Solenopsis invicta (fire ant) P450s

152 sequence pieces

 

data-mining from the Ant Genomes Portal

http://hymenopteragenome.org/ant_genomes/?q=blast

 

protein BLASTs were done against the protein models

Official_Gene_Set_Proteins.2.2.3

The CYP2 clan and mito clan sequences were completed by

Blasting with homologous sequences against the

Sinv_1.0_Scaffold_Assembly to find the missing sequence parts.

 

Blast searches of the genomic sequence identified more genes without gene models.

Exhaustive searching of the genomic DNA has not been done.

 

CYP3 and CYP4 clans are only sorted into family and subfamily bins.

These have not been systematically completed so there are many fragments.

 

CYP4AA, CYP4AB, CYP4BW, CYP6AQ, CYP6BE are expanded

 

77 sequences are complete or missing only the C-term exon.

There are 19 CYP3 clan pseudogenes and 26 CYP4 clan pseudogenes.

There are 23 partial sequences in the CYP4 clan (15 in CYP4AB and 8 in CYP4BW).

There are no partials in the CYP2, CYP3 and mito clans (excluding the pseudogenes).

 

The gene count = 77 complete plus 23 partials = 100 genes.

However, some of the partials may join so the count may drop.

 

 

 

D. Nelson

 

May 19, 2011

Revised May 23, 2011

 

CYP2 clan (11 complete sequences)

 

>CYP15A1 SI2.2.0_13834 locus=Si_gnF.scaffold06514[46107..46847]

73% to CYP15A1 Pogonomyrmex barbatus

72% to CYP15A1 Linepithema humile

Si_gnF.scaffold06514 last exon, adjacent to CYP305D1 on opp. strand

44877 MLCSLLFTLLLICFCVYNCIKPKNYPP 44957

46107 GPWWIPFVGCFPQFKWLHSKHGYTYLALQDLARTYGPILGLKLGNQKVVVISTYDLVKKA

      LQQDEFNGRPDGFFFRVRSFGKKR 46358

46557 GVLFTEGSEWSQVRKFTMRHLRTFGIGQSIMKQQLA

      MEARILVDHLQQMNERGVVSMHTAFDVAALNSLWVMIAGHRFDYGDPKLQEALKLVHDAFK 46847

46940 LLDTMGGVISQMPFLRFVIPEQSGYNDLMRILQGLWSFLDDEIKMHEKKLSDEPRDLI 47113

47114 DVFLLEIRKNNNENEDTIFERK 47179

47513 NLLILCLDLFLAGSKTTSDTLSSIFLYLSLNPEWVKTLQAELDRVVGRSRAPTEDDLPF 47689

47690 LPMTEAFLTE 47719

      AQRYLILAPLGVPHRAAKDISFNGYRVPK 48265

48366 DAIVLFDLHSVQNDRTYWDQPNEFRPQRFLDEHGQFCRNNKSLAFGL 48506

48701 GRRRCMGEQLARSSVFLMFTHIVHYFDIELSDEYDKPDLNAYDGFSLAPKPYYLKLTRR 48877

 

>CYP18A1 SI2.2.0_13749 locus=Si_gnF.scaffold03503[1066384..1067322]

58% to CYP18A1 Apis mellifera

Si_gnF.scaffold03503

1068609 MLVKQSVLWLWWTLGGNNFEVFYSLLIFIGGAATVSRILRLKRSLALPPGPWGCPIRGYLPN 1068424

1068423 MTGPTHLKFKKLADDFGKIFSVSFGSDVIVVLSDYQKIREMFSKEEYTGRPHTDFMNII 1068247

1068246 NGYGE 1068232

GIVNTEGALWSEQRKFLHDKLRKFGMMNSGMGRANMEKRIM 1067621

CEVDMFLQELRTRKEEPTNISSPLAVAISNVICSLTMGVRFSNDDPKFKRFMDLIDEGFK

LFGKLTYANHIPILRYLPGINGIRNKISQNRAEMVEFFQQIIDDHRTHWKLN

DIRDIVDAYLYEIQEAEREGRDHELFQGKDKDRQMQQIMGDLFSAGMETVKNTLEWSMV

FMLNYPEAAKAVQKELDEKVGRTRLPLLKDLPDLPITDATIQEILRRSTLVPLGTTHATT

R ()

1065600 DVSLDNYTLPAGTHVIPLLYKVHMDPTLWDEPEAFRPSRFLSEDKTTVNKPKYFMPFGA 1065424

1065423 GRRICLGETLARMEIFLFFSSMMHMFHLNLPKDASPPSLEGNVGITISPKPFEVCLQYRG 1065244

1065243 LDQDCGSNGPLRNIGSH 1065193

 

>CYP303A1 SI2.2.0_13260 locus=Si_gnF.scaffold06988[3533..4492]

83% to CYP303A1 Pogonomyrmex barbatus

MLLLILILLLLYLSCQKPKGYPPGPRWWPILGCALEIARIRQETGYLFKTCSALCK

KYGPVVGLKIGQDRIVILNDIESSRAMLTNEDCDGRPTGPFYKARTWGHRLGLIVVDDKL

WVEQRRFVIRHLREFGLGRTSMVTIIEDEALKLVEHFKRLLQ

KVSQSAGMIISMHDAFGVTVLNTLWKMMAGKR

3446 YDNGDKELTHLQKILSKLLNEIDIIGAPFGHFPLLRFIAPEMSGYKAFVETHQELWAFLK 3267

3172 EELDNHKNTFLSSAPRDLMDVYLNVLNSEDCSDTF 3068

     SESQLLAICVDLFIAGSETTSKALGFG 2910

2909 FLNLILNPQVQRKAHEEIDRVIGRDRFPTLADKPR

2720 MPYIQAIVLESLRIFVGRTLNVPHRAIRDTTIAGHNIPK

     DTMLVVNYNRIIMDESWNDAEDFRPERFLDSDGNIITPEKYVPFGMG 2358

2247 GRHRCMGEVLARSNIFIITATLLQAFNFSVVPGEARPSTQDFVDGVTAGPKPYRALISLR 2068

 

>CYP305Da SI2.2.0_06922 locus=Si_gnF.scaffold06118[22598..24010]

join with SI2.2.0_04114 locus=Si_gnF.scaffold06118[11841..13309]

60% to CYP305D1 Pogonomyrmex barbatus missing C-term exon

88% to SI2.2.0_06264, 59% to CYP305D1 Pogonomyrmex barbatus

Si_gnF.scaffold06118

Si_gnF.scaffold08792 last exon

64% to CYP305D1 Pogonomyrmex barbatus

62% to CYP305D Si_gnF.scaffold06514 only reasonable choice to complete gene

24010 MVVTAALMILTILFITVVLTRERPKGCPP 23924

23382 GPFPWPFIGNQYYLRRLQKKYGGQHMAFLHLSKIYNSNVISLRLGGKYTIAVSDSKLIQQ 23203

23202 ICVNEKYDGRPWNEFMKLRNLGMKK 23131

13399 GLTANDGPEWKELHNWSARALRQVGFAKPAMVDLLNNEMTLIAKR 13265

13264 LRDGGVQPIRPAFAPAVMNVLWFLVTRSNPSENPKR ()

      LQNFINMMDHRSQQFDATGGILSAIPWIRYIAPEMSGY 12905

12904 NTVVTLNKELKTFLM 12860

      DTINEHKKRYIKGNESDFIDLFLQEMYESEGQGERAHVFD 12646

12440 DGNLIVTLIDFFIAGISTTTATLDILFMQITNHPDVQRKLHEEIDAVIGNRTPSLEDRKK 12261

      MPYTEAI 12087

12086 LNESQRLTSVVVLLAPHRTVEDTILDGYKIPKDTIVLLNVHCNNMDPDVYPDPNSFRPER 11907

11906 FINKDGNYQTQENLIQFEK 11850

 1386 GKRRCIGEVLARSAIFLLFVGVMQKYRLLPLPGKGSVNAEFTIGIIRELKHYELLIVPR 1210

 

>CYP305Db SI2.2.0_15057 locus=Si_gnF.scaffold07142[30066..31340]

59% to CYP305D1 Pogonomyrmex barbatus N-term

CYP305D SI2.2.0_06264 locus=Si_gnF.scaffold07142[20648..22119]

88% to SI2.2.0_04114, 59% to CYP305D1 Pogonomyrmex barbatus

aa 180-467

SI2.2.0_12836 Si_gnF.scaffold07142 last exon

66% to CYP305D1 Linepithema humile

87% to CYP305Da SI2.2.0_06922

62% to CYP305D Si_gnF.scaffold06514

31364 MIVIAILMMLTILLITIVLTQQRPKDCPP

30462 GPFPWPFIGNQYYLRRLEKKYGGPHMAFLHLSKMYNSNV

      IALRLGGKYTIAVSNSKLIQQICVNEKYDGRPWYEFMKLRNLGMKK ()

22209 GLTTNDGPEWKELHNWSARALRQVGFAKPA

MVDLLNNEMTLITKGLGNGSVQPIRPAFAPAVMNVLWFLVTGSNPSENPERLQNFINMMD

HRSQQFDMTGGILSAIPWLHYIAPEMSGYNTIVTLNNKLKTFLMDTINEHKKRYNKGNES

DFIDLFLQKMYESEGQGERAHVFDDANLIVTLIDIFIAGISTTTATLDILFMQITNHLDV

QRKLHEEIDAVIENRTPSLEDRKKMPYTEAVLNESQRLTSVMVIFPPHRAVEDTILNDYK

IPKDTVVLLNVHCNNMNPDVYPDPNSFRPERYINKDGIFQTQENIIQFGKGQ

11445 GKRRCLGEVLAKSAIFLLFVGVMQKYRLLPVPSKESVEAKFTIGLLRELMPYEILIVPR 11269

 

>CYP305Dc Si_gnF.scaffold06514 last exon

54470 MFVTVALVILTILLITILLRQRLKRPP 54390

53593 GPFPWPFFGNRYYLEKLTRKYGGQHFAFKELSKMYKSGIISLRLGTSNVIVVSDSRLIHE 53414

53413 ICLSEKFDGRPWNEFIKLRNMGLRKG 53336

      GITMNDGPEWKELRMWTVRTLRSVGFARQ 52302

52301 TMLDLITEEMKLIMKRLADGGVQRIRPAFAPVVINVLWLLVTGRKPSDDLTR 52146

52032 LQNFLDLLERRAQLFDMSGGILATFPWIRYVAPERSGYNVLVTLNNELKNFLM 51874

      DTINEHKKRYVKGNEADFIDMFLQEMNKEEQEDKVSVF 51664

51456 FSDDNLLVTLIDFFIAGTSTTTATLDILFLQMANHQDIQRKLHEEIDTVIGRHRLPQLEDRV 51271

51121 RMFYTEAILTECQRLWLVTPVIGPRRVLENTILDGYEIPKNTTVLINVYSNNTDPEFFPD 50942

50941 PNSFKPERHINKDGIYQIQHENVINFGKGE 50852

50456 GRRRCPGEALAKSAIFLLFVGIMQKYRLLPVPGQNCINVEFNSGLTCTPKPYEMLIVSR 50280

 

>CYP306A1 SI2.2.0_13566 locus=Si_gnF.scaffold03503[1034249..1034568]

79% to CYP306A1 Linepithema humile

        MIALVLLGVSLVLFVYIFRKNNKTHRLPPGPCGVPLLGYLPWIDPARPHVSLTQLARKYG

        PICGLRMGSVYTVLLSDPQLVRQTFAKDAFAGRAPLYLTHGIMQGY

1050059 GLICAEGDLWKDQRRFVAGCLKNFGMTKLPGAKRDKMEERILAAVNECTS 1050208

1050892 KLKELAMEEIDPLETLHHCIGNMMNDLVFGKVYEEDDKVWKWLRHLQEEGVKHIGVAGP 1051068

1051069 LNFLPFLR 1051092

        FLPRYGKVMELLIDGQLKTHQQYQTIIDEHRARREKTDNFLAAFDEAMSNDT 1053362

1053363 NNGYFTQPQFYHLLADLFGAGTDTTLTTFRWFLLFMATHPDEQ 1053491

1053613 QKKIQDEMNELLGEKPPNLEDRLLLIRLEAAIAETQRLRSVVPVGIPHGTVE 1053768

1055024 DTQIGDYDVPKGTMVVPLQWAIHTDHFYWHDPLSFKPERFIAEDGSLAKPKAFLPYQA 1055197

        GKRMCVGDELAKMILFLFAARILHTFVISVPSGM 1055383

1055384 RIDLEGECGITLVPKSHRLIFTLRE 1055458

 

>CYP307B1 SI2.2.0_01048 locus=Si_gnF.scaffold03327[1087173..1090848]

88% to CYP307B1 Pogonomyrmex barbatus N-term

MIFISATTYFLLAIVLVALVLIVMDHVRLKKKQKKIYDGEESSDLLDPPGPTPWPVLGSL

HILGRYDVPYKAFGDLVKAYNSQVIKLRMGSLPCVVVNGLENIKEVLVTKGHHFDSRPNF

IRYHLLFCGNKENSLAFCNWSDVQKTRREMLRGHTFPRAFTTRYNQLNGIIGGEVDWLIN

HLTGISGISLHAKPLILHTCANIFIKYFCSRSFDLGNGPFREMIENFDKVFYEVNQGYAA

DFMPFLMPLHQRNMTRMANWSHEIRKFVEKNIIGDRLTSWRSVIPEEDYVDCLINHIKTD

AEPTMTWDMAIFALEDIVGGHSAVGNLLVKILAYLATRPHVQKIAQMEIDGIETTGNFVG

LENRGSMPYTEAIILEAIRLIASPIVPHVANQDSSIAGYKIEKDTFIFLNNYDLNMSKEL

WTSPEEFIPQRFVQNGKLLKPEHFLPFGGGRRSCMGYKMVQYISFSTIATLLKNFNILPV

EKEIYKVPIGNLALPENTFKFRFEKR

 

>CYP343A1 SI2.2.0_14452 locus=Si_gnF.scaffold01858[316311..316613]

83% to CYP343A1 Pogonomyrmex barbatus N-term

317097 MWFIIICLTIIFTIMILHSWRRPSTFPPG 317011

       GPRGLPIVGNILDVKRLVDETKFYSHAWCRLADIYGPIVGLKLGIAEPMIIVSGKDAVIE

       MMSQHQFDGRPNGFVHKLRTGGERRGVMFTDGDMWRDQRR

315693 FVLRTLKEFGFGNVTMEDLILNNAVSLTTTIESLAKLGPITNFYDITSVAVLNSLWTLV 315517

315516 AGSRYA ()

       LDNPKLIEVLSVVNGIIRNTNVTGGILT 315337

315336 HLPFLRYIIPGLTGFTALNQRQTQMWHFIE

315179 TEIARHKQTRTHGEFRDFIDVYLAEMDTKQSTVSS 315075

314452 EAQLISIVKDLFTAGVETTNNTIGFIITYLVVRQDVQRKVHEEIDRVLGNEI 314297

314296 LPHIIYKNR 314270

314181 RLPYLNATIAEVTRLANVGPTSIPHRAMADSVLLGYKIKKNYTLLANLRSVHMDEQHWGD 314002

314001 PKEFRPERFINDKGEYVEDPWLIPFGL 313921

313852 GHRKCLGETLAKKSVFLFTACLLQKFQFILPPKHSNPILDGVDGFTIAPPHLSIVAIKR 313676

 

>CYP369Aa SI2.2.0_01258 locus=Si_gnF.scaffold05901[323253..326968]

79% to CYP369A1 Pogonomyrmex barbatus

84% to CYP369A SI2.2.0_04668

322715 MSPLLILILTLLIVYKLYRFAYDKPPNTPP

323130 GIIRLPIGGSYWMLLWGNYKFPYMTIDYYVKKLKSKIISCY

MGDHFVIIVNDYKNIKEVLARDEFDGRVSAPFLLDRSFGKNL

GIFFVDGPKWHEQRRFAL

RHMRDFGFGRRQEKLESEIMDEMSLLLDIMKNGPIYDEEKQILKGNLAFFPNILHASAGN

NIWNIMFGHRFDRSEHDMPRRLCRAAVMLQKANDTTGGAIFQRPFLKYFGNMFGYKNHMI 324035

324036 ASNILNNTVK 324065

324505 KYLEYQKYSMNENDERGFIDRYIKKLNEDDNSNNFTEEQLIILLVDFMFPALSALS

GVITHIIKYLM

HYPKIMEKVRNEIDNVVGTGRLVTWEDRKDLPYLEAIIRETLRIETITPLSVIHRTLKKT

MLGGYEIPANTPIFTNLAAMHHDPELWGDPEVFRPERFLTEDGQLGKDISLPFGFGHRLC

AGETYARYNMFGTVALLLQNFNFFFVEGEPSSLEDKDPGLVVFPKDLWIRFESR

 

>CYP369Ab SI2.2.0_04668 locus=Si_gnF.scaffold05901[330076..333081]

78% to CYP369A1 Pogonomyrmex barbatus

328118 MSPFLIVILTFLLVYKLYRFVYDKPPNAPP 328207

329592 GIIRIPIGGSYWMLLWGNYKFPHMTIDYYVKKLKSKIISC YFGDQFVVIANDYESIKQVLARE 329780

329781 EFDGRVTAPFLLDRSFGKDL 329840

GIFFIDGPKWHEQRRFALRH

MRDFGFGRRQEKLESEIMDEMSLLLDIMKNGPIYDEEKQILKGNLALFPDILYASSGNNI

WNVMFGHRFDRSEHDVPRRLCRAAVMFQRANDTTGGAILQRPFLKYF GNMFGYKNHMKAS

NIMEDIVKKYLEHQKASVSENDDRGFIDRYLKKLNEEDKTDNFTEEQLIVLLIDIMFPAF

SALP GVITHIIKYLVHHPRVMEKVRNEIDNVVGTGRLATWEDRKHLPYLEATIRETMRIE

TVTPLSLAHRSVKKITLGGYEIPANTAIFTNLAAMHHDPDLWGDPEVFRPERFLKEDGQL

GKDISLPFGFGHRLCAGETYARFNLFGTLALLLQNFNFFFVEGEPSSLKDKVPGITVIPK

ELWIRFELR

 

CYP3 clan (63 sequences)

44 sequences are complete or only missing the last exon, 19 are pseudogenes

CYP6 (five subfamiles), CYP9 (3 subfamilies) and CYP336 (1 subfamily)

 

>CYP6AQ SI2.2.0_07739 locus=Si_gnF.scaffold03952[1060570..1063032]

72% to CYP6AQ15 Pogonomyrmex barbatus

Si_gnF.scaffold03952 (+) strand

1060570 MALITAYWGLDGIIVLTTLIITLYLYMTRKFGYWKKQGVREATPTPFFGNFTDCMLMKKNP

AHLMKDLYDQGEGMPYIGFYLLDKPCLMIRDREIVKNILVKDFNYFSDRYGSPDINDRLG

YANLFFIKNPAWKFLRTKLTPTFTSGKLKKMFELMIECGKNLDAYLDSLKLEDKGMEMEV

KELTAKFATDIIGITAYGLNVNSLNNPDAEFRKYGKKIFEYNIFRGFEFLSIFFFPTLVR

WTGMRSFGKEATGFLRSVLWETLTERMKSGQKRNDLIDTLIELRNTYKDQNIGGFKFDGD

DLVAQAAVFFTAGYETSSSVMAFTLYELAIHSEIQDRLRKEILDALHETDGKITYDMVMS

LPYLDMVVSETLRMYPPLAFLDRVAVDTYKVPNSDLVIEKGTPIYISMQGMHYNPEFFPD

PERYDPERFSEENKRKIPPCTYFPFGEGPRICIGARMGLLQTKLGIITILSKYEVEPCKK

TLIPMVLDPKGTLTSPMGGDICLNIRNIN

 

>CYP6AQ SI2.2.0_05967 locus=Si_gnF.scaffold01203[623551..626604]

80% to CYP6AQ17 Pogonomyrmex barbatus

MALITVYWSLDVIIIFLTLMATAYLYMTRNFKYWKKRGILEMTPTPFFGNFKECLFLKKA

PAYFLKDIYDETKGVPYAGFYVLDKPFLLVRDRELIKKILVKDFNCFSDRYNSADPADRI

GYANLLFIRNPAWKTIRTKLTPFFTSGKMKKMFNLMLICVKNLDEYLNSLQLEGEGKTIE

VKDLSAKFTTDIIGGTAYGLDVNSFKNPDAEFRKYGKMMFQFNLIRGLEMLAIFFLPTVT

RLAHLKMFGKQPTEFLRKVFWETLTQRMKSGIKRNDLIDILIELKNSNNKDLQDFTFDGD

DLLAQPVSFFAAGFETSSTTTAFALYQLAVEPEIQNTLRKEILEALDETNGEITYDMTSS

LPYLDMVVSETLRMYPPLGYINRMTNQTYEAPEFNLVIEKGTPIYISMLGLHYDPEYFPN

PNKFDPERFNEENKRSRPACVYFPFGEGPHACIGIRFGLLQTKLTLLQILSKYEVTPCEE

TMVPMTIDPRAVLTVPLNGVIHLNFREIN

 

>CYP6AQ SI2.2.0_01866 locus=Si_gnF.scaffold03952[999059..1000786]

72% to CYP6AQ16 Pogonomyrmex barbatus

last exon in a sequence gap

999059 MALITAYWGLDGIIILATLLITLYLYMTRKFGYWRKRGVREATPTPFFGNFTDCMLMKKNP

SHLMKDLYDQGEGVPYIGFYLLDKPCLMIRDREIVKNVLVKDFNYFSDRYGSPDTNDRLG

YANLFFIKNPVWKFLRTKLTPTFTSGKLKKMFELMTECGKNLDAYLDLLILEDKGMNIQV

KDLTAKFATDIIGITAYGLNVNSLNNPDAEFRKYGKKIFEYNIIRGFELLSMFFFPTIVR

WTGMRTFGKEATGFLRSVLWETLTERIKTGQKRNDLIDTLIELQNTYKDQNIGGFKFDGD

DLVAQAAVFFTAGYETSSSVMAFTLYEIAIHSEIQNRLRKEILDALHETDGKITYDMVMS

LPYLDMVVSETLRMYPPLAFLDRVAVDTYKVPNSDLVIEKGTPIYISMQGMHYDPEFFPD

PERYDPERFSEENKRIIQPCTYFPFGEGPRICI (1) 1000786

 

>CYP6AQ SI2.2.0_03692a locus=Si_gnF.scaffold03952[1070077..1077954]

two genes fused

87% to CYP6AQ17 Pogonomyrmex barbatus

1070077 MALITTYWGLDGIIIFLALVVTAYLYMTRNFKYWKKRGILEMTPTPFFGNFKECLFLKKAP

AYFLKEIYDETKGLPYVGFYVLDKPFLLVRDRELVKNILVKDFNCFSDRYNTADPADRIG

YANLFFIRNPTWKAIRTKLTPFFTSGKMKKMFDLMIVCVQNLDDYLNSLQLEGKGKTLEV

RDITARFATDIIGSTAYGLDVNSFKDPDAEFRKYGKMIFHYTTIRGFEMLAIFFLPAIVR

LAQIKMFGKQPSDFMRKVFWETLTQREKSGMKRNDLIDILIELKNSNDQELKDFTFDGDD

LLAQAASFFSAGFETSSTTTAFALYELAMQPEIQNTLRKEILEALDKTNGKITYDLTWSL

PYLDMVVSETLRMYPPLGYLNRMPNQTYKVPEFNLVIEKGTPCYISMLGLHYDPEYFPNP

NKFDPERFNEENKRARPTCVYFPFGEGPHACIGNRFGLLQAKLTLLQILSKYEVTPCEKT

MVPVTIDPRGAMTVPLNGRICE

 

>CYP6AQ SI2.2.0_03692b locus=Si_gnF.scaffold03952[1070078..1077955]

two genes fused

missing C-term

68% to CYP6AQ17 Pogonomyrmex barbatus

MALITNCWSLDSIIILTALIIIAYLYMTRNFKYWKKRG

VLQVTPTPFVGNFMECLLLKKSPAYYLKELYDQAKDEPYLGFYVLDKPILLLRDPEIIKN

IMIKDFNVFYDRYSTSDPNDRIGYANLFSIRNPAWKVIRTKLTPFFTSGKLKKMFNLMLE

SGKHLDDYFDSLKLNDKGLIMDVKDISSKLTMDVISSTAFGLEVNSFQNSNLDFRQYGKM

IFNTTYKRGWEFLSLFFLPNVVRMFKIKLFGEETTAYLRKLFWEAISTRMKSGEKRYDLI

NILVELKKNESDKEIDGFRFDGDDLMAQAASFFSAGFDTSAVPIAFALYELALQPDIQST

LRKEIHEVLNNFDGNITYDMLLSLPYMDMVISETLRKYPPLGFLNRKAMQTYEIPDSNLV

LEKGMPVYIPMLGLHYDSKYFPDPDKFDPERFNEENKRNMPSCVYFPYGEGPHACIGTRF

GQLLIKLTLTKIL

 

>CYP6AQ SI2.2.0_07409 locus=Si_gnF.scaffold03952[984074..986365]

68% to CYP6AQ10 Linepithema humile

MDCMLMKKNPSHFMKDLYDQGEGVPYIGFYLLDKPCLMIRDREIVKNILVKDFNYFSDRY

GSPDTNDRLGYANLFFIKNPAWKFLRTKLTPVFTPGKLKKMFKLMTECGKNLDTYLDSLK

LENKGMEMEVKELTAKFATDIIGITAYGLIVNSLNNPDAEFRKYGKKVFEYNIVRGFEFL

SMFFLPTLFRWTGMRTFGKEATGFLRTVLWETLTERMKSGRKRNDLIDTLIELRNTYKDQ

NIGGFKFDGDDLVAQAAVFFTAGYESSSSIMAFTLYELAIHSEIQDKLRKEILDALHEND

GKITYDMVMSLSYLDMVVSETLRMYPPLAFLDRVTIETYKVPNFDLVIEKGTPVYISMRG

MHYNPEFFPDPERYDPERFSEENKRNIPSCTYFPFGEGPRICIGARMGLL

QIKLGIITILSKYGVEPCQKTLIPMVLDPRGTLTSPMGGDICLNIRKINTLYSS

 

>CYP6AQ SI2.2.0_15722 locus=Si_gnF.scaffold06627[10972..12979]

80% to CYP6AQ17 Pogonomyrmex barbatus

missing C-term, last exon in a sequence gap

MAFITVYWSLDVIIIFLTIMATAYLYMTRNFKYWKKRGILEMTPTPFFGNFKECLFL

KKAPAYFLKDIYDETKGVPYAGFYVLDKPFLLVRDRELIKKILVKDFNCFSDRHNSADPA

DRIGYANLLFIRNPAWKTIRTKLTPFFTSGKMKKMFDLMIICVKNLDEYLNSLQLEGEGK

TIEVKDLSAKFTTDIIGSTAYGLDVNSFKNPDAEFRKYGKMMFQFNMIRGLEMLAIFFLP

TITRLAHLKMFGKQPTDFLRKVFWETLTQRIKSGIKRNDLIDILIELKNSNNKDLPDFTF

DGDDLLAQPVSFFAAGFETSSTTTAFALYELAVKPEIQNTLRKEILEALDETNGEITYDM

TSSLPYLDKVVSETLRMYPPLGYINRMTNQTYEAPEFNLVIEKGTPIYISMLGLHYDPEH

FPNPNKFDPERFNEENKRSRPACVYFPFGEGPHACI (1)

 

>CYP6AQ pseudogene on both strands

SI2.2.0_04515 locus=Si_gnF.scaffold10523[10963..12207]

66% to CYP6AQ17 Pogonomyrmex barbatus

first part on plus strand

10963 MALITVYWSLDVIIIFLTLMATTYLYMTRNFKYR*KRGILEMKPTPFFGNFKECLFLKKA

PAYFLKDIYDETKGVPYAGFYVLDKPFLLVRDQELIKKILVKDFNYFSE*YNSADPADRM

GYANLLFIR NPAWKTIRTKLTPFFTSGKMKKMFDLMIICVKNLDEYLNSLQLE (1)

GEGKTIEMKDLSARFTTDIIGSTAYGLVNPFKNPDAEFRKYGKMMFQFNTIR ()

GLGDARDIFPSNCNSF

GTFKDVRQTAYGLPAKSLLETLTQRMKSGIKRNDLIHILIELKNSNNKDLQDF ()

TFDGDDL

LAQPASFFATDFETSSTTMAFTLYELAVEPKIQNTQKEILEALDKTNGKITYD 12204

 

Minus strand has last two exons 1.3 kb away (presumably one pseudogene)

14032 *TWSLPYLDMVISETLKMYPPLGYINRMTN*TYEVPEFNLVIEKGTPIYISMHGL

HYNPEYFPNPNKFDPERFNEENKRSKPACVYFPFGEGPHACI (1)

GNRFGLLQAKLTLLQILSKYKVTSCEETIVPMTIDPRGVLTVPLNGVIYLNF*EIN 13490

 

>CYP6AS26 Solenopsis invicta (Lausanne fire ant) EST EE143495.1

SI2.2.0_00515 locus=Si_gnF.scaffold10535[567736..570140]

72% to CYP6AS62 Pogonomyrmex barbatus

MELFEILCGIAVIIIIVYYFLTSTFNFWKSRGVRGPRPIPGYGNIKDILMLKQFFGDFAT

KLYNDYKNEQFIGIFARRTPILIVKDLDLIKDILIKDFTKFADRAPVPITERAEPLSQHL

FNLEAKRWRPLRMKLSPVFTSGKLKDMFFLISECADHLVQYMEKLVSRSEPIECRELTAK

YTTDVIGSCAFGIEINALSDNDSEFRKMGRKVFDQPWSNRLRMRLKQMAPKFYDMLGYVL

PQMDITKFFTRIVVETMDYRDTHNVVRNDFIDKLRELKKHPEILGDIPLTDSLIASQAFV

FFLAGFETSSTTMSNALYELALNRKIQDKLREEITETYLKHGENLTYENIKEMDYLDKIF

KETLRKYPPVAILMRRSMTSYTFEGTNVSIPKNQRVWIPAYAIQRDPNIYPKPDVFDPER

FTDEAVQSRHPMSYLPFGDGPRNCIGARFAVHQTKVGLIKILRNYKVETCEKTPIPYVND

PKAFLLAPKGGIHLKIVKIN

 

>CYP6ASa SI2.2.0_07734 locus=Si_gnF.scaffold02797[2160854..2163860]

76% to CYP6AS65 Pogonomyrmex barbatus

70% to CYP6AS42 Linepithema humile

MAGIFEILCACVVILYLIYRYVTADFNYWTSRGINGPKPVPFFGNVAKFMMGKKCLGDVY

KEIYDQYPTESVVGIFRRTRPVLLLRDAKYIKQVLIKDFATFTDRNAFVYDKAEPMSMHL

FRLDAVRWRPLRTRLSPTFTSGKLKDMFHLLLNCADYFEKYLDEKVPENGVVECKDLTSK

FTVDVIGSCAFGLEMNALKEENNEFQKMGRYIFRSSPTVILKNTLKEIPWFYKNFGHLID

DHEITKFMTDITRSTIEYRKQNNIHRHDFIDTLIDIKDNPDKLGFD ()

ANVTDEFIAAQAFVFFAAGFETSSTTMSHAMYELALNQSIQDKVREEIKEVLNNSNGEI

LYDDIKKMTYLEKVFQETLRKYPPVMYLVRKPIKNYTFEGTKINLRKGQDVIIPIYAIQN

DPNIYPDPEVFDPERFSPENMEQRNSMYYLPFGDGPRNCIGARFAVNQTKVGLIKVLMNY

KLDVCEKTQIPVVLAPLSGLMFQTTHGIYVKLSKIT

 

>CYP6ASc SI2.2.0_08052 locus=Si_gnF.scaffold02797[2165345..2167910]

86% to CYP6ASa SI2.2.0_07734

71% to CYP6AS42 Linepithema humile

MAGLFEILCACVVILYLIYRYVTADFDYWTSRGINGPKPIPFFGNVAKFMMGKKSLGDMY

KEIYVQYPTESVVGVFLRGRPVLLLRDPKYIKQVLIKDFATFIERSTFINDKAEPMSMHL

FRLDAVRWRPLRTRLSPTFTSGKLKDMFHLLLNCADYFEKYLDKKVSENGVVECKDLTSK

FTVDVIGSCAFGLEMNALKEENNEFQKMGRYIFRANTAIVFKSMLREIPWVYKNFGHIFD

DHKVTKFITDITRNTIEYRKKNNIRRHDFIDTLIDLKDNPDKLGFNNVTDEFIAAQAFVF

FAAGFETSSTTMSCAMYELALNQSIQDKVRKEIKEVLNSSDGVILYDDIKKMSYLEKIFQ

ETLRKYPLVMFLMRRPIRNYTFEGTKIDLRKGQEVIIPVYGIHNDPNIYPNPEVFDPERF

SPENMEQRNSMYYLPFGDGPRNCI ()

2168030 GARFAAYQTKVGLIKVLMNYKINVCEKTQIPIVLAPQSPLTLQTTHGIYVKLTKLI* 2168200

 

>CYP6ASb SI2.2.0_01135 locus=Si_gnF.scaffold10535[550245..552460]

72% to CYP6AS52 Linepithema humile

MGLFEILCGTAVLFLAFYYFFTSSFDFWKSRGVRGPKPIPGFGNFKDVLLVKISAGEYVK

KVYNDYKDESLIGIFARTKPILIVKDLNLIKDVLIKDFSTFADRGVHTFEKAEPLSQHLF

SLESKRWRPLRMRLSPVFTSGKIKEMLSLISECADHMVEYMEKIVSKDEPVECCELTAKY

TTDVIGSCAFGINMNALSNEDSEFRKMGRKVFHPDWMHFLRIRFREFYPQLYNMLGCILP

QMETHTFFTRVITETINYRETNNIIRNDFVDMLRELKKNPDKLGDINLTDSLLASQAFVF

FLAGFETSSTTMSHALYELALNQKIQDKLREEIDMVYTKYGKDLILDNIKEMKYLDKVFK

ETLRKYSPGTLLQRESTSSYTFRGTNVSIPKNQKIFIPVYAIHQDPSIYPEPDVYDPERF

TDEAVQKRHSMAFLPFGDGPRNCIGARFAIYQSKIGLIKILRNYKVETCEQTLIPYVSNP

KAFVFSPKGGKIQLKMTKI

 

>CYP6BC SI2.2.0_09260 locus=Si_gnF.scaffold05118[811209..812947]

85% to CYP6BC4 Pogonomyrmex barbatus

MLGIVAILLDPFVLIGFILGSLYFYLTATFDFWKCRGVPFKKPTVLLGNFGPLLLFRRSQ

PEGVKEMYQWFKDERFFGAFRVRSPVLILRDPDLVRSVCVKDFACFSNRGIPVNNDQDPL

SGHLFNLEGRKWKGLRSKLTPAFSSGKLKRMFYLLVECCEELQRLIDEASSNGDQTVEVR

ELAAKFIIDVIGSCAFGIQINALTDEESEFHRAVKRLSKPSYKATLWRMLRTAMPRLYRL

LGVQLVDPSVTKFFMHVVSQMISQRESNGTTRHDFMDLLIELRNKGTLENEAGSPTICSD

EDAQAAKEIELDENAIAAQAFAFFIAGYETSSNTIAFCLYELALNQEVQDKTRREVRDAM

RGGKLTYEAVQEMKYLDMVIL

KTLRKYPPAPLFS

RRCEYKYQIPNTNVELPAGMRVIIPIYGLHHDPNHYPDPTRFNPERFTDENKRTRHPYTY

LPFGEGPRNCI (1) 812944

814078 GMRFALLQIKMGIIAFLKDHRVEICDKSTVPIKFSRRSLVTTSETGFWLTITPS* 814242

 

>CYP6BE SI2.2.0_05728 locus=Si_gnF.scaffold05127[137157..141950]

68% to CYP6BE6 Linepithema humile

MVFAELIAIFIGVLSFAYIYYK

YVVFNFWHKKGVFYVEPVVPTGNITGKEHVGKYFXLNKMKVLSTGVFFHDAYLKYKGHRV

FGTYTFFKPNLVIADLDLIRTVLTKEFQSFHDRGMYCNEKIDPLTGNLFLMPGKRWRNMR

VKMTPTFTSGKIKQMFAIMKECGEELAKHLENKAKMRDSIEIKDILASYTTDVIMSTAFG

VKSNCVQKPNNEYRIQGKKVFDINYIKLALAMFAPQIMEFFSIPFTPQSVTDFYMKMFQE

AVEYRQAHHIVRHDFMNLLIQLMERGYVDPEDDKKTIDESCNIHTIVNKLTMAEATAQSF

AFFVAGFETSASTATYTLYELAQYQNIQDKVRKEIDEMLVKHGDLTYDAINDMTYLHKVI

NGKYTYMKYPSLPILNRICTEEIDLPTTNIRVPKGTLITVPVLGVHRDPSIYPDPDKFDP

ERFNVDKVKERHPYAYIPFGEGPRNCIGSRFGYLQMKIGLVSLLSKYKFKLHSRTPVPLN

FSERSIVLTAK

 

>CYP6BEa SI2.2.0_09464 locus=Si_gnF.scaffold07259[20690..25555]

68% to CYP6BE6 Linepithema humile

MVLAELIAVFIGVLSIVYVYYK

YVIFNFWRKKDVFYVEPVVPTGNITGKEHVGKYFCLIXLXLNKMKVLSTGVFFHDAYLKY

KGHRAFGTYTFFKPNLVIADLDLIRTVLTKEFQSFHDRGMYCNEKIDPLTGHLFLMPGKR

WRNMRVKLTPTFTSGKIKQMFVIVKKCGEELAKHLENKAKMRESIEIKDILASYTTDVIM

STAFGVKSNCVQKPNNEYRVQGKKVFDINYIKLALAMFAPQIMEFFSIPITPQSVTDFYM

KMFQEAVEYRQAHHIVRHDFMNLLIQLMEKGYVDPEDDKKTIDESCNIHTIVSKLTMAEA

TAQSFAFFVAGFETSASTATYALYELAQYQNVQDKVRKEIDEMLIKHGDLTYDAINDMTY

LHKVMNGKYTYMKYPSLPILNRICTKEIDLPTTNIRIPKGTLITVPVLGVHRDPSIYPDP

DKFDPERFNVDKVKERHPYAYMPFGEGPRNCIGSRFGYLQMKIGLVSLLSKYKFKLHSRT

PVPLSFSERSIVLTAK

 

>CYP6BEb SI2.2.0_08400 locus=Si_gnF.scaffold07259[82365..85759]

65% to CYP6BE6 Linepithema humile

MLAELIGIFIVILSIVYIYYK

YVIFNFWRKRGVFYIEPVVPIGNIAPLVIGKSQIGKYFXQILICVFFHDIYLKYKDHPVF

GTYSLFKPNLVVADLDLIRTLLIKEFKSFHDRGAYCNEKVDPLTGNLFLMPGKRWRNMRF

KLTPTFTSRKIKQMFFILKECSEELVKHLESKAQVRESVEIKDIIGRFMTDVIMSTAFGV

KSNCIEEPNNEYRVQGKKIFNLSSIKIAMTFCVPQIMDFFSIPLLPRSVTNFYMNMFREN

VENRKANHIVRHDFMNLLIQLMERGFVDPEDNKTIINESSAINKLTMTEATAQSFAFFGA

GFETSSSTVTFALYELSQYQDIQDKTRNEIDEVLAKHGELTYDAVNDMTYLQKVIKTLRK

YPPIPILNRVCTEEIELPNIRIPKGTLITIPLLGLHRDPSIYPNPEKFDPERFNADEIXK

RHPYAYMPFGEGPRNCIGLRFGYMQTKVALVSLLSKYKFKLHSRTSVPLHFIEGS

 

>CYP6BEc.1 Si_gnF.scaffold07259[95193..98504]

SI2.2.0_06333 with a different exon 1

69% to CYP6BE6 Linepithema humile

GC boundary at KVIN

98504 MVLVELIGAFIIALSIVYIYFKYVIFHFWRKRGVFYPKPVVPIGNVTELIM (1)

GVFFHDAYLKYKGHGVFGMYSFYKPNLVIADLDLIRTVLTKEFGSFHDRGMFYN

EKIDPLSGHLFFMPGKKWRNLRVKMTPTFTSGKIKQMFPILKDCSDELTKYLEDKALMRE

SVEMKDMFAR (2)

YLTDVIMSTAFGIKSNCIEEPNNEYRIQGKKIFEANSIWIILVMFVPQIMDFFCIPL

TDRQVTNFYMNMFRKSVEYRQAHNIVRHDFMNLLIQLMERGYVDPDDKKTANTS (1) 

SAVNKLTLAEATAQSYIFFLAGFESSSSIATHALYELAQNQDIQDKVRKEIDETLTKHD

DLTYDAVNEMIYLHKVIN (1)

ETMRKYPPLPVLNRICTKEIVLPTANIHVPKGTLITIPVLGLHRDPS 1664

LYPDPDKFDPERFNAVEVAERHPYAYLPFGEGPRNCI (1)

GARFGYVQMKVGLVNLLSKYKFKLHSRTPVPLTFNEKSVTLAAKDGIYLIIEPR* 95193

 

>CYP6BEc.2 Si_gnF.scaffold07259[102015..106503]

64% to CYP6BE6 Linepithema humile

N-term is in a sequence gap

GC boundary at KVIK, first intron does not have a gt boundary

106503  IGAFIVILSIIYIYYKYVIFNFWSRRGVFYVKPVVPTGNIAALIT (?)

GIFFRDAYMKYKNYRAFGMYSLFKPNLLIADPELIRLVLTKEFESFHDRGM

YCNEKIDPLTGHLFLMSGKRWRNMRVKLTPTFTTGRIKQMFSIIKECGNKLADYLDRQAQ

MRESIEIKDILSR (2)

YTTDVIMSTAFGINSNCIEEPNNEYRIQGKKVFYFKSLWIALFMFVPQIMNFFSIPLTN

RSVTNFYMNIFRQNVEYRQAHNIVRHDFMNLLIQLMEKGYLDPDDDEKTNE (1)

AAVDKLTMIEATAQSYVFFIAGFESSSMTAAFTLYELAQREDIQNKLRKEIDEVLSEHGG

LTYDAVNNMIYLSKVIK (1)

ETLRKYPPLPILNRICTEEIVLPTTDIRIPKGTIITIPVLGLHQDPSIYPNPDTFD

PERFNLDEVAKRHRFAYLAFGEGPRNCI (1)

GKRFGYIETKIGLVCLLAKYKFKIHPRTQIPLVFNPQTLGLAPKGGIHLIIEPR* 102015

 

>CYP6BE SI2.2.0_00435 locus=Si_gnF.scaffold04311[9322..11443]

60% to CYP6BE6  Linepithema humile

C-term exon is a sequence gap

MVFIVLIGIFIGVLTCVYIYFKYVVFNFWRNLGVFFPEPVVPIGNVAAIVARKVPV (1)

GIFFQD

MYMKYKHHGAFGLYTFFKPNLVITDLELIRTVLIKNFHNFHDRGFYCNEKIDPLTGHLFL

LSGQKWKNMRAKLTPTFTPVKIGQMFEIAKKIGNNFAIYLENKAQMKESIEMKDMFSRYT

TDVIMATAFGINSNCINEPNNKFRIYGKKILKVNSIWVAIFMFAPQIMNFFSIPITHRSV

TKFYMKMFREIVEYRQNNKIINNDFVDLLMELMENSHNDNKPDKAIKLTMVEATAQSFAF

FVAGFETSSATASYTLFELAQNQNIQDKLCDEIDQVLKKYGDLTYEALKNMTYLHQVIQE

SMRKYPSVPVLNRICTEEIDLPITDIDVCIPKGTLITIPVLGIHRDPTIYPDPDKFDPER

FCEDENKKRHSCAFLSFGEGKRKCI (1)

 

>CYP6BE SI2.2.0_08209 locus=Si_gnF.scaffold03126[1796785..1799367]

64% to CYP6BE6 Linepithema humile

N-term exon and C-term exon are in sequence gaps

GVYFQDIY

MKYKHNRAFGIYTFYKPNLVIADPNLIRIVLTKEFERFHDRGFYCNEKIDPLTGHLFLLS

GKKWRTMRTKLTPTFTSGKIKQMFTIVKEIGNELAKSLENKAQMRDSIEMKDMFSRFSTD

VIMSTAFGLNSKCIDQPNNAYRIQGKKTLKINSIWIALFMFAPQIMKFFSIPITYRSITN

FYMNMFRENVEYRKTHNIIKHDFVNLLIQLMEKGYLDNDNNKTDEETKLTMAEATAQSFA

FFIAGFETSAATATFALYELAQNENIQDKLREEIDEVLIKYGDLTFDALNDMTYLHKVIN

ELSEELHIFLLNIAESMRKYPSVPILSRICTEEIVLPTTDIHIPKGTLITIPVLGIHRDP

AIYPDPDKFDPERFCEDEIKKRHPYEFLPFGGGQRKCI (1)

 

>CYP6BE SI2.2.0_00612 locus=Si_gnF.scaffold05127[124354..130798]

Missing N- and C-term

68% to CYP6BE6 Linepithema humile

MVLVELIGAFIVVLSIVYIYYKYVIFNFWRKRGVFYIEPVVPTGNVTPLVT (1)

GVFFHDAYLKY

KNHRAFGMYTLFMPNLVIADLDLVRTVLTKEFKSFHDRGMYCNEKIDPLTDHLFLMSGKR

WRNMRVKMTPTFTSGKMKQMFVILKECGEELAKYLDSKAQTRDSIEIKDTFGRYTTDVIM

SAAFGIKSNCIEEPNNEYRVQGKKIFDVNSIKLAMFFFAPQILDFFSIPFTERSVTDFYM

KMFRETVEYRQANQIVRPDFMNLLIQLMERGYVDPEDDRKTTVSSNISKLTMAEATAQGF

VFFAAGFETSSSTATFALYELAQYQDMQDKVSNEINEILAKHGGLTYDAVNDMTYLHKIL

NETLRKYPPLPILNRICTEEINLPTTNIRLPKGTLITIPLLGIHRDPSIYPDPDKFDPER

FNADKVEKRHPYAFIPFGEGPRNCI (1)

GLRFGYLQTKIRLIYLLSKYKFKLHSWTPVPLAFSERSFILTPKSGVYLTIEPR*

 

>CYP6BE SI2.2.0_09066 locus=Si_gnF.scaffold00695[58649..62286]

60% to CYP6BE3 Linepithema humile

MVFAELIAFSITVLNIIYFYFKYIIFNFWRKRGVFYVEPIVPIGNFTPIVTGRKQY (1)

GVFFNDAY

SKYKEHRAFGMYGFFTPILVITDLNLMRTVLLKEFHSFHDRGLYCNEEIDPLTGHLFLIS

GENWKNMRNKIISIFTSARMKEMFPILKECGDELAMYLESKAQIRDSIEIKDIFARYTTD

VIMSTAFGIKSNCIQEPNNEYRNQGKKIFGIHFIKLALMYSAPKIFDLLRIPLTPRSVTN

FYSNMFRETVEYRKSHPNIIRKDFVNLLMQLMEKGCVNSKDDKETIDKSSTVNKLTMMEA

TAQSFVFFAAGFETSASTATFALYELAQHHDIQDKLRNEIDEVLEEHGDLTYGALEDMTY

LQNVIDETLRKYPPVPVLNRICTEEIDLPTTNIRVPKGTLIIIPVLGVHRDPSIYPDPDN

FDPERFNKDKRKERHRYAHMPFGQGPRNCIGLRFGYLQTKIALVSLLSKYKFQLHLRTPV

PLSFNERC

 

>CYP6BE PSEUDOGENE SI2.2.0_07415 locus=Si_gnF.scaffold06568[34913..36349] (-) STRAND

52% to CYP6BE6 Linepithema humile middle region

80% to CYP6BE SI2.2.0_00435

missing N-term and C-terms in sequence gaps

CYP6BE PSEUDOGENE SI2.2.0_03123 locus=Si_gnF.scaffold06568[26946..28258] (-) STRAND

60% to CYP6BE3 Linepithema humile

MIGHT BE THE C-TERM OF SI2.2.0_07415

36349 FFKPNLVIADLDLIRLLKTNFHNFHDRGFYCNEKIDPLTGHL (?)

FLLFGQKWKNMRAILTYTFTPAKMKQMFEIVKEIGNNFAMYLENKAQMRDSIEIKNMFSR (2)

YSTDVIMSTAFGINSNCINKPNNEFRIYGKRTLKANSILVSIFMFAPQIMKFFFI

SITHQSVTNFYMKIFRENVEYRQVNRIIRNDFVNLLMKLMENSHIDNYDNKPDK (1)

ATKLTMAEATAQSFAFFIAGFETSSATTSYALFELAQNENMQGELK (2) 34913

(29 aa gap)

28258 QDKFRDEIDEVLKKYGDLIYKALNNMTYLDKVIN (1)

ESM*KYPSVSILNRICTEEIDLPLTDIDIRVSKGTLITIPVFGIHGDPTIY

PDPDKFDPERFCKDKKEKRHPCAFLSFGKGQRKCI (1)

SELFGLMQTKVGLVGLLSKYKFTLYPRSKKPFIFSEKCIGLGVKGIYFIIKPRK* 26946

 

>CYP6BE Pseudogene SI2.2.0_02014 locus=Si_gnF.scaffold00310[250516..252506] (+) strand

67% to CYP6BE SI2.2.0_00612

250516 VRDSVEMKDI

251263 NYTTDVIMSTAFGVKSN

CIQESNNEYRIQGKK

ISDKNSNKVVLFSSAAQIFNFFSIPFTARYRQTRFY

HDIVRHDFMNLLVQLMERSYVDPDDKKTIDELC

VNKLTVIEATAQSFAFFAVGFETSSSTATFALYKLAQYQNIQDKVRKEIDEMLVKYGNLI

YDAINDMTYLHKVINGKYTDM

KYPPAILTRICIDEIDLPTTNICVSKGTLIIIPLLGAHRDPSIYPDPDKFDSERFNADK

VKERHPYMPFGEGPRKCIG 252506

 

>CYP6BE C-term pseudogene fragment SI2.2.0_01770 locus=Si_gnF.scaffold06503[13719..14818]

74% to CYP6BE6 Linepithema humile C-term fragment (last two exons)

90% to SI2.2.0_00612

14818 ETLRKYPPLPILNRICTEEIDLPTTDIHLPKGTLITIPLLGIHRDPSIYPDPDKFDPERF

NADKVKERHPYAFMPFGEGPRNCI (1)

GSRFGYLQTKVGLIYLLSKYKFKLHSRTPVPLAFSERSAILAPKSGVYLTIELR* 13719

 

>CYP6BE pseudogene SI2.2.0_01758 locus=Si_gnF.scaffold06944[34820..35494] (-) strand

60% to CYP6BE7 Linepithema humile C-term

35494 ETLRKYPPLSILFRKCTRDLDVSDTDIHISKETIVIIPVLGLHRDPTIYPDPDKFDLERFT

EANKATRHSSAYL &

PFGDGPRMCM (1)

GMKFAFSQIKVGLAKLLLKYKFKPHLKISIPLTIDKTSVLIVAPKRWNTSNH* 34820

 

>CYP6BE pseudogene SI2.2.0_16115 locus=Si_gnF.scaffold02127[776132..777529]

 (plus strand fragment, N-term) 92% to SI2.2.0_00612

777374 MVLVELIAAFIVILSSVYIYYKYVIFNFWRKRGVFYIEPVVPVGNVTPLVTG 777529

(minus strand fragments, C-term, 8 base pairs separating + and – strand fragments)

73% to SI2.2.0_00612

777365 YNAINDTAYLQKVIN

EALRLYPSLPIFNRICTEEIDLPIVNIRMPKGTLITIPLLGLHRDP

SIYSDPNKFDPERFNDDEIK

KRHSYAYMPFGEGPRNCI

GMRFGYLQTNIGLVSLLLK

YKFKLHSWTPVPLTYSERSPSLEPKTGAHLIIEKR* 776132

 

>CYP6BE pseudogene SI2.2.0_16165 locus=Si_gnF.scaffold06767[19118..20698]

86% to SI2.2.0_09066

20698 FAFFAAGFETSASIATFALYELAQYHDIQDKLRNEIDEVLKEHGDLIYGVLNNMTYL

HITETLRKYPPVPVLN

*ICTKEIDLPTNPTTNIRVPKETLIVIPVLGVHRDPSIYPDPDNFDPERFNKDIE

EKRHRYAHMQFGQGPRNCI (1)

GMRFGYLQTKIALVSLLSKYKFQLHSRTPVPPSFNERCLVLEAKTGVHLIIEPR* 19118

 

>CYP6BE pseudogene SI2.2.0_16294 locus=Si_gnF.scaffold10523[3..1342] (-) strand

56% to CYP6BE6 Linepithema humile I-helix region

1342 MATAFGIQSNCIKQQNHEFTYWGKQVFGEASIWKVLFMFS

VMKFFSIPFTDKETSKFFMDLFQENMNYRKNNNIISEDFMNALIQLMEKGYIKYDNKKDVIGDLC

ADVNKLTIAEAAAQAFGFFLAGYETSATTASYCLYELACNPDIQDKVRTEIDELLEK

HGEISYEAANEMKYFQNVIN

ETLRKYPPLSILFRKCTRD 3

 

>CYP6BE pseudogene SI2.2.0_15268 locus=Si_gnF.scaffold07231[3189..3426] (-) strand

53% to Cyp6BE6 Linepithema humile

3426 TMRKYPPVLTLIRKCTEDVYLPTVNIFIAKESLTVV

LCGIRDSANYSDPDMFNLKRFNEKNKASRHPYTYLSFGKGPRKCI 3189

 

>CYP6BE pseudogene SI2.2.0_14847 locus=Si_gnF.scaffold07685[18066..18685]

83% to CYP6BE SI2.2.0_09066

3160 RYTTDVIMSTAFDVKSNCIQEPNNEYRI*GKKIVDIHFIKLALMFSAPKIFDFLRIPLTP 2981

2980 RSVTNFYSNIFREAVEYVRKSHNIVRNDFMNLLMQLMKRGRVNSKDDKEIIDES () 2819

2641 STVNKLTMMEATAQSFAFFAAGFETSASTATFALYELAQHHDIHYEDKLRNEIDKVLEE 2465

2464 HGDLIYGSLK & 2435

2430 DMTYLQNVIDD 2398

2232 ENLRKYPPVPVLN

2195 ICTKEIDLPTTNIRVPKGTLIIIPVLGVHRDPSIYLDPDNFDPSTKRFNKDKGEERH 2025

     RNCIG 1999

1226 RFGNLHTKIALVSLLLKYKF 1167

1165 RTPVPLTISFNERC 1124

 

>CYP6ES SI2.2.0_02304 locus=Si_gnF.scaffold02694[5543719..5546056]

78% to CYP6ES3

MDCLIYFTTVLIIFVSLFYAYAKYRLSYWSRRGVKSLPTHLLFGNFKECITLKKPPAEVM

REIYNGADPDDLYIGFYIFHKPMLLLRDHDLIKQVMIKDFDVFPNRRFGSGIEKDSVGLD

SILSIKQPRWRYLRNKLTPILTGQKLKNMIPLMAECGKSMLNFIEKLSTDEAGQSKWEVK

DIGGRYSTDVMASLAFGISINSFDEKETAFLKNGTKIFRGFMRGIAFIILFFLPEWDFLV

APFIKQPANYFREIFWDSMNNREKLGFKRGDMIDSMLALKNGEQNPIYKFEGDNLLAHPS

SFYIAGFEASATAIAFALYDLARHPEHQDTLYNEIKTHLSGKELTMDLINELSFLDSVIA

ESLRLHPPLPVTDRIATRNYELPNTGLTIEKDVPVYVSVNSTNQDPKYFSNPRDFIPLRT

DNRENRKFYESLAFGIGPRSCIGQRLALLIVKVALITILSNYTMSYETDKKCTSSNNDAI

HVFTYAADGLYVKFKKR

 

>CYP9P SI2.2.0_02683 locus=Si_gnF.scaffold02632[448..1998]

71% to CYP9P11 Linepithema humile

MDSSLFLSPFTLLLIT

LIVIGVLKVVTVMYSTYFFWRNKGVPYLPNSLSSFITSWKLFFGRLSFADHFKFLYDYFP

NAKYVGMMDFGTPVVLLRDPELIKDVTVKDFEHFMDHRSFVDEDLEPLFGKNVFALRGDR

WKEMRNTLSPSFTASKMKLMFDLISKCSEDFVNYLVDHPEICHEIEIKGVFRRYTTDVIA

TAAFGISVNSMKDRENEFYMRGVETTKFFGGFLSLVKMIFMRVFPKLSKWMDLTFFPSAT

AKFFKTVVAETIKVREEQNIVRPDMIHLLMQARDKKSASTHQMTLEDIVSQAFIFFLAGF

DTASTLMCFVVHELAVNKDIQDRLRQEVQKYFAEGNGKISYDSLSQMSYMDMVISEALRK

YPPSIFIDRLCTKRYELPPSQPGGKNVIVEPNNMLLLSVYGLHRDPQYFPNPDKFDPERF

SEENKDNIVPYSYLPFGHGPRKCIGNRFALMETKILIAHLLQKFTLKTTEKTVEPVVFNT

KEFSLQPVGGFWVSLEKRET*

 

>CYP9P pseudogene

SI2.2.0_07988 locus=Si_gnF.scaffold10311[243793..245296] (+) strand

73% to CYP9P13 Linepithema humile

one frameshift with a short deletion and a stop codon

MDSSLLSSAFTL

LLITLIAIGVDILKVVTVMHRSYFFWRNKGVPYLPNSLSSLLTG*KLFLRRISFADYCIFL

YDYFPNAKYIGMMDFGTPAVLLRDPELIRDVMVKDFEHFPDHRSFVDEESLTNIFALRGD

RWKEMRNTLSPSFTASKMKFMFDLISKCSEDFVNYLADHPEICHAIETKGALRRYTNDVI

ATAAFGISVNSMKDRENEFYTRGLEATKFSSGLL &

QWMGLTFFPSATAKFFKTVVGETIKA

REEQDIVRPDMIHLLMQARDKKSASTHQMTLDDIVSQAFIFFFAGFDTSSTLMCFVVHEL

AVNKDIQDRLREEVRQHLAEGNGEISYDSLSKMSYMDMVISETLRKYPPTIFIDRLCTKR

YELPPSQPGCKNAIIEPNNILMFPIYGIHRDPQYFPNPNKFDPERFNEENKDNILPYTYL

PFGHRPRKCIGNRFALMETKILIAHLLQKFILKTTEKTVEQPVVFNKKEFSLQPVGGFWIGLEKREM*

 

>CYP9P SI2.2.0_07302 locus=Si_gnF.scaffold01412[789..2342]

72% to CYP9P7 Linepithema humile

MESLISLPFVL

LLITLVAIGVLKIVTVLHDAYFHWKNKGIPYMPNSLSSFIASWKLFFGYTTLPEHCQYVY

NYFPDAKYFGTVDFFTPFPIVIVRDPELIKNIAVKDFEHFTDHRSFIDETVEPLFGK

NIFSLRGDRWKEMRNILSPSFTASKMKFMFELISKCSHNFVNYLVDHPELCCEMETKGAF

RRYTNDVIATAAFGISVNSMKDRDNEFYTRGVEATTFATGILAIAKITFLRACPRLAKLM

GVSFFPPNTLKFFRRIVGETVKAREEQDIIRPDMIHLLMQARDKESASAPKMTLDDIVSQ

AFIFFFAGFETTSIMMCFAAHELAVNQDVQDRLREEVQQYLIEGNGEISYESLSKMTYMD

MVISETLRKYPPVVMTDRLCTKKYELPPSLPGFKNVIIEREDQVLFPVYALHHDPKYFPN

PNKFDPERFNDENKDSIVPYTYLPFGLGPRMCVGNRFALMETKILIAQLLQNHVILPVFA

LHRDPKYFPNPNKFDPERFNNENKDNILPCTYLPFGFGPRMCVGNRFALMETKILIAQLL

QKFTLKTTEKTVEPVVFSRKDFNIQPVGGFWIRLEKRET* 2342

 

>CYP9P Si_gnF.scaffold01412[5666..7222]

5666 MDSSILLSTFVLLLTTLVVIGILKIATVLYYAYFHWKNKGIPYVPN

SLSSLIMSWKMLLGQATFPDYCQYLYYYFPDAKYFGTVDFFMPWPIMIVRDPELIKNITV

KDFEHFTDHRTYIDENVEPLFGKNVLSLRGERWKEMRNILSPSFTANKMKFMFELILKCS

HDFVDYLADHPELCHEIEAKEAFRRYTNDVIATAAFGISMNSMKDRDNEFYTRGVEATKF

ATGLLAMAKLIFISSCPGLAKLMGVSIFSSDTLKFFEKIVEENIKAREKQDVIRPDMIHL

LMQARDKENASGHKMTLGDIVSQAFIFFFAGFDTSSMLMCYVAHELAVNQDIQDRLREEI

QQYLIEGNGEISYESLSKMPYMDMVISETLRKHPPAVISDRVCTKKYELPPSQPGCKNVI

IEAGSHVILPVFALHRDPKYFPNPNKFDPERFNNENKDNILPCTYLPFGFGPRMCIGNRF

ALMETKILIVQLLQKFILKTTDKTVEPVVFSKKEFALQPVDGFWIALEKRET* 7222

 

>CYP9P Si_gnF.scaffold02230[1197581..1199125]

1197581 MDLSLLSSPFVLLLITVVLIVVLKIVTV

LHHVYFYWKDKGLPCLYNSLSSILTDWKLFSNFTLVEYGQYIYYNFPDARYIGTVDSSTP

SVFIRDPELIKDIMVKDFEHFTDHRSFIDENSDPLFGKNTFFLRGDRWKEMRTTLSPSFT

ASKMKFMFDLVSKCSQDFINFLIDHPNFCHMIDMKEAFRRYTTDVIATTAFGISVNSMKD

RDNEFFTKGIEATQFSVGLLAKLKIIFLRECPRLSKLMGLTLFPSNMSKFFKNVVEETIR

VRKEQNIVRPDMIHLLVQARDKESASVHKMTLDDIVSQAFSFFFAGFDTTSTLMCFVAHE

LAVNQDIQDRLHKEVLQCLAEGNNEISYESILKMSYMDMVISETLRKHPPLIFLDRLCTK

KYELPPSQPGCKSVILKPNNILIFPVYALHHDPKYFPNPDKFDPERFSEENKDNISPYTY

LPFGHGPRKCIGNRFVLMEAKILLAHLLQKFTLKPTEKTIEPIVYSKEFTLQPVGGFWIK

LEKRET* 1199125

 

>CYP9P pseudogene SI2.2.0_80135 locus=Si_gnF.scaffold02230[1202226..1203759]

68% to CYP9P9 Linepithema humile

1202226 MDLSLFSSPFVLLLITVMLIVVLKIVTVLHNVYIYWKDKGLPCLYNSLSSILTDWKLFSN 1202405

1202406 FTLVEYSQYIYYNFPDAKYIGSVDFSTPSVFIRDPELIKDIMVKDFEHFTDHRNFTDENA 1202585

1202586 DPLFGKSTFFLRGDRWKEMRTTLSPSFTANKIKFMFDLV & 1202702

1202705 SQDFINYLIDHPNFCHMIDM

KEAFRRYTTDVIATTAFGISVNSMKDRDNEFFTRGIEDTQFSAR

LLARLKILFLRECPRLSKLIGLTLFSSNMSNFFKNVVEETIKARKEQNIV

RPDMIHLLMQIRDKESASVHKMTLGDIVSQAFSFFFAGFDTTSTLMCFVAHELAVNQDIQ

DRLRKEVQQCLAEENNEISYESILKMSYMDMVISETLRKHPPLIFLDRLCTKKYELPPSQ

PGCKSVILKPNNIIMFPVYALHHDPKYFPNPDNFDPERFSEENKNIISPYTYLPF & 1203571

1203574 GPRKCIANRFVLMEAKVLLAHLLQTFTLKPTEKTIEPIVYSKAFTLQPTGGFWINLEKRKT* 1203759

 

>CYP9P SI2.2.0_16389 locus=Si_gnF.scaffold10311[950064..951619]

73% to CYP9P9 Linepithema humile middle region

951619 MDLSLLSSPFTLLLITLIVIGVLKVVTVFYRIYTFWKKKGAPYFPNSWSSNITGWKLLL

ARISLTEYCKYIYNYIPNAKYVGMMDFA

TTTVLLRDPELIKDIMVKDFEHFPDHRSFINEDIEPLLGKNIFALRGDRWKEMRNTLSPS

FTASKMKFMFDLISKCSKDFVDYFADHPEICHAIETKEAFRRYTNDVIATAAFGISVNSM

KDQDNEFYIRGMETTKAFSGSLIMIKMTIMRLCPNFARRMGLTLFSPATTKFFKTVVAET

IKAREEQSIVRPDMIHLLMKARDKNDASVRKMTLDDIVSQAF & 950693

950693 CFFSAGFDTTATLMCFAVHELAVNQDVQNRLREEVQKHLAEGNGEISYDSLSKMSYMD

MVISETLRKYPPAIFTDRLCTQRYELPPSQPGCKSVILEPNSVLMLPIYGLHHDPQYFPN

PDKFDPERFSEENKDNIVPYSYLPFGHGPRKCIGNRFALMETKILIAHLLQKFTVKTTEK

TVEPIVFSKKEFTLQPVGGFWVALEKRENIL* 950064

 

>CYP9R SI2.2.0_11458 locus=Si_gnF.scaffold02923[1829870..1832352]

73% to CYP9R21 Pogonomyrmex barbatus

MECCTIILSILVSVLAIYYYSFRKNTNAFQQHGVPHVKQISVLEWIWRVIIRPRSFAEAV

QNIYEVHPDAKYVGAFNFSQLIIVLRDLELIKSIGIKNFDSFQDHQFFGNDTQDPLFGTN

LFALRGDKWREMRVLLSPAFTASKMKTMFQLISECAVNFSEYLMNVPSDKRVMEMKDVSM

RYANDVIASCAFGINVDSMRDRENDFYIYGSKSVDFGLINIIKIMMHQHMPTLVRLFNIK

LMDDRTKDFFVNLVADTIRTREEKGITRPDMIQLLMDSKDKREPGKELSILNMTSQAFIF

FVAGFETSSTLMSFAAHEIAVNPDVQEKLRNEIDKVLEDTNGHPSYEAINGMKYLSAVIN

EALRKYPVQVMTERLCTKDFELPPTLPDAKPFLVKKDTNVWIPLYSLQRDPQYFPEPEKF

KPERFLDEGDQCNFDAYHPFGLGPRMCIGNRFALLETRTLLFHLLARCQLKPCEKTSTTV

KLKKGGFQMRIEGGFWLSVVPRENRHPTITKAH

 

>CYP9R SI2.2.0_80332 locus=Si_gnF.scaffold06002[239062..240697].pep_2

72% to CYP9R30 Pogonomyrmex barbatus

MEYWSILLLIVIGALSIHYLFRNFNFFKRHGVLHFPLATTFGITASLMFKRMSIIDF

LLKLYNFNPDAKYIGIYVMKEPAILLRDPELIKFILVKDFEAFPDRRGFSGLDEPLIAK

NLFSLRGENWRNVRTLLSPSFTSSKMKMMFTLMSECAEDFTKFLSTLPENKSEMDMKDAF

SRYANDVIATCAFGIKINSMKDPTNTFYAYGKELVNFSRERPLKFLFLRTFPSIARIFNI

KFINDNVSKFFKDIIRTTIATRDAEHITRPDMLQLMMDIRGKEGRRELDIDDITAQAFVF

FLGGFDTNSTAMSFAAHEIAANPEVQAKLQQEIDEILEESNGAVSYESVNKLEYLNAVIN

EVLRLYPPVGFLDRKCEKPYELPPALPGEKPFVVNKGMNFWIPTYAIHNDKKYYDNPEKF

YPERFLNNKMHHYSFCYMPFGLGPRMCIANRFALLELKVLLFHLLARCELKPSAKTTSPI

KFSKNLIPMPENGFWLNIQRRKDINPI

 

>CYP9R SI2.2.0_03658a.1 locus=Si_gnF.scaffold10311[393451.. 394992]

two genes fused

393451 MEYWTIVLSILA

GILAIYYYSFRKNANVFQQHGIPQAKQFSSLEWLWRIFIRPRSFAEVIKDIYKVHSDAKY

IGVFNFSQIVLVIRDLELIKSVAIKNFDAFQDHLFFGNEAQDPLFGTNLLALRGDKWREM

RVLLSPAFTVSKMKAMFPLMSECAVNFSEYLINVSSDKRVMEMRDIFTRYANDVIATCAF

GIHVDSMRDPENNFYVFGKKAVDFGVINIIKIMLHQHMPSLVSLLNIKLMDDRTKEFFVN

LVANTIRTRDEKGITRPDMIQLMMDGRGKREPGKELTILDMTSQAFIFFLAGFDTSSTLI

SFAAHEIAVNPDVQEKLHNEIDKVLKDTNGHPSYEEINGMKYLNAVINETLRKYPAQIMT

DRLCVKDFELPAALPGAKPYLVKKDTRLWIPFYALQRDPKYFPEPDKFKPERFLDAGDQC

NFDAYHPFGLGPRMCIGNRFALLETRILFFHLLARCQLKPCEKTLISAKLQKGGFQMRIE

GGFWLSVVPRENQEPTITKAN* 394992

 

>CYP9R SI2.2.0_03658a.2 locus=Si_gnF.scaffold10311[395903..397462]

395903 MIYIIVLSVTVGALSLYYYIFKDLNYFQKHGIPH

KPSLPLLGNMGPSIFRQQSMGELVRETYNLNHEAKYVGFFDMTLPIVMIRDPELIKSITL

KHFDMFMEHYNVVDENVEPLFGKNLFALRGEKWRQVRSLLSPAFTGSKMKSMFKLMSDCG

TDFSNYSAQLPPEKRIMQTKDAFTRYTNDVIATCAFGISVDSMKNPENEFYVYGREATTF

NTAALIKLYMFRFFPWLARLINLKLVHKQKADFFRNLIETTIKTRDANSIVRPDMLQLMM

ENKGKEGKTELTVDDMVAQAFSFFFGGFDTTSTLMCFAAHEIAVNRDIQEKLQKEVDQVL

EKTNGQLSYETINGMEYLDAVINEALRMYPVAVITDRVCGKDFELPPALPGMKTFTIKKD

QCIWIPTYGLHHDSKYFKDPEKFDPERFLGERKKESLNCGGYIPFGLGPRMCIGNRFALL

ETKVLFFHLLSRCDLKTCEKTPMPLKLAKGSFTMTPEGGFWLKMVPRESVHHTVAFNLSS

RTHQM* 397462

 

>CYP9R SI2.2.0_03658b locus=Si_gnF.scaffold10311[405490..407043]

71% to CYP9R9 Linepithema humile N-term

405490 MIYLIALSVIVGALGIYYYVFKDVNYFKKHGIPHKRPLPLLGNMGPSICRLQ

SVAELVKEIYNLNREAKYVGFFDMTLPIVMIRDPELIKSITLKHFDNFMDHRSFVDENIE

PLFGKNLFALRGEKWRQVRSLLSPAFTGSKMKSMFKLMSDCGVDFTNYLARLPPEKRILQ

TKDVFTRYTNDVIATCAFGISVDSMKNPENQFYVYGKEATTFNIVTLLKLYIFRSLPWIA

RLINLKFVRKQIADFFRNLVETTIETRDANGIVRPDMLQLMMENRSKEGKAKLTADDMVA

QAFIFFFGGFDSTSTLMCFAAHEMAVNQDIQEKLQKEVDKVLEETNGQISYEAINGMEYL

DAVLDEALRMYPVAVAMDRVCGKDFELPPALPGLKPFIVKKDQGIWIPTYGLQHDPKYFE

DPERFDPERFLGERRKESLNCGGYVPFGLGPRMCIGNRFALLETKVLLFHLLARCDLRTC

KKTPMPLKIAKDGFNMKPEGGFWLEVLPRKSVHHTIGVNVSNGIH* 407043

 

>CYP9R SI2.2.0_80741 locus=Si_gnF.scaffold10311[414059..415615].pep_1

82% to CYP9R26 Pogonomyrmex barbatus

414059 MIYVIVLSVIAGALG

LYYLFKDLNYFKKYGVPYIKPFPIVGSMGPMLLRTQSVHDFVKSIYSAYPDARYVGLYDV

KTPIVMLRDIELIKSVTLKHFDMFIDHIGFVDENQDKFFGKNLVALRGERWREVRSILSP

AFTSSKMKSMFKLMSECAVDFSSYLTQLPPEKKIMELKDVFTRYTNDVIATCAFGVKVDS

MRNPKNDFFVYGTEATNFRGLIFLKFLIFRKLPQLARILKMTLIHEKIADFFRDLVKTTI

KTRDENGIVRPDMLQLMMESRGKDGKAELSIDDMVAQAFIFFFGGFESTSTAMCFAAHEI

AMNQDIQKRLQNEIDQVLEDTNGQASYEAVNGMEYLDAVINETLRMYPVASAMDRLCGKD

FELPSTLPGKKPFTVKKGHGIWIPVYGLHHDPQYFEEPEKFDPERFLGERKKHSLNCGAY

LPFGLGPRMCIGNRFALLETKVLLFQLLARCELKSCEKTPIPIKIAKDGGFTLRPEGGFW

LNVTPRKNTHHSITVNATNGTSM* 415615

 

>CYP9AS Si_gnF.scaffold01122

1179708 MELFTLLLSIVVASICLYYFIISKLTHFERLKIPHVRPIPLLGNMAPFVFGRIAPMELMQ 1179887

1179888 KIYHLFPDAKYYGFYDFTKPMIVIRDPELISTIAIKQFDNFSDHYGFVNETLDPIAAKNL 1180067

1180068 FNLRGDHWREMRKLLSPSFTSSKMKMMFGLMNQCAENFVNFVVTESGKTGKAYDMKDLLS 1180247

1180248 RYATDTVATCAFGINTDSFKYPNNEFFMVGKKAMTFDAWMSFKFFMHRNFSLLSKILKL 1180424

1180425 RMFGPKIENFFKDVVATTVKARDEQGIVRPDMIQLMMETRNKDSGPEFDIDEMTAQAFVF 1180604

1180605 FLGGFDTVSSVMCFMAHEIGVNPDVQRKLREEIEDVLRQTNGKPTYEAINRMKYLDAVIN 1180784

1180785 ETQRLYPVAILLDRVCVKKTVLPPATPDGEPITLKPGDNIWFMPFSLHRDPKYYPHPKKF 1180964

1180965 DPERFLNGSVDNSVYMPFGIGPRLCIGNRFALMEAKIMIFHLLWRCDIEPDVKTRVPMVF 1181144

1181145 NKKSLAPLPDGGFWLKLRARNSKASVTQCLPNGHNVDEQ* 1181264


>CYP9AS pseudogene Si_gnF.scaffold01122

1185448 MEPSTLLLTILIASI*LYYFILKKLFYFERRKIP & 1185549

        NVQ*VLILSNMAPFILRRASPAEIIQKLYNLFPD 1185652

        AKYFSLYNFTRPIIVIREPELIS 1185721

1185722 MITIKHFDNFCDHCPFMIETLDPITSRNLFNLQGDHWREMRKLLSPSFTSNKMKAMFGLT 1185901

1185902 SQCAENFTNFVATESGNSGKTYE 1185970

1185966 MKDLLCRYANDTVTTCAFGINVGSFRHPKKEFFLLRRKAMNFDGPWLTFTIFMHRNFPLL 1186145

1186146 LTLLNLKMFGPKIENFFKNIVIDTVKARDEQKIIRPDLIQLMMETKNKDSGSEFDIDEMT 1186325

1186326 AQAFIFFVAEFDAVSNAICFVAHEVGVNPDVQKKLREKIDDVLKQTNGKPTYETINHMKY 1186505

1186506 LDAVINESLRL

        LTEVKVMLFYLLW 1186847

1186848 RCNLEPDVKTYRVSMVSQKRLFAL*LKGGFWLELRARNLKAPI 1186976

 

>CYP9AS Si_gnF.scaffold01122

1190986 MEPSTLLLTILIASICYFILNKLLYFERRKIPHVQSIPILGNMAPFILGRDSPTEILQ 1191159

1191160 KLYNRFSNAKYFGLYDFTRPTIVIRDPELISMITIKHFDNFCDHYGFVNETLDPIASRNL 1191339

1191340 FNLQGDHWREMRKLLSPSFTSSKMKAMFGLMSQCAENFTNFVTAESGKSGKTYDMKDLLC 1191519

1191520 RYANDTVATCAFGISVDSFKHPKNEFYMLGRKAMNFGGPWLTFAFFMNRNFPLLSKLFNV 1191699

1191700 KMFGPKIENFFKNIVTDTVKTRDEQKIVRPDMIQLMMETRNKNSGPEFDINEMTAQAFVF 1191879

1191880 FLAGFDAVSNAMCFVAHEIGVNPDVQKKLREEIDDVLRQTNGKPTYEAINHMKYLDAVVN 1192059

1192060 ESLRLYPGAAFLDRQCVKETELPPATPDGESITVKPGDSIWFSSFALHRDPKYYPHPDKF 1192239

1192240 DPERFLNGSVDNSVYMPFGIGPRICIANRFALMEIKVMVFYLLWHCDLEPDVKTSVPMVF 1192419

1192420 HKRTFALVPKRGFWLKLRARNLKAPVTN* 1192506

 

>CYP9Asaa Si_gnF.scaffold01122 1195531-1197048 (+) strand

1195531 MELSTLLLTIVVASICLYYFLKSKLTYFERLKIPHVKPIPLLGNMAPFVFGRIAHVELVQKLYNLFPD

AKYFGFYDFSTPTFVIRDPELISTMAIKQFDNFSDHNGFASELDPIASKNLFNLQGDHWR

EMRKLLSPSFTSSKMKMMFQLMSQCAENFANSLATESGKIGKTYDMKDVLCRYANDTVAT

CAFGISIDSFKHPENEFFVLGRKALNFGGKWVSFVFLMNRYFTQFAKLFKLRMFGPKIEN

FFKDIVANTVKARDEQGIVRPDMIQLMMETRNKDSGPEFDIDEMTAQAFIFFIAGFEGIS

TAMCFMAHEVGVNPDVQNKLREEIDDVLKQTNGKPTYEAIHRMKYLDAVVNESLRLYPGG

AFLDRKCVKETKLPPATPNGEPSTIKPGDSVWFSSFSLHRDPKYYSHPDKFDPERFLNGN

VDNSVYMPFGIGPRICIANRFALMEAKVMLFYLLWRCDLEPDIRTRVPMVFQKRTIAITA

VEGFWLKLRARNSKVPVV* 1197048

 

>CYP9AS SI2.2.0_11819a locus=Si_gnF.scaffold01122[1198465..1200021] (+) strand

two genes fused

72% to CYP9AS14v1 Pogonomyrmex barbatus

1198465 MEPTTLLLTILTAGVCLYYFVLSKLTYFERLKVPYVQPIPFFGNMAPFVFRRISNVELIQKMYNLFPD

AKYFGFFDFSSPTFIIRDPELISMIAIKHFDNFCDHRAFVNESLDPIAGRNLFNLRGDHW

REMRKLLSPSFTSSKMKMMFELMSQCAENCATFVATEAGKAGKTYDMKEILCRYANDTVA

TCAFGISVDSFKFPKNEFFMVGRKAMVFEGLVSFKLYMHRNFPLLADLFKLRMFGPKIEN

FFKDVVSNTVKTRDEQGIVRPDMMQLMMETRNKDNRREFDINEMTAQAFVFFLAGFDTVS

TAMCCMTHEIGINPDVQRKLREEIDDVLRQTNGKPTYEAINRMKYLDAVITETLRMYPIV

SFLDRVCIKETELPPATPKSKPVTLKPGDRVWFPNYSLHRDPKYYPHPNKFDPERFLDNT

VDNSIYMPFGIGPRICIGNRFALMETKIMLFYLLWHCDLEPDDIKTKIPM

VFSKTSFTTTAEGGFWLKLRARNLKAPVTQGLSNGHKVEEP* 1200021

 

>CYP9AS pseudogene fragment Si_gnF.scaffold01122

joined to the next P450 gene start codon

1202308 IRKLIQVFSCITDLEIFVA 1202364

 

>CYP9AS SI2.2.0_11819b locus=Si_gnF.scaffold01122[1198487..1203751]

two genes fused

75% to CYP9AS11v1 Pogonomyrmex barbatus

1202365 MELITLLLTILIVSICLYYFVLSKLIYFERLKIPYVQPIPLLGNMAPF

VFQRMSHPELVQKIYNLFPDAKYFGFYDFSTPTIVIRDPELISMIAIKQFDNFCDHQGFG

NDTLDPIAGRNLFNLQGDHWREMRKLLSPSFTSSKMKMMFGLMSQCAENFANFVATESGK

TGKTYDMKDILCRYANDTVATCAFGISIDSFKHPKNEFFVLGRKALNFQGLLSFKVYMHR

SFPFLANLFKLRLFGPKTENFFKDIVTTTVKIRDEQGIVRPDMIQLMMETRSKNNGPEFD

INEMTAQAFVFFLAGFDSVSAAMCFMTHEIGVNPDVQSKLREEIDNVLKQTNGKPTYEAI

NRMKYLDAVVNETLRLYPLASFLDRVCIKETILPPATPNSEPITMKPGDRVWFPNLSLHR

DPKYYQYPDKFDPERFLNDSVDDSVYMPFGIGPRICIGNRFALMEAKVMLFYLL

WRCDLEPDAKTRVPMVLSKTSFVMMADGGFWLKLRARNSKASITQCLSNEHKVGK* 1203918

 

>CYP9AS pseudogene Si_gnF.scaffold01122 (-) strand C-term

1209445 KIFNGNVNKSMYMLFDIGSRSSIDNRFALMEEVMVFYLLCRCDLESNVKTRAAMAFHKR 1209269

1209268 TFTMLPNGDFLLRAKNLKVHI 1209206

 

>CYP9AS Si_gnF.scaffold01122 (-) strand

1211984 MELSTLLMTILAAGVCLYYFVLSKLIYFERLKIRYVQPIPLLGNMAQVIFRRISMAEHIQ 1211805

1211804 NIYNRFPDEKYVGFYDFTRPTFIIRDPEIISMIAIKHFDNFCNHRSVVNESLDPIASRNL 1211625

1211624 VSLQGHRWRKMRRLLSPTFTSSKIKMMFGLMSECAENLINFVITESGKTGKTFDINDLFL 1211445

1211444 RYANDTVATCAFGISVDSFKHPKNTFFMIGKEGMTFNAWKYFKFFMNRNFPLFAKLLKL 1211268

1211267 RLIGSKIEIFFKDIVSNVIKARDKQGIVRSDMIQLMMEIRNKDSGSEFDIDEMTAQAFVL 1211088

1211087 FAAGFDSATTAMCFMAHEVGVNPDVQNKLREEIDDVLRWTDGKPTYEAINHMKYLDAVVN 1210908

1210907 ETLRLYQGPAFTDRICITETEMPPATPDGEPITIKPGDAVWFPGFSLHRDPKYYPHPDKF 1210728

1210727 DPERFMDNSVDKSVYMPFGIGPRICIGNRFALIEAKIMLFYLLWKCDLEPDVKTKVPLVI 1210548

1210547 SKTSFTITAEGGFWLKLRARNSKAPVVCLSNGHKNENQR* 1210429

 

>CYP9AS pseudogene Si_gnF.scaffold01122 (-) strand N-term

1212821 MELSTLLMTILAAGVCLYYFVLSKLIYFERLKIRYVQPIPLLGNMAQVIFRRISMAEHIQ 1212642

1212641 NIYNRFPDEKYVGFYDFTRPTFIIRDPEIISMIAIKHFDNFCNHRSVVNESLDPIASRNL 1212462

1212461 VSLQGHRWR 1212435

 

>CYP9AS pseudogene Si_gnF.scaffold01122 (-) strand  C-term

1219359 KIFNGNVNKSLYMLFDLGSRISIDNRFALMEEVMVFYLLCRCDLESNVKTRAAMAFHKR 1219183

1219182 TFTMLPNGDFLLRAKNLKVHI 1219120

 

>CYP9AS Si_gnF.scaffold01122 (-) strand

1221930 MELSTLLMTILAAGVCLYYFVLSKLIYFERLKIRYVQPIPLLGNMAQVIFRRISMAEHIQ 1221751

1221750 NIYNRFPDEKYVGFYDFTRPTFIIRDPEIISMIAIKHFDNFCNHSSVVNESLDPIASRNL 1221571

1221570 VSLQGHRWRKMRRLLTPTFTSGKIKMMFGLMSECAENLINFVITESGKTGKTFDINDLFF 1221391

1221390 RYANDTVATCAFGISVDSFKHPENTFFMIGKEGMTFNAWKYFKFFMNRNFPLFAKLLKL 1221214

1221213 RLIGSKIENFFKDIVTNVVKVRDEQGIVRPDMIQLMIKTRNKDSGPEFDIDEMTAQAFVF 1221034

1221033 FIAGFDSVATAMCFMAHEIGINPDVQKKLREEINDVLKWTDGKPTYEAINHMKYLDAVVN 1220854

1220853 ETLRLYQGPAFIDRICVTETKLPPATPDGEPITIKPGDAVWFPGFSLHRDPKYYPHPDKF 1220674

1220673 DPERFMDNSVDKSVYMPFGIGPRICIANRFALMEAKVMLFYLLWKCDLEPDVKTKIPLMI 1220494

1220493 SKTSFTITAEEGFWLKLRARNSKAPVVCLSNGHKNEYQ* 1220377

 

>CYP9AS pseudogene Si_gnF.scaffold01122 (-) strand N-term

1222586 MELSTLLMTILAAGVCLYYFVLSKLIYFERLKIRYVQPIPLLGNMAQVIFRRISMAEHIQ 1222407

1222406 NIYNRFPDEKYVGFYDFTRPTFIIRDPEIISMIAIKHFDNFCNHSSVVNE 1222257

 

>CYP9AS pseudogene.a SI2.2.0_10369 locus=Si_gnF.scaffold03952[1015073..1015853]

1015073 IELSTLFLTILTASICLYHFILNKLNYFDRLKIRYVQPISVFGNMARVIFRRMSMAEHIQSIYNLFPDEKYV 1015288

1015289 GFYDFTRLTFIIRDPKIISKITIKCFDNFCNHRSVVNESTDLRASRNLVSLQEHHWREMR 1015468

1015469 TLLSPTFSSGKIKMM & 1015513

1015518 CAENTINFVITESRKTGETFDINDLFLRYANNTLATYAFSISIDLFKHLKNALFVIGKEG 1015697

1015698 MTFNAWKY*KFFMNRNFPPFAKLLKLRMIGPKIVNFFKDIVTNVVKARDDQG 1015853

 

>CYP9AS pseudogene.b SI2.2.0_10369 locus=Si_gnF.scaffold03952[1020791..1021219]

(-) strand

1021219 IELSTLFLTILTASICLYHFILNKLNYFDRLKIRYVQPISVFGNMARVIFRRMSMAEHIQ 1021040

1021039 SIYNLFPDEKYVGFYDFTRLTFIIRDPKIISKITIKCFDNFCNYRSVVNESIDLRASRNL 1020860

1020859 VSLQEHRWREMQTLLSPTFSSGK 1020791

note these two pseudogene sequences are on the same contig as five CYP6AQ sequences

 

>CYP336A SI2.2.0_04743 locus=Si_gnF.scaffold00805[326202..327704]

61% to CYP336A15 Pogonomyrmex barbatus

MIVLAISTLVFLVVLYFYLTRNFNYWQKREIPIADGVLPGFGHMKDILLLKSTISETLRK

IYKENKNRSMVGIYSMSTPSLLILEPELVKTVLQTKFVNFHENYLKTDPKLDPLLSNNPF

FTYGEKWQTGRKRLTYAFSNVRLKILFETVKQVCLKLEEYMDNKIGKAGRAEFLFNRLFA

QFTAQVVSTVGFGIDGLCFDDNEKESLFEMGNVFVKPSTFNHLLFNLVFLIPTIGKLCQS

KFLPQNIDHFFRTMVRDVLHQRRKQGIRGNDFLQLMVDLEKMEGEEFEMDVIASHAVSFF

IDGYTTSSYTLSFVVFHLANNPEVQKKLREEVVSVINKYNGELTFEGIKDMTYLEKVIME

SMRVTPSLGFLYKVCTEDTELAGSDGLVCHVKAGTPIMISVRGLHEDARYWENPEEFDPD

RFSADRKHSINRFTYIPFGEGPRMCVGMRMALLQIKMCLITIMRKYSVELSPKTRLPLKL

TASSFLDSPEGGLWGFFRPL

 

>CYP336A SI2.2.0_05364 locus=Si_gnF.scaffold00805[343084..344511]

76% to CYP336A16

MNTVL

LSLIFGALIIFYFYLTRNYKYWQKRGIPCVDGALPGFGHMLSVAFMKTHFSNFCDEIYKN

NKGRSMVGIYDFTTPLLMILEPEMVKTVLQTNFSSFSKNAIDIDPKLDPLSSYNPFLLSG

EKWLHSRKRLTYAFSSMRLKILLESVKKVCATFENYIDGKLSNVEKAEFELKSLFSRYTA

QVVAAAGFGVDGYCFDDEKKDQSFRKIGQAIFEPSTRNVIMFALVFFVPSLNKIFKMRFI

PEHVDHFFRTLVADLMEQRRKDKIPRNDFLHLMAELERAEGDKFDTEMLAGQAMSFVTDG

YETSSSVMSYIGFHLASYPEVQEKLREEVMTVLNRYDGQITYEGLREMTYMDQVFNESLR

MIPAGVVSKKRCTEEFELKGSDGLVYRIEPGMEILIPIQALHTDPQYWENPEKYDPERFN

PDRKHSIERFAYLPFGEGPRICVGMRMAQLQVKAGLTTILKKYRMELSPKTQVPL

 

>CYP336A SI2.2.0_04389 locus=Si_gnF.scaffold01203[896608..897921]

one stop codon, possible pseudogene

71% to CYP336A16 Pogonomyrmex barbatus

75% to CYP336A AC17497-PA no introns

MSIILVSLIFGALVALYFYLTRNHKYWQTRGVPCMDGALPGFGHMLSVATMRTGISDFCDKI

YKDNKGHSMIGVYDFMSPLLMILEPRLVKTVLQTNFSSFSENAVHLDSKLDPLLSYNIFG

LSGEKWVNGRKRLTYAFSSMRLKILLESVKKVCVTFEDYIDKKLSNVEKAEFELKTLFSR

YTAQVVAAAGFGVDGYCFDDEKEDISFRKIGQSILEPTARNAMIFTIVFLIPSLNRILKM

KFIPDHVDHFFRTLVADHMEQRRKDKIPRHDFLHLMAELE*AEGCKFDNEMLAGQAMSFILD

GYETSSSTMSYVGFHLASYPEIQEKLREEVMSVLNRYNGEITYEGLKEMTYMDQVFNESMRMIPA

AVVMKKRCTKEFELKGSDGVACRVPPGMEILIPVQALHKDPQYWEHPEEYDPERFNPDRK

HSIEKFAYLPFGEGPRICVGMRMAQLLMKAGFTVILRKYKLELSPKMQVPLKMIPGALLP

APKGGFSIYF

 

CYP4 clan (68 different sequences)

16 genes are complete in 6 subfamilies

There are 23 partial sequences and some of these may join later.

There are 26 pseudogenes

CYP4 has seven subfamilies present but CYP4DC may belong to CYP4CX

There are 2 CYP4G genes

There are 2 CYP4AA genes and 9 CYP4AA pseudogenes

There are 6 complete 4AB genes and 15 partials and 12 pseudogenes

There are 3 complete CYP4BW genes, 8 partials and 3 pseudogenes

There are 2 complete CYP4CY genes

There is 1 complete CYP4CX gene and 1 partial and 1 pseudogene

There is  1 CYP4DC pseudogene (may belong to the CYP4CX subfamily)

 

 

>CYP4G SI2.2.0_09253 locus=Si_gnF.scaffold07457[349772..354476]

89% to CYP4G71 Pogonomyrmex barbatus

missing N-term exon in a sequence gap

SKWRAHRKLIAPTFHLNVLKTFIDLFNANSRAVVEKMRKEGDKEFDCHDYMSECTVEILL

ETAMGVSKSTQDRSGFEYAMAVMK

MCDILHLRHRTIWLRPDWLFNLTKYGKDQIRLLEIIHGLTKKVIARKKQE

IKNSTGNIVDDSTQTGNVKTVETTSVEGLSFGQSAGLKDDLDVDDNDVGEKKRQAFLDLL

MEAGQNGSVLTDEEVKEQVDTIMFEGHDTTAAASSFFLSIMGCHPDIQEKVIQELDEIFG

DSDRPATFQDTLEMKYLERCLMETLRLYPPVPVIARNIKHDLKLVSGDYTIPAGTTVIMT

TFKMHRQPHIYPNPEVFNPDNFLPEKTASRHYYAFVPFSAGPRSCVGRKYAMLKLKIILS

TIMRNYRIRSDIKESDFRLQADIILKRAEGFMIKLEPRKRPAAATA

 

>CYP4G SI2.2.0_09298 locus=Si_gnF.scaffold01858[372861..377325] (-) strand

70% to CYP4G64 Linepithema humile

377325 MDVEPVTTPYFSVTIYTLLATFITTLIALYYYV

ETNRSVRLIKKMPNPPSLPIIGHSLITMGLTPEKFLTMALKYYDFLNNSRVIGAHFGTKS

VVVLLDPEDIELILSSSMYLDKATEYRMFKPWLGDGLLITSGNKWRKHRKAIAPSFHMNI

LKTFVPLFYENSIDLVNRLRDEVGKEFDCHDYLSAVTVDILTETAMGIKREKRAKTGYDY

AMAVMKMSDIVARRHYDMSLYLDTFFQFSKLANIQKKLLKTIHTLTEHVIKQKAIDVEEK

RAKGEQVKEAENGKPSEKSNATENTETVKNNTTFNMHYVRDDLDEIDENDIGEKKRLAFL

DMMFEMKKNGQMTDEEIWEEVNTIMFEGHDTTAAGSSFALSVLGNHPDIQARVHEELDTI

FGDSDRQCTYQDTLEMKYLERVILETLRLFPPVPWIARKVNKEVKLVTGNYIIPKNATVI

IMQFWVHRLEKYYPNPTVFNPDNFLPEKMQQRHYYAYIPFSAGPRSCVGRKFAMLKLKVL

LSTILRNYRVISEIKDDDFHLRADIILKRHDGFNIKLEPLKPATRS* 372861

 

>CYP4AA pseudogene? SI2.2.0_03866 locus=Si_gnF.scaffold01665[1379235..1382003]

63% to CYP4AA1 Linepithema humile  

missing C-term in a seq. gap, one frameshift, possible pseudogene

87% to CYP4AA   SI2.2.0_07130 (partial seq)

85% to CYP4AA   SI2.2.0_11609

67% to CYP4AA   SI2.2.0_03315

71% to CYP4AA   SI2.2.0_02576

75% to CYP4AA   SI2.2.0_06461

68% to CYP4AA   SI2.2.0_12116

59% to CYP4AA   SI2.2.0_08695

MWVYLILLAIILAIFHALYQKNYFRIIRFIFTLNGPKMVPILGNANLFIEGN (1)

LLERITDEHQNYGRIIRIWLTFVPHVVLIEPEDIKIIFKNRKHRAKASFYKLLDDFLGKG

LITQDVDKWDAHRKILQPAFRPAMLENFIETFGECAIRLVDKLLEKDGENINITTFVNNSVYDIVR (1)

ETILGIPASQTYNDEEDKFRK (2)

IMYRFAHPWLLINWIYRLTAASKSEQQHQNELMDFCSKKVEEMHENLQKNDFFNN

SRKTSLLEFMIEYMIKENDPQITKKEIIEECCTFMLAGQESVATSTAITLFYLARNLKWQ

KKCIEEINEIFGEDRRSPIMEDLTKMKNLEMCIKESLRLYPTVPLFART &

GEDITV (1)

GEHVIPAGCNVILMPYCTHRLPHHFPDPHDFKPERFSPENSETRHPFAYIPFSSGRRNCI (1)

 

>CYP4AA SI2.2.0_03315 locus=Si_gnF.scaffold07158[62314..68567]

63% to CYP4AA1 Linepithema humile  

MWAYFVFLAIFVVICVLYQKNYFRIIRFIFTLNGPKTVPILGNANMFLEGNFLQTIINAG

QNYGRIFRIWLTFVPYVVLTEPEDIKMILGNTKHRQKXHFYNLLENFLGKGLITQDVDKW

IIHRKILQPVFKPNDSAKFIGTFNKYADRLVNKLLEKNGKDINVTTFVNNSVYDILRETI

LGIPASQQYHDGEDNFRKNQVMLTYRLTQPWLLIDCIYRLTAAGKSKERNQKYLIEFCNR

KMREFLQNNGSINHDSTTEETSLLEYMIKYIINNENSEINTHDIIEQCCTFMLAGQESVA

TIIAITLFHLANNSKWQKTCTSELNEIFGADKRSPIKEDLDKMENLEMCIKESLRLYPTV

PLFARTLGMDVKLEEHIIPAGSNVVIMPYCTHRLSHHFPDPHVFKPERFSRENSEKRHRC

AYMPFSIGSRDCIGRYXFAMFEMKSIISAILRKCQLEPVLGKEKMIPKFRVTVRAHGG

 

>CYP4AA pseudogene SI2.2.0_02576 locus=Si_gnF.scaffold00396[22216..24656]

57% to CYP4AA1   Linepithema humile

missing N-term

IVDEHQNYGRIIRIWLMFVSHVVLIEPEDIKIIFKSMKHIAKASFYKLVNNFLGKGXITQ

DVDKWKVHRKILQPVFNPDMLKKFIETFGECLVDKLLEKNGEDLNVTTFVTNLVYDIVRE

TILGIPASKTYRINLESKNQFMMMYRFARPWLLINXIYRLTAASKSEKQHQNELMDFCSK

KMEDMHESLQKNGFLNDPRTGKTSLLEFTIEYMINMKNPQITKQDAIEECCIFMLAGQES

VATATAITLFYLARNLKWQKKCIEELNETIGEDGRSIMEDLTKMKNLEICIKESLRLYPT

VSLFARTLGEDMRVEHVIPADCNVIIMLYCTH*LPHHFPNPHNFKPE*FSSENS (?)

EKRHPYACIPFSAGPRNCI (1)

GYKFAMLQMKSIISAILRKSQLEPVLGKESFLAKYRITIRAHSVLWIKIKANDE

YKPKQSYTSGTETFDFSGCGVPLGVE*

 

>CYP4AA SI2.2.0_11609 locus=Si_gnF.scaffold04526[3561..6790]

58% to CYP4AA1 Linepithema humile

MWAYLVLLAVILTILHALYQKNYFRIIRFIFTLNWPKTVLILGNANLFIEENLLEKIADE

HQNYGRIIRIWMTFVIIEPEDIEIIVKSSKHLAKASFYKLLXNFLGKGLITQDVDKWKVH

RKILQLAFHPSMLKKFIETFGECADRLVDKLLEKDGEDINITTFVNNSVYDIVRETILGI

PASQTNPFTMMYRFAHPWLLIDWIYRLTAASKSEQQHQNELMDFCYKKMEKMHESSQKND

FFNDSRKTSLLEFMIEYMTNTNDPQITKQEAIEECCTFMLAGQESVATSTAITLFYLARN

QKWQKKCIEELNEIFGEDRRSPIMEDLTKMKNLEMCIKESLRLYPSVPLFARTLGKDITV

GERVIPAGCNVIIMPYCTHRLPHHFPDPHDFKPERFSPENSETRHPFAYIPFSGGRRNCI

GSNFAMLQMKSIISAILRKSQLEPVVGKKNFLAKYRITIRAHGGLWIKIKANDKYKPKQS 3603

3602 YSLGTETFDFSGC* 3561

 

>CYP4AA single exon pseudogene

SI2.2.0_07130 locus=Si_gnF.scaffold04526[33531..33971] (+) strand

61% to CYP4AA1 Linepithema humile

33531 QKHHQNKLIDFCLKKMEEMHESLQKNDFFNDLRKTSLLEFMIEYMINKNDPQITKKEIIEECRTFMLAGQASVAT

STAITLFYLVRNLKWQKKCIEEINEIFGEDRRSPLKEDLTKMKNLEMCIKESLRLYPTVP

LFTRTFGKDVTI 33971

 

>CYP4AA Pseudogene SI2.2.0_12116 locus=Si_gnF.scaffold04526[34639..37243] (-) strand

~53% to CYP4AA1 Linepithema humile

37243 MWVYLILLAIILAIFHALHQKNYFRIIRFIFTLHGPKMVPILGNANLFIEG

(gap)

VKQNFIETFGEYANRLVDKLLEKDGEDINITTFVNNSI &

IVR (1)

ETILGIPASQTYGEDKFRK

NRNQFMMMYRFARPWLLIN*IYRLTAANKSEKQHQNELMDFCXKKMEEMHESLQK

NDFFNDSRKTSLLEFMIEYMINENNPQITKKQIIEECRTFMLAGQESVATSTAITLFYLA

KNLKWQXKCIEEINDIFGEDRRSPLKEDLTKMKILEMCIKESLRLYSTVPLFAKTLGKDI

TVEERVIPAECNVIIMPHCTHRLPHHFSDPHDIKPERFSPENSETRHPFAYIPFSGGRRN

CIGSNFATL*MKLIISAILRKNQLEPVLGEENFLAKYRITIRAHGGLWFKIKANNIYKPKQS 34723

34722 YTSERETFDFFGYGVSHQSVGGGRKCN* 34639

 

>CYP4AA pseudogene SI2.2.0_06461 locus=Si_gnF.scaffold04526[92669..94545]

59% to CYP4AA1 Linepithema humile, missing N-term

FDFLVFERIADKHQNYGRIIRIWLTFVPY &

YVVLIEPGDIKIIFKSTNTQYKHTFYKLVD

NFLDKGL &

TQNVDKWKVYRKILQPDFHXHMLNKFI &

FGECIDRLIDKLLEKDEEDINVTI

FVNNSVYNIVR

ETILGIPASQT ()

NQFMMMYRFARLWLLIN*IYRLTAANKSEKQHQNELMDFC &

KKMEETHEFLQKNAFLNGPRTRKTSSLEFMIEYMINMKNLQITKQDAIEKCCTFMLA

GQESVATANSITLFYLAKNLKWQKKCIEELNEIFGENRRSPIMKDLIKMENLEMCIKESL

SLYLTVPLFARTLGEDMRV (1)

GEHVIPAGCNVIIMPYCTHQLPHHFPEPHDFKPERFSPENS

EERPTYHPNPYAYIPFSAGRRNC

GYKLAVLHIKSIISAI

LRKSQLEPVLGKENFLAKYRITIRAHFGKLWIKIEANDKYKLKQ 92653

92652 SYHQERRLLIFLGVEYLIEAGGGGEV* 92562

 

>CYP4AA pseudogene SI2.2.0_08695 locus=Si_gnF.scaffold07231[11182..12815]

53% to CYP4AA1 Linepithema humile. heme Cys not present, 5 frameshifts

missing N-term

RIINEGQNYGRIIRIWLTFVLYVVLIDPEDIKKIFGNTEHRQKTSLYKLLENFLSKGLKMRPDARCR &

NGSEILQPVFKPDNSAKFIGTFNECADRLVSKLLEKNGKDINITTVVNN &

YDILRET (2)

ILGIPASQQYHKDNIRKNQVMLTYRLTRSWVLIDWIYRL &

AARKLEERNEKHLIEFC &

IKKMKEFLQNNGFLNHNDNTTKKTSLLEYMIKYIINNENSEINMLDIKQCCAFMLAGSQPA &

TTIAVTLFHLANNSKWQKKCTSELNEIFGKGKRSPIKEDVDKMENLEMCIKESLRLY

PTVSLFARILGMDVKL (1)

EEHIILGSNVLIMPYCTQRLSHQFSDPHVFKPERFSRENSEKRH

RYVYIPFSMGFRDSI (1)

GHFAMYEIKSIISPILRKCQLKPILGKEKIIPKKGQ*

 

>CYP4AA pseudogene SI2.2.0_12267 locus=Si_gnF.scaffold06810[31394..32567] (+) strand

~52% to CYP4AA1  Linepithema humile

CYP4AA SI2.2.0_16333 locus=Si_gnF.scaffold06810[32967..33392] (-) strand

70% to CYP4AA1 Linepithema humile

two parts of this pseudogene are on opposite strands

31394 LERIINERQNYDRIIHIWLTFIPYVVIIEPKDIQKILGISKHRQKTSLYKLLGNFLGEDLITQDVDD &
WSIYRKILQPFFNPDGSPKFIGTFNECADRLVDKLLEKNGEDLNVTTFINNSVYDILR (1)

ETILGISSSQQYHDGEDNFRK (2)

NQVTLTYRLTRPWLLIDWFYR

LTATGKAEERNQKYLIEFCNRKMKEFLQNNGSLNHDSTTEKLSLLQYMIKYMINKNSEIN

THDIIKQCCTFMLAGQESVATTVAITLSHLANNSKWQKICISELNEIFGANKRSPIKEDL

DKMQNLEMCINECLRLYPTVPLFARPLEMDVKL (1) 32567

33392 GHTIPAGFNVLILPYCTHRLSHHFSVPHAFKPERFSKNS &

KKRHQFAYIPFSMGYRNCI

GKNFAMFEMKTIISTVLRNCRLEPVLGKEKIIPKFRVTIRAQGGLWIKAKAHDK* 32967

 

>CYP4AA pseudogene SI2.2.0_15879 locus=Si_gnF.scaffold06810[24281..30713]

68% to CYP4AA1 Linepithema humile

GEHTIPAGFNVLILPYCTHRLSHHFSDPHAFKPERFIKNS &

IKRHQFGYIPFIMGYRNCI

GKNFAMFEMKTIISTVLRNCRLEPVLGKEKIIPKFRVTIRAQGGLWIKAKAA*

 

>CYP4AA pseudogene SI2.2.0_15026 locus=Si_gnF.scaffold06744[20080..20608] (+) strand

52% TO CYP4AA1 Linepithema humile I-HELIX TO EXXR

20080 EMGEMHKCLQKNSALID*DSTAGKTSLLEYMIKYMINNKNL &

NHNTRDIIKECCTFMLAGQESVATTIAITLFYLANNFKWQKRCIREISEIIGKNRRLPIKEILD

KMINLKMCIKEFLIFYPTVP &

PLFART

GEHVISTGCNVLYTVP 20608

 

$$$

 

>CYP4AB2     Solenopsis invicta (fire ant) AY345971

CYP4AB2 SI2.2.0_13117 locus=Si_gnF.scaffold02434[57168..57798]

MFIALLLIIIVVYLMCHCYAQYGPNGRLINKIPGPPGYPIIGNL

FNLLESREQFWETLSILNEQYYPIYKLRAFFNSLVFIRHPDDLEIILNNTKHISKSNL

YDALRPWLGMGLLTSGGSKWHLRRKILTPTFHFNILQQFVEILIEEGESMTRSLKNAG

GTITKDLVPFISEYTLNAICETAMGTSLQEMGSFQQQYRKAVHRMGELLVYRAMRPWL

KYDWIFSLTSKGREQKKLLKILHGFTEKVIAKRKDYHKRTKGQYLKNLNKDVVPNETE

TIGIKKKRFAMLDLLIQASQEGLLTDFDIREEVDTFMFEGFDTTGMAMCFILSLLAEH

KDIQDCVRKEIDAVMQENQGKLNMKSLQDLQYLERCIKEALRLYPSVYFISRITSEET

ELKTYLIPAGTLVILNFYITHRDSNFWPNPEVFDPDRFLPDNIRNRHPYSYLPFSAGP

RNCIGQRFALLELKAMLVPLIYNFYLEPVDYLENQRFGIDMILRSLDPCRLKFVPIAT

EGI*

 

>CYP4AB2 Solenopsis invicta (Lausanne fire ant) EE147029.1

FWPNPEVFDPDRFLPDNIRNRHPYSYLPFSAGPRNCI

GQRFALLELKAMLVPLIYNFYLEPVDYLENQRFGIDMILRSLDPCRLKFAPIATEGI*

 

>CYP4AB2 Si_gnF.scaffold08268 almost the same seq as the EST EE147029.1

 366 IQDCVRKEIDAVMQENQGKLNMKSLQDLQYLERCIKEALRLYPSVYFISRITSEETQL 539

 871 KTYLIPAGTLVILNFYITHRDSNFWPNPEVFDPDRFLPDNIRNRHPYSYLPFSAGPRNCI (1) 1050

1113 GQRFALLELKAMLVPLIYNFYLEPVDYLENQRFGIDMILRSLDPCRLKFVPIATEGI* 1286

 

$$$

 

>CYP4AB24 Solenopsis invicta (Lausanne fire ant) EE131689 EST

YPIIGNTIKLINLGVLRIWKYIICTSSDKYYPIWKLRSFFESLVIIRHPDDMETILN

NTKHINKSKLYDILHPWLGTGLLTSTDSKWHTRRKILTPTFHFNI

 

>CYP4AB25 Solenopsis invicta (Lausanne fire ant) EE142405 EST

MFVTLLILCVSIILLYFITYYGRFRRLIGKVPSKPDLPFIGNALEFFMYS

QEKIWEAERLANKTHTIYTFWCGPIAFIATRDPDDIEKILSNTTQHLSKGYIYNLLHPWL

GTGLLTSEGAKWRKRRKILTPTFHFTILKEFVDIFTEESNRMIKYLKNIEGSNIDNLMNF

ISHHTLNAICG

 

>CYP4AB SI2.2.0_13106 locus=Si_gnF.scaffold02434[44974..46011] (-) strand

SI2.2.0_01000 

86% to CYP4AB2 Solenopsis invicta C-helix to ETAM exon

C-term is in a sequence gap

48416 MFITLFVLIIVVYLACHYYVQYKRNGQLINKIPGPPSYPIIGNLLLMLDSK (1) 48264

47354 VHLWKTVKTTSNQYYPIMKWQAIFDSVVLY & 47274

47271 IRHPDDLE (0) 47248

46922 IILNNTKHINKNILYGVLRPWLGTGLLTSR (1) 46833

45420 GSKWHSRRKILTPTFHFNILQQFVEILIDEGESMTKSLKNARGTFIKDLVPFVSEHTLNAIC (1) 45235

      ETAMGTSLQKMGTFQQQYRKAVYRMGKLLFYR 44977

 

>CYP4AB Si_gnF.scaffold02434 53090-59396 (+) strand)

94% to CYP4AB2

C-term is in a sequence gap

53090 MFIALLLIIIVVYLMCHCYAQYGPSGRLINKIPGPPGYPIIGNLFNLLESR (1) 53242

54496 EQLWETLRILNEQYYPIYRLRVFFNSLVFIRHPDDLE (0) 54606

55685 IILNNKKHISKSNLYDTLHPWLGMGLLTSG (1) 55774

57298 GSKWHLRRKILTPAFHFNILQQFVEILIEEGESMTRSLKNAGGTITKDLVPFISEYTLNAIC (1) 57483

57655 ETAMGTSLQEMGSFQQQYRKAVHRMGELLFYR (2) 57750

      GTRPWLKYDWIFSLTSKGREQKKLLKILHGFTEK (0) 58554

59298 VIAKRKDYHKRTNGQHLKNLNEDVVPNETETIG (1) 59396

 

$$$

 

>Seq 1 scaffold01962.a exons 7-12

CYP4AB1

N-terminal is in a sequence gap

1096616 VKKKRLAMLDFLIYASQEGHLTDVDIREEVDTFMFE 1096723

1096803 GHDTTSTSLCYTLALLAENKDIQ 1096871

1097645 DRVRQEVDVVMQENEGKLTIKSLQNLQYLERCIKESLRLYPSVYFISRITTEEAQL 1097812

1098499 ESHLIPVGTIMHLHIYGVHRDPNFWPNPDVFDPDRFLPENSRNRHPYSYIPFSAGPRNCI 1098678

1098736 GQRFAMLEMKAMITPLIHNFCLEPVDLLKNLRVGPDLVLRPLGGHRIKFIPIATKCI 1098906

 

>CYP4AB1     Solenopsis invicta (fire ant) AY345970

scaffold01962.a

SI2.2.0_16179 locus=Si_gnF.scaffold01962[1098474..1098909]

SI2.2.0_80854 locus=Si_gnF.scaffold01962[1098424..1099075].pep_1

Missing exon 1

QHLINLLFSLCDKYYPIFRTWAFFEGFVSIRHPDDLE

VILNSSTNIEKSRIYSVLHPWFGLGLLTSGGSKWHSRRKILTPTFHFNILQQFVEILIEEGE

SMTNSLKNAGSTITKDLVPLISEHTLNAICETAMGTSLQGMNSVQQEYRKAVHRMGEL

FIYRLVRHWLISDWIFALTSQGREQVKILKILHGFTNKIIAERKDYHKRTNGQYLKNF

NQSIITDNEEIVG

1096616 SKKKRLAMLDFLIYASQEGHLTDVDIREEVDTFMFEGHDTTSTSL

CYTLALLAENKDIQDRVRQEVDLVMQENEGKLTIKSLQNLQYLERCIKESLRLYPSVY

FISRITTEEAQLKSHLIPVGTIMHLHIYGVHRDPNFWPNPDVFDPDRFLPENSRNRHP

YSYIPFSAGPRNCIGQRFAMLEMKAMIAPLIHNFCLEPVDLLKNLRVGPDLVLRPLGG

HRIKFIPIATKCI* 1098909

 

$$$ two versions of the same gene

 

>CYP4AB26 Solenopsis invicta (Lausanne fire ant) EE148664.1

TLNAICETAMGI

SLQGLGSFQQQYRKAVHQMGEFIVYRLLRQWLKNDWIFSLTPRGREQAKL

LKILHGFTEKIIKERKDYHKLTNGQYLKNLNKDAVADEEIIGIRRKRLAMLDLLIQASQE

GLLTDKDIREEVDTFTFEGHDTTSSGICFTLALLAEHKDIQERVRKEIDVIMKENQEKLT

MKSLQDLQYLERCIKEALRLYPGVFFISRNTSEKVQLKSYLIPAGTLLHLNIFGVHRDPK

FWPNPEIFDPDRFLPD

 

>CYP4AB26 SI2.2.0_05332 locus=Si_gnF.scaffold01962[1112709..1118200] (+) strand

Seq 2 scaffold01962.b

note 2 amino acid diffs qith EST EE148664.1

74% to CYP4AB2 Solenopsis invicta  

1112709 MFIILLLLILTVYLTCHIYTHYGPDGRLLNKIPGPLGLPIIGNVLLVRSTR (1) 1112861

1113133 EGLWKVLCYLTEQYYPIGKVWAFFTVAVTIRHPDDLE (0) 1113243

1113455 VILNSTKHTDKSRVYDILHPWLGTGLLTSA (1) 1113544

1114500 GSKWQSRRKILTPTFHFNILQQFVEILIEEGERMTNSLKNAEDSVTKDLIPFISEHTLNAIC (1) 1114685

1114869 ETAMGTSLQGLGSFQQQYRKAVHQMGEFIVYR (2) 1114964

1115454 LLRQWLKNDWIFSLTPRGREQAKLLKILHGFTEK (0) 1115555

1115746 IIKERKDYHKLTNGQYLKNLNKDAVADEEIIG (1) 1115841

1116083 IRRKRLAMLDLLIQASQEGLLTDKDIREEVDTFTFE (0) 1116190

1116259 GHDTTSSGICFTLALLAEHKDIQ (0)

1116440 ERVRKEIDVIMKENQEKLTMKSLQDLQYLERCIKEALRLYPSVFFISRNTSEKVQL (1) 1116607

1117788 KSYLIPAGTLLHLNIFGVHRDPKFWPNPEIFDPDRFLPDKIRNRHPYSYLPFSAGPRNCI (1) 1117967

1118027 GQRFAILEMKAMIAPLIYNFYLEPVDYLKDLRIGADILLRPFTLHRLKFIPIAKKCI* 1118200

 

$$$

 

>Seq 3 scaffold01962.c exons 6-12 pseudogene 1121941-1125575 (+) strand

bad boundary ar DRVR

1121941 LLRPWLINN*IFSLTSKGRQQTKILKLLHGFTKK (0) 1122042

1122216 AIEKRKDYHKRTNNQYLRNLNKQVVNAETIG (1) 1122308

1122564 IQRRRLVMLDLLIQASQKGLLTDIDIREEVDTFMFK (0) 1122671

1122740 GHDTISSGICFTLSLLAEHKDIQ (0) 1122808

1123818 DRVRKEVDVIMQENQGKLTIKLLQDLQYLKKCIKEVLRLHPSVYFISRVTSERT*L (1) 1123976

1125158 KSHLIPAGIIMQMQNIFRVHRDPNFWPNPEVFDPDRFLPEKIRNRHPYSYLPFSGGPRNCI (1) 1125340

1125402 GQRFALLEMKAMIVPLIHNFYFEPVDYLKDLRIGADLILGPFDSHHIKFIPITTKSI* 1125575

 

>Seq 4 scaffold01962.d 1129353-1135259 (+) strand

1129353 MFVTILLLIFIAFLVFNCYVQYGPNGQLINKIPGPCCYPIIGNTIKLINLG (1) 1129487

1130206 VLRIWKYIICTSSDKYYPIWKLRSFFESLVIIRHPDDME (0) 1130322

1131443 TILNNTKHINKSKLYDILHPWLGTGLLTST (1) 1131532

1131936 DSKWHTRRKILTPTFHFNILQQFVEILIKEGECMTNSLKNTGGTITKDLEPFITEHTLNAIC (1) 1132121

1132314 ETAMGTSLQRTGLFQQKYREAIHQIMETLLYR (2) 1132409

1132884 AVRVWLHGWIFWLTPLGRKQIKLLKVMHGFTEK (0) 1132982

1133199 VIAERKDYYKRTNGQYLKNLNKDTIEDEAEIG (1) 1133294

1133533 VRKKRLAMLDLLIQTAQENHLSDLDIREEVDTFMFE (0) 1133640

1133724 GHDTTAMGITYTLALLAEHKDIQ (0) 1133792

1134227 DGVRKEIDAIMEENQGKLTILSLQKLQYLDRCIKEALRLYPSVFTIMRTTSEETLL (1) 1134394

1134852 QSYVIPAGTMVLLNIYATHRDPSFWTNPEIFNPDRFLPEIIRNRHPYSYLPFSAGPRNCI (1) 1135031

1135089 GQRFAMLELKAMIAPLIHNFYLEPVDYLKNIEFKADMILRPLKPHRIKFVPIAKSI* 1135259

 

>Seq 5 scaffold01962.e 1138554-1145958 (+) STRAND

CYP4AB27 Solenopsis invicta (Lausanne fire ant) EE134101 EST

1138554 MFIIILLLIFILFLTCHYYAQYISNRRLMNKIPGHVSYITLNSIMLGCGSR (1) 1138691

1140053 EELWKILINFADQFYPIFKLWSFSVPLISIRHPNDLE (0) 1140163

1140385 IILKNTKHLEKGIFYDALHPFSGTSLFTST (1) 1140474

1141340 GSKWQSRRRLLTPIFHFNALQQFTEILIEEGESMANSLKNAADTITKDLVPFISEHTLNAIC (1) 1141525

1142678 EAVVGISPQKMGSFQHQYWTAVYRINEFIIYR (2) 1142773

1143260 SLRLWAHNDWIFSLTPKGREQTKVLKLLHGFTEK (0) 1143361

1143551 IIEERKIYHKHNGQYLRNLIKGTVATNAETIG (1) 1143646

1143899 IQKKRLAMLDFLIMASQENFLTDSDIKEEVNGFIFK (0) 1144006

1144080 GNETVAMGICFALSLLAEHKDIQ (0) 1144148

1144503 DCARKEINTIMQQNQGKLTMKLLQDLQYLERCIQETLRLYPSMLLMARITSEDTQL (1) 1144670

1145544 QSHLIPAGAMMLLNIFGVHRDSNFWLNPEIFDPDRFLPENIQNRHLYSYIPFSAGPRKCI (1) 1145723

1145785 GQRFALLMMKAMIVPLIHNFYLEPVDYLKDVRMGINLICRPLNSHRIKFIPIATKST* 1145958

 

>Seq 6 scaffold01962.f exons 1-10, missing last two exons

1151406 MFIALLLIIIVVYLMCHCYAQYGPNGRLINKIPGPPGYPIIGNLFNLLESR (1) 1151558

1152797 EQFWETLSILNEQYYPIYKLRAFFNSLVFIRHPDDLE (0) 1152907

1153985 IILNNTKHISKSNLYDALHPWLGMGLLTSG (1) 1154074

1155612 GSKWHLRRKILTPTFHFNILQQFVEILIEEGESMTRSLKNAGGTITKDLVPFISEYTLNAIC (1) 1155797

1155968 ETAMGTSLQEMGSFQQQYRKAVHRMGELLVYR (2) 1156063

1156775 AMRPWLKYDWIFSLTSKGREQKKLLKILHGFTEK (0) 1156873

1157718 VIAKRKDYHKRTKGQYLKNLNKDVVPNxxxxx 1157792

1158848 IKKKRFAMLDLLIQASQEGLLTDFDIREEVDTFMFE (0) 1158955

1159018 GFDTTGMAMCFILSLLAEHKDIQ (0) 1159086

1160368 DCVRKEIDAVMQENQGKLNMKSLQDLQYLERCIKEALRLYPSVYFISRITSEETELST* 1160544

 

>Seq 7 scaffold01962.g exons 1-4 1163608-1166774 (+) strand pseudogene

1163608 MFITLFVLIIVVYLACHYYVQYGRNGRLINKIPGPPSYPIIGNLLLMLDSK (1) 1163760

1164687 EHLWKTVKKT &

        SNQYYPIMKWQAFFESVVCIRHPDDLE (0) 1164767

1165070 IILNNTKHINKSILYGVLHPWLGTGLLTSR (1) 1165156

1166589 GSKWHSRRKILTPTFHFNILQQFVEILIDEGESMTKSLKNARGTIIKDLVPFVSEHTLNAIC 1166774

 

>Seq8 scaffold01962.h exons 4-10 1180920-1184104 (+) STRAND

surrounded by two sequence gaps

1180920 GSNRHKRRKMLTPTFHFKILKQFVEILIEEGNCMIKCLKDTDGLVDDLMCLVSKHTLNSIC (1) 1181102

1181376 ETAMGTSLHEMGEFQHQYREAVHEVGKILTYR (2) 1181471

1182626 AMRPWLFPNMIFSLTSMGKKFNKNLKILHGFTEK (0) 1182727

1182872 IIEERKQYHNDTNERFLTHLSNDTGMLDDEEMTG (1) 1182973

1183046 IKKKRLAMLDLLIAEAHNNQIDDLGIREEVDTFMFE (0) 1183153

1183588 GHDTVAMGLTFAILVLAEHKDVQ (0) 1183656

1183937 ECARNEVSALMEANGGKLTMSMLNDMPYLERCLKESLRLYPSVPLISRVLTKDEQI (1) 1184104

 

>Seq 9 scaffold01962.i part of exon 4 and exons 4-12

sequence gap upstream

1187112 RMIKYLKNIEGSNIDNLMNFISHHTLNAIC (1) 1187201

1188456 ETAMGTLLQNMDESQQQYRQAIHEMGNVFFYR (2) 1188551

1189199 LMRPWLHLDMIFALTPMGKKQTKNLKILHKFTEK (0) 1189300

1189476 IIAERKQYHESTGGQFLKLLENDTDITETDDEAILG (1) 1189583

1189671 IKKKRLAMLDLLIAAARNNEINDSDIREEVDTFMFE (0) 1189778

1190132 GHDTVAMGLTFAILLLAEHKDVQ (0) 1190200

1190398 ERVRNEVKTVIHENGGKFTITTLNNLLYLERCLKESLRLYPSVPTISRVLSEDTTL (1) 1190565

1191127 QSYLIPSGAVMVIHSYDVHRDPNYWPNPDVFDPDRFLPERIQNRHPYSYIPFSAGSRNCI (1) 1191306

1191370 GQRFAMLEMKTVIASLVQNFYLEPVDHLEDLQFKKDLVMRVTRPIRVRFIPIKDLQSGVNT* 1191555

 

>Seq 10 scaffold01962.j exons 5-12 1196606-1199163 (+) strand

sequence gap upstream

1196606 ETAMGTLLQNMDESQQQYRQAIHEMGNLYVYR (2) 1196701

1196821 LMRPWFHPDMIFALTPMGRKQAKNLKILHKFTER (0) 1196922

1197107 VIVERKQYHESTGGQILKFSKNDITETDNEEILG (1) 1197208

1197295 IKKKRLAMLDLLIAAARNNEINDSDIREEVDTFMFE (0) 1197402

1197750 GHDTVAVGLTFAILLLAEHKEVQ (00 1197818

1198018 ERVRNEVNTVIHENGGKFTITALNNLLYLERCLKESLRLYPSVPAISRVLSEDTTL (1) 1198185

1198735 QSYLIPSGAIIIIYPYDVHRNPNYWPNPDVFDPDRFLSERIQKRHPYSYIPFSAGSRNCI (1) 1198914

1198978 GQRFAMLEMKTVIASLVQNFYLEPVDHLEDLQFKKDLVTRVTRPIRVRFIPIKELQSGVNT* 1199163

 

>Seq 11 scaffold01962.k part of exon 10 and exons 11-12 1200489-1201344 (+) strand pseudogene

SI2.2.0_04607

1200489 MKEMDNLYPSVYFISRIISEDTKL (1) 1200560

1200932 QSYLVPAGIILHLNIHGVHRDPN & 1201000

1201002 WPNPDVFDPDRFLPEEIQHRHPYSYLPFSAGPRNCI (1) 1201109

1201165 GQRYALLEMKAIVACLIHNFYLEPVDYLKNLQIHVDLVL*LDHRLRVRFVPICKINASI* 1201344

 

>CYP4AB Si_gnF.scaffold05141  228-1733 (+) strand small contig

84% to CYP4AB2 C-term exons 8-12

228 IKKRRLAMLDLLIQAAQEGLLTDADIREEVDTFMFE (0)

GFDTTAMAMCYTLSLLAEHKDIQ (0)

DCVRKEINAVMRENQGKLTMKSLQDLQYLERCIKETLRLYPSVFFISRITSEETQL (1)

QTYLIPAGTIVMLHFYMTHRDPNFWPNPEIFDPDRFLPENIRNRHPYSYLPFSAGPRNCI (1)

1560 GQRFALLELKAMIAPLIHNFYLEPVDYLKDLRIGIDLILRPLNPHRLKFIPIATKCI* 1733

 

>CYP4AB Si_gnF.scaffold08413  length=2869 1591-2550 (-) strand pseudogene

95% to CYP4AB Si_gnF.scaffold05141

2550 DCVRKEINAVMRENQGKLTMKSLQDLQYLERCIKETLRLYPSVFFISRITSEEIQL (1)

QTYLIPAGTIVTLHFYMTHRD &

NFWPNPEIFDSDRFLPENIRNRHPYLPFSVGPRNCI (1)

GQRFALLELKAMIAPLIHNFYLEPVDYLKDLRIGIDLILRPLNPHRLKFIPIATKCI* 1591

 

>CYP4AB Si_gnF.scaffold09754  length=2039 386-1773 (+) strand on small contig

83% to CYP4AB   Si_gnF.scaffold05141

 386 DCVRKEVNAIMQESEGKLTMKSLQDMQYLERCIKEGLRLYPSVYFISRVTSEETQL (1)

1361 KSYVIPAGTVMHLDIYGVHKDPNFWLNPEIFDPDRFLPENIRNRHPYSYIPFSAGPRNCI (1) 1540

1600 GQRFALLELKAIIAPLVHNFYLEPVDYLKDIRIGVDLVLRPLNPHHLKFIPIATKCT* 1773

 

 

>CYP4AB Si_gnF.scaffold05253  60-233 (+) strand on small contig

89% to CYP4AB   Si_gnF.scaffold05141

60 GQRFALLELKAIIAPLVHNFYLEPVDYLKDIRIGVDLVLRPLNPHHLKFIPIATKCT* 233

 

 

>CYP4AB Si_gnF.scaffold06174 

length=10343 large gap in the middle of this contig

75% to CYP4AB26

1231 SEGLFKLLITRGDTYYPIYKVHYYFFLTVISIRHPDDLE (0) 1347

1581 ILNSTKHLDKSIIYKLFHPWLGTGLLTSG (1) 1667

2006 GSKWQSRRKILTPAFHFNILQQFVEILIKEGENMTRSLKNAECTVIKDLLPFISEHTLNAIC (1) 2191

(sequence gap)

8414 NRHPYSYIPFSAGPRNC 8464

8527 GQRFALLELKAIIAPLVHNFYLEPVDYLKDIRIGVDLVLRPLDPHHLKFIPIITKCT* 8694

 

 

>CYP4AB Si_gnF.scaffold10402  632-1775 (+) strand on a small contig

          Length = 2057 84% to CYP4AB Si_gnF.scaffold05141

 632 DCVRKEVNAIMQESEGKLTMKSLQDMQYLERCIKEGLRLYPSVYFISRITSEETQL (1) 799

1348 KSYLIPAGTVMHLHIYGVHRDPNFWPNPEIFDPDRFLPENIRNRHPYSYIPFSAGPRNCI 1527

1587 GQRFAFLELKAIIAPLVHNFYLEPVDYLKDIRIGVDLVLRPLDPHHLKFIPIITKCTYAFKGI* 1775

 

>CYP4AB pseudogenes Si_gnF.scaffold03790  length=3014

547-1395 (+ amd - strands)

(+) strand

 547 DRVQKEVDVIMQDNKGKLTKKSIDDLKYLERCIKESLRLYPPAYFISRVASEEIQLQ 717

(-) strand

 903 DRVRQEVDVIMQE              YLERCIKKSLSLYLPAYFISRVATEEIQ 724

 

1395 ESHLIHVGTIMHLYIYGVHRDPNFWPNPEIFDPDRFLPENSQKRHPYSYIPFSAGFRNCI 1216

1158 GQRFAMLEMMAMIALLIQNFYLEPVDLLKNLRLGPDLVLHPLGGHRIKFIPIAT* 994

 

>CYP4AB Si_gnF.scaffold09337  length=2487

two pseudogene pieces on opposite strands

          Length = 2487

(-) strand

1438 SYLIPPGTIIFLCIYAVHHDSNFWPNPELFNRDRFTDENKKKHYPYSYISFSF*RHDCI 1262

1198 GKHFALLEMRAIMAELIHNFYLEPVDLLKDMQLEVDMLLHPINPRRIKFIPITK* 1034

(+) strand

853 VTFLCIYAVHHDFNFWPNSELFNPDKFTDENA & 948

947 QKHYQYSYIPFSARRRNCI 1003

 

$$$

 

>Si_gnF.scaffold04403  length=16921

          Length = 16921

 

>CYP4AB SI2.2.0_02873.a locus=Si_gnF.scaffold04403[8969..9959]

two genes

runs off the end of the contig

 102 KKNGLAMLDFLIYASQEGHLTDVDIREEVDTFMFE (0) 206

 286 GHDTTSTSLCYTLALLAENKDIQ (0) 354

1126 DRVRQEVDLVMQENEGKLTIKSLQNLQYLERCIKESLRLYPSVYFISRITTEEAQL (1) 1293

1980 KSHLIPVGTIMHLHIYGVHRDPNFWPNPDVFDPDRFLPENSRNRHPYSYIPFSAGPRNCI (1) 2159

2217 GQRFAMLEMKAMIAPLIHNFCLEPVDLLKNLRVGPDLVLRPLGGHRIKFIPIATKCI* 2390

 

>CYP4AB SI2.2.0_02873.b locus=Si_gnF.scaffold04403[8969..9959]

two genes this is a pseudogene

8152 EQYYPIGKIWTFFTAAITIRHPDDLE (0) 8235

     VILNGTK &

8463 YTDKSRIYDMFHPWLGTGLLTNG (1) 8531

9492 GSKWQSRRKILTPTFHFNILQQFVEILIEEGERMTNSLKNAGDSITKDLTPFINEHTLNAIC (1) 9677

     ETAMGISLQGMGSFQQQYRKAVHRMGELFVYR (2) 9956

     (sequence gap)

 

$$$$$

 

>CYP4AB SI2.2.0_10180 locus=Si_gnF.scaffold10311[993060..999204] (+) strand

86% to Seq   5 scaffold01962.e

993060 MFITILLFILILFLTCHYYAQYISNQRLMNKIPGYVSYVIVNNLILRQDSL (1)

       EELWKILINLADLYYPILKLWNFLVFLIFIRHPNDLE (0)

       VMLKNSKHIEKGIFYDALHPFIGTSLFTST (1)

       RSKWQSRRRLLTPIFHFNALQQFTEILIEEGESMTNSLKNAGDTITKDLDPFISEHTLNAIC (1)

       EAVIGISPQGMSLFQHQYRKAVYRINEFIVYR (2)

       FFRQWAHNNWIFSLTPKGREQTKILKLLHGFTEK (0)

       IIEERKVYHKHNGQYLRNLIEGTVATDAKTIE (1)

       IQKKRLAMLDFLIIASQKDLLTDSDIKEEVNGLIYK (0)

       SHDTVAMGICFALSLLAEHKDIQ (0)

       DCARKEIDTIMQQNQGKLTMKSLQDLQYLERCIQETLRLYPSVLLMARITSEDTQL (1)

       QSHLIPAGAMMILNIFKVHRDKNFWPNPEIFDPDRFLPENVQNRHLYSYIPFSAGPRKCI (1)

999031 GQRFALLMMKAMIAPLIHNFYLEPVDYLKDVRMGINLICRPLDSHRIKFIPIATKSI* 999204

 

>CYP4AB SI2.2.0_16196 locus=Si_gnF.scaffold07705[174944..175410] (+) strand

74% to CYP4AB69

rest of this gene is in a seq. gap

174944 ESYLVPSGTILHLNIIDIHRDSNFWPNPDVFDPDRFLPDKIQKRHPYSYLPFSAGPRNCI (1) 175123

175216 GQRFAMLEMKAIMASLIYNFYLEPVDYLKDLRFMTDMITRVTGPIRTRFVPIDRTSPGSTKSSLI* 175410

 

>CYP4AB Si_gnF.scaffold10413  pseudogene

pseudogene with pieces on both strands

(+) strand

29981 VRNKRLALLNLLIQASQENLLTDTDI & 30058

      REEVNTFTFG (0)

30162 GHDTTSSGICFTLSLLAEHKDVQ (0)

30330 DRVRKEVNIIMKKN*KKLTFNSLKDLNYLERCIKEALRLYPRVFFISRKTSETTKL (1) 30497

(-) strand

29749 NRHPYSYIPFSAEPRNCI (1) 29696

29634 GQKYAWLEMKAIIASLIHNFYLRSTEPVDYLKNLRTGTNLVLRALTSSHCLKFIPMATKISNNVV* 29437

 

>Si_gnF.scaffold00514  length=2723796

 

 

>CYP4AB SI2.2.0_10885.a locus=Si_gnF.scaffold00514[2243846..2245332]

four pseudogenes in close proximity but on alternating strands

- strand

exons 8,9,10 72% to CYP4AB26

2245331 VRKKRLALLDLLIQASQEGLLTDIVINEEVNTFTF

2245163 FQDHDITSSDICFTLLLLAEHKDVQ 2245089

2244988 DCVRKEVDGIIKENQEKLTTKLQENLQCLERCIKKALRLYPSVYFISQITSKDAQLSS 2244815

 

Change strand

>CYP4AB SI2.2.0_10885.b locus=Si_gnF.scaffold00514[2243846..2245332]

 

+ strand

exons 11,12

2244353 IKIFGVHRDSNFLPNLELFDPDRFLSEEIKYRHRYSYLRFSAGSRSCI 2244496

2244558 RRFALLKMKAIIACLIHNFYLEPVNYLKDLL & 2244650

2244650 NLILRPHRLKFIPIATKSI 2244706

 

Change strand

>CYP4AB SI2.2.0_10885.c locus=Si_gnF.scaffold00514[2243846..2245332]

 

- strand

exons 11,12

2244244 LKSYLILVGTLLHLNIFEVNRDPNFWPNPK & 2244155

2244155 VFDTDRFLPDHEIQNCHHYSHLPISAEQRNCI

2243999 GRRFAMLEMR & 2243970

2243970 AIIACLIHNFYLKPVDLLKDLRIGTNLILHSLTPHRLKFIPIATKSI 2243830

 

Change strand

>CYP4AB SI2.2.0_10885.d locus=Si_gnF.scaffold00514[2243846..2245332]

 

+ strand

exons 11,12

2243279 LKSYLILVGTLLHINIFGVHRDPNFWPNPEIFDPDRFLPDHEIQNCHHYSHLPISAGQRNCI 2243464

        GRQFAMLEMR

2243554 TIIACLIHNFYVKPVNLLEDLRIGTNLILRSLTPHCLKFILIATKSL 2243694

 

>CYP4BW SI2.2.0_04964 locus=Si_gnF.scaffold00690[840319..845688] (-) strand

63% to CYP4BW7 Pogonomyrmex barbatus

MDFAFLALCIFYFVVIFLVLSIVHDQYDVYQKLKNIPQIDRYPFGVMFELMNLSNY (1)

ACTKKLLTHLEKMNKEGIYVQWIFGQPYINVFKPEYLE (0)

LILPSTVNITKGAHYKLLEPWLGNGLITST (1)

GKQWFHDRKLIWPTFHFSILNQFAVILSEKAEILTTCLDRKIEKNPGKAIDICPFIFNAALDIIC (1)

ETAMGVDIRAQEVVTKYTSAVHT (2)

ISWLIMTRIFRPWYWINWLFYLSPRGKQYKSTLDTLHEFTKQ (0)

VICKRKAERKLQNDYSEPKNEDNEFNI (1)

GKRKRKAFLDLLLDQNAKDDCPLTDDELRAQVDTFMFA (0)

GQDTTAIAIIWTLFLLGNNLEHQEKVHKELEEVFGVSETPASVKELSQLKYLDRVMKETLRILPSIPVITRKLTEDVKL (1)

GNNILPKGLTIGMSIIFIHRNPEIWPDPLKFDPDRFLPENSKHRHPYAFIPFSAGPRNCIGQKFALIEQKILLTAVLRKWRV

KSVKTIDTIKYGGAILLRPREEVLIHFTPKK*

 

>CYP4BW SI2.2.0_03570 locus=Si_gnF.scaffold00690[819559..823811] (-) strand

67% to CYP4BW7 Pogonomyrmex barbatus

exon 1 in a seq gap

ACTKRLLKHLEKTTKEGIYIKWMFGKPYINVFKPEYLE (0)

LILPSTVNIKKGTHYKLLEPWLGNGLITST (1)

GKQWFHDRKLIWPTFHFSILNQYAVIQSEKAEILTTCLERKIEKNPRNAIDICPFIFNATLDIIC (1)

EAAMGVNIRAQEVVTKYTSAVHK (2)

ISWLITTRTIRPWYWINWLYYLTPGGKQYKSTLDTLHEFTKQ (0)

VIHKRKAERQSQNGYLEFENENNEYNIGKRKRKTFLDLLLDQNAKDDSPLTDDELRAQVDTFMAA (0)

GHDTTAIAIIWALFLLGNNLEHQEKVHKELEEVFGNSETPASVKELSRLKYLDRVIKETLRIFPSIPLVARKLTEDIKL (1)

GNNVLPTGLTIGVSIIFTHRNPEIWPDPLKFDPDRFLPENSKHRHPYAFIPFSAGPRNCLGQKFALIEQKIVLTAVLRKWKV

KSVKTVDTIKYGGALTLKPREEVLMHFMPKK*

 

>CYP4BW SI2.2.0_11849 locus=Si_gnF.scaffold00690[830949..836133] (-) strand

67% to CYP4BW7 Pogonomyrmex barbatus

MDFVSLVLSIFYYFVVIFLVLSILYSQYDVYQKFKNIPQIDKYPLGDTFELMNLSNH (1)

ECTKKLLTYLEKMSKEELFIKWIFGQPLIIVLKPEYLE (0)

LILCSTVNITKGMYYKLLEPWLGNGLIIST (1)

DKQWYHDRKLIWPTFHFSILNQYAVIQSEKAEILITCLERKIEKNPGKAIDICPFIFNAALDIIC (1)

ETAMGVDIRAQEVETKYTSAVHT (2)

ISWLIMTRIFRPWYWINWLFYLSPRGKQYKSKLDTLHEFTKQ (0)

VIRKKKAERQLRNDYSEPENEDNEFNIGKRKKKAFLDLLLDQNAKDGSPLTDDELRAQVDTFMFG (0)

GQDTTAIAIIWTLFLLGNNLEHQEKVHKELEEVFGVSETPASVKELSQLKYLDRVMKETLRILPSIPVITRKLTEDVKL (1)

GKNILPKGYTVVIAILFVHRNPEIWPDPLKFDPDRFLPENSKHRHPYAFIPFS

AGPRNCIGQKFALIEQKIVLTAVLRKWRVKSVKTVDTIKYGGALTLQPREEVLIHFSPKK*

 

>CYP4BW SI2.2.0_07419 locus=Si_gnF.scaffold00690[1246394..1251419] (-) strand

73% to CYP4BW7 Pogonomyrmex barbatus

missing N-term exons 1,2 and middle region exons 6,7 and part of 8

runs off the end of the contig

1251419 LILPSTVNITKGSPYVLLKPWLGNGLLLST (1)

1250934 GKQWFHDRKLIGSTFHFSILDQFAVIVSEKAEILNKCLERKIEQDPGKAINIFPFILNAALDIIC (1)

ETAMGVDIRAQEVETKYSLTIHE (2)

(gap)

IYVLSQLNYLDRIIKETLRIFPSVPLISRELVEDVKL (1)

DDNILPKDYTVVLPILLIHRNPEVWPDPLKFDPDRFLPENSKHRNPYAYVPFSAGPRNCVGQ

KFALLEEKTLLTAILRKWRVKSVKTLDTIQFGGAVILRPTEEVLVHFTPKK* 1246394

 

>CYP4BW SI2.2.0_08443 locus=Si_gnF.scaffold06914[214036..220646] (-) strand

56% to CYP4BW7 Pogonomyrmex barbatus

MDFISLALFTLCVIVIFRFLLMVHYQYAVRQKLKNIPQVDSFPFGSAYETMSISLE

KRLKKDFQYLAQTCKKGIYIQWFLGKPYIFVYKPEYLE

HIFPSTVNITKAVRYDLLKSWLGKGLLTST

GKQWFHDRKLIGATFHFSILEKFAVVMTEKAQILTKCLQRKIDENPGKAIDIYPLIVNATLDVIC

217371 ETAMGTDIRAQEIQSKYTTALQE (2)

VAELTMTRFFQPWLWIDWLY

(sequence gap)

GKKKKIAFLDLLLEENEKDDTPMTDDELRSQVDTIMFA (0) 215106

GHDTTSVAVCWTLFLLGNNLDHQEKVHEELEEVFGDSEAPATVKQLPLLKYLDRVIKETL

RIFPSANLISRELVEDVKLDDHILPKDHEVSVPIALVHRNPEVWPDPLKFDPDRFLPENS

KDRNPYAYVPFSAGPRNCVGIRFAQQELKLLLVAILRKWKVKSVETMDTIRYVEFMVLRP

CEELLIHFTSKK*

 

>CYP4BW pseudogene SI2.2.0_14929 locus=Si_gnF.scaffold07060[27367..28204]

54% to CYP4BW6 Linepithema humile

76% to CYP4BW SI2.2.0_04496

27367 IAKLTMTRMF*PWL*IDWLYYLTPAGRQYKSTLKIVHKIGDE (0)

VIEKKKLERHSKTDLTKLENKDNNI (1)

DKKKKITFLDLLLEENAKDDTLMTDNELRANVDTIMRA ()

EHGTTAVAVCWTLFLLSNNLDHQEKVHEEHEEVFRDLETSTTEEQLKNSKHLNRVIEETHRIFPSVPVISKKLIQEVKL (1) 28204

 

>CYP4BW SI2.2.0_14364 locus=Si_gnF.scaffold06914[226406..231295] (-) strand

63% to CYP4BW7 Pogonomyrmex barbatus, missing the N-term exons 1-5

231295 GKQWFHDRKLIGATFHFSILEKFAVVMTEKAQILTKCLQKKMDENPGKAIDIFPLVINATLDIIC (1)

ETAMGMDLRVQEVHSKYVTAV

227963 VSELIMTRIFQPWLWMDWIYYLTPAGRQFKSALKTVHGFADE (2)

VIKKKKLERRSKTGKTELENKDDESDI (1)

GKKNRVAFLDLLLEENGKDDSPMTDDELRAQVDTIMFA (0)

GHDTTSVAVCWTLFLLGNNLEHQKKVHEELEEVFGDSETPASVKQLPQLKYLDRVIKETLRIFPSANFISRQIIEEIKL (1)

DDHILPKDHEVSVPILLVHRNPEVWPDPLKFDPDRFLPENSKDRNPYAYVPFSAGPRNCVGMRFAQLEM

KLLLVAILRKWRVKSVKTIDTIRYGEIVVVRPCEELLIHFTPKK* 226406

 

>CYP4BW SI2.2.0_05526 locus=Si_gnF.scaffold06914[277062..285783] (-) strand

~60% to CYP4BW7 Pogonomyrmex barbatus

285783 MDFISLALFTLCVIVIFRVLLMVHYQYVVRQKLKNVPQVDSFPFGSTLETISMPPE (1)

ERLKMDLKNMEKTCKEGIYIQWMGGKPFIAVFKPEYLE (0)

RILPSTVNISKGSHYDMLESWLGKGLLIST (1)

GKQWFHDRKLIGTTFHFSILEKFAVVMTEKAQILIKILQKKMDENPGKPIDIFPLLINATLDVIC (1)

ETAMGMDLRAQEVQSKYTTAVQE (2)

IAELIIKRAYQPWVWADWIYYLTPAGRQYKSALKIVHGFANE (0)

VIEKKKRERQSKTNDTELENNDEFDI (1)

GKKKRVAFLDLLLEQNSKDDTPMTDEELRSQVDTIMFA (0)

GHDTTSAAISWTLFLLGNNLEHQEKVH

QELEEVFGDSDAPASVKQLPQLKYLDRVIKETLRIFPSAPGISRELVEDVQL (1)

DDITIPKDHSVLVQILLTHRNPEVWPDPLKFDPDRFLPENAKDRSPYAYIPFSAGPRNCIGMRFAQQE

QKLLLVAILRKWRVKSVKTLDTIRYGDFIVLRPSEELLIHFIPKK* 277062

 

>CYP4BW SI2.2.0_12858 locus=Si_gnF.scaffold06131[31159..33170]

C-term

61% to CYP4BW7 Pogonomyrmex barbatus

missing exons 1,2 in a sequence gap

58725 VILDSKNITKGFHYKLLEAWLGKGLIIST 58639

40861 GEQWSHDRKLI & 40829

40827 GHSFYKQMLNHAIIQSEKAEILITRLERKIEENPGEAIDICPFMFNCTLDIIW (1) 40672

      ETAMGVDLRAQEPNIVTEYTTAVHQ 39217

33851 ISELTMTRFFQPWYWINWLFYLSPKGKQYKSILKTLHEFTKQ (0) 33726

33441 VIYRKQAERQSQNSYTKFENDDDEFNI (1) 33361

33275 GKQKRKAFLDVLLDENAKNDSPLTDDELKAQVDTFMFA (0)

      GHDTNALALIWTLFLLGNNLEHQEEVHKELETVFGDSVTPASQEQLSQLEYLNRVIKESHRILPSVPLISFIL (1)

      GNNVIPKGMTVAITIMFLHRNPEIWPNPLKFDPDRFLPENSYNRPKC

      AFIPFSSGQRSCIGQQFAAIEQKIILTAILRKWRVKSVKTIDTIKYSASVLLRPEEKVLIHFTPKK*

 

>CYP4BW SI2.2.0_14240 locus=Si_gnF.scaffold07090[397414..401911]

63% to CYP4BW7 Pogonomyrmex barbatus

missing the last two exons

401911 MDFISLAILTLCIIVIFEILSTIYNQYTIRQKFKDVPQVEGHPIFGTTFKLMNLSDY (1)

       ERMKWFTKFMLKNCKEGAFVQWVGAKPFISVFKPEHLE (0)

       HIFPSTVNITKGLPYRMLAPWLGNGLLTST (1)

       GKQWFHDRKLIGPTFHFSILDQFAVVQSEKAEILTKCLEKK &

399338 IEKDSGKAFDIFPFIVNAALDIIC (1) 399267

       ETAMGVDIRAQEVETEYTSTVHQL ()

398280 SKLVMQRLLRPWYWIDWLYYSVSSGKQFKSAVHILHGFTKQ (0)

       VIRKRKAERKSQNGFIKIENEDNEFNI 397970

397890 GKRKRKAFLDLLLDQNEKDDAPLTDDELRAQVDTFMFE (0)

       GHDTTAVAITWTLFLLGNNLEHQEKVHEELEEIFGNSET 397534

397533 PASVKEITQLKYLDRVIKETLRLFPSVPIILRKLTEDVKL 397414

 

>CYP4BW SI2.2.0_14240 locus=Si_gnF.scaffold07090[387229..393169]

missing the first two exons

393169 LQKVFPSTVNITKGMPYNMLTPWLENGLLTST (1) 393080

390356 GPQWFHDRKLIGPTFHFSILDQFAVVISEKAEILTKCLEKKIEKDSGKAFDIFPFIVNAALDIIC (1) 390162

389471 ETAMGVDVRAQEVETKYTSTVHQ 389403

389214 SKLVMRRLFRPWYWVDWSYNLVPSGKQFKSVLHVLHGFTKQ 389092

388985 VISTRKAERQSQNDFTELENEDNEFNI (1) 388905

388825 GKRKRKAFLDLLLDQNAKDDAPLTDDELRAQVDTFMFE (0)

       GHDTTAVAITWALFLLGNNLEHQEKVHDELKEIFGSSETPA 388469

388468 SVKEITQLKYLDRIIKETLRIFPSVPLITRIFTEDVKL (1) 388355

387570 DKYIIPKDITIVLPIISTHRNPEVWPEPMKFDPDRFLPENSKGRNPYAYVPFSAGPRNC 387394

387393 IGQRFALLEEKIVLTAILRKWRVKSVKTLDNIKYGGSLILRPNEEVLIHFTPKK* 387229

 

>CYP4BW SI2.2.0_04496 locus=Si_gnF.scaffold07332[3396..4324]

57% to CYP4BW7 Pogonomyrmex barbatus

note scaffold05005 has same exon 8 GHGTTÉ

3396 VAKLITIRMFQPWLWIDWLYYLTPAGRQYTSTLKIVHEFADE (0) 3521

VIKKKKLEQHSKTDLTELENKTNDI (1)

GKKKKTTFLDVLVEENTKDDTPMSDNELRAHVDTIMSA (0)

GHGTTAVAVCWALFLLGNNPDHQEKVHKELEEVFRDSETPATKEQLDDLKYLSRVIDETLRIFPSAPTISRKLTEEVKL (1) 4234

 

>CYP4BW pseudogene SI2.2.0_03143 locus=Si_gnF.scaffold07426[2171..2505]

62% to CYP4BW8 Solenopsis invicta

2505 VIPKGITIAITIMFLHRNPEIWPNPLMFDPDCFLLENSRNRQKYAFIPFSSGQRSCIGQQFATIEQKIILTA

     VLRK*TVKSVKTMDTIKYSASVL &

2218 LRSAEKILTHFTCKK* 2171

 

>CYP4BW pseudogene SI2.2.0_05877 locus=Si_gnF.scaffold10539[164172..164529]

55% to CYP4BW8 Solenopsis invicta

164172 ISFILENNTIPKGITIAITIMFLHRNSEIW

       PNPLMFDPDCFLLENSRNRQKYAFIPFSSGQRSCIGQQFATIEQKIILTAVLRK*R & 164429

164429 VKSVKTMDTIKYSASVL & 164479

164482 LRSAEEILTHFTCKK* 164529

 

 

>CYP4CY SI2.2.0_01999 locus=Si_gnF.scaffold02189[366127..372915] (-) strand

60% to CYP4CY3 Pogonomyrmex barbatus

missing I-helix region

no start MET found ATA not ATG

GC boundary at GLLF

372915 ITFIIEVNKKEYYKLKRNLKFIFSIPGPSLLSSFIISMQIACNYK (1) 372781

EFIHSIQTTAKKYGYVTRFILGTDIYVVLTKPENCK (0)

LVLTKEIGNNKSIVTKLWKSFFGDGIIRVS (1)

GAPHRLRRKIIQPLMNVKYLYEYVTFFDIYSNCCVDALEKHVDGPTFDLKQYMEQYAVNIYL (1) 371082

ETIVGIQGTAHKGELDGLLNSQET (2)

370541 LFKGTYNRVIKPWLQTDWIFSLTKKGKQMRVAQNTVLDFMYS (0) 370416

IFQKVNPVFHNYWKRVVQVCGNVTNEFCKVSDENCIDDMRNFLIAVSSCKGLLF (0)

IHSTITEITTFIIIMLAMHTEVQ (0)

368752 EKLREEIFVTLNNDKIDAQSLYCMQYLQMVFKETLRLFPVAPVLSRALTEDIKL (1)

LESCTLPEGCFIMIPIIAIHRNPVYWPKPLEFIPERFSSENSSNRHRYTYIPFGTGLRDCI (1)

GQKYAFLCVATLIANLVRRYRFSTTISNIDDIKLTTDIVLRSQDVKCSISRV* 366127

 

>CYP4CY SI2.2.0_02221 locus=Si_gnF.scaffold02189[352256..358610] (-) strand

76% to CYP4CY3 Pogonomyrmex barbatus (part)

75% to CYP4CY SI2.2.0_01999

358610 MIFVIGFNKKEYYKLKRNLKFAFSLPGPSIFSLFINSLQIACNYK (1) 358476

       EFINCVEATTKKYGNLTRFILGTDLFVVLTKPEDYK (0)

       VVLTHVNGNNKSTVTKPWEIFLGDGIIRTS (1)

357184 GAPHKLRRKIIQPLLNVKHSYECVTFFDIYSNYCADNLEKYVDGPMFDLKLYIARYSFNIFL (1) 356999

       ETILGIQGTAHEGEHDELLYSQEI (1)

356455 LFKGAHNRLIKPWLQIEWIFSLTKSGKQMRVAQNTVLDFICN (0) 356333

355832 ISPQKTTTVFHNYWTRVEQVCGSITNKFCEVSNENFIDDMRTFLSAVSSCKSLLF (0) 355668

355627 IHSTVTETTSFITLMLAMHTEIQ (0) 355559

353206 DKLREEISVTLGNNKIDAQSLLCMQYFYMVFQETLRLFPVASSVSRQLTGDIKL (1) 353045

       ESCTLPDGCFIMIPTFAIHRNPAYWSKPLEFIPERFSLKNSSNRHRYTYIPFGTGLRDCI (1)

       GQKYAFLSVATIIVNLVRRFRFSTTIRNVADVKLTSDIILRSQGVKWSITHV* 352256

 

>CYP4CX SI2.2.0_08600 locus=Si_gnF.scaffold07694[25040..37989] (-) strand

62% to CYP4CX4 Linepithema humile

37989 MLFIIVGLIASFACIVINYFIQKWFAYQTLPGPIRLPLIGTSYIFLQRKSE (1) 37837

36433 DFLNILMRNCDKYLSPFRIWIGPKLLIVIYEPSQIK (0) 36326

33808 VLQSHICVDKSTMYNVVKPLFGSGMLTA 33725

33805 LQSHICVDKSTMYNVVKPLFGSGMLTAP (1)

33622 AHIWTRDRKMIAPIFNTIMLREFVDTFVQEASILIEKLEKIGHNGNEIFVLEPLERCTFKIAL (1) 33434

      GTMTGIKMEENILNEIVEAIE (2)

      (gap)

      LMNVLISSTHNKKFTEKEIFYHLVTMLLT (0)

27031 ASDTIAVTMYFVTFVLANFSEIQ 26963

26148 ERVYKELLEIYGMKTLKDAPVKYEDLQHMHYLERVIKETLRIFPTGPVIAREVTEDFKI (1) 25972

25457 GDIVLPKSADIFISFIQLHRNKKYWPNPLVFDPDRFLPENIKSYQSFYFPFSDGPRNCI (1) 25281

25207 GMKYAMFSMKVILTTLIRTFVFKVNQRIEIDKIKLNMNLVLSTVEPLKIILEKRKL 25040

 

>CYP4CX.a SI2.2.0_13669 locus=Si_gnF.scaffold06899[1060118..1066514]

71% to CYP4CX_fragment4 Linepithema humile EXXR region

two genes

CYP4DC = CYP4CX SI2.2.0_02477 locus=Si_gnF.scaffold06899[1060125..1061424]

52% to CYP4CXd AC07210-PA

1066514 MVFTVVLITLACITVSYFVWNYCRPFFVRKEITLPGPRKLYTNFLRKNTD (1) 1066365

1065046 EFLNIINSLGFYYPSPFQIKLNYTPLVIIYEPDQVK (0) 1064939

        DFLQNRDNLDKNLLYKFTEHIFGMGLLTAP (1)

1064129 ESIWTHSRKAIARNFNPITLREFFNIFVERSLMLMNKLEKVGLNGKEFTSFMHLKTSALEIAL (1) 1063941

        DTMMGIKQTDLKTINLYVESAEK (2)

1062120 IKNILRRRMYSTWIMNELSFYNFIFNNFYALGHEQKKVIKSL (1) 1061995

1061636 DKTFFEMMLKTFSKKNFTEKLIRDNMITLLLT (0) 1061511

1061426 ATDSIGVTLNFVVFMLANFSEIQ (0) 1061361

1060817 EKVYKELTEIYGTTSVKSTPIKYEDLQHMNYLDRVIKETMRLFPTIPLVGRKLKEDMKI (1) 1060641

        GEYIIPKNTNVTIAFMLMYRNEKYWPDPLKFDPDRFLPKRLKDNQLSYFVPFSDGPRNCI (1) 1060353

1060288 GMRYAMTSMKVILATLVRTFVLKVDEHIPINKIKLQTDITISPIKPFKIRIEKRNL* 1060118

 

>CYP4CX.b pseudogene SI2.2.0_13669 locus=Si_gnF.scaffold06899[1069814..1070617]

1070786 DRTVLDMLLEALKNENVTDKSIHDNIIMLVIM (0) 1070691

1070620 ASETISITVDFAIFMLANFPEIQ 1070552

1069990 EKVYKELAEICGTETPMSAPVKYDDLQNMHYLDRVIKETMRLFPAIPILGRQSVKDMNI 1069814

 

>CYP4DC pseudogene SI2.2.0_07823 locus=Si_gnF.scaffold03038[182421..186801]

61% to CYP4DC3 Cys not present at heme region

several bad boundaries

50% to CYPCXa AC01144-PA

MLFIIVALIATLACIIINYFIRKFFPFEAVNTLPGPVRLPLIGTSYIFLRNSY (?)

DFLSIIMQMCEKFSSPFQFWIGPKLVFVIYEPDQIK (0)

TVLQSHFCLDKSMMYNAVKPIFGSGLLTAP (1)

AHIWTGDRKMIAPIFQTVMLREFVDIFVQEASILTEELEKIGHNGNEIFFLKPSLERYTLKIAF (1)

GTMIGIKVKENILNEIVEALGR (2)

FRNAFLIPDFIFNFTSMGSTQRKTIIFVQSLIDK (0)

YNIIGKRLVNILMSSTHNKKFTEKEIFYHLITMLIT (0)

ASDTIAVTMYFVIFVLANFSEIQ (1)

EKVYKELLEIYGTKTPKAAPVKYEDLQRMNYLERVIKETLRIFPTGPVIAREVTEDVKI (1)

xxxVLPKSADIVVSFIQMHRNKKYWPNPLVFDPDRFLPVNIKNNQSFYFAPFSDGPRNYI (1)

GMTYGMIAIKIILTTLIQTFIFKVNQSIELDKIKLNMGVMLSTVESLKVKLEKRNV*

 

 

Mito clan (6 complete sequences)

 

>CYP12K1 SI2.2.0_11039 locus=Si_gnF.scaffold05285[220255..226839]

69% to CYP12K1 Linepithema humile

MRGRFLIREINGSRMPSKVQCRARSVVAYPIKHNETKVDNEMQHARPTEDIPGPKALPLL

GNWFRFLPYIGGVLIGVNNVGEYGRADTFTQLRMLHEQYGDIVKLDNIGPRRPNILLFSP

ELCEKMYRVESAWPMRIAMETLHYYRQNREHIYNGQYGLATSQGKVWHDFRSKVNPHMMQ

PRTVKAHVAQTSEVTREFVEKMRALRDPKSLELPNDFKNEILKWALESICSIAMDCRLGC

LKSDLAPDSEPQIMINCVQEMFDLMYRMEIQMSLWKVYNTRNLKKLFRALDTLNGIARKH

IEQAKIKYETTDNSANLHDRSVLEKLLRIDKQTAQVMALDMLTAGVDTTGNVFSSLLYYI

ANNPEKQEKLREEVMSLLPDKTSPVTQDVLNQTRYAKACIKESLRLFPLAVGNLRTMRTD

VCLGGYKIPAGFDVIACHSVISKKPTQFSRTQEYIPERWLRGNTEFPSAKEAHPFAYMPF

GFGPRTCIGRRFAEMEIETLLLTVMRNFRIEWHHGPLEYESRFINIVVTPMQFKLVDL

 

>CYP301A1 SI2.2.0_02182 locus=Si_gnF.scaffold01122[3850337..3858545]

89% to CYP301A1 Linepithema humile

MKPSLRICGIRHCSLRSCESLFRRVAYRDFCSDTITSECPHASSSPRIASSFVRPYDEVP

GPRPIPILGNAWRLLPLIGQYQISDVGKISQLFYEEYGKIVRLTGLIGRPDLLFVYDANE

IEKVYRQEGPTPFRPAMPCLVRYKSIVRKDFFGELPGVVGVHGEPWKEFRTRVQKPVLQP

KTVRKYITPIEVVTKDFIKRIEKIKRDDGELPDDFDNEIHKWALECIGRVALDVRLGCLG

ETLSSNSEPQKIIDAAKFALRNVASLELKAPYWRYIPTPLWTRYVRNMNYFIEICMKYID

AAIVRLKNKKVVDESDLSLVERILAKETDPKIAYIFALDLILVGIDTISMAVCSILYQLA

TRPEEQEKIHQELLQILPDPSVSLTPSHLDQAIYMKAFIREVFRVYSTVIGNGRTLQNDT

VICGYKVPKGVQVVFPTLVTGNMEEYVTDAKTFKPARWLKDSDNENLHPFASLPYGYGAR

MCLGRRFADLEMQVLLAKLLRSYKLEYHYQPLKYKVTFMYAPDGELKFKIIKR

 

>CYP301B SI2.2.0_01361 locus=Si_gnF.scaffold01122[3871724..3871939]

70% to CYP301B1 Linepithema humile N-term

CYP301B1 SI2.2.0_09914 locus=Si_gnF.scaffold01122[3858881..3866555]

84% to CYP301B1 Linepithema humile

MTTLKQHAKQLLHRFVRSNTKSDRALDTLVTDVGRQDLLRHARPYSEIPGPKPIPLLGNT

WRFLPYIGIVK

GNYEIQSIDKLSKKLHSQYGDIVKIEGLLGRPDMVFVYDANEIERIFRREEKMPYRPSMP

SLDYYKHVLRKDFFQTNPGVIAVHGESWYNFRSKVQQVMLQPRIARMYIGAIEEASTALL

RRIAKIRDQKHEVPDNFLNEMHKWSLESIAQIALDVRLGCLDDDANAETQRLIDALITFF

KNVPVLELKIPFWKFFNTPTWQEYVNSLDTIVSTISKYTAAALSRTKSNMDSDKELSLLE

RVLACEGDTKVASILALDLFLVGVDTTSSTVASVLYQLALHQEQQALAYDEICNVLPQRN

APLKMTNIDSLKYLKACIKETLRMYPVVIGNGRSTTSDIVIGDYRVPKGVHVVFQHYVIS

NLEKYFPQSNEFLPERWLCDDGVRHAFASLPFGYGRRMCLGRRFAELEIIIVVSKILQFY

KIEYHHEKLDYYINPMYTPKGPLKLRFIE

 

>CYP302A1 SI2.2.0_00987 locus=Si_gnF.scaffold01390[678328..682682]

81% to CYP302A1 Linepithema humile

gene model is missing C-term = Si_gnF.scaffold01390

added yellow RLFLE from Si_gnF.scaffold01390 680332-680153 region (-) strand

MCSRGKLCGRKETILKLCAQSYSINPCRADGIVEPKPFENIPGPKSLPLIGTLYKYLPFI

GEYNFTKLHTNGLMKLKRYGPLVREEIVPGQQVVWVFRPEDIAEIFKAEAGLHPKRRSHL

ALLKYRKDRSKVYNTGGLLPTNGIEWWKLRREFQKVLSKPRNVVDYLEDTNAVVQEFVQL

CSREKPDDFLPLLSRLFLE

LTCLVAFDVKMRSLSEEEKNPHSRSSRLIEAAFVTNSVILKLDNGP

RLWRFFETPLYRKLRKAQNYMEEVALEMVTQRNQDLLICRKQSLLEEYLKNEVLDIKDIV

GMACDMLLAGIDTTTYSTSFALYHLAKNISVQEKLRSEASALLTDPMSPITAETLKNATY

TKAVIKETFRLNPISVGIGRILQTDVVLSGYRVPKETVVVTQNQVICRLPEYFDEPNSFK

PERWLRDSNDKLREKSVNPYTVLPFGHGPRSCIARRFAEQNMQVVLLR

678255 LCRNLQFTWSGESLDSISLLINKPDAPIKLRFKNLHA* 678142

 

>CYP314A1 SI2.2.0_06964 locus=Si_gnF.scaffold09376[47038..51904]

92% to CYP314A1 Pogonomyrmex barbatus

MLLSGVWFETIAAALLAILVLATGYRPPWWFWTRNYNANADDNTGDNGRKFKTARDVPGP

FALPILGTRWIYSRFGYYRLNKIHEAYKDLNQRYGPLCKEEALWNCLVVSVFSRRDIEAV

LKRGSRYPLRPPQEVISHYRRSRRDRYTNLGLVNEQGATWQKLRAALTPELTGAGTVFGF

FPALNIVTDGFIDLIRERRTSRLTVRGFEELAYRMGLESTCTLILGRHLGFLKPNSSSTL

TTRLAEAVRIHFTASRDAFYGLPLWKLLPTSAYKQLIESEDTIYNIISDLVEATMLEKQD

DARDESVEAVFLSILRQKDLDMRDKKAAIVDFIAAGIHTLGNTLVFLFNLIGRNPEVQET

LYNEARSLAPPGCDLTVDDLRKAKYLRACITESFRIVPTTPCIARILDEPIELEGYRLDP

GTVVLLHTWIAGLSDDNFKDASKCLPERWLKPMAPHSPLLVAPFGAGRRICPGKRFVELA

LQLILAKIVREFEIVVEEELGLQFEFILAPQSPVSLGFRDR

 

>CYP315A1 SI2.2.0_12229 locus=Si_gnF.scaffold01122[777530..779828]

62% to CYP315A1 Linepithema humile

gene model is missing C-term = Si_gnF.scaffold01122

MHTTRRVLRRFARLMNLHDDFNILLVKHRMLRSDSRSFIPNENDAAVPSSRNIAGQ

GLARNFMLSQTFVRDFSTLTGKEPPEPRSLPVFGTMLDLILAGGAKKLHEYVDKRHRELG

PVYREQIGPVRAVFVNSAAEYRKILLDLAGPMPRNFLPESWQLYNEIRGQNRGLLFMDGE

EWLHHRRILNNVMIKPDPMEFLCTPCQESAKNLTEKWKAYSQIGCTIPKLEHHLYQWSIE

VMLAVMIGSRWRDCKPQLRSEIDYVAMMVHQIFEYSATLTIIPPKLAMKFKLPIWTKFVK

IVDTVLERVHNLVPKMIQLSNGDGLLQMITNYGICDDMAGRIITDFIIAAGDTTSVAMQW

MLLLLSGRPELQDQLFHDIKNLSAKEILEHKLLRNVRKETLRLYPVAPFLVRYLPTDAII

GGYLVPKGELIVMSLYSSSRDEKNFPRPNEFWPERWMKTKESLPHYQEVNDARASLPFAT

GLRNCVGRKLAITQMSLTLAE

777458 NFKIECENRDSIEMILHLVSVPSKPIKLKLTDREI* 777351

 

gray = false positive hit

 

SI2.2.0_05332 locus=Si_gnF.scaffold01962[1112728..1118120]

SI2.2.0_16179 locus=Si_gnF.scaffold01962[1098474..1099025]

SI2.2.0_04964 locus=Si_gnF.scaffold00690[840323..845689]

SI2.2.0_03570 locus=Si_gnF.scaffold00690[819513..823829].pep_2 q...   331   2e-91

SI2.2.0_11849 locus=Si_gnF.scaffold00690[830903..834155].pep_2 q...   311   2e-85

SI2.2.0_08443 locus=Si_gnF.scaffold06914[213990..220697].pep_2 q...   286   1e-77

SI2.2.0_10885 locus=Si_gnF.scaffold00514[2243796..2245382].pep_2...   283   9e-77

SI2.2.0_05526 locus=Si_gnF.scaffold06914[276505..285890].pep_2 q...   276   1e-74

SI2.2.0_09298 locus=Si_gnF.scaffold01858[372836..377277].pep_2 q...   267   5e-72

SI2.2.0_09253 locus=Si_gnF.scaffold07457[349722..354526].pep_1 q...   257   4e-69

SI2.2.0_80854 locus=Si_gnF.scaffold01962[1098424..1099075].pep_1...   250   5e-67

SI2.2.0_14364 locus=Si_gnF.scaffold06914[225813..227968].pep_2 q...   250   7e-67

SI2.2.0_11609 locus=Si_gnF.scaffold04526[3572..6840].pep_2 quali...   215   2e-56

SI2.2.0_10269 locus=Si_gnF.scaffold10402[613..1578].pep_1 qualit...   208   3e-54

SI2.2.0_07419 locus=Si_gnF.scaffold00690[1246348..1251503].pep_2...   205   2e-53

SI2.2.0_03866 locus=Si_gnF.scaffold01665[1379185..1382053].pep_2...   201   3e-52

SI2.2.0_03315 locus=Si_gnF.scaffold07158[62264..68617].pep_2 qua...   199   2e-51

SI2.2.0_02576 locus=Si_gnF.scaffold00396[22166..24706].pep_1 qua...   181   4e-46

SI2.2.0_02683 locus=Si_gnF.scaffold02632[446..2543].pep_1 qualit...   179   2e-45

SI2.2.0_10180 locus=Si_gnF.scaffold10311[998741..1002074].pep_1 ...   176   9e-45

SI2.2.0_16196 locus=Si_gnF.scaffold07705[174894..175492].pep_1 q...   169   1e-42

SI2.2.0_02873 locus=Si_gnF.scaffold04403[8919..10009].pep_1 qual...   167   4e-42

SI2.2.0_06461 locus=Si_gnF.scaffold04526[92619..94595].pep_2 qua...   167   7e-42

SI2.2.0_07988 locus=Si_gnF.scaffold10311[243960..245314].pep_1 q...   162   2e-40

SI2.2.0_05728 locus=Si_gnF.scaffold05127[137107..142000].pep_2 q...   160   7e-40

SI2.2.0_80135 locus=Si_gnF.scaffold02230[1197790..1203798].pep_1...   159   1e-39

SI2.2.0_13106 locus=Si_gnF.scaffold02434[44924..46061].pep_2 qua...   157   8e-39

SI2.2.0_08400 locus=Si_gnF.scaffold07259[82315..85809].pep_2 qua...   156   1e-38

SI2.2.0_08695 locus=Si_gnF.scaffold07231[11132..12865].pep_2 qua...   155   3e-38

SI2.2.0_13117 locus=Si_gnF.scaffold02434[57118..57848].pep_1 qua...   154   4e-38

SI2.2.0_09066 locus=Si_gnF.scaffold00695[58599..62336].pep_2 qua...   154   6e-38

SI2.2.0_09464 locus=Si_gnF.scaffold07259[20640..25605].pep_2 qua...   150   7e-37

SI2.2.0_00435 locus=Si_gnF.scaffold04311[9272..11493].pep_2 qual...   149   2e-36

SI2.2.0_07739 locus=Si_gnF.scaffold03952[1060521..1063083].pep_1...   149   2e-36

SI2.2.0_07302 locus=Si_gnF.scaffold01412[1121..7162].pep_1 quali...   147   5e-36

SI2.2.0_07734 locus=Si_gnF.scaffold02797[2160804..2163910].pep_1...   145   2e-35

SI2.2.0_08209 locus=Si_gnF.scaffold03126[1796735..1799417].pep_1...   145   2e-35

SI2.2.0_01135 locus=Si_gnF.scaffold10535[550195..552510].pep_2 q...   144   4e-35

SI2.2.0_11819 locus=Si_gnF.scaffold01122[1198437..1203801].pep_1...   144   4e-35

SI2.2.0_00515 locus=Si_gnF.scaffold10535[567686..570190].pep_2 q...   144   7e-35

SI2.2.0_06333 locus=Si_gnF.scaffold07259[95186..106506].pep_2 qu...   143   9e-35

SI2.2.0_08052 locus=Si_gnF.scaffold02797[2165295..2167960].pep_1...   143   1e-34

SI2.2.0_12116 locus=Si_gnF.scaffold04526[34695..37294].pep_2 qua...   143   1e-34

SI2.2.0_12858 locus=Si_gnF.scaffold06131[31109..33220].pep_2 qua...   142   1e-34

SI2.2.0_00612 locus=Si_gnF.scaffold05127[124304..130848].pep_2 q...   141   3e-34

SI2.2.0_07409 locus=Si_gnF.scaffold03952[984024..986415].pep_1 q...   141   4e-34

SI2.2.0_05967 locus=Si_gnF.scaffold01203[623501..626654].pep_2 q...   139   2e-33

SI2.2.0_04743 locus=Si_gnF.scaffold00805[326152..327754].pep_2 q...   139   2e-33

SI2.2.0_80741 locus=Si_gnF.scaffold10311[414009..416184].pep_1 f...   135   2e-32

SI2.2.0_09260 locus=Si_gnF.scaffold05118[811159..812997].pep_1 q...   134   7e-32

 

SI2.2.0_11819 locus=Si_gnF.scaffold01122[1198437..1203801].pep_1...   732   0.0  

SI2.2.0_80741 locus=Si_gnF.scaffold10311[414009..416184].pep_1 f...   505   e-143

SI2.2.0_11458 locus=Si_gnF.scaffold02923[1829820..1832402].pep_1...   483   e-137

SI2.2.0_80332 locus=Si_gnF.scaffold06002[239062..240697].pep_2 f...   472   e-134

SI2.2.0_02683 locus=Si_gnF.scaffold02632[446..2543].pep_1 qualit...   432   e-121

SI2.2.0_80135 locus=Si_gnF.scaffold02230[1197790..1203798].pep_1...   395   e-110

SI2.2.0_07988 locus=Si_gnF.scaffold10311[243960..245314].pep_1 q...   380   e-106

SI2.2.0_03658 locus=Si_gnF.scaffold10311[393741..405822].pep_1 q...   352   1e-97

SI2.2.0_07302 locus=Si_gnF.scaffold01412[1121..7162].pep_1 quali...   345   2e-95

SI2.2.0_07739 locus=Si_gnF.scaffold03952[1060521..1063083].pep_1...   301   4e-82

SI2.2.0_03692 locus=Si_gnF.scaffold03952[1070028..1078005].pep_1...   285   3e-77

SI2.2.0_00515 locus=Si_gnF.scaffold10535[567686..570190].pep_2 q...   280   5e-76

SI2.2.0_01866 locus=Si_gnF.scaffold03952[999010..1000837].pep_1 ...   279   1e-75

SI2.2.0_01135 locus=Si_gnF.scaffold10535[550195..552510].pep_2 q...   276   9e-75

SI2.2.0_05967 locus=Si_gnF.scaffold01203[623501..626654].pep_2 q...   276   1e-74

SI2.2.0_09260 locus=Si_gnF.scaffold05118[811159..812997].pep_1 q...   274   4e-74

SI2.2.0_08052 locus=Si_gnF.scaffold02797[2165295..2167960].pep_1...   262   1e-70

SI2.2.0_07409 locus=Si_gnF.scaffold03952[984024..986415].pep_1 q...   261   4e-70

SI2.2.0_07734 locus=Si_gnF.scaffold02797[2160804..2163910].pep_1...   260   7e-70

SI2.2.0_15722 locus=Si_gnF.scaffold06627[10922..13029].pep_2 qua...   259   1e-69

SI2.2.0_08400 locus=Si_gnF.scaffold07259[82315..85809].pep_2 qua...   254   5e-68

SI2.2.0_09066 locus=Si_gnF.scaffold00695[58599..62336].pep_2 qua...   248   3e-66

SI2.2.0_06333 locus=Si_gnF.scaffold07259[95186..106506].pep_2 qu...   248   4e-66

SI2.2.0_00435 locus=Si_gnF.scaffold04311[9272..11493].pep_2 qual...   245   2e-65

SI2.2.0_00612 locus=Si_gnF.scaffold05127[124304..130848].pep_2 q...   244   3e-65

SI2.2.0_09464 locus=Si_gnF.scaffold07259[20640..25605].pep_2 qua...   243   7e-65

SI2.2.0_05728 locus=Si_gnF.scaffold05127[137107..142000].pep_2 q...   242   2e-64

SI2.2.0_04743 locus=Si_gnF.scaffold00805[326152..327754].pep_2 q...   241   4e-64

SI2.2.0_08209 locus=Si_gnF.scaffold03126[1796735..1799417].pep_1...   240   6e-64

SI2.2.0_05364 locus=Si_gnF.scaffold00805[343034..344561].pep_1 q...   237   5e-63

SI2.2.0_16389 locus=Si_gnF.scaffold10311[950643..951408].pep_2 q...   211   4e-55

SI2.2.0_02304 locus=Si_gnF.scaffold02694[5543669..5546106].pep_2...   196   1e-50

SI2.2.0_10369 locus=Si_gnF.scaffold03952[1020738..1021385].pep_2...   154   5e-38

SI2.2.0_04515 locus=Si_gnF.scaffold10523[10913..12257].pep_1 qua...   137   9e-33

SI2.2.0_04389 locus=Si_gnF.scaffold01203[896558..897971].pep_1 q...   130   6e-31

SI2.2.0_11609 locus=Si_gnF.scaffold04526[3572..6840].pep_2 quali...   122   3e-28

SI2.2.0_14364 locus=Si_gnF.scaffold06914[225813..227968].pep_2 q...   121   4e-28

SI2.2.0_07415 locus=Si_gnF.scaffold06568[34646..36399].pep_2 qua...   120   7e-28

SI2.2.0_16103 locus=Si_gnF.scaffold03952[1015095..1015896].pep_1...   119   1e-27

SI2.2.0_08443 locus=Si_gnF.scaffold06914[213990..220697].pep_2 q...   119   3e-27

SI2.2.0_09298 locus=Si_gnF.scaffold01858[372836..377277].pep_2 q...   118   4e-27

SI2.2.0_04964 locus=Si_gnF.scaffold00690[840273..845739].pep_2 q...   117   1e-26

SI2.2.0_03570 locus=Si_gnF.scaffold00690[819513..823829].pep_2 q...   113   1e-25

SI2.2.0_11849 locus=Si_gnF.scaffold00690[830903..834155].pep_2 q...   110   9e-25

SI2.2.0_05526 locus=Si_gnF.scaffold06914[276505..285890].pep_2 q...   108   3e-24

SI2.2.0_02014 locus=Si_gnF.scaffold00310[251591..252753].pep_1 q...   107   8e-24

SI2.2.0_09253 locus=Si_gnF.scaffold07457[349722..354526].pep_1 q...   106   1e-23

SI2.2.0_03315 locus=Si_gnF.scaffold07158[62264..68617].pep_2 qua...   103   1e-22

SI2.2.0_03866 locus=Si_gnF.scaffold01665[1379185..1382053].pep_2...   100   1e-21

SI2.2.0_02576 locus=Si_gnF.scaffold00396[22166..24706].pep_1 qua...    99   2e-21

 

SI2.2.0_13834 locus=Si_gnF.scaffold06514[46057..46897].pep_1 qua...   278   2e-75

SI2.2.0_04114 locus=Si_gnF.scaffold06118[11791..13359].pep_2 qua...   173   9e-44

SI2.2.0_04668 locus=Si_gnF.scaffold05901[330026..333131].pep_1 q...   166   1e-41

SI2.2.0_06264 locus=Si_gnF.scaffold07142[20598..22169].pep_2 qua...   163   9e-41

SI2.2.0_01258 locus=Si_gnF.scaffold05901[323203..327018].pep_1 q...   155   2e-38

SI2.2.0_13260 locus=Si_gnF.scaffold06988[3483..4542].pep_2 quali...   131   5e-31

SI2.2.0_01048 locus=Si_gnF.scaffold03327[1087123..1090898].pep_2...   107   1e-23

SI2.2.0_13749 locus=Si_gnF.scaffold03503[1066334..1067372].pep_2...    95   4e-20

SI2.2.0_09914 locus=Si_gnF.scaffold01122[3858831..3866605].pep_2...    92   3e-19

SI2.2.0_03692 locus=Si_gnF.scaffold03952[1070028..1078005].pep_1...    81   6e-16

SI2.2.0_12116 locus=Si_gnF.scaffold04526[34695..37294].pep_2 qua...    80   2e-15

SI2.2.0_12229 locus=Si_gnF.scaffold01122[777480..779878].pep_2 q...    79   3e-15

SI2.2.0_05526 locus=Si_gnF.scaffold06914[276505..285890].pep_2 q...    78   5e-15

SI2.2.0_01135 locus=Si_gnF.scaffold10535[550195..552510].pep_2 q...    77   1e-14

SI2.2.0_05967 locus=Si_gnF.scaffold01203[623501..626654].pep_2 q...    77   1e-14

SI2.2.0_02477 locus=Si_gnF.scaffold06899[1060075..1061474].pep_2...    76   2e-14

SI2.2.0_07734 locus=Si_gnF.scaffold02797[2160804..2163910].pep_1...    75   3e-14

SI2.2.0_11609 locus=Si_gnF.scaffold04526[3572..6840].pep_2 quali...    75   4e-14

SI2.2.0_80332 locus=Si_gnF.scaffold06002[239062..240697].pep_2 f...    74   7e-14

SI2.2.0_08052 locus=Si_gnF.scaffold02797[2165295..2167960].pep_1...    74   7e-14

SI2.2.0_01866 locus=Si_gnF.scaffold03952[999010..1000837].pep_1 ...    74   7e-14

SI2.2.0_08443 locus=Si_gnF.scaffold06914[213990..220697].pep_2 q...    73   2e-13

SI2.2.0_14364 locus=Si_gnF.scaffold06914[225813..227968].pep_2 q...    73   2e-13

SI2.2.0_11819 locus=Si_gnF.scaffold01122[1198437..1203801].pep_1...    73   2e-13

SI2.2.0_04743 locus=Si_gnF.scaffold00805[326152..327754].pep_2 q...    72   3e-13

SI2.2.0_14452 locus=Si_gnF.scaffold01858[316261..316663].pep_2 q...    72   3e-13

SI2.2.0_03866 locus=Si_gnF.scaffold01665[1379185..1382053].pep_2...    72   3e-13

SI2.2.0_15722 locus=Si_gnF.scaffold06627[10922..13029].pep_2 qua...    72   5e-13

SI2.2.0_07739 locus=Si_gnF.scaffold03952[1060521..1063083].pep_1...    72   5e-13

SI2.2.0_00987 locus=Si_gnF.scaffold01390[678278..682732].pep_2 q...    69   4e-12

SI2.2.0_80741 locus=Si_gnF.scaffold10311[414009..416184].pep_1 f...    68   7e-12

SI2.2.0_11039 locus=Si_gnF.scaffold05285[220205..226889].pep_1 q...    68   7e-12

SI2.2.0_04964 locus=Si_gnF.scaffold00690[840273..845739].pep_2 q...    68   7e-12

SI2.2.0_02304 locus=Si_gnF.scaffold02694[5543669..5546106].pep_2...    67   1e-11

SI2.2.0_09298 locus=Si_gnF.scaffold01858[372836..377277].pep_2 q...    67   1e-11

SI2.2.0_03315 locus=Si_gnF.scaffold07158[62264..68617].pep_2 qua...    66   3e-11

SI2.2.0_00515 locus=Si_gnF.scaffold10535[567686..570190].pep_2 q...    66   3e-11

SI2.2.0_04389 locus=Si_gnF.scaffold01203[896558..897971].pep_1 q...    65   3e-11

SI2.2.0_09253 locus=Si_gnF.scaffold07457[349722..354526].pep_1 q...    65   6e-11

SI2.2.0_11849 locus=Si_gnF.scaffold00690[830903..834155].pep_2 q...    64   7e-11

SI2.2.0_05364 locus=Si_gnF.scaffold00805[343034..344561].pep_1 q...    64   1e-10

SI2.2.0_00435 locus=Si_gnF.scaffold04311[9272..11493].pep_2 qual...    63   2e-10

SI2.2.0_03570 locus=Si_gnF.scaffold00690[819513..823829].pep_2 q...    63   2e-10

SI2.2.0_06964 locus=Si_gnF.scaffold09376[46988..51954].pep_1 qua...    62   4e-10

SI2.2.0_07409 locus=Si_gnF.scaffold03952[984024..986415].pep_1 q...    62   5e-10

SI2.2.0_08209 locus=Si_gnF.scaffold03126[1796735..1799417].pep_1...    61   8e-10

SI2.2.0_11458 locus=Si_gnF.scaffold02923[1829820..1832402].pep_1...    60   1e-09

SI2.2.0_02683 locus=Si_gnF.scaffold02632[446..2543].pep_1 qualit...    60   1e-09

SI2.2.0_02182 locus=Si_gnF.scaffold01122[3850287..3858595].pep_1...    59   2e-09

SI2.2.0_80854 locus=Si_gnF.scaffold01962[1098424..1099075].pep_1...    59   3e-09

SI2.2.0_08400 locus=Si_gnF.scaffold07259[82315..85809].pep_2 qua...    59   4e-09

SI2.2.0_16196 locus=Si_gnF.scaffold07705[174894..175492].pep_1 q...    57   1e-08

SI2.2.0_08600 locus=Si_gnF.scaffold07694[25012..26199].pep_2 qua...    57   1e-08

SI2.2.0_09066 locus=Si_gnF.scaffold00695[58599..62336].pep_2 qua...    57   1e-08

SI2.2.0_06461 locus=Si_gnF.scaffold04526[92619..94595].pep_2 qua...    56   2e-08

SI2.2.0_01999 locus=Si_gnF.scaffold02189[366087..369726].pep_2 q...    56   2e-08

SI2.2.0_10180 locus=Si_gnF.scaffold10311[998741..1002074].pep_1 ...    56   3e-08

SI2.2.0_00612 locus=Si_gnF.scaffold05127[124304..130848].pep_2 q...    55   3e-08

SI2.2.0_02221 locus=Si_gnF.scaffold02189[352701..357669].pep_2 q...    55   4e-08

SI2.2.0_12858 locus=Si_gnF.scaffold06131[31109..33220].pep_2 qua...    55   6e-08

SI2.2.0_08695 locus=Si_gnF.scaffold07231[11132..12865].pep_2 qua...    55   6e-08

SI2.2.0_05728 locus=Si_gnF.scaffold05127[137107..142000].pep_2 q...    55   6e-08

SI2.2.0_06922 locus=Si_gnF.scaffold06118[22548..24060].pep_2 qua...    54   1e-07

SI2.2.0_16179 locus=Si_gnF.scaffold04403[1042..2440].pep_1 quali...    53   2e-07

SI2.2.0_07302 locus=Si_gnF.scaffold01412[1121..7162].pep_1 quali...    53   2e-07

SI2.2.0_15057 locus=Si_gnF.scaffold07142[30016..31390].pep_2 qua...    53   2e-07

SI2.2.0_09464 locus=Si_gnF.scaffold07259[20640..25605].pep_2 qua...    53   2e-07

SI2.2.0_03658 locus=Si_gnF.scaffold10311[393741..405822].pep_1 q...    52   4e-07

SI2.2.0_02576 locus=Si_gnF.scaffold00396[22166..24706].pep_1 qua...    52   5e-07

SI2.2.0_07988 locus=Si_gnF.scaffold10311[243960..245314].pep_1 q...    51   6e-07

SI2.2.0_10269 locus=Si_gnF.scaffold10402[613..1578].pep_1 qualit...    51   8e-07

SI2.2.0_80135 locus=Si_gnF.scaffold02230[1197790..1203798].pep_1...    50   1e-06

SI2.2.0_07419 locus=Si_gnF.scaffold00690[1246348..1251503].pep_2...    50   1e-06

SI2.2.0_07130 locus=Si_gnF.scaffold04526[33472..34072].pep_1 qua...    49   3e-06

SI2.2.0_09260 locus=Si_gnF.scaffold05118[811159..812997].pep_1 q...    48   7e-06

SI2.2.0_01601 locus=Si_gnF.scaffold07174[18304..18930].pep_2 qua...    47   9e-06

SI2.2.0_07823 locus=Si_gnF.scaffold03038[182371..186851].pep_2 q...    47   2e-05

SI2.2.0_09725 locus=Si_gnF.scaffold10523[13449..14155].pep_2 qua...    46   2e-05

SI2.2.0_01770 locus=Si_gnF.scaffold06503[14438..20381].pep_2 qua...    46   3e-05

SI2.2.0_13566 locus=Si_gnF.scaffold03503[1034199..1034618].pep_1...    46   3e-05

SI2.2.0_07582 locus=Si_gnF.scaffold07656[135419..136785].pep_1 q...    45   4e-05

SI2.2.0_12267 locus=Si_gnF.scaffold06810[31342..32912].pep_1 qua...    44   8e-05

SI2.2.0_06333 locus=Si_gnF.scaffold07259[95186..106506].pep_2 qu...    44   8e-05

SI2.2.0_05877 locus=Si_gnF.scaffold10539[163160..164476].pep_1 q...    44   1e-04

SI2.2.0_03123 locus=Si_gnF.scaffold06568[27687..28233].pep_2 qua...    44   1e-04

SI2.2.0_02014 locus=Si_gnF.scaffold00310[251591..252753].pep_1 q...    42   3e-04

SI2.2.0_03143 locus=Si_gnF.scaffold07426[2227..2554].pep_2 quali...    39   0.003

SI2.2.0_04496 locus=Si_gnF.scaffold07332[3345..4400].pep_1 quali...    37   0.013

SI2.2.0_16165 locus=Si_gnF.scaffold06767[19994..20879].pep_2 qua...    36   0.021

SI2.2.0_15026 locus=Si_gnF.scaffold06744[20120..20530].pep_1 qua...    34   0.081

SI2.2.0_10885 locus=Si_gnF.scaffold00514[2243796..2245382].pep_2...    33   0.14 

SI2.2.0_04607 locus=Si_gnF.scaffold01962[1200928..1201334].pep_1...    33   0.18 

SI2.2.0_16115 locus=Si_gnF.scaffold02127[775832..777664].pep_2 q...    33   0.24 

SI2.2.0_11899 locus=Si_gnF.scaffold03776[896776..907958].pep_2 q...    32   0.31 

SI2.2.0_10157 locus=Si_gnF.scaffold01506[185707..191608].pep_2 q...    31   0.90 

SI2.2.0_12836 locus=Si_gnF.scaffold07142[11216..11741].pep_2 qua...    31   0.90 

SI2.2.0_01758 locus=Si_gnF.scaffold06944[35222..35543].pep_2 qua...    30   1.2  

SI2.2.0_04515 locus=Si_gnF.scaffold10523[10913..12257].pep_1 qua...    30   1.5  

SI2.2.0_09014 locus=Si_gnF.scaffold02470[384805..386979].pep_1 q...    30   1.5  

SI2.2.0_12881 locus=Si_gnF.scaffold09503[17815..28222].pep_2 qua...    30   1.5  

 

SI2.2.0_00987 locus=Si_gnF.scaffold01390[678278..682732].pep_2 q...   744   0.0  

SI2.2.0_11039 locus=Si_gnF.scaffold05285[220205..226889].pep_1 q...   259   9e-70

SI2.2.0_02182 locus=Si_gnF.scaffold01122[3850287..3858595].pep_1...   229   2e-60

SI2.2.0_06964 locus=Si_gnF.scaffold09376[46988..51954].pep_1 qua...   177   8e-45

SI2.2.0_09914 locus=Si_gnF.scaffold01122[3858831..3866605].pep_2...   173   9e-44

SI2.2.0_08443 locus=Si_gnF.scaffold06914[213990..220697].pep_2 q...   107   1e-23

SI2.2.0_05526 locus=Si_gnF.scaffold06914[276505..285890].pep_2 q...   102   2e-22

SI2.2.0_02683 locus=Si_gnF.scaffold02632[446..2543].pep_1 qualit...   101   5e-22

SI2.2.0_00515 locus=Si_gnF.scaffold10535[567686..570190].pep_2 q...    99   4e-21

SI2.2.0_05364 locus=Si_gnF.scaffold00805[343034..344561].pep_1 q...    98   6e-21

SI2.2.0_11458 locus=Si_gnF.scaffold02923[1829820..1832402].pep_1...    97   1e-20

SI2.2.0_04743 locus=Si_gnF.scaffold00805[326152..327754].pep_2 q...    97   1e-20

SI2.2.0_80135 locus=Si_gnF.scaffold02230[1197790..1203798].pep_1...    96   2e-20

SI2.2.0_09066 locus=Si_gnF.scaffold00695[58599..62336].pep_2 qua...    96   2e-20

SI2.2.0_08400 locus=Si_gnF.scaffold07259[82315..85809].pep_2 qua...    93   1e-19

SI2.2.0_04964 locus=Si_gnF.scaffold00690[840273..845739].pep_2 q...    92   3e-19

SI2.2.0_03866 locus=Si_gnF.scaffold01665[1379185..1382053].pep_2...    91   6e-19

SI2.2.0_03570 locus=Si_gnF.scaffold00690[819513..823829].pep_2 q...    91   6e-19

SI2.2.0_07988 locus=Si_gnF.scaffold10311[243960..245314].pep_1 q...    91   7e-19

SI2.2.0_01135 locus=Si_gnF.scaffold10535[550195..552510].pep_2 q...    91   1e-18

SI2.2.0_11819 locus=Si_gnF.scaffold01122[1198437..1203801].pep_1...    91   1e-18

SI2.2.0_14364 locus=Si_gnF.scaffold06914[225813..227968].pep_2 q...    90   1e-18

SI2.2.0_04389 locus=Si_gnF.scaffold01203[896558..897971].pep_1 q...    90   1e-18

SI2.2.0_12229 locus=Si_gnF.scaffold01122[777480..779878].pep_2 q...    90   2e-18

SI2.2.0_06333 locus=Si_gnF.scaffold07259[95186..106506].pep_2 qu...    90   2e-18

SI2.2.0_07302 locus=Si_gnF.scaffold01412[1121..7162].pep_1 quali...    89   2e-18

SI2.2.0_03692 locus=Si_gnF.scaffold03952[1070028..1078005].pep_1...    87   8e-18

SI2.2.0_80741 locus=Si_gnF.scaffold10311[414009..416184].pep_1 f...    87   1e-17

SI2.2.0_05967 locus=Si_gnF.scaffold01203[623501..626654].pep_2 q...    85   5e-17

SI2.2.0_07739 locus=Si_gnF.scaffold03952[1060521..1063083].pep_1...    84   1e-16

SI2.2.0_11609 locus=Si_gnF.scaffold04526[3572..6840].pep_2 quali...    83   2e-16

SI2.2.0_11849 locus=Si_gnF.scaffold00690[830903..834155].pep_2 q...    83   2e-16

SI2.2.0_80332 locus=Si_gnF.scaffold06002[239062..240697].pep_2 f...    82   3e-16

SI2.2.0_05728 locus=Si_gnF.scaffold05127[137107..142000].pep_2 q...    82   3e-16

SI2.2.0_09464 locus=Si_gnF.scaffold07259[20640..25605].pep_2 qua...    82   3e-16

SI2.2.0_03315 locus=Si_gnF.scaffold07158[62264..68617].pep_2 qua...    82   5e-16

SI2.2.0_01866 locus=Si_gnF.scaffold03952[999010..1000837].pep_1 ...    82   5e-16

SI2.2.0_03658 locus=Si_gnF.scaffold10311[393741..405822].pep_1 q...    82   5e-16

SI2.2.0_01999 locus=Si_gnF.scaffold02189[366087..369726].pep_2 q...    81   6e-16

SI2.2.0_02477 locus=Si_gnF.scaffold06899[1060075..1061474].pep_2...    81   8e-16

SI2.2.0_08209 locus=Si_gnF.scaffold03126[1796735..1799417].pep_1...    80   1e-15

SI2.2.0_09253 locus=Si_gnF.scaffold07457[349722..354526].pep_1 q...    79   3e-15

SI2.2.0_02304 locus=Si_gnF.scaffold02694[5543669..5546106].pep_2...    79   3e-15

SI2.2.0_00612 locus=Si_gnF.scaffold05127[124304..130848].pep_2 q...    79   4e-15

SI2.2.0_09298 locus=Si_gnF.scaffold01858[372836..377277].pep_2 q...    79   4e-15

SI2.2.0_07734 locus=Si_gnF.scaffold02797[2160804..2163910].pep_1...    77   1e-14

SI2.2.0_07409 locus=Si_gnF.scaffold03952[984024..986415].pep_1 q...    77   1e-14

SI2.2.0_12858 locus=Si_gnF.scaffold06131[31109..33220].pep_2 qua...    76   2e-14

SI2.2.0_02221 locus=Si_gnF.scaffold02189[352701..357669].pep_2 q...    76   2e-14

SI2.2.0_15722 locus=Si_gnF.scaffold06627[10922..13029].pep_2 qua...    75   6e-14

SI2.2.0_00435 locus=Si_gnF.scaffold04311[9272..11493].pep_2 qual...    74   7e-14

SI2.2.0_02576 locus=Si_gnF.scaffold00396[22166..24706].pep_1 qua...    74   7e-14

SI2.2.0_12116 locus=Si_gnF.scaffold04526[34695..37294].pep_2 qua...    72   3e-13

SI2.2.0_04668 locus=Si_gnF.scaffold05901[330026..333131].pep_1 q...    71   8e-13

SI2.2.0_09260 locus=Si_gnF.scaffold05118[811159..812997].pep_1 q...    70   2e-12

SI2.2.0_08052 locus=Si_gnF.scaffold02797[2165295..2167960].pep_1...    68   7e-12

SI2.2.0_06461 locus=Si_gnF.scaffold04526[92619..94595].pep_2 qua...    67   9e-12

SI2.2.0_06264 locus=Si_gnF.scaffold07142[20598..22169].pep_2 qua...    65   6e-11

SI2.2.0_07419 locus=Si_gnF.scaffold00690[1246348..1251503].pep_2...    64   1e-10

SI2.2.0_08695 locus=Si_gnF.scaffold07231[11132..12865].pep_2 qua...    63   2e-10

SI2.2.0_04114 locus=Si_gnF.scaffold06118[11791..13359].pep_2 qua...    62   5e-10

SI2.2.0_01258 locus=Si_gnF.scaffold05901[323203..327018].pep_1 q...    61   6e-10

SI2.2.0_16179 locus=Si_gnF.scaffold04403[1042..2440].pep_1 quali...    60   1e-09

SI2.2.0_08600 locus=Si_gnF.scaffold07694[25012..26199].pep_2 qua...    59   2e-09

SI2.2.0_10269 locus=Si_gnF.scaffold10402[613..1578].pep_1 qualit...    56   2e-08

SI2.2.0_09725 locus=Si_gnF.scaffold10523[13449..14155].pep_2 qua...    52   3e-07

SI2.2.0_01048 locus=Si_gnF.scaffold03327[1087123..1090898].pep_2...    51   9e-07

SI2.2.0_02014 locus=Si_gnF.scaffold00310[251591..252753].pep_1 q...    51   9e-07

SI2.2.0_01770 locus=Si_gnF.scaffold06503[14438..20381].pep_2 qua...    49   2e-06

SI2.2.0_05877 locus=Si_gnF.scaffold10539[163160..164476].pep_1 q...    48   6e-06

SI2.2.0_80854 locus=Si_gnF.scaffold01962[1098424..1099075].pep_1...    48   6e-06

SI2.2.0_07582 locus=Si_gnF.scaffold07656[135419..136785].pep_1 q...    47   1e-05

SI2.2.0_05332 locus=Si_gnF.scaffold01962[1112678..1118170].pep_1...    47   1e-05

SI2.2.0_04496 locus=Si_gnF.scaffold07332[3345..4400].pep_1 quali...    46   2e-05

SI2.2.0_16196 locus=Si_gnF.scaffold07705[174894..175492].pep_1 q...    46   2e-05

SI2.2.0_16165 locus=Si_gnF.scaffold06767[19994..20879].pep_2 qua...    45   4e-05

SI2.2.0_12267 locus=Si_gnF.scaffold06810[31342..32912].pep_1 qua...    43   2e-04

SI2.2.0_16294 locus=Si_gnF.scaffold10523[94..1394].pep_2 quality...    43   2e-04

SI2.2.0_01361 locus=Si_gnF.scaffold01122[3871674..3871989].pep_2...    41   9e-04

SI2.2.0_01601 locus=Si_gnF.scaffold07174[18304..18930].pep_2 qua...    40   0.001

SI2.2.0_14929 locus=Si_gnF.scaffold07060[26934..28401].pep_1 qua...    39   0.003

SI2.2.0_07130 locus=Si_gnF.scaffold04526[33472..34072].pep_1 qua...    39   0.003

SI2.2.0_10180 locus=Si_gnF.scaffold10311[998741..1002074].pep_1 ...    38   0.006

SI2.2.0_03143 locus=Si_gnF.scaffold07426[2227..2554].pep_2 quali...    38   0.006

SI2.2.0_14240 locus=Si_gnF.scaffold07090[399293..401961].pep_2 q...    37   0.013

SI2.2.0_07415 locus=Si_gnF.scaffold06568[34646..36399].pep_2 qua...    35   0.048

SI2.2.0_06324 locus=Si_gnF.scaffold01122[4732776..4738234].pep_1...    33   0.18 

SI2.2.0_15268 locus=Si_gnF.scaffold07231[3118..4505].pep_2 quali...    32   0.41 

SI2.2.0_14847 locus=Si_gnF.scaffold07685[18016..18735].pep_2 qua...    32   0.53 

SI2.2.0_01484 locus=Si_gnF.scaffold03478[12918..15828].pep_2 qua...    32   0.53 

SI2.2.0_16333 locus=Si_gnF.scaffold06810[32917..35445].pep_2 qua...    31   0.70 

SI2.2.0_10425 locus=Si_gnF.scaffold06343[683246..687553].pep_2 q...    31   0.91 

SI2.2.0_80460 locus=Si_gnF.scaffold00805[175585..186529].pep_1 f...    30   1.2  

SI2.2.0_07823 locus=Si_gnF.scaffold03038[182371..186851].pep_2 q...    30   1.6  

SI2.2.0_02701 locus=Si_gnF.scaffold03171[375130..378722].pep_2 q...    30   2.0  

SI2.2.0_03123 locus=Si_gnF.scaffold06568[27687..28233].pep_2 qua...    29   2.7  

SI2.2.0_15879 locus=Si_gnF.scaffold06810[24231..30763].pep_2 qua...    29   3.5  

SI2.2.0_05756 locus=Si_gnF.scaffold05431[120055..124732].pep_1 q...    28   4.5  

SI2.2.0_01000 locus=Si_gnF.scaffold02434[48149..48466].pep_2 qua...    28   4.5  

SI2.2.0_13669 locus=Si_gnF.scaffold06899[1069740..1074893].pep_2...    28   4.5