3v1 same as estExt_Genewise1.C_680079|Selmo1 after intron removal

Jing-Ke removed possible small intron, checkd against other CYP90s to verify = OK

MVDSRI

MVWTSIAGIAGALWLVALVYWRSWRFRKLERLPPGSMGWPLIGELIPYVTIARSEAPYIFPMEREKKYGTVFKTSLLTGKTIMITDVEGVKFVLHNEGVLFESGYPRSLKDVLGEHAMLFQHGELHKRMHAMLKRFVSSTPLKKHLTREMELLTKQGMSTWSRGTKILLQDEIQRITHDFLMKQLFGLEPGKLSATIFEEFNRLMGGIIGIPLMIPGTPYHRAMKARKKLTKIISGMVAFRRSRPDIEHKDILNALIEEIKQEERDADQIIVDNALINIANAEGIPAVIIAFAVKNLSENPKALEQIREENLAIRKGKDPSEGLTWNEYMSLDFTHAVFNETLRLANGAQGVMRKALKDVEFRGYVIPKGWTVLPYFLNIHFDEKMFPQPTKFHPWRWLE (0)

RSIPSSYVLPFGGGARLCPGQELAKVQTAVFLHHFVTQFRWEAEPEKVINFPKISTKNHLPVVLHDL

 

$$$$$$

 

>15 CYP90F1v1 e_gw1.10.148.1|Selmo1 42% to CYP90A1, 36% to 90E1

MNLPPGRMGWPLVGETLEYLATRPIGVPQPFIAKRVARYGSIFKTHLFGCPTIVTTDPDFNRFVLANEGKLFQSSYPAGV

DRVLGKFSMVQASGELHKRMRALTVSFMQAQSLKDNFLQTIQARVISLLSTWEGRVVKIQDEAQSLSFDCIVGHVLGMDP

GAENTKTIKEDFFNLVYGLTIPLRIPGTRYWTAMKGRQNIVRLVEQMVAERTTKPCTARKDFLQQLLQDDNGKNLTLEQI

SDFIVFMLFAAHDTTATAMTMAIKYLLANPQALNQLQEEHLEIRRNKRSPDEPLEWNDYLQMTFTQHVINETLRLTNVLT

SAHRIALQDVQTEEGYVIPKGWKVVSSWTTIHLNPKLYAEPLEFNPWRWKTQSVKYFTPFSGGPRFCTGSELARLEIALL

LHFIITKYSLHPAEDDEAVYFGTVKMRKGLPVTVTKLSQIL*

 

>CYP90F1v2 e_gw1.29.84.1|Selmo1 99% to e_gw1.10.148.1|Selmo1

MNLPPGRMGWPLVGETLEYLATRPIGVPQPFIAKRVARYGSIFKTHLFGCPTIVTTDPDFNRFVLANEGKLFQSSYPAGV

DRVLGKFSMVQASGELHKRMRALTVSFMQAQSLKDNFLQTIQARVISLLSTWEGRVVKIQDEAQSLSFDCIVGHVLGMDP

GAENTKTIKEDFFNLVYGLTIPLRIPGTRYWTAMKGRQNIVRLVEQMVAERTTKPCTARKDFLQQLLQDDNGKNLTLEQI

SDFIVFMLFAAHDTTATAMTMAIKYLLANPQALNQLQEEHLEIRRNKRSPDEPLEWNDYLQMTFTQHVINETLRLTNVLT

SAHRIALQDVQTEEGYVIPKGWKVVSSWTTIHLNPKLYAEPLEFNPWRWKTQSVKYFTPFSGGPRFCTGSELARLEIALL

LHFILTKYSLHPAEDDEAVYFGTVKMRKGLPVTVTKLSQIL*

 

$$$$$$

 

>CYP707A20v1   Selaginella moellendorffii (lycopod, Gemmiferous spike moss)

 

            trace files 880087960, 883600473, 1415633291

            915148778, 915028484, 914857652

            55% to 707A4

MADLALLVLGSAMLLLLALLKLARRSYALGRLPLPPGTMGWPYLGETLQLYSQNPNAFFSSKQKR

YGDIFKTHILGCPSVMIASSPEAAKFILVSHAHLFKTTFPSSKEGIIGPHALFFHEGEYHRRLR

RLVQGCFGPDVIRDLVPELETISIQALDSLDRAGGIINTFQEMKK (0)

YAFDVGVLKIFGGSLDGLDKEDLKRA

YQTLERGYNSFPIDIAGTPYNAAMK (0)

ARKRLSSIVSRIILDRRRQQKQADNGRCKDFLSTLMESQDDSCKNLTDDQIAD

NVIGVIFAAQDTTASVLTWLLKYLKENPALLDSVT ()

EHENIRRSKPEGAKGLTWADTKNMPLTSR ()

ETMRLATILSFTFREAVQDVEYN ()

GYVIPKGWKVMPLFRNIHHSPEFFLEPQKFD

PSRFEEHPKPNTFMPFGNGIHSCPGRELAKLEMLVLVHNITTQFR (2)

WEFAGPTEGVQYGPFPVPKAGLPISITRKSES*

 

>14 CYP707A20v1 e_gw1.10.347.1|Selmo1 98% to CYP707A20

MLLLLALLKLARRSYALGRLPLPPGTMGWPYLGETLQLYSQNPNAFFSSKQKRYGDIFKTHILGCPSVMIASPEAAKFIL

VSHAHLFKTTFPSSKEGIIGPHALFFHEGEYHRRLRRLVQGCFGPDVIRDLVPELETISIQALDSLDRAGGIINTFQEMK

KYAFDVGVLKIFGGSLDGLDKEDLKRAYQTLERGYNSFPIDIAGTPYNAAMKARKRLSSIVSRIILDRRRQQKQADNGRC

KDFLSTLMESQDDSCKNLTDDQIADNVIGVIFAAQDTTASVLTWLLKYLKENPALLESVTAEHENIRRSKPEGAKGLTWA

DTKNMPLTSRVIQETMRLATILSFTFREAVQDVEYNGYVIPKGWKVMPLFRNIHHSPEFFLEPQKFNPSRFEEHPKPNTF

MPFGNGIHSCPGRELAKLEMLVLVHNITTQFRWEFAGPTEGVQYGPFPVPKAGLPISITRKSES*

 

>CYP707A20v2 e_gw1.29.314.1|Selmo1 98% to CYP707A20

MLLLLALLKLARRSYALGRLPLPPGTMGWPYLGETLQLYSQNPNAFFSSKQKRYGDIFKTHILGCPSVMIASPEAAKFIL

VSHAHLFKTTFPSSKEGIIGPHALFFHEGEYHRRLRRLVQGCFGPDVIRDLVPELETISIQALDSLDRAGGIINTFQEMK

KYAFDVGVLKIFGGSLDELDKEDLKRAYQTLERGYNSFPIDIAGTPYNAAMKARKRLSSIVSRIILDRRRQQKQADNGRC

KDFLSTLMESQDDSCKNLTDDQIADNVIGVIFAAQDTTASVLTWLLKYLKENPALLDSVTAEHENIRRSKPEGAKGLTWA

DTKNMPLTSRVIQETMRLATILSFTFREAVQDVEYNGYVIPKGWKVMPLFRNIHHSPEFFLEPQKFDPSRFEEHPKPNTF

MPFGNGIHSCPGRELAKLEMLVLVHNITTQFRWEFAGPTEGVQYGPFPVPKAGLPISITRKSES*

 

$$$$$$

 

>17 CYP707A43v2 e_gw1.19.692.1|Selmo1 96% to e_gw1.18.604.1|Selmo1 69% to CYP707A20

MVFFLVAAAALYALALTLLLPWIYQRVSLRRINLPPGSLGWPFLGETLRLYTQSPNVFFASRHKRYGEIFKTHILGCPSV

MIASPEAAKFILVTHAHLFKTTFPSSKEGIIGPHALFFHDGDYHRRLKRLMQSCFSPEAIRGLVPHIEAVSLAALDLWES

SQHPIDTFHEMKKYAFDVGVHQIFGGQERGLDRGDLKRAYQALERGYNSFPIDIAGTPYNTAMKARKHLSTVVSQIIKDR

RHRQEEARGHDGDLHYTDLLTRLMDSKDAMSDEQIGDNVIGVIFAAQDTTASVLTWLLKYLKENPVLLDAVTVSNSQTPL

FCSTFFLSWSDTRNMPLTSRAIQETLRLATILSFTFREAVEDVQYKDYIIPKGWKVMPLFRMLHHSPDFFPDPFKFDPSR

FEEPIKPNTFIPFGNGLHSCPGNELAKLEILVLVHHLTTTYRWDFAGATEGVEYRPFPVPKAGLPITITRK*

 

>CYP707A43v1 e_gw1.18.604.1|Selmo1 70% to CYP707A20

MVFFLVAAAALYALALTLLLPWIYQRVSLRRINLPPGSLGWPFLGETLRLYTQSPNVFFASRHKRYGEIFKTHILGCPSV

MIASPEAAKFILVTHAHLFKTTFPSSKEGIIGPHALFFHDGDYHRRLKRLMQSCFSPEAIRGLVPHIEAVSLAALDLWES

SQHPIDTFHEMKKYAFDVGVHQIFGGQERGLDRGDLKRAYQALERGYNSFPIDIAGTPYNTAMKARKHLSTVVSQIIKDR

RHRQEEARGHDGDLHYTDLLTRLMDSKDGMSDEQIGDNVIGVIFAAQDTTASVLTWLLKYLKENPVLLDAVTAEQERIRR

SIIDGDRSLSWSDTRNMPLTSRAIQETLRLATILSFTFREAVEDVQYKDYIIPKGWKVMPLFRMLHHSPDFFPDPFKFDP

SRFEEPIKPNTFIPFGNGLHSCPGNELAKLEILVLVHHLTTTYRWDFAGATEGVEYRPFPVPKAGLPITITRK*

 

$$$$$$

 

>CYP707B2v2 e_gw1.44.472.1|Selmo1 39% to 707A4, CYP85 clan

MWDALSQWGILISLARAWRREKNAKLPRGNWWLPWLGESLDFFWRSPDDFYKTRFSRYGSIFLSHIFGSTTIVTSTPEEA

KFILGTRHKLFRAKYPTSIDRVLNHPFWEGDFHCRVRKIVQAPMMPEVLKSQISKFDSLATWTLNTWSHGDHVITHAETR

KFSFHVALYLVCSLEPSAESMKMLDDYECVAKGAICFPLNVPGTGFHLALKKSKVILEALDNIIARRRMERSVHNDILSS

LLNSSDENGIKLTTDQVKNVLITLLFAGHETTGVLLVWIVKYLTENPQVLHLVKEEQEIVRQSMADDKQPLTWANVRNMP

YTLKVVQETLRLANVAPFSPREILEDVEYNGILFPKGWRVQVYYRHFHLNPEYYKEPLKFDPSRFEVPPKPMVYTPFGNG

IRLCPGSELVKLEVLIFIHRLVTNYSWHAVGADKGIQYWPTPRPKGGYKIKVHSHAHSSFSQEQL*

 

>20 CYP707B2v1 e_gw1.2.299.1|Selmo1 99% to e_gw1.44.472.1|Selmo1

37% to CYP707A20

MWDALSQWGILISLARAWRREKNAKLPRGNWWLPWLGESLDFFWRSPDDFYKTRFSRYGSIFLSHIFGSTTIVTSTPEEA

KFILGTRHKLFRARYPTSIDRVLNHPFWEGDFHCRVRKIVQAPMMPEVLKSQISKFDSLATWTLNTWSHGDHVITHAETR

KFSFHVALYLVCSLEPSAESMKMLDDYECVAKGAICFPLNVPGTGFHLALKKSKVILEALDNIIARRRMERSVHNDILSS

LLNSSDENGIKLTTDQVKNVLITLLFAGHETTGVLLVWIVKYLTENPQVLHLVKEEQEIVRQSMADDKQPLAWANVRNMP

YTLKVVQETLRLANVAPFSPREILEDVEYNGILFPKGWRVQVYYRHFHLNPEYYKEPLKFDPSRFEVPPKPMVYTPFGNG

IRLCPGSELVKLEVLIFIHRLVTNYSWHAVGADKGIQYWPTPRPKGGYKIKVHSHAHSSFSQEQL*

 

$$$$$$

 

>CYP707B1v2 e_gw1.70.264.1|Selmo1 70% to e_gw1.44.472.1|Selmo1, 39% to 707A4, CYP85 clan

MVLIGVLIACALVLLTFPVFLVQWSLYIAQSGSGKIPRGRWWFIPWLGESLHFFYKSPDQFFRERYARFGEIYRTHILGS

PTIITSTPEHAKFILATKHKSFKAIYPPSIDRVLNHPSWEGAFHQRIRKIVQSSMLSETIRDSIPKFESLCRWCLEDWNE

REFVVTHDETRKFAFHVALSITCSMAPCEESMRLLDSYGILSNGAISMPINFPGTGFHLAIKVRFHFRSEILTDLTSLVK

RRKSDTATTYSDILGSLLASKDDQGTKFTDDEIRDILITFLFAGHETTAVFLVWIVKYLTEHPDILEQVRDEQDQIRSAR

EHPESPLTWSEIKNMPVSLRVVQESLRLANVAPFSPREVVEDVEHDGVLFPKGWKVQVYYRHFHLNPTYFKDPHKFDPSR

FLTPPKPGIYTPFGNGIRLCPGSEVVKLEALIFIHLLVTNYNWKIVGGDCGVQYWPTPRPKGGLHLKVWKRSD*

 

>31 CYP707B1v1 e_gw1.64.270.1|Selmo1 99% to e_gw1.70.264.1|Selmo1

MVLIGVLIACALVLLTSPVFLVQWSLYIAQSGSGKIPRGRWWFIPWLGESLHFFYKSPDQFFRERYARFGEIYRTHILGS

PTIITSTPEHAKFILATKHKSFKAIYPPSIDRVLNHPSWEGAFHQRIRKIVQSSMLSETIRDSIPKFESLCRWCLENWNE

REFVVTHDETRKFAFHVALSITCSMAPCEESMRLLDSYGILSNGAISMPINFPGTGFHLAIKVRFHFRSEILTDLTSLVK

RRKSDTATTYSDILGSLLASKDDQGTKFTDDEIRDILITFLFAGHETTAVFLVWIVKYLTEHPDILEQVRDEQDQIRSAR

EHPESPLTWSEIKNMPVSLRVVQESLRLANVAPFSPREVVEDVEHDGVLFPKGWKVQVYYRHFHLNPTYFKDPHKFDPSR

FLTPPKPGIYTPFGNGVRLCPGSEVVKLEALIFIHLLVTNYKWKIVGGDCGVQYWPTPRPKGGLHLKVWKRSD*

 

$$$$$$

 

>CYP780A4v2 e_gw1.9.357.1|Selmo1 35% to CYP707A1 probable CYP85 clan

MELLLLSWNALYVLAFLLSFWLIYRKFYTSQGSSTIKLPAGSHGWPLVGESVSLFLGSPLDFLTTRRKRFGGVFSSNLLG

SPTIVTTTVEAAKFFLSCAECGPSGLFGRLFGPESISQAVGSDHALYRRIMLGMMVPEVLKHHVEKIDNLAQEILESWGS

KKTVSVMEETVKFSYCTVIGFVCQKLLPTTPDTIDLMRDVQAIETGLLQFPIDIPFSPYHKALQARARLHTFLDGLINER

RAQVAAKGETHKDALGEFVTHKDDKVGTLSNQQVEDNLMALLFGGHHTTALALLWLIKYLHENPQAFKEVEEEQKQVLLE

KGSTKYKLTWEDTKLMPATLRAVHETLRLSNVVGLVTRKITKDISYNGYTLPKDWMVHVHMSAIHLDESIYPNATRFDPS

RFKVPAKTGTFIPFGSGQRTCPGSALAKLELCIFIHRLITKYRYFLFLHFLAIYTQTLL*

 

>7 CYP780A4v1 e_gw1.4.1247.1|Selmo1 96% to e_gw1.9.357.1|Selmo1

MELLLLSWNALYLLAFLLSFWLIYRKFYNSQGSSTIKLPAGSHGWPLVGESLSLFQGSPLDFLTTRRKRFGGVFSSNLLG

SPTIVTTTVEAAKFFLSCADCGPSGLFGRLFGPDSISQAVGSDHALYRRIMLGMMVPEVLKHHVEKIDNLAQEILESWGS

KKTVSVMEETFSYCTVIGFVCQKLLPTTPETIDLMRDVQAIETGLLQFPIDIPFSPYHKALQARARLHTFLDGLINERRA

QVAAKDETHKDALGEFVTHKDDKVGTLSNQQVEDNLMALLFGGHHTTALALLWLIKYLHENPQAFKEVEEEQRQIVLEKG

STKYKLTWEDTKMMPATLRAVHETLRLSNVVGLVTRKITKDISYNGYILPKDWMVHVHMSAIHLDESIYRNATRFDSSRF

KVPAKTGTFIPFGSGQRTCPGSALAKLELCVFIHRLITKYRYFLFLHFLAIYTQTLL*

 

$$$$$$

 

>8 CYP780B1v1 fgenesh2_pg.C_scaffold_6000297|Selmo1 40% to 707A3

MALWSLYLLLVIPAVAAFLISSKRKSGSVQTPPGNRGWPILGETIQLLRGTAEDFVFQRRKR

FGDIFSAHLFGRQSIVISTPEAVKFFLTNPGARNCCSPSNSGFLIVGKESVGHVEGATH

ARYHRAILSSMSGDPLNNHVQR

FDKIAMDLLTSWQRKGCVTVLEETLQ

LTFDVVTAFICDDPRIFQTKTGDFMHDVTVASRGLFKLPINLPFTDYHRALQ

ARKRLHYHLDRLINERRISK

ITHDDLLHKLMNDKDLNSTNQQIEDNIVGLLFAGQHTTPLTLVWMMKRLQENPEILKEV

VEEHQKILREREQPHLTWEDTRRMPVTMRVLQETLRLASGGMLVREMKHAVEYNG

YVFPKGWTLHIFHTAIHLNEDYFADPYKFDPSRFL

VPQKPGTLIGFGCGLRTCPGAELAKLEILVFFHRLVTQY

SWKPKAPNGAIRNWPLRIPEDGYVVEINRK*

 

$$$$$$

 

>27 CYP780A8v1 e_gw1.46.123.1|Selmo1 83% to e_gw1.9.357.1|Selmo1 35% to CYP707A1, CYP85 clan

MELVLQSWNALYFLVFLLSLWLISRKFYKPSTIKLPPGSHGWPLVGESLSFFRESPLDFLTTRRKRFGGVFSSNLLGSPT

IVSTTVEAAKFFLSCADCGPSGLFRRLIGPKIISEAIGSEHALYRRIVLGMMVPETLKHHVETIDNLAQEILESWGSKKT

VTVMEETLKFSYCAVIGFVCQKLLPSTPEMIDLMRDVQALVTGMLQFPIDIPFTPYRKALQARARLNTFLDGLINERRAL

LGAKGERHKDALDEFIMHKDDKVGTISNQQVEDNLIALLLGGHDTTALALLWLIKYLHENPQAFREVEEEQRRIFVKKGS

TKYKLTWEDTKQMLATLRVAVDETLRLSNIVGMVTRKITKDISYKGYTLPKDWQVQVHMSSIHLDESIYPNATKFDPSRF

KVPAKTGTFIPFSYGQRICPGSALVKLELCVFIHRLITKYRYFLFLFFLLPFVLSKILTNCNL*

 

>CYP780A8v2 e_gw1.96.66.1|Selmo1 96% to e_gw1.46.123.1|Selmo1

MELILQSWNALYFLVFLLSLWLISRKFYKPSTIKLPPGSHGWPLVGESLSFFRESPLDFLTTRRKRFGGVFSSNLLGSPT

IVATTVEAAKFFLSCADCGPSGLFRRLIGPKIISETIGSEHALYRRIVLGMMVPETLKHHVETIDNLAQEILESWGSKKT

VTVMEETLKFSYCAVIGFVCQKLLPSTPEMIDLMRDVQALVTGMLQFPIDIPFTPYRKALQARARLHTFLDGLINERRAL

LGAKGERHKDALDEFIMHKDDKVGILSNQQVEDNLTALLLGGHDTTALALLWLIKYLHENPQAFREVEEEQRRIFVKKGS

RKYKLTWEDTKQMLATLRVAVDETLRLSNIVGMVTRKITKDISYNGYTLPKDWQVQVHMSAIHLDESIYPNATKFDPSRF

EVPAKTGTFIPFSYGQRICPGSALVKLELCVFIHRLITKYRYFLFLLFFCCPLSFKNSNKL*

 

$$$$$$

 

>37 CYP780A10 e_gw1.150.42.1|Selmo1 81% to e_gw1.46.123.1|Selmo1, CYP85 clan

MELFLQSWNALYFLVFLLSLWLISQKFYKSSTIKLPPGSHGLPLVGESLSLFWGSPLDFLSTRRKRFGGVFWSNLLGSPT

IVATTVGSAKFFLSCADCGPSGLFARLIGPKSASEVIGSEHALYRRIILGMMVPETLKCHVQMIDILAQETLESWGSKKT

VSVMEETVKFSYCTVIGLVCQKLLPSTPEMIDLMRDVQTIENGVLQFPINLPFSPYRKALQQARARLHRFLDGLINERRA

ELAANGETDKDALDEFITHKDDKVGFLSNQQVEDNLMTMLFGGHHTTALALMWLIKHLNENPQAFKEVEEEQRRILLGKR

STKYSLTWEDTRQMPATLRVAVHESLRLSNVVGVVTRKITKDISYKGYTLPKDWMIHVYMPPIHLDDSIYPNAAKFNPSR

FEVPAKTGTFIPFGYGDRICPGRALSQLEQMIFIHRLITKYRWEPVNPNSTTSYWPMPSVKDGYLVHAMSI*

 

>9 CYP780A5v1 fgenesh2_pg.C_scaffold_6000055|Selmo1 93% to e_gw1.150.42.1|Selmo1 with indel

MKLFLQSWNALYFLVFLLSLWLISRKFYKSSTIKLPPGSHGLPLVGESLSLFWGSPLDFLSTRRKRFFCDFHFDLALTNC

GGVFWSNLLGSPTIVATTVESAKFFLSCADCGPSGLFARLLGPKSVNEVIGSEHALYRRIILGMMVPETLKCHVQMIDIL

AQETLESWGSKKTVSVMEETVKFSYCTVIGLVCQKLLPSTPEMIDLMRDIQTIENGVLQFPIDLPFSPYRKALQARARLH

RFLDGLINERRAELAANGETHKDALDEFITHKDDKVGFLSNQQVEDNLMTMLFGGHHTTALALVWLIKHLNENPQAFKEV

EEEQRRILLGKRSTKYSLTWDDTKQMPATLRAVHESLRLSNVAGVVTRKITKDISYKGYTLPKDWMIHVYMPPIHLDDSI

YPNAAKFNPSRFEVPAKTGTFIPFGYGDRICPGRALSQLEQMIFMHRLITKYRWEPVNPNSKTNYWPTPSVKDGYLVHAM

SIYVQQIGHAFVLLHSRTRSIPGAHRLQKLTAPLHEPGMATSIVTLSARSSIIPPKRWKTSPGVTISCQ*

 

>36 CYP780A9 fgenesh2_pg.C_scaffold_150000002|Selmo1 29% to 707A2 some gaps in seq

90% to e_gw1.150.42.1|Selmo1

MELFLQSWIALYFLVFLLSLWLISRKFYKSSTIKLPPGSHGLPLVGESLSLFWRSPLDFLSTRRKRFGGVFWSNLLGSPT

IVATTVESAKFFLSCADCGPSGLFARLIGPKSLSEVIGSEHALYRRILLGMMVPETLKCHVQMIDTLAQETLESWGSKKT

VSVMEETVKFSYCTVIGLVCQKLLPSTPAMIDLMRDVQTIENGVLQFPIDLPFSPYRKALQARARLHRFLDGLINERRTE

LAANGETDKDALDEFIMHKDDKEEQRRILLGKSSTKYSLTWEDTRQMPATLRAVHESLRLSNVVGVVTRKITKDISYKGY

TLPKDWMIHVYMPPIHLDDSIYPNAAKFNPSRFEVPAKTGTFIPFGYGDRICPGRALSQLEQMIFIHRLITKYRWEPVNP

NSKTSYWPMPSVKDGYLVHAMSI*

 

>11 CYP780A6P fgenesh2_pg.C_scaffold_6000095|Selmo1 38% to 707A3

these are two pieces of a pseudogene

93% to e_gw1.150.42.1

89% to fgenesh2_pg.C_scaffold_6000055|Selmo1

first part on (-) strand) runs into seq. gap

MELFLQSWNALYFLVFLLSLWLISQKFYKSSTIKLPPGSHGLPLVGESLSLFWGSPLDFLSTRRKRFF

GGVFWSNLLGSPTIVATTVES

AKFFLSCADCGPSGLFARLIGPKSASEVIGSEHALYRRIILGMMVPETLKCHVQMIDILA QETLESWxxxxxxxxxxxxx

 

Second part on (+) strand missing C-term exon

KFSYCTVIGLVCQKLLPSTPEMIDLMRDVQTIENGVLQFPIDLPFSPYRKALQ

ARLHRFLDGLINER

RAELAANVHTHKDALDEFITHKDDKVGFLSNQQVEDNLMKMLFGGHHTTALALMWLIKHLNENPQAFKEVE

EEQRRILLGKSSTKYSLTWEDTRQMPATLR

AVYESLRLSNVVGVVTRKITKDISYK

GYALPKDWMIHVYMPPIHLDDSIYPNAAKFNPSRFEV

 

>12 CYP780A7 fgenesh2_pg.C_scaffold_6000096|Selmo1 36% to 707A6

94% to fgenesh2_pg.C_scaffold_6000055|Selmo1

MELFLQSWNALYFLVFLLSLWLISQKFYKSSTIKLPPGSHGLPLVGESLSLFWGSPLDFLSTRRKRFGGVFWSNLLGSPT

IVATTVESAKFFLSCADCGPSGLFARLIGPKSASEVIGSEHALYRRIILGMMVPETLKCH

V  Q  M  I  D  I  L  A  Q  E  T  LESW

(seq gap)

N  G  E  T  D  K  D  A  L  D  E F  I  T  H  K  D  D  K

VGFLSNQQVEDNLMTMLFGG

HHTTALALMWLIKHLNENPQAFKEVEEEQRRILLGKRTKYSLTWEDTRQMPATLRAVHESLRLSNVVGVVTRKITKDISY

KGYTLPKDWMIHVYMPPIHLDDSIYPNAAKFNPSRFEVPAKTGTFIPFGYGDRICPGRALSQLEQMIFIHRLITKYRWEP

VNLNSTTSYWPMPSVKDGYLVHAMSIYVQQIGHAFVVLHSRTRSIPGAHRLQKLTAPLHEPGMARSIVTLSARRPSSIIP

PKRWKTCPGVTISCQ*

 

$$$$$$

 

>4 CYP780A1v1 estExt_Genewise1Plus.C_11081|Selmo1 33% to CYP707A2, CYP85 clan

MELFLQSWNALYFL

MFLLSLWLISQKFYKSSTIKLPPGSHGLPLVGESLSLFWGSPLGFLSTRCKRFGGVFWSNLLGSPT

IVATTVESAKFFLSCADCGPSGLFARLLGPETINEVIGSQHALYRRIFLGLMVPEALKCHVQMIDILAQDTLESWGSKKT

VSVMEETLKFSYCTLIGLVCKKLLPSTPEMIDLMKDAQTIENGVLQFPIDLPFSPYRKALQARARLHRFLDGLINERRAE

LAANGEKRKDALDEFITHKDDKVGFLSNQQVEDNLVTLLFGGHHTTALALVWLMKHLNGNPQAFKEVEEEQRRIFLGKSS

TNYNLTWEDTSQMPATLRAVNESLRLSNVVGVVTRKLTKDISYKGYTLPKDWMVHVYIPPIHLDDSIYPNAAKFNPSRFE

VPAKTGTFIPFGYGDRICPGSALSLLEQMIFIHRLITKYRWEPVNPNSKTSYWPMPSVKDGYLVHVMSI*

 

>CYP780A1v2 estExt_Genewise1.C_160031|Selmo1 98% to estExt_Genewise1Plus.C_11081|Selmo1

M  E  L  F  L  Q  S  W  N  A  L  Y  F  L

MFLLSLWLISRKFYKSSTIKLPPGSHGLPLVGESLSLFWGSPLGFLSTRRKRFGGVFWSNLLGSPTIVATT

VESAKFFLSCADCGPSGLFA

RLLGPETINEVIGSQHALYRRIFLGLMVPEALKCHVQMIDILAQDTLESWGSIKTVSVMEETLKFSYCT

LIGLVCKKLLPSTPEMIDLMKDAQTIENGVLQFPIDLPFSPYRKALQARARLHRFLDGLINERRAELAANGEKRKDALDE

FLTHKDDKVGFLSNQQVEDNLVALLFGGHHTTALALVWLMKHLNGNPQAFKEVEEEQRRIFLGKSSTNYNLTWEDTRQMP

ATLRVVNESLRLSNVVGVVTRKITKDISYKGYTLPKDWMVHVYMPPIHLDDSIYPNAAKFNPSRFEVPAKTGTFIPFGYG

DRICPGSALSLLEQMIFIHRLITKYRWEPVNPNSKTSYWPMPSVKDGYLVHVMSI*

 

>5 CYP780A2v1 fgenesh2_pg.C_scaffold_1000487|Selmo1 33% to 707A2 (missing N-term)

98% to estExt_Genewise1Plus.C_11081|Selmo1

LFWGSPLGFLSTRCKRFGGVFWSNLLGSPTIVAT

MVESAKFFLSCADCGPSGLFA

RLLGPETINEVIGSQHALYWRIFLGLMVPEALKCHVQMIDILAQDTLESWGLKKTVSVM

EETLKFSYCTLIGLVCKKLLPSTPEMIDLMKDAQTIENGVLQFPIDLPFSPYRKALQARARLHRFLDGLINERRAELAAN

GEKRKDALDEFITHKDDKVGFLSNQQVEDNLVTLLFGGHHTTALALVWLMKHLNGNPQAFKEVEEEQRRIFLGKSSTNYN

LTWEDTSQMPATLRAVNEILRLSNVVGVVTRKLTKDISYKGYTLPKDWMVHVYMPPIHLDDSIYPNAAKFNPSRFEVPAK

TGTFIPFGYGDRICPGSALSLLEQMIFIHRLITKYRWEPVNPNSKTSYWPMPSVKDEYLVHVMSI*

 

>6 CYP780A3v1 e_gw1.1.1451.1|Selmo1 34% to 707A3, 88% to e_gw1.150.42.1|Selmo1

M  E  L  F  L  Q  S  W  N  A  L  N  F

L  V  F  L  L  S  L  W  L  I  S  R  K  F  Y  K  S  S  T  R &

PGSHGLPLVRESLSLFWGSPLDFLSTRRKRYGGVFWSNLLGSPTIVATTVKSAKFFLSCTDCGPSGLFARLLGPETINEV

IGSQHALYRRIILGMMVPETLKCHVQMIDILAQETLESWGSKKMVSVMEETLKAFITYCTVIGLVCQKLLPSTPEMIDLM

RDILMIENGVFQFPIDLPFSPYHKALQARARLHRFLDGLINKRRAELAANSETHKDALDEFITHKDDKAGFLSNQQVEDN

LVTLLFGGHHTTALALVWLMKHLNENPQAFKEVEEEQTRIFLGRSSNNYNLTWEDTRQMPATLRVAVNESMRLSNVVGVV

TRKLTKYISYKGYTLPKDWMIHVYMPPIHLDDSIYLNAAKFNPSRFEVPAKTGTFIPFGYGDRICPGRALSLEKMIFIHR

LITKYR*

 

 

>fgenesh2_pg.C_scaffold_16000018|Selmo1 28% to 707A1 pseudogene

88% to estExt_Genewise1Plus.C_11081|Selmo1

MELFLQSWNALYFLVFLLSLWLISRKFYKPSTIKLLPGSHGLPLVGESLSLFWGSPQDFLSTRRKR ()

YGGVFWSNLLGSPTIVATTVESAKFFLSCADCGPSGVFARLLGPETVNEVIGSQHALYRRI

ILGMMVPETLKCHVQMIDILAQETLESWGSKKTVSVMEETAK ()

FSYCAMIGLVCKKLLPSTPEMIDLMKDAQTIENGVLQFPIDLPFSPYRKALQ ()

ARARLHRFLDGLINERRGELAANGETHKDALDEFITHKDDK VGFLSNQ &

N  L  L  F  G  G  H  H  T  T

A  L  A  L  M  W  L  I  K  H  L  N  E  N  P  Q  A  L  K  EVE (0)

EQRKIFLGKSSTKYNLTWEDTRQMPAILRV

AVHESLRLSNVEN &

TKDISYK (1)

GYTLPKDWMVHVYMPPI &

SIYLNAAKFNPSRFE (0)

VPAKTGRFIPFGYGDRICPGRALSLLEQMD &

IFIHRLITKYR (2)

WEPVNPKSKISYWPMPSVKDGYLVHAMSH*

 

$$$$$$

 

>18 CYP707C1v1 e_gw1.21.206.1|Selmo1 37% to 707A5 38% to 707A2 in the CYP85 clan

MVKQSRVAVEVSSTSGAKTPPGPAWRIPLVGETLSFLRDPHRFYLTRIARYGEIFSTSLFGDKCIIVTTPEASKWLLQSA

QKFFKPAYPESANSLIDPTRSFGSEQLHNYVRRIVGSSLYPESLQSHIPAIEALACSVLDSWTKQKSVNVYSEMAKYTFE

VAMKILCGMEPGKQMDALFQNMQDFEKAFLTLNINLPFTTYRRGLKARDSMFKAVEEMIQQRRKKKRDWSGREQQQRLDM

LDSMICVETKDEKFANAVTDIHVRGIIMTILFAGHETSAAQLVWAIKNLHDNPELLHGVKEEHEAIRRKREPGSPLTWSQ

VMKEMPLTLRVINETMRTSYVGLFLPREALDDLEYDGYYFPKGWKVYASPSMVHLNPKLYTEPYKFDPTRFQDGGPKPNT

FIPFGNGQRLCLGGELAKVEMLVLIHHLVTTYSWKIKEDHGGIRWWPVPIPKGGLVIQVEREVERGLEKETRQGQTGELG

SGEFQH*

 

>CYP707C1v2 e_gw1.31.155.1|Selmo1 98% to e_gw1.21.206.1|Selmo1

MLKQSRVAVEVSSTSGAKTPPGPPWRIPLVGETLSFLRDPHRFYLTRIARYGEIFSTSLFGDKCIIVTTPEASKWLLQSA

QKFFKPAYPESANSLIDPTRSFGSEQLHNYVRRIVGSSLYPESLQFHVPAIEALACSVLDSWTKQKSINVYSEMAKYTFE

VAMKILCGMEPGKQMDALFQNMQDFEKAFLTLNINLPFTTYRRGLKARDSMFKAVEEMIQQRRKKKRDWSGREQQQRLDM

LDSMICVETKDEKFANAVTDIHVRGIIMTILFAGHETSAAQLVWAIKNLHDNPELLHGVKEEHEAIRRKREPGSPLTWSQ

VMKEMPLTLRVINETMRTSYVGLFLPREALDDLEYDGYYFPKGWKVYASPSMVHLNPKLYTEPYKFDPTRFQDGGPKPNT

FIPFGNGQRLCLGGELAKVEMLVLIHHLVTTYSWKIKEDHGGIRWWPVPIPKGGLVIQVEREVERGLEKETRQGQTGELG

SGEFQH*

 

$$$$$$

 

>CYP716J1v2  Selaginella moellendorffii (lycopod, Gemmiferous spike moss)

 

          Trace files 869265011, 914995324, 719961663, 914786209

          45% to 716F1, 45% to 716B1 and 716B2, 37% to 716A2

          41% to 716D5, 39% to 716E1, 35% to 716C1, 35% to 716H1

MMIVVFFLVSTALLILTRSLLQFLRNSSSNSSSSSKGRVPPGSLGVPVIGDSLNFVKALK

RNDPWRFYGEKRAKYGTVFKMSLLGSPVVILPAP

AGHKLLFGSEEKLMVNSWPVGFKRLLGPGSLTSLTGEDFKRMKKVFMSFLKPEALQRYVP

RVSQLSLKHLEDHWEAYAGEEFAIYPAVKSFIFSVACSSFMSLETEEEQLELEEPFAIWT

KGLLQLPVNIPGTLFHKALKRREVIHDLLGRLISKRRQEFLQGRASESSDMLSVMLSYRN

EDGKPACTDAEIKDNLLLLLFAAHDTSSSTLTLSLKFLAENPYWRNQVLQ (1)

ENLAISQEKSGQDGY

SLEWDDLRGMKVSWRVLQETLRLQPPALSGYREVIQDFEFGDYLIPKGWK (0)

ACWTVVSHRLPEFFPDPEKFDPSRFEGDGPTPYTYVPFGGGPRMCPG

NEYAKMVMLVLLHHLVLRFDWQLADPDEGVTMDPMPMPQNGLNVKLHKRT*

 

>1 CYP716J1v1 fgenesh2_pg.C_scaffold_0000292|Selmo1 96% to CYP716J1

MMIVVFFLVSTALLILTRSLLQFLRNSSSKGRVPPGSLGVPVIGDSLNFVKALKRNDPWRFYGEKRAKYGPVFKMSLLGS

PVVILPAPAGHKLLFGSEEKLVVNSWPVGFKRLLGPGSLTSLTGEDFKRMKKVFMSFLKPEALQRYVPRVSQLSLKHLED

HWEAYAGEEFAIYPAVKSFIFSLACSSFMSLETEEEQLELEEPFAIWTKGLLQLPLNIPGTLFHKALKRREVIHDLLGRL

ISKRRQELLQGRASETSDMLSVMLSYRNEDGKPACTDAEIKDNLLLLLFAAHDTSSSTLTLSLKFLAENPYWRNQVLQEN

LAISQEKSGQDGYSLEWDDLRGMKVSWRVLQETLRLQPPAPSGYRKVIQDFEFGDYLIPKGWKACWTVVSHKLPEFFPDP

EKFDPSHFEGDSPAPYTYVPFGGGPRMCPGNEYAKMVMLVLLHHLVLRFDWQLADPDEGVTMDPMPMPQNGLNVKLHKRT*

 

>estExt_ CYP716J1v2 Genewise1.C_81429|Selmo1 99% to CYP716J1

MMIVVFFLVSTALLILTRSLLQFLRNSSSNSSSSSKGRVPPGSLGVPVIGDSLNFVKALKRNDPWRFYGEKRAKYGPVFK

MSLLGSPVVILPAPAGHKLLFGSEEKLMVNSWPVGFKRLLGPGSLTSLTGEDFKRMKKVFMSFLKPEALQRYVPRVSQLS

LKHLEDHWEAYAGEEFAIYPAVKSFIFSVACSSFMSLETEEEQLELEEPFAIWTKGLLQLPVNIPGTLFHKALKRREVIH

DLLGRLISKRRQEFLQGRASESSDMLSVMLSYRNEDGKPACTDAEIKDNLLLLLFAAHDTSSSTLTLSLKFLAENPYWRN

QVLQENLAISQEKSGQDGYSLEWDDLRGMKVSWRVLQETLRLQPPALSGYREVIQDFEFGDYLIPKGWKACWTVVSHRLP

EFFPDPEKFDPSRFEGDGPTPYTYVPFGGGPRMCPGNEYAKMVMLVLLHHLVLRFDWQLADPDEGVTMDPMPMPQNGLNV

KLHKRT*

 

$$$$$$

 

>26 CYP716M1v1 fgenesh1_pm.C_scaffold_45000005|Selmo1

MDLPPGSLGLPLLGETLQFIRYTKSNRPWEFIEQREAKYGKIFKTSLFGSPMVMVSPPQGNKLVFSNHNLLVETAWPSPM

KTLVGSNAINFMSGEEAKSFRDVLMTFLSAQAVQSQVVPTSNMIQDHLHKHWKHGETVLAYSLIKQALFSVTCCAFLSVS

DEEEQLELLEPLAKIIKGLISLPLDLPWTNFHHAKKGRVELYKMFDKYIARRRIELENGSSSQQDLLSLLLSTKLDNGKL

MNDDQIKDNILSLLFAGHDTSSSSLAMTLKCLAQNPACYQELRREHLDILSAKQPGEELNQNDLRKMKYTWMVIQETLRV

MPTGFGILRKALKDIEMDGFTIPKGWQLLISGYRSYRKPEFFAEPFKFEPSRFAEGTGPVPYTYIPFGGGPRICPGIQLA

KMQVMVFLHHLVTRYEWTLVEPDEPVSYTPVAMPTKGLPIKLK*

 

>CYP716M1v2 e_gw1.63.104.1|Selmo1 44% to 716B2, 38% to CYP716A1, CYP85 clan

45% to 716J1

MVPVLVLYLVCIGAAALAYLQRWRRFKA

MDLPPGSLGLPLLGETLQFIRYTKSNRPWEFIEQREAKYGKIFKTSLFGSPM

VMVSPPQGNKLVFSNHNLLVETAWPSPMKTLVGSNAINFMSGEEAKSFRDVLMTFLSAQAVQSQVVPTSNMIQDHLHKHW

KHGETVLAYSLIKQALFSVTCCAFLSVSDEEEQLELLEPLAKIIKGLISLPLDLPWTNFHHAKKGRVELYKMFDKYIARR

RIELENGSSCQQDLLSLLLSTKLDNGKLMNDDQIKDNILSLLFAGHDTSSSSLAMTLKCLAQNPACYQELRREHMDILSA

KQPGEELNQNDLRKMKYTWMVIQETLRVMPTGFGILRKALKDVEMDGFTIPKGWQLLISGYRSYRKPEFFAEPFKFEPSR

FAEGTGPVPYTYIPFGGGPRICPGIQLAKMQVMVFLHHLVTRYEWTLVEPDEPVSYTPVAMPTKGLPIKLK*

 

$$$$$$

 

>30 CYP716P7 fgenesh1_pm.C_scaffold_57000069|Selmo1

93% to fgenesh2_pg.C_scaffold_0001034|Selmo1

M  P  W  I  T  V  V  A  S  F  L  I  P  V  L  G  T

L  W  I  W  R  Y  F  S  R  E  R  Y  D  P  P  L  P  P  G  S

MGLPLVGETLHILYAMKTSTLWEFYGAREKKYGPIYKTHIFGRP

TIVVSPPLGFKLLFSNHGKLVESSWPQPMKTLLGDK

CLFFMEGQKAKSFRHILLAFLGPDAIRRYVERASVIIQEHIDKFWMAGSEVKAYPLVKKALFSLVFSLFLSISDEEEERE

LLAPFQGFLQGLLELPIDLPGTMFRRAKVGRAKIFKKLDEYIAKRKIELETGKAWPQQDFLSVLLTTKGEDGEPMTKEEI

KQNILMLVMSAHDTTVSSLVSSMKYIGENPWCYDRLREEHVSIALAKSQKEPLTHSDLQKMDYTWKIVQEAMRLAPPAAG

NLRRATTEFTMDGFTVPKDWQLNWTVFRSHKKKEFFEEPEMFNPDRFDRPLLPNTYVPFGGGPRICPGYELAKMQDRIFL

HYLVTRFKWTLLDPNEAIHMTPLALPVNGLGIKLVSNPVKI*

 

>3 CYP716P4 fgenesh2_pg.C_scaffold_0001034|Selmo1 38% to 716A1

94% to gw1.57.22.1

M  P  W  I  T  V  V  A  S  L  L  I  P  A  L  W  I  W  R  Y  F  S

R  E  R  Y  D  P  P  L  P  P  G  S  M  G  L  P  L  V  G  E  T  L  H

I  L  Y  A  M  K  T  S  T  L  W  E  F  Y  G  A  R  E  K  K  Y  GPIY

Y  K  T  H  I  F  G &

TIVVNPPLGFKLLFSNHGKLVESSWPQPMRTLLGDECLFFMEGQKAKSFRHILLAFLGPDAIRRYAERA

SMIIQEHIDKFWMAGSEVKAYPLVKKALFSLVFSLFLSISDEEEERELLAPFQDFLQGLLELPIDLPGTMFRRAKVGRAK

IFKKLDEYIAKRKVELETGQAWPQQDFLSVLLTTKGEDGEPMTEEEIKQNILMLVMSAHDTTVSSLMSSMKYIGENPWCY

YRLRTEHISILLARSPNEPLTHSDLQKMDYTWKIVQEAMRLAPPAAGNLRRVITEFTMDGFTVPKDWLLNWTVFRSHKKE

KFFEEPERFKPDRFDRPLLPNTYVPFGGGPRICPGYELAKMQDRIFLHHLVTRFKWMLLDPNEAIHMTPLALPVNGLGIK

LISNPVKI*

 

>29 CYP716P6 gw1.57.22.1|Selmo1

93% to fgenesh2_pg.C_scaffold_0001034|Selmo1 38% to 716A1

M  P  W  I  T  V  V  A  S

L  F  I  P  A  L  W  I  W  R  Y  F  S  R  E  R  Y  D  P  P

LPPGS

MGLPLVGETLHILYAMKTSTLWEFYGAREKKYGPIYKTHIFGRP

TIVVNPPLGFKLLFSNHGKLVESSWPQPMRT

LLGDKCLFFMEGQKAKSFRHILLAFLGPDAIRRYVERASVIIQEHIDKLWMAGSEVKAYSLLKKALFSLVFSLFLSISNE

EEERELLAPFQDFLQGLLELPIDLPGTMFRRAKVGRAKIFKKLDEYIAKREIELETGNAWPQQDFLSVLLTTKGEDGQPM

TKEEIKQNILMLVMSAHDTTVSSLVSSMKCIGENPWCYDRLREEHVSIALAKSPNEPLTHNDLQKMDYTWKIVQEAMRLA

PPAAGNLRRATTEFTMDGFTVPKDWQLNWTVFRSHKKEKFFEEPERFKPDRFDRPFLPNTYVPFGGGPRICPGYELAKMQ

DRIFLHHLVTRFKWMLLDPNEAIHMTPLALPVNGLDIKLI

 

$$$$$$

 

>CYP716P1v2 estExt_Genewise1.C_1230105|Selmo1 40% to CYP716A1

MTQKRYAKPLPPGSLGLPFVGETLHFLHSMKTNRPWEFFESRERKYGPVFKTHLFGSPTVVVNPPDGLKLIFTNHNKLVR

GSWPSSIRKLVGERSLFFMEGDEAKRFRHILLAFLGPEALQRYVGRTHAMIQKHVEENWIAGGEIKAYQSVKEALFAVIY

DLFLSLADEKEQQELLEPFRVVLHALIELPIDFPGTAFSKAMAGRREIMAKLDRMIEQRRLDLQSGKASAQQDLLSVLLV

AKGEDGRGMTDEEIKQNIVMLVLGGHDTSSSSLAIAIKYIAENPSCYDELRKEHLEIAASKKAGEPLSIADVRRMKYTWR

VVQEGMRFVPPTTGVIRRAIVDFEMDGYTVPQGWQLFGSMYQSNKKEKFFPEAESFKPDRFLGTGPVPYSYIPFGGGPRM

CPGYELAKVQDCVFLHHIVTRFKWSLCDPDEIVQMAPLAAPLKGLPIKLTSNPI*

 

>35 CYP716P1v1 e_gw1.100.31.1|Selmo1

MTQKRYAKPLPPGSLGLPFVGETLHLLHSMKTNKPWEFFESREKKYGPVFKTHLFGSPTVVVNPPDGLKLIFTNHNKLVR

GSWPSSMRKLVGERSLFFMEGDEAKRFRHILLAFLGPEALQRYVGRTHATIQKHVEENWIAGGEIKAYHSVKEALFAVIY

DLFLSVADEKEQQELLDPFRVVLHALLELPIDFPGTAFSKAMAGRREIMAKLDRMIEQRRLDLQSGKASAQQDLLSVLLV

TKGEDGRGMTDEEIKQNILMLVLGGHDTSSSSLGIAIKYIAENPSCYDELRKEHLEIAASKKAGEPLSIADVRRMKYTWR

VVQEGMRFVPPTSGVIRRAIVDFEMDGYTVPQGWQLFGSMYQSNKKEKFFPEAESFKPDRFLGTGPVPYSYIPFGGGPRM

CPGYELAKVQDCVFLYHIVTRFKWSLCDPNEIVQMAPLAAPLKGLPIKLTSNPI*

 

>fgenesh2_pg.C_scaffold_119000093|Selmo1 80% to estExt_Genewise1.C_1230105|Selmo1 possible psedogene

MEVDLEEIRHPLSERCYICSIPSRGKYGPVFKTHLFGLPTVMVTSTDGLKLIFTNQSKIVHGSWPSSVKKLVGERSLFFR

PFRHILIALLGPEALQRYVGRIAMIQKHVEESWIAGGEIKAYHSVKEALYAVIYDLFLSLTDEKEQQELLDPFRVVLHAL

IELPLDFPATAFSKGMAGRQEIMTKLDRMMEQRRLDLQSGKASSRLSSKISCRCCWSRWATHDRRGDQAKHLDAGYWNP*

 

$$$$$$

 

>38 CYP716P2 fgenesh2_pg.C_scaffold_174000009|Selmo1 60% to e_gw1.100.31.1|Selmo1

MKTNKPWEFLESREKKYGLVLKTRLFGLPTVVVTSPKLIFTNHSKLVPSSVKKLLGERSLEGDQAKRFRHILLAFLGPGY

VGRMQAMIQKHVEESWIAGGEIKAYHSVKEALYAVVYDLFLSLTDEKEQQELLDPFRVVLHALLELPLDFPGTQGHGWQP

GDHGEAGPADGAAATGFAEREGVLPSEQQDLLSVLLVTKGEDGRRMTDEEIKQNILMLHLDIAAGEPLSIADVRRMKYTW

RVVQEGMRFVPPTIGVFRRAIVDFVMGGYTVPQGWRIPSSILCLCKIFSFFFFLLPIPAETMSKQLFGPMYQSNKKEKFF

PEAESFKPDRFLGTGPVLTRTSHSVEGRACALVTGLPRSKNACFCTTLSPGSSGARVTRTRSCKWLHWQHHSRAFPSS*

 

$$$$$$

 

>2 CYP716P3 estExt_Genewise1Plus.C_02337|Selmo1 37% to CYP716A2, 39% to 716A1

MLEFPGVIAVVSLVLAGIWIWRAFSQKSYDPTTPPGSFGLPFLGETLHLLYSMKANDLSGFYESRERKYGQVFKTHLFGH

PTVVVSPPLGFKFLFSNHGKLVESSWPAPVKMLMGDKSLFFMEGQKAKSFRHILMAFLGPEAMRRYVGRSSSIAQAHIKK

FWLDESEVRAYVLLKKAMFSAVFNLFLSIQNEEEERELLVLFEEFLHGMLELPINFPGTKFRRAKLARHKIFEKLDKYIS

KRKVEIQEGKASAEQDLLSVLLTTRGEDGELMSAEEVKQNILMMVLAGHDTTASTLAVSIKCIAENPWCYDRLRQEHLAI

AAAKDSSEPLRVEDLQRMNYTWKVVQEAMRLLPPVLGNTRIAITQMTIEGFTVPKDWRFMWRVFRSNRRSAFFPEPDKFD

PERFDGSSGLIPYTYVPFGGGPRICPGNEFAKMLLRVFLHHLLTQFQWALLDPNEHIQMAPFALPANGLHIKLSKNPI*

 

$$$$$$

 

>10 CYP716K1v1 e_gw1.6.26.1|Selmo1 37% to CYP716A2

MILLLGACFLLLITTIFAIRFSPSSNLPPGNLGWPIVGETLQFLALFRKNKAYSFFHERMAKHGGVFKTSLLGSPTIVMP

GPDGNKFLFSQENKLVVGCWPPSTASLLGPCSLAVQTGQEHRRLREVFMTFLSSQALGRYLPKLCLLAQSFLQSKWNEEA

VVTVAPLVQSFVFSAACNLFLSMDKESDQELLLVPFYKFVKGMMSLPVHFPGTRYYEALKSREAILRLLDPVISARKKEL

LANPTDDRDMLSVLLTTCDEDGKLISENEIEDNVLLMLFAGHETVFRALTITMKMLTDNPHWKEELYQEHLEIRASKSKP

DYVLEWNDLRKMKLTWCSVQESMRLYPPSPGATRKATQEFEYAGYRIPEGYKLMWSVNTSRMKDEFFPEPQKFDPLRFQG

NGPAPYVFTPFGGGPRTCPGNEFAKMEMLVFLHYLLLSHDWKPVITNEGIIVETAPLPAHGLPVKLSKR*

 

>CYP716K1v2 fgenesh1_pm.C_scaffold_17000007|Selmo1 99% to e_gw1.6.26.1|Selmo1

MEVQETQPRSNLPPGNLGWPIVGETLQFLALFRKNKAYSFFHERMAKHGGVFKTSLLGSPTIVMPGPDGNKFLFSQENKL

VVGCWPPSTASLLGPRSLAVQTGQEHRRLREVFMTFLSSQALGRYLPKLCLLAQSFLQSKWNEEAVVTVAPLVQSFVFSA

ACNLFLSMDKESDQELLLVPFYKFVKGMMSLPVHFPGTRYYEALKSREAILRLLDPVISARKKELLANPTDDRDMLSVLL

TTCDEDGKLISENEIEDNVLLMLFAGHETVFRALTITMKMLTDNPHWKEELYQEHLEIRASKSKPDYVLEWNDLRKMKLT

WCSVQESMRLYPPSPGATRKATQEFEYAGYRIPEGYKLMWSVNTSRMKDEFFPEPQKFDPLRFQGNGPAPYVFTPFGGGP

RTCPGNEFAKMEMLVFLHYLLLSHDWKPVITNEGIIVETAPLPAHGLPVKLSKR*

 

>e_gw1.17.896.1|Selmo1 98% to e_gw1.6.26.1|Selmo1

MVSFTSLSFSFTDPEPTLEVFYIPASIMWSVNTSRMKDEFFPEPQKFDPLRFQGNGPAPYVFTPFGGGPRTCPGNEFAKM

EMLVFLHYLLLSHDWKPVITNEGIIVETAPLPAHGLPVKLSKR*

 

$$$$$$

 

>CYP716P5v2 e_gw1.81.12.1|Selmo1 90% to estExt_Genewise1Plus.C_02337|Selmo1

MLEFPGGVVAVVSLVLAGLWIWRAFSQKSYDPPTPPGSFGLPFLGETLHLLYSMKANSLSEFFESRERRYGPVFKTHLFG

RPTVVLSPPLGFKFLFSNHGKLVESSWPAPMKMIMGDKSLFFMEGQRAKSFRHILMAFLGPEAMRRYVARTSSIAQAHIE

KFWLDGSEVRAYFLVKKALFSVVFNLFLSIQNEEEERELLVPFEEFLHGLLELPINFPGTKFRQAKLATGKIFGKLDKFI

NKRKVELQEGKASAEQDLLSVLLTTRGEDGELMSEEEVKQNILMMVLAGHDTTASTLAVSMKCIAENPWCYDRLRQEHLA

VAAAKDSSEPLRLEDLQKMNYTWKVVQEAMRLVPPALGNTRIAITHMTIEGFTVPKDWRFMWSVFQSNRRSAFFPEPDKF

DPERFNGSSGLIPYTYVPFGGGPRICPGNELAKMLLRVFLHHLLTQFQWSLLDPNEHIQMAPLAAPANGLHIKLSKNPI*

 

>25 CYP716P5v1 e_gw1.43.434.1|Selmo1 89% to estExt_Genewise1Plus.C_02337|Selmo1

96% to e_gw1.81.12.1|Selmo1

MLEFLVAVVSLVLAGLWIWRAFSQKSYDPPTPPGSFGLPFLGETLHVLYSMKANSLSEFFESRERRYGPVFKTHLFGHPT

VVVSPPLGFKFLFSNHGKLVESSWPAPMKMLMGDKSLFFMEGQRAKSFRHILMAFLGPEAMRRYVARASSIAQAHIEKFW

LDGSEVRAYFLVKKALFSVVFNLFLSIQDDEEERELLVPFEEFLHGLLELPINFPGTKFRQAKLATRKISGKLDKFINKR

KVELQEGKASAEQDLLSVLLTTRGEDGELMSEEEVKQNILMMVLAGHDTTASTLAVSMKCIAENPWCYDRLRQEHLAIAA

AKDSSEPLRLEDLQKMNYTWKVVQEAMRLVPPALGNTRIAITHMTIEGFTVPKDWRFMWSVFQSNRRSAFFPEPDKFDPE

RFNGSSGLIPYTYVPFGGGPRICPGNELAKMLLRVFLHHLLTQLQWSLLDPNEHIQMAPLAAPANGLHIKLSKNPI*

 

>fgenesh2_pg.C_scaffold_57000215|Selmo1 31% to 716A2 some gaps in seq

very similar to e_gw1.81.12.1|Selmo1 with errors, pseudogene?

MKMIMGDKSLFFMEGQRAKSFRHILMAFLGPEAMRRYVARASSIAQAHIEKFWLDGSEVRAYLLVKKALFSVVFNLFLSI

QNEEEEKELLVPFEEFLHGLVELPINFPGTKFRRAKLATRKIFGKLDKFISKRKGRGWREKNILMMVMAGHDTTASTLAV

SMKCIAENPWCYDRLRQEHLAIAAAKPLRVEDLQKMNYTWKVASGPSSAGKHADSDHANDHRGLHSSKRLASKFLHSIIS

RTSLMIIDGQFMWSVFRSNRRSAFFPDPDKFDPERFDGSSGLIPYTYVPFGGGPRICPGNEFAKMLLRVFLHHLLTQFQW

ALLDPNEHSIRTSGQRPPRQTVQKSNIIPREVPWILETINYITRSWNHSITLYHHFYNVLPRIKHVACIFLVEASGS*

 

>fgenesh2_pg.C_scaffold_76000035|Selmo1 83% to e_gw1.43.434.1|Selmo1

MKANRPWEFYESREKYGQGFKTRLFGHPTVVGHRRHILMAFLGPDTSEVKKALFSVVFNLFLSIQDEEEEKELLAPFEDA

QLSRDISAVGGTQADTVEGFTVPKDWRFHWSIFQSNKRSAFFMDPDKFDLE*

 

>e_gw1.415.10.1|Selmo1 100% to e_gw1.43.434.1|Selmo1

WSVFQSNRRSAFFPEPDKFDPERFNGSSGLIPYTYVPFGGGPRICPGNELAKMLLRVFLHHLLTQLQWSLLDPNEHIQMA

PLAAPANGLHIKLSKNPI*

 

$$$$$$

 

>16 CYP716L1v1 fgenesh1_pm.C_scaffold_13000015|Selmo1, 47% to 716B1 Picea

MALLAMVALLFFLVAPLFWIFNLIVASRKETPAQALQIPPGNLGWPLIGETFRYAVQSGSTFYDERVAKYGAVFKTSLFG

SKTVVLPAPEGNRLILMNENKLVSVSYPKSVSVLLGENSLIALRGDEHRRSKALLMTFLRPEMLQKFVGRVCKVVHDHLQ

KFWSGGDEVIRVYNLMKMFTFALACDLLMGLDIGDEEMEFLARDFDTLVRGLFQLPIDLPGTQFCRAKAARKKLDQCFDR

HIREKRRELAGSFRARSHEQDMLEVLLTTRDENGEFSTDLAIKDNIVSLLFAGHDTSSVALTWTLKFLADSPSCMDKVVQ

ENLAVRSSRSSSELSWEDLRKLKYTWQVVQESMRMRPPVGGGFREALVDLEFDGYLNWTTATSYRKPEFFVEPNKFDPSR

FDGGNGIAPYTFLPFGAGARMCPGSEFAKMEILVFLHYCVLQFDWKLLEPNEQVIIDPMPRPVHGMPVRISKRN*

 

>CYP716L1v2 e_gw1.48.17.1|Selmo1

96% to fgenesh1_pm.C_scaffold_13000015|Selmo1, 37% to CYP718 CYP85 clan

MVALLFFLVAPLLWIFNLVVASRKETPAQALQIPPGNLGWPLIGETFRYAVQSGSTFYDERVAKYGAVFKTSLFGSKTVV

LPAPEGNRLILMNENKLVSVSYPKSVSVLLGENSLIALRGDEHRRSKALLMTFLRPEMLQKFVGRVCKVVHDHLQKFWSG

GDEVIRVYNLMKMFTFALACDLLMGLDIGDEEMEFLARDFDTLVRGLFQLPIDLPGTQFCRAKAARKKLDQCFDRHIREK

RREIAGSFRARSHEQDMLEVLLTTRDENGEFSTDLAIKDNIVSLLFAGHDTSSVALTWTLKFLADSPSCMDKIVQENLAI

RNSRSSSELSWEDLRKLKYTWQVVQESMRMRPPVGGGFREALVDLEFDGYVVPKGWKASFLLNWTTATSYRKPEFFVEPN

KFDPSRFDGGNAIAPYTFLPFGAGARMCPGSEFAKMEILVFLHYCVLQFDWKLLEPNEQVIIDPMPRPVHGMPVRISKRN

*

 

$$$$$$

 

CYP86 clan sequences (30 sequences in 10 bins) [7% of the P450 sequences]

 

>1 CYP86F3v1 e_gw1.73.49.1|Selmo1 53% to CYP86B3, 54% to 86F1 moss

MIAAYLVCHFLRYHNAKGPLVWPIVGMIPQLSRNFKQGYDWVTGILVQTGGTFTFIVPWIPSLNVVVTSDPQNVEYILKT

NFANFPKGKILRAGFHDLLGSGIFNSDHNTWLLQRKLASLEFYTKSFRDLTARSVQRLVHRRLLPILRHAAATSATIDLQ

DVMLRFTFDNICILAFGADPGCLCAGLPRVPFARAFDVATTLTLLRFTVPEFSWKLDRLLGIRRERKLHECLKTIEAFAA

DVIAKRKAEMADDRPSRRSDLLSCFLSSTDPATGKPSYSDKFLRDVAINFILAGRDTSSVALSWFFWLLQSNPRVEAAIL

DELRTVVRSSGRRCVRDPDFSVEELRSMQYLHAALSESLRLYPSVPIDNKEVVEDDTLPDGTRVKKGRRVLYSIYSMGRM

ESIWGPDCLDFRPERWIKNGFFVPESPFKYTAFNAGPRLCLGKDVAYLQMKAIAASILSRFSVRVVDGHVAKQKLSLTLF

MRNGLPVTLHHRPLFDDGDCHSP*

 

>CYP86F3v2 e_gw1.90.39.1|Selmo1 98% to e_gw1.73.49.1|Selmo1

MIAAYLVCHFLRYHNAKGPLVWPIVGMIPQLSRNFKQGYDWVTGILVQTGGTFTFIVPWIPSLNVVVTSDPQNVEYILKT

NFANFPKGKILRAGFHDLLGSGIFNSDHNTWLLQRKLASLEFYTKSFRDLTARSVQRLVHRRLLPILRHAAATSATIDLQ

DVMLRFTFDNICILAFGADPGCLCAGLPRVPFARAFDVATTLTLLRFTVPEFSWKLDRLLGIRRERKLRECLKTIEAFAA

DVIAKRKAEMADDRPSRRSDLLSCFLSSTDPATGKPSYSDKFLRDVAINFILAGRDTSSVALSWFFWLLQSNPRVEAAIL

DELRTVVRGSGRGCVRASDPEFSVEELRSMQYLHAALSESLRLYPSVPIDNKEVAEDDTLPDGTRVKKGRRVLYSIYSMG

RMESIWGPDCLDFRPERWIKNGFFVPESPFKYTAFNAGPRLCLGKDVAYLQMKAIAASILSRFSVRVVDGHVAKQKLSLT

LFMRNGLPVTLHHRPLFDDGDRHSP*

 

$$$$$$

 

>2 CYP94J1v1 e_gw1.42.412.1|Selmo1 48% to CYP94H1 moss, 44% to CYP94D10, 43% to 94C3,

41% to 94B3

MEQGTLAAALLISCVGFFVWFYLKNRHENGETVPRMYPLLGTMPELLKNKDRILEWTTEYLAKSPGHTITLKRWGAKPFK

LTSNAQNVEYILKTNFDNYPKGEYVCDTLRDLLGDGIFNADAGLWKLQRKLASYEFTTRSLHDYLMDSVAEKIEKRLLPT

IASICGRRVDLQDVFMRFAFDSICKLAFGVDPMSLDPSFPTIAFARAFDESTRLSTERFYQVHPLLWKIKRYFNLGSEKH

LKEYLAIVNEFAAMVIKNRRKKTGARENQDLLSRFMALEMEDTASSYSDKFLRDIIISFVLAGKDTTSVTLSWFFWLLSK

HPKVENKIIQEIVDVAERNHEPGRRMKHFAYSELREMNYLQAALSESLRLYPAVPFDSKGAKGPDVLPDGSRIEKGTRVT

YQIYAMGRMESLWGKDCLEFKPERWLSSTGSFVNESPYKFTAFQAGPRICIGKEMAMLQMKSLVAALLPKFKFEMASDTE

PRYSINMTLAIKNGLPVIPRARE*

 

>CYP94J1v2 e_gw1.67.26.1|Selmo1 98% to e_gw1.42.412.1|Selmo1

MEQGTLAAALLISCVGFFAWFYLKNRHGNGETVPRMYPLLGTMPELLKNKDRILEWTTEYLAKSPGHTITLKRWGAKPFK

LTSNAQNVEYILKTNFDNYPKGEYVCDTLRDLLGDGIFNADAGLWKLQRKLASYEFPTRSLHDYLMDSVAEKIEKRLLPT

IASICGQRVDLQDVFMRFAFDSICKLAFGVDPMSLDPSFPTIAFARAFDESTRLSTERFYQVHPLLWKIKRYFNLGSEKH

LKEYLAIVNEFAAMVINNRRKKTGARENQDLLSRFMALEMEDTGSSYSDKFLRDIIISFVLAGKDTTSVTLSWFFWLLSK

HPKVENKIIQEIVDVAERNHEPGRRMKHFSYSELREMNYLQAALSESLRLYPAVPFDSKGAKGPDVLPDGSRIEKGTRVT

YQIYAMGRMESLWGKDCLEFKPERWLSSTGSFVNESPYKFTAFQAGPRICIGKEMAMLQMKSLVAAMLPKFKFEMASDTE

PRYSINMTLAIKNGLPVIPRARE*

 

>CYP94J1v2 e_gw1.67.26.1|Selmo1 98% to e_gw1.42.412.1|Selmo1_JKW_mannual

This model is incorrect

meqgtlaaalliscvgffawfylakspghtitlkrwgakpfk

ltsnaqnveyilktnfdnypkgeyvcdtlrdllgdgifnadaglwklmdsvaekiekrllpt

iasicgqrvdlqdvfmrfafdsicklafgvdpmsldpsfptiafarafdestrlsterfyqvhpllwkikryfnlgsekh

lkey

flgswlskwrtrevrtptnsyeilssalfwqartqllshcrgssgswskdetlllqraprdelspgsvigilkalssssvrqqrcqrprrttrweqdrerneghvpdlcngtngepmgeglsrvqarkvakq

hwkfceresv*

 

$$$

 

>CYP94J2v1 e_gw1.40.98.1|Selmo1 98% to e_gw1.89.58.1

Selmo1/scaffold_40:864274-865749

MLWSLSFVLAAAVGWIVRRTIQSRADSQRTGGPVLYPVVGNVFDFLRNSHRFLEWSTEYVINSPSNTFTTGRFGSTFKIT

GNPATVEHILKTNFENYPKGEHLRQSLTDLLGDGIFNVDGELWKIQRRLASFEFTTRSLREFLMDSLADEVHSRLLPTLA

SVSRDGKEIDLQDLFMRFNFDNICKLSFGVDPACLDPSFPDVKFAQAFDKATTLSTLRFQKIHPLVWKLMRALNVGPERE

LKEVLDVVNEFAVSVVQKRREEKGRVNQDLLSRFIGLDSTSFSDEFLRDIIISFVLAGKDTTAVSLSWFFWLLSNHPGVQ

QEIIRKVGSIVAKGSNRPFTYKELRDMVYLQAALCESMRLYPPVPIDTKVVKNSDVLPDGNCVEKGMKVSYHVYAIGRME

SLWGKDCLEFKPERWIHDGQFVEVSPFKFPVFQAGPRVCLGKEMAMLQMKYVVAALVPKFELVVVGKEEPCYGINMTLIM

KDGLPVVPKLR*

 

>3 CYP94J2v2 e_gw1.89.58.1|Selmo1 59% to e_gw1.42.412.1|Selmo1 49% to 94D2, 42% to 94B4

Selmo1/scaffold_89:754864-756339

MLWSLSFVLAAAVGWIVRRTIQSRADSQRTGGPVLYPVVGNVFDFLRNSHRFLEWSTEYVINSPSNTFTTGRFGSTFKIT

GNPATVEHILKTNFENYPKGEHLRQSLTDLLGDGIFNVDGELWKIQRKLASFEFTTRSLREFLMDSLADEVHSRLLPTLA

SVSRDGKEIDLQDLFMRFNFDNICKLSFGVDPACLDPSFPEVKFAQAFDKATTLSTLRFQKIHPLVWKLMRALNVGPERE

LKEVLDVVNEFAVSVVQKRREEKGRVNQDLLSRFIGLDSTSFSDEFLRDIIISFVLAGKDTTAVSLSWFFWLLSNHPGVQ

QEIIREVGSIVAKGSNRPFTYKELRDMVYLQAALCESMRLYPPVPIDTKVVKNSDVLPDGNCVEKGMKVSYHVYAMGRME

SLWGKDCLEFKPERWIQDGQFVEVSPFKFPVFQAGPRVCLGKEMAMLQMKYVVAALVPKFELVVVGKEEPCYGINMTLIM

KDGLPVVPKLR*

 

>4 CYP94J3 fgenesh1_pm.C_scaffold_40000038|Selmo1

Selmo1/scaffold_40:891918-