Tribolium castaneum P450s (red flour beetle)

 

D. Nelson April 17, 2006

(from search of Genbank proteins for tribolium and P450)

147 hits – one reductase = 146 hits (127 different sequences)

plus CYP9D2 and seq 31, 131-144 not in the original set = 143 P450 sequences.

The other seqs not in the protein section of Genbank were found by

Blast searching the WGS section.

some are short and are from pseudogenes. 

Four sequences are broken on adjacent contigs (4Q8, 345A2, 347A3, 349A2).

Note: the roman numeral names on these sequences are from annotation by others not by me

I have assigned names to all 143 sequences.

Gene clusters have been identified.

For list of gene clusters click here

 

 

 

Previously named CYP4G7, CYP4G14, 4H10, 4H11, 4Q1, 4Q2, 4Q3, 4Q4, 4Q5, 4Q6, 4Q7,

4Q8, 4Q9, 9D1, 9D2

314A1 = GenEMBL CB336480

note 4H10 now = CYP4BR1 and 4H11 = CYP4BN6

 

CYP2 Clan (8 sequences)

 

families in this clan include CYP15, 18, 303, 304, 305, 306, 307

 

Seq 81 CYP15A1 in CYP2 clan

 

>CYP15A1 seq 81, XP_970303.1| PREDICTED: similar to Probable cytochrome P450 305a1 (CYPCCCVA1) [Tribolium castaneum] 56% to 15A1, 39% to 305A1 Dm,

41% to XP_966541 seq 82, 44% to CYP15B1 Anopheles, 48% to CYP15 Aedes

MLFFVTLVISLVLLFLILDTIKPRRYPPGPKWLPIVGNFLEFRRRLSEIGYHHLVWKEFSEEYGDVVGLK

MGRNLVVAVFGAEAVKEVLTREEFDGRPDGFFFRLRTFGKRLGIVFSDGQFWQKQRKFSMQHLRNFGFGR

KEMEEKIEEETKDLIAVFKKQCSEPIWMHTAFDVSVLNVLWAMMAGERFNINDERLRKLLKIVHDAFRLT

DMSGGMLNQLPFLRFIAPETCGYNQLVDVLVRMWEFLQETISEHRKTLCSSHARDLIDAFLQKMDIQSDS

SFTDDQLMSLCLDLFMAGSETTSNTLGFSVVYMLQFPEVQKKVQDEMDEVVGRNRWPTLQDRIKLKYTEA

VLMEIQRRANIPPLGIAHRATRDVSLFDYRIPEGTIVLTSLYSVHMDHKFWKDPLAFRPERFLNKEGNLE

VDEKYFAPFGYGKRRCLGESLAKANYFLFFTALLHNFYLEKDCDGPEPQLEGYDGVTISPKPFRAKLIPR

TD

 

Seq 80 CYP18A1 in 2 clan

 

>CYP18A1 seq 80, gi|91092498|ref|XP_968393.1| PREDICTED: similar to Cytochrome P450 18a1 (CYPXVIIIA1) [Tribolium castaneum] 37% to XP_970303, 58% to 18A1 Dm intact

MFVYSGLVLWNFLAEELSTKVLAVFLMVLFLVRLVQMLVQMLKEASALPPGPWGLPILGSLPFLKGDLHL

HFRDLTHKYGSLISTRLGSQLIVVLSDYKMIRDAFRKEEFTGRPITEFTTLLDGYGVINTAGKLWKDQRR

FLHDGLRHFGMSYIGSRKTQMENRIMREVEEFLSVLTARKDTPIDLNPVLAVSLSNVICDILMSVRFSHN

DERFKRFMFLIDEGFKLFSSLEASFFIPILKYLPGQRQTREKIAKNRAEMAQFLQETIEEHRKSFDPSHL

RDLLDTYLYEIQKADEEGTGDHLFEGKDHDRQMQQIMGDLFSAGMETIKSSLQWAVLFMLHHPEVMKAVQ

EELDQVVGRRRLPKLEDLPYLPVTESTMLEVLRISSIVPMGTTHAPTRDLKLNGFHLPRHAQIVPLLHSV

HMDPSLWHEPERFNPSRFINAEGKVVKPEYFLPFGVGRRMCLGEILARMEIFSFFSSLLHSFDICVPTGE

TLPSLKGVAGVTISPNAFRVCLKPRPMEWDSMGTIRPAGSH

 

Seq 82 CYP303A1 in CYP2 clan

 

>CYP303A1 seq 82, gi|91079760|ref|XP_966541.1| PREDICTED: similar to Probable cytochrome P450 303a1 (CYPCCCIIIA1) [Tribolium castaneum]41% to XP_970303 seq 81

42% to 303A1 Dm, 47% to 303A1 Anopheles, 51% to 303A1 Aedes

AAJJ01001201.1 first  78 aa (small gap 8 aa)

AAJJ01004085.1 starting with EFLAS

MLLAIGFFVIILGLLAYLDTKKPKNYPPGPSWLPIIGSAHTIAEWRKKAGYLYKATAEM

AEKYGPVIGLRVGKDLIVVxxxxxxxx

EFLASDDLAGRPTGAFFDMRTWGERR (1)

GVLLTDSDFWQEQRRFILRQLREFGFG

RKNMSSMIEEETAIMVESYQKMLAGKKSVTLNMESAFNIHILNTLWMMMAGIRYSPEDKNLKSLQDILGR

LFSTVDMVGAPFSQFPILRFIAPEISGYKLYLETHLQIWEFLYDELKRHKETWDENNLRDFMDVYLKMLN

SPERKESFCEKQLLAICLDMFMAGSETTSKSLGFCFLNLIMYPDVQKKAQQEIDAVVGRNRLPSLEDRPQ

MPYMECVVLEALRMFSGRAFTVPHRAFKDTHLNGYIIPKDAMVIANMHGTLMGPESGVEDPEIFKPERYL

KDGKITLADTYLPFGFGKHRCLGETLAKANVFLFTASLLQHFNFSIVPGSPPTTECIDGVTPGPLPFKAL

VTPRE

 

Seq 126 CYP304E1

 

>CYP304E1 seq 126, gi|91077588|ref|XP_973180.1| PREDICTED: similar to Probable cytochrome P450 304a1 (CYPCCCIVA1) [Tribolium castaneum] 33% to XP_970303 seq 81

37% to 304a1 Dm, 40% to 304Byy Aedes, 38% to 304B1 Anopheles

AAJJ01000062.1, DT790944.1 DN650948.1 ESTs

MLGFLTLLVTFVTLLVFLFYKFSKERPENFPPGPPSLPIWGSYWFLLKENYNLLHLSFETLGKRYKTDIL

GFFLGNAPTVVTLSYELTKEMLSRDEFMGRNDTIIVQTRSRGSPKGIFFTDGPVWKQQRRFALRHMRDYG

FGRRSENMENLAHQETNYLIDFLTKEPSQGDLDVCKKKGLVLVPDFMYGSLINTVMLVLTSRHFEHQEVR

KYAKAAFRFMKSEDSTGGAITITPWLRYIAPTFFGFTSAVDDNDMLIDFMK (0)

GLIEEHVETFSDDHHRDFI

DDYISESIKQGIEID (1)

23621 YLQLALITLDFMFPSPVGVGHTLSFYFAHLINNPEIQTKIQEEIDQVVGRSRLPS

LDDRKDLPYFEASIRENLRLMPVTPLGVTRRCVKDTMLGGHFIPKDSFVLANLWTAHRDPRIWDDPEEFR

PERFLDSDGKLLRKDYTIGFGAGKRLCAGETYARNTMFLIMSGLLQNFTFKSPYNRPIDLKDVLPGVTLS

LKETWISAVPR

 

Seq 119 CYP305A1

 

>CYP305A1 seq 119, gi|91079738|ref|XP_970235.1| PREDICTED: similar to Probable cytochrome P450 305a1 (CYPCCCVA1) [Tribolium castaneum] 38% to XP_970303 seq 81

41% to 305A1 Dm, 46% to 305A5 Aedes, 40% to 305B1 B. mori

MWLAVLLFFVFVVTYVIQQVKKPPNFPPGPYWLPFVGNLPQLKKLSKKLGGQHLALSHLAKEYNTNVLGL

KLGKDYVVTVFTYPLIRDVLISEEFEGRPDNFFLRLRCMGQKRGITCTEGEEWNTLRNFVNRHLRNLGFG

KKPMEKMIQDEICDILTILKKDGSDIQVDKFLAPCVLSVIWTLITGEKISRENNQLDELLDLFNLRSKAF

DMTGGTLTQYPWLRYFLPEWSGFNLIKSVNTSLKNLFMKYIREHKDGWFEGRNEDLIYRYISEMKTNTEA

SKYFTDDHLVMVCVDLFIGGAQTTSRTLGFAFLMMIMYPEVQKKVQEQIDKHYDKNSSIEYSDRYKLPYV

EAVLLETIRYRYVVPIGGPRRVTKNTTLDGYYLPKNTTVLISFYSINNDPENWQNPEIFNPERFLDEKGS

LLPDEKLIPFALGRRRCVGEILAKNCIFLLFVEILRRYNVSLAPGSKPPTGKPIAGITLSPESYRVKFTE

RSL

 

Seq 79 CYP306A1

 

>CYP306A1 seq 79, gi|91092500|ref|XP_968477.1| PREDICTED: similar to Cytochrome P450 306a1 (CYPCCCVIA1) (Phantom protein) (Dmphm), partial [Tribolium castaneum]

39% to 306A1 short seq needs revision, 46% to 306a1 Aedes, 49% to bee 306A1

AAJJ01000667.1

MAPLWSVLLSFLLFIIAYTWLRRSRNLPPGPWNLPVIGYLAWLNPQFPYLTLTSLSKKYGPIYGLYLGSI

YTVVISDAKLIKKTFNKDASSGRAPLHLTHGIMKGFGLICAQGDLWKDQRKFVHNTLRTLGASKVSPNRP

TMEALILHHVSDLVQHIKSLGESVTLDPLDSLRHSLGSAINQMVFGKCWSRDDATWKWLQHLQEEGTKHI

GVAGPLNFLPLLRFLPKSKQTINFLTEGIRDTHQIYREIIEEQKNSSNETVSNVIQAFLAEKEKRKNEDS

VKFYNDQQFHYLLADIFGASLDTTLTTLRWYVLYMAVHQDVQKKVRSLLNDLTLEQIAMVPYFEATIAEV

QRIRPVVPVGIPHGSVEELEIAQYKVPPGTMIVPLQWAVHMDANIWDEPEVFKPERFINEEGKFFKPEAF

IPFQAGKRMCVGDELARMFLYLFGAALVKNFAISCMGEVDLTGDCGITLTPKPHELIFTSL

 

Seq 131 CYP307A1

 

>CYP307A1 seq 131, AAJJ01000951.1  Tribolium castaneum strain Georgia GA2

55% to 307A1

MLALLCLCVVLLVWWFSRPKKSPSTI

33251  PGPRPWPLIGSMHLLAGHETPFQAFTALSRVYGDIFSIHLGSASCVVVNNFKLIKEVLIA  33430

33431  KGGDFGGRPDFARFHKLFGGDRNN (1) 33502

34320  SLALCDWSSLQKTRRSIARTYCSPRFTSLQYDRVNNVGEEELKSFLHQLDQLPHGQPC  34493

34494  NVKPAVLMVCANMFTQYMCSTSFAYEDKGFQKIVRYFDEIFWEINQGYAVDFLPWLLPVY  34673

34674  TGHMKKISNWATEIRQFILSRIIDKHRATLDTNSPPRDFTDALLMHLEEDPNMNWQHIIF  34853

34854  ELEDFLGGHSAIGNLVMVTLAAVVDHPEVAKRIQEEVDQVTGGTRCPNLFDKAAMPYTE  35030

35031  ATILETLRTASSPIVPHVASKDTEIDGHEVSKGTIVFINNYELNQGDAYWDEPGLFKPER  35210

35211  FLSSTGNIVKPAHFIPFSTGKRTCIGQRLVQCFSFVVLATLLQYYDVSTKESVK  35372

35373  VQPGCVAVPPDCFKLVLTPRK*  35438

 

seq 132 CYP307B1

 

>CYP307B1 seq 132, AAJJ01001163.1  Tribolium castaneum strain Georgia GA2

53% to 307B1 Anopheles, 55% to 307B Aedes, 51% to bee 307B1

13728  MFFTQFTLYLIAFVVLATVFAIAEAMRTRQGKY

13629  RPPSPLKLPIIGHLHLMSGYQVPYQAFTSLSKKFGSVFGLQLGYVKCVVINGQKNIREAL  13450

13449  VTKGHHFDSRPNFERYQQLFSGNKEN (1) 13372

13324  SLAFCNWSTTQKTRRDMLKAYTFPRAFTNRFYTLEELVSSGTRSVVAALSTNTTSTKSV  13148

13147  ISRHCANIFTRHFCSKSFDVDEATFVEMVDNYDEIFYEVNQGYAADFLPFLLPFHEKNLK  12968

12967  RVNGLTHKIRDFVLDHIIEGRFDSFDVQAEPDDYVESLIKYVKSGESPQLSWDSALFALE  12788

12787  DIIGGHSAVANFLVKLFAFLAKEPQVQENIHKEIDRVLGTKEVSISHRTLLPYTEAT  12617

12616  IFEAIRLIASPIVPRVANRDSSIN (1)  12545

12489  GLEIEKGTVIFLNNYDLSMSPQLWDEPEKFKPERFIRE  12376

12375  ERLVKPEHFLPFGGGRRSCMGYKMVQLVSFGILGGIMQNFTIGADDTSYTVPVGSLALP  12199

12198  KDTFTFKFVRR*  12163

 

Mito clan (9 sequences)

 

This clan includes CYP12, 49, 301, 302, 314, 315

 

Seq 60 CYP12

 

>CYP12H1 seq 60, gi|91093939|ref|XP_966937.1| PREDICTED: similar to Probable cytochrome P450 12c1, mitochondrial precursor (CYPXIIC1) [Tribolium castaneum]

37% to 12c1, 38% to 12A4 mito clan, 42% to 12F2

DT790363.1 EST

MSTGSENVISQKKLDHYKNLNALENSDVMPEGWDKAKPFESLPGPKPIPFFGN

IWRFLVPKIGDFYGIDFLDLHKIFYEQYGDISILKGMINDPIVVIFNPKDYETLFRNEGIWPIRKGLQSF

NEYRKSRKDIFVNAGLLLEEGENWFKIRSVVNPILMQPRNISQYTDKMNSVADELVNNITNLLEESENGE

MPENFHNELYKWSLESVGLVTLDTHLGCLKNDLDEDSEPQKLIRSTLEMFKLMHKLDVLPSFHNYVSTPS

WRKFVQVMDFIVETNMKYVNQVLDKLEKGETTSTEIPSVLEKLLKVDRNIAVTMSIDMMIAGIDTTGRIL

GAALYFLGKNHEAQEKLRSEAISLLQTKDQAVTSEVLKKAPYLKAVIKETTRLAPIGIGNLRTTVKNLVL

GGYQIPKGTDVVTSNLVLCTNDEYFSRAKEFIPERWLSTTSGELSKKNTNPFIFAPFGYGPRSCVGKRLA

SLELEVALLKIIRNFELDWPHEDMVFKTKMLYGMTEPLKIHVRSV

 

Seq 87 CYP49A1 mito clan

 

>CYP49A1 seq 87, gi|91086895|ref|XP_970738.1| PREDICTED: similar to Probable cytochrome P450 49a1 (CYPXLIXA1) [Tribolium castaneum] 63% to 49A1 Dm, 47% to XP_974014 seq 88

MSLSRKLLVPKRALAVAQRAYSTDRPYSTAIMPELLDELAIPEHVERVEATPRPYSAIPGPKELPLIGNA

WRFAPIIGQYKIQELDKVMWSLNRDYGRIVKVGGLIGHPDLLFVFNGDDIEKVFRMEEAMPHRPSMPSLH

YYKQILKKDFFDGNAGVIGVHGPKWEEFRKKVQHALLPPQIAKKYIEPLDVIAGDFLHRMEDMLDENQEL

PNHFLSEIYKWALESVARVSLDTRLGCLEPNLSQNSESQRIINSINTFFWNVAEVELKMPVWRVYKNRSF

KKYIGALEDFRTLCLKHIHKSMEKMQEKNFDEIKEENISIVERILLKTDNPKLAAVLALDLLLVGVDTTS

IAAASTIYQLSQNPEKQQKLFDELQQVLPENDSKIDVSIQDKMPYLKACIKETLRMYPVIIGNGRSLQTD

TVIAGYKVPKGTHVIFPHLVVSNSEDYFHEPHRFLPERWLKTENACPMHKKIHPFVTLPFGYGRRSCLGR

RFAEAELQILLAKIFRKYKVEYNYGPLSYKITPTYVPEQPLKFKLVKRE

 

Seq 88 CYP301A1 mito clan

 

>CYP301A1, seq 88, gi|91081457|ref|XP_974014.1| PREDICTED: similar to Probable cytochrome P450 301a1, mitochondrial precursor (CYPCCCIA1) [Tribolium castaneum]

75% to 301A1 bee, 66% to CYP301A1 Dm, 47% to XP_970738

MVATSKFPQAAKIVKNITRSRSQTVTPAFCPHLENLNEAKPYSEIPGPKPIPILGNTWRLLPIIGQYDVS

DVAKLSELFYKEYGKIVKLSGLVGRPDLLFIYDANEIEKIYRQEGPTPFRPSMPCLVRYKSVVRKDFFGD

VGGVVGVHGEPWRRFRSTVQKPILQVQTVKKYIEPIENVTNYFIQRMMEMQNDDQEMPSDFDNEIHKWAL

ECIGRVSLDARLGCLDPNLPPDSEPQKIIEAAKYALRNVAILELKFPFWRYFPTSLWTRYVQNMDYFVEI

CMKHIDAAMERLKSKTVLDEKDLSLVERILANEPDPKTAYILALDLILVGIDTISMAVCSILYQLATRPE

QQEKMYQELKRVMPDPNTPLNTKLLDQMDFLKAFVKEVLRVYSTVIGNGRTLQQDTIIHGYRIPKGVQVV

FPTLITGSMEEFVSQSNEFIPERWMKKSSSDYKIHPFASLPYGYGARMCLGRRFADLEIQVLLAKLIRSY

KLEYHHEPLEYKVTFMYAPDGPLRFKVIKREE

 

Seq 61 CYP301B1

 

>CYP301B1 seq 61, gi|91081459|ref|XP_974040.1| PREDICTED: similar to Probable cytochrome P450 49a1 (CYPXLIXA1) [Tribolium castaneum] 43% to 49A1 Dm, mito clan

60% to 301B1 bee, 48% to 301A1 bee

MKLLRAAKRVISSSSQQQLGVISAIEENHCKEWADAVPYEEVPGPKPLPFLGNTWRFIPFIGDFQIEHID

KVSKKLYEKYGKIVKMQGLLGRPDMLFLFDPDEIEKVFRQEDTLPYRPSMPSLNYYKHVHRKEFFGDNCG

VIAVHGDRWQNFRTKVNQIMLQPRVTRMYVKSIETTSQELVDRIEVIKNKKSEVPDDFLNELHKWSLESI

AKIALDVRLGCLDPNAHPDTQTLINAINTFFMNVPILELKIPFWKIWNTPTFKEYLHALDTIREITLKHV

DIALHKLSQDDCEELSVLQRVLKMENDAKTASNLALDMFLVGVDTTSNAVASILYQLSLHQEKQAKLYEE

IASLLPCKSTQISHEKLDQMHYLKACIKETMRMYPVVIGNGRCTTRDRVIGGYQIPKGVQVIFQHCVISN

LEEYFPRSGEFLPERWLKNSELFRNHHPFASLPFGFGKRMCLGRRFADLEIQTVIAKVVRNFKIEYHHDK

LDYHIHPMYTPYGPLRLTFIRRQ

 

Seq 107 CYP302A1 mito clan

 

>CYP302A1 seq 107, gi|91083869|ref|XP_974252.1| PREDICTED: similar to Cytochrome P450 302a1, mitochondrial precursor (Disembodied protein) [Tribolium castaneum]

47% to 302a1, 49% to 302A1 bee

MCLFSKKSVHYLLTIRTRNYYYRGRFLTTAVDPPKSFKEIPGPLSLPLVGTLYLYFPFIGRYQFDRLHKN

ALKNFQLYGPIIREEIVPGEHIVWLGDPDDIAKMFHTEGTYPYRKSHLTLEKYRLDRPHIYNSGGLLPTN

GPEWSRIRKVFQKGLSGPTEALSFIKGSDDVISEWLDTRFKKIHKETSNMDFLQELSRLFLELIGVAAFD

IRFQSFHDDELDPCSKSTKLLESAFVTNSTILKTDNGPQLWRKFETPAYRRLRKAQELMESVAIDLVALK

LSTFKEKTSNPPTLLERYLASASLDFKDIIGVVCDFLLAGMDTTTYSSSFLLYHLATNPSTQDALYEEAC

RLLPNPAAPLTTEKYKQAEYAKCAVKESLRLRPISIGVGRQLTTDVVFSGYKVPSGTVVVTLNQVLSRME

KYFPEPDSFKPERWMKNDPSYVQTHPYLVIPFGHGQRSCIARRFAEQNMVILILKLARKYKLRWNGSEID

SKSLLINKPDGPILLSFEPR

 

Seq 36 CYP314A1

 

>CYP314A1 seq 36, gi|91091448|ref|XP_972699.1| PREDICTED: similar to Cytochrome P450 314a1, mitochondrial precursor (CYPCCCXIVA1) (Ecdysone 20-monooxygenase) (E20MO) (Shade protein) [Tribolium castaneum] 42% to 314A1 bee, 39% to 314A1 Aedes

CB336479.1 EST

MFEKIFQSLDVTSLLIIAIFFLFLEYRPPWWYRNNDCKKGVKLIPGPLALPGLGTTWIFFFGGFSFNRLH

LYYENMYKRYGPVMKEEYWCNIPVINLFEKREIVKVLKAGGKYPLRPPVEAVAHYRRSRPDRYASIGLVN

EQGEAWYDLRSTLTPALTSPKTITSFLPEAQQIADDWCNLLKLSRDKNGRVSNLNYIADRLGLELTCALV

LGRRMGFLLPGAETETGEKLAEAVRQHFLGTRDTYFGFPFWKLFPTPAYKTLIKSEASIYELALELINSA

NESTKESAVFQSVIQAEIDEREKIAAIIDFISAGIHTMKNSLLFLLHLIGQDLQIQKKIIEDSTKSYSKA

CVTETFRLLPTANALGRILEEEMELGGYRLSAGTVVVCHFGIACRDERNFPDASKFKPERWLDDDKVQTA

TNSLFLLTPFGAGRRICPGKRFIEHILPLLLESTVNSFEIQAEEELELQFEFLVTPKGQMPMVFKDRV

 

Seq 113 CYP315

 

>CYP315A1 seq 113, gi|91082845|ref|XP_970122.1| PREDICTED: similar to Cytochrome P450 315a1, mitochondrial precursor (CYPCCCXVA1) (Shadow protein) [Tribolium castaneum]

41% to 315A1 Dm

MLFRRVLAQLSTRPKSSLVSANTVLHFDEIPSPKGLPLVGTTLALIAHGSTPKLHDYVDKRHKQLGPIFK

EKLGPVSAVFVADPDEIRAVFDHEGKHPLHVLPDAWVAYNQMYGCPRGLFFMDGANWWYHRRIMNRLLLK

GDFRWIEGACECVSDKLIDSLMGESDYCGNLEATLYKWSLDVIVSILLGSGSYSQLCGELEPKVQKLAQV

THLVFQTSAKLALIPASFASKFKIPQWRRFVDSVDNALAQANALVDTLIEKKPHSDGLLPKLLAEQITLE

DIKRIIVDLVLAAGDTTAVAMEWMLYLVAKSPQIQEKLRRNPDFVKHVFKETLRLYPVAPFLTRILPEDA

ILGGYGVPKGTLVVMSIYTSGRDGRYFKNPGLFQPERWDRKDEFYSSEMKKASLPFAMGLRACVGRKVAE

TQLQMTLLKIVNKFEVELGNQREVEIVLKMVAVPSEPLLLKFKKL

 

Seq 118 CYP334B1

 

>CYP334B1 seq 118, gi|91080189|ref|XP_971083.1| PREDICTED: similar to Probable cytochrome P450 49a1 (CYPXLIXA1) [Tribolium castaneum] AAJJ01000115.1

30% to 301A1 Dm, 30% to XP_974014 seq 88

42% to 334A1 bee

MSILRGKNSPFCILRRFNNLKNFAHDSTKTSATSASATQAPSPGTFTIS (1)

GKPSISVPQDTVKVTLQKPDMDVLVDTTTISRQMVAEQISKSIAFDNIPGPISLR

56932 IIHRIWGMVPILSTQITGGAIQYFLAV (1)

56799 GSLLSWSGN

MALFKRFFDHYGPVVRLHGPLGGDIVMVSRPEHIAAVFKNEGPYPIRSSLDSVEKYRLQHRKLRHTGPIL

MFGPEWENFRKSIEQPLPQLIARQYDKIDDACNKFIARIANIRNRQEEVPGTFQKEIYKWCLECMCLVTL

DKKLGFLDPCGLSSTSDPGVLLDGLMKATKAIQRCEYGLHLWQFLPTPAWKSLVENCDAIDNVLSKYVHR

IQVLIKEKKEASDGVSKEVNCLMENVLLKPGIMVEDAMTILLDMMLIGINATAHTIAFMLYHLAKNPRCQ

VKLYNEIARQPKKLSKDALAAMPYLQACIKETLRLKPPIPLLGRILNDDLSIYNYHIPRGTYLLMVTSLS

SWREEYFEDAHKFMPERWLTPIDDMQLFASIPFGYGAKACLGKELAEMQIGALITKILRNFKIEYLYGDI

NSTNKLWAAPNKKLRFRFAERV

 

Seq 124 new family

 

>CYP353A1 seq 124, gi|91078950|ref|XP_974117.1| PREDICTED: similar to Probable cytochrome P450 12c1, mitochondrial precursor (CYPXIIC1) [Tribolium castaneum] AAJJ01000087.1

35% to XP_972699 seq 36 CYP314A1, mito clan

MSIIASWLRYNKFHTQLINIKYSPVNKSFKNLPTLKSYPVIGHSYLFFPR (1)

GKYKSERLTEAFVDISKTLGPIFKLNLGGSA

63033 MVVTLDPDHTRILFQNEGTRPERPPFPALLHFRRKRFSSVGVVPGNGEEWYKMRKGVTPLLKLQLIEPYK

RQQEDIAKTFVEYVKTHRDENFVLRDIFSHLLKFTIEGHRFHCLFSDNLETEQIIKASVDFMDGLYGTLI

EPPFWKLWKTPSYKKLESSHNTIYKILERHLEQIKFQFSENPESVKESQPYMYSLFSNDQLSWDDKIMLA

MEIFLGGIDATATTISFTLHYLSQNPEIQKMARSQ

NTDFLKACIRETLRLSPTAGGNSRFLSNNTVIGGY

LIPKGTLLLSLNSGMARDERYFKDAQKYRPQRFVRATREDFHRYASLPFGHGPRMCPGKRVAENEIILKN

FALESAGSSDVGMVFRMNRIPDKPISVRFVDTNH

 

 

CYP3 clan (70 sequences)

 

This clan includes the CYP6 and CYP9 families, CYP28, CYP308, 309, 310

 

Seq 37

 

>CYP345A2 seq 37, XP_970633.1| PREDICTED: similar to Cytochrome P450 6g1 (CYPVIG1) (Cyp6-like protein) [Tribolium castaneum] 88% to XP_970561 seq 38,

48% to XP_970485 seq 39

AAJJ01001436 exon 1 only

AAJJ01003559 exons 2-4

4485 MLLTPYLPLDTVVLLSVLALLLYKYFSRNFDHWEKKNVFYFKPIPFFGNFVDISLFRTTIGEHLAKLYNQ

TTEPFFGIFVFDKPHLIIKSPELVKTILVRDFNNFDDRCIASPHHDPLVKNMLFLNKNPEWKNVRVKMTP

VFTTGKLKGMIPLINDVGETMTKYIAQKIPNFSLEAKEICAKFSTDVIAKCAFGINANSFKNEDAEFRKI

GRRIFDFRWSTAIQQTSYFFLPGLVNLLKFRMLDKDASDFLRETFWHTIKLREEKNLKANDLIDAIIALK

DNQEFCKNMNF 3613

EGDKVVAQAAQFFVAGFETTSSTMAFTLYELCLQPQFQRRVRAEIATCLKEHNGLTYEA

LQSMKYLNMCVCETLRKYPVLPFLDRTCKEDYKLPNSNVVIEKGTPVFIPMFGLHYDPQYFPNPQKYDPE

RFSDENMQNITPFSYIPFGEGPRNCIGERFGLIGTKLGLIHILSEFEVEKSSDTPVPLEFEPKSFVLASK

VGLPMKFKKVMTSAA

 

Seq 38

 

>CYP345A1 seq 38, XP_970561.1| PREDICTED: similar to Cytochrome P450 6g1 (CYPVIG1) (Cyp6-like protein) [Tribolium castaneum] 88% to XP_970633 seq 37

AAJJ01001436

10779 MLLTSYLPLDTFLLLSVFTLLLYKYFSRNYDHWEKKNVFFFKPTPFFGNILDISLFRTTIGEHLAKLYNQ

TTEPFFGIFVFDKPHLIIKSPELVKTILVRDFNNFDDRGVASPHHDPLVKNMLFFNKNPEWKNVRVKMTP

VFTTGKLKGMIPLINDIGETLTKYIAQKTSNLSLEAKEISAKYTTDVIAKCAFGINANSLKNEDAEFRNL

GRRFFDFRWSNAIQQTSYFLLPGLVNVLKLRVMDKKDSNFLRETFWQTIKLRQENNSKAKDLIDAIIAMK

ENKEFCKNFNF 9907

9862 EGDKVVAQAAQFFIAGFETTSATMAFTLYELCLQPQIQSKVRTEIMTCVKEHNGLTYEA

LQDMKYLNMCVC (1) 9650

9600 ETLRKYPVLPFLDRTCKEDYKLPNSNVVIEKGTPVFIPMFGLHYDPQYFPNPQKYDPE

RFSDENMQNITPFSYIPFGEGPRNCI 9349

9299 GERFGLISTKLGLIHVLSNFEVERSSDTPVPLEFEPKSFVLASK

VGLPMKFKKVMTSAA* 9120

 

Seq 39

 

>CYP345B1 seq 39, XP_970485.1| PREDICTED: similar to Probable cytochrome P450 6g2 (CYPVIG2) [Tribolium castaneum] 48% to XP_970633 seq 37

AAJJ01001436

MGLELQFSIINLLILLITFWTTLYLYFTRKFNHWKSKNVPQVAPIPFFGNAFEVFTWRKNIGEFARQIYN

STTKPFIGFFICDEPYLLIRDPELVKSILVKDFAVFSNRSISENKENDPMGSHLLFLLKTPDWRDMRRKI

TPVFTSGKMKNMYSLISEAGNDMIQHMRKEVSKSDQLEMREVAARYTTDAITSTSFGINANCFKNEKAEF

REVSRRVFNWAIWERSISTTCYFIAPNLVKLFKLKFIDSASATFLREAFWRTMTDREEKKFVRNDLLDIL

IDIKKQEDINDPYKL

16321 DGDKLVAQATQFFVAGFETTSSTICFTLYELAINKDLQNKLKSEIRDVVRKHGEI

SYNSLKDMEYLDMCIK (1)

ETLRKYPVLPFLDRKCDTDYRIPGSDVVLEKGSPVFISVSGLHYDPQYFPDPDK

YDPLRFTEENIKSRPQFTYLPFGEGPRNCI (1)

GARFGSVSSKSGVAKIISEFEVDLCEKTQHPIQIDPKGFLMAPVSDLVLKFKRLDD 15592

 

Seq 42

 

>CYP6BM1 seq 42, XP_970825.1| PREDICTED: similar to Cytochrome P450 6a8 (CYPVIA8) [Tribolium castaneum] 52% to XP_970556 seq 43

MAFISLTILAILLLLAVTLFYKWKFQYWKTRQVPFLPPKIPFGNIPNPFTLKEKPGIFIKQFYQEMKRNG

WKHGGFYFFACPVYMVVDPDYIKQVLIKDFQYFIDRGIYSNEKDDPISHNLFSANETKWKYLRTLLNPSF

TSKKIKAMFTILLACEKFLTQNVENNQVIDANHIFANFTIDVITTCAFGLDCNGNQNLALKHFGEKTINY

SKLKMFVLMLASIFPKLAKKFGCVIMHKNTQEFFVQFVADIIKFREENNYTRDDFMQFLIKLKNKSAKQV

FTLEEVASQCVLFFIAGFETSHATMSFALYELAKHQDIQQKVREEFWAVVDSQESEITYEAVQKLKYLDQ

VLNETLRKYPVVMYLTRRCIKDYKVPEDGAVIEKGTTVIIPTVALNYDENYYPNPKKFDPQRFSEENKKL

RHPCIHLPFGLGPRFCIGRRFALIQVKVGLVLLLKNYSFTVNPNTREPIKLKIHSFISAPEDKILLDVHK

L

 

Seq 138

 

>CYP6BP2P seq 138, AAJJ01000994 pseudogene between seq 42 and seq 46

14792 GSGYRGFYVFVTPVYLPTDLNYVKNILTNDFNYFNRRGIYYNEKDDPLGAHLINLSGKKK 14971

14972 HILRK 14986

15032 MIKAHKVAATFTIDIIFSCTLGLDCKTFKDKHSLLQYFLNKCLFWSKFRWFVQVLAAMN 15208

15209 GSVKQNKQNFFLEIVSILNIARK*LRE

15276 NNYVRKDLQMLINQKKSNAFSVSEITAQCLPFFDAGFDTSAATLTFALT 15422

      EIAKNLEVQEIIRAEIGEINYEILLETRYLDQVID 15526

15571 KTLRKYPPVLFVPRRCCDDYRTP 15639

      SSIVIEKGTFVLISIFGI 15709

15710 HHDQESAKFDPERFCRENKKLRHPYAYIPFGEGPRS*IG 15826

15871 KRFGLMQIKFFVASISKNYKLTKNPRTPEPLTIEVDRMVLLP*NDIFLDLVKVD 16032

 

Seq 43

 

>CYP6BK1 seq 43, XP_970556.1| PREDICTED: similar to Cytochrome P450 6a2 (CYPVIA2) (P450-B1) [Tribolium castaneum] 67% to XP_970481 seq 44

MFSVLVFLIIVVVFLYYKWAFTYWHRRNIPYLEPSFPFGNLPNLFQRKENIGLTVEKFYNEMKRRKWKHG

GVYFLVSPVYCVIDLEYVKNIMNRDFEYFTNRSIYYNEKDDPLSAHLFAIGGQKWRNLRTKLTATFTSGK

MKAMFQTLLECETNLLKQIEDCNNPINIKEILSCFTTDVIGSVGFGLECKTFEEKNSPFRIYGKKVFKDS

VLRSLKRAFLTSNFPELARKLGILAFPSEITDFFLKVVADTVKYREENNRSRNDFLQLLIDLKNSGTLSL

EEIAAQCFLFFLAGFETSSTTMTFALYELAQHQDIQDKVREEIDAVLKKYGGKITYEAIHDMKYMNQVID

ETLRKYPAASIITRTCVKDYKIPDQDIVIEKGTSVIIPVLGIHHDEKFYPNPEKFDPERFTEENKAARHH

YAHLPFGEGPRICIGMRFGLVQSKVGLTSLLKNYIFKVNKKTIEPLKMQARSLILAAEGEIWLDVYKL

 

Seq 47

 

>CYP6BN1 seq 47, XP_969048.1| PREDICTED: similar to Cytochrome P450 6a2 (CYPVIA2) (P450-B1) [Tribolium castaneum] 50% to XP_970556 seq 43

MNTTIEILTIIILTIFCFYKWKFSYWKSRKIPYLDPKFPFGNVSNPFFMKEKVGMTLARFYNDMKQRGWK

YGGFYFGVSPICLIVDPDLIKNIVTRDFEHFVDRGVYFNEKDDPLSGHLANLDGQKWKNMRRKLNPTFSA

SKTKNMFPIVKFCVENMMEKVKSCYENAHKCCNINEVFPAFSINVICSCAFGLQEENALFKAYADECVSW

TKYKYLVQILATFFDKTAKRMGITTVPRNAAKFFMKVVTDSVKYREENDYVRSDFMQLLIEMKKQNQLTI

EEIAAQCFVFFIAGFETSSATLTFALYELAKNQNLQNVARDEILANCPNEITYDSLADLKFLDQVVDETL

RKYPPLLYVTRQCVKNYKIPDEDVVIEKGTLVAIPISALHSDEEFYPKPETFEPERFSKTEKSLRHPYTF

LPFGEGPRMCIGKRFGLLEVKLALTCLLKNYKFSVNCKTKEPLAMRVDTVVLAPKDEIWLDLEKI

 

Seq 44

 

>CYP6BK2 seq 44, XP_970481.1| PREDICTED: similar to Probable cytochrome P450 6a14 (CYPVIA14) [Tribolium castaneum] 65% to XP_970415 seq 45, 67% to XP_970556 seq 43

MLFSDSLTKDLFGCVLTFAILIIAYFKWSYQYWKRKNLPYLKPTFPFGNITGLLTRKETFGVIIQKVYQE

MKNCNWNHGGIYLTLNPAYCAIDLEYVKNIMTKDFQHFVDRGSYYNEKDDPLSAHLFAIGGQKWRNLRTK

LTPTFTSGKMKQMFQTLVDCESNLAKKIDMEYEKKHPIDIKEVLGCFTTDIIGSCAFGLDCKTFEHENSP

FRVYGKKLFKGSTLRNIKRSLLTQNFPDLAQKLGVLALPEDISNFFMKVVKDTVRYREKNGFTRSDFLQL

LINLKNSKVAEEEGYKHDGNTLTLEEIAAQSFVFFIAGFETSSTTMTFALYELAKNQEIQSQVREEIDAV

LKKHDGKITYDSIQDMKFMNQVIDETLRKYPPIPFVTRKCVNNYQIPGENIVIEKGTTVIIPILGIHYDK

DYYPNPEKFDPERFTEKNKNARHHYAHIPFGEGPRICIGARFGLMQTKVGLISLLRNYKFTVNNMTREPL

RMQVDSFVLAAEGEIWLDAHKL

 

Seq 48

 

>CYP6BK5 seq 48, XP_970347.1| PREDICTED: similar to Probable cytochrome P450 6a23 (CYPVIA23) [Tribolium castaneum] 73% to XP_970481 seq 44

90% to AAJJ01000871 seq 133

AAJJ01005400.1 has exact match, runs off the end

   1 IGDFFLKVVKDTVNYREKNNFTRKDFMQLLIDLK

 105 NNKLVGEEGKSERGLTIEEVAAQSFVFFLAGFETSSTTMTFALYEMAKHQDIQAKVREEIDT

     VLKKHDGKITYEAIQEMKYMGQVID (1) 365

2242 ETLRKYPPVPFLTRQCVKDYKIPNEDVTIEKGTTVIIPVLGIHYD

     KDIYPDPEKFDPERFTEENKNARHNYSHIPFGEGPRICIGMRFGLMQSKVGLTSLLKKYKFTVNKKTQEP

     IKFQVNPFILAAEGEIWLSAEKI* 2658

 

Seq 133

 

>CYP6BK9 seq 133, AAJJ01000871.1 one stop codon, possible pseudogene

note this seq has P450s from 3700-6600, 22800-21300 (-) = XP_969875,

29500-31000 = XP_969813, 33000-38500 = XP_969746

46% to 6BE1 bee, similar to 6A and 6N subfamilies

3760  MMCILGVF

3784  IALLAVILTSYYKWSFQYWERKNLPYLKPTIPYGNITSPFNRKENIAVTIQNIYEEMKTR  3963

3964  GWRHGGIYTVTSPAYFLVNLDYVKNIMTKDFQHFVNRGFYHNENDDPVSAHLFAIGGSKW  4143

4144  RFLRTKLTPTFTSGKMKMMF*TLADCEINLQEKMQDEFEKNQPIDIKEILACFTTDIIDS  4323

4324  CVFGLDCNSFKEENLPFRQYGRKVFAATKFRVVRSTFAANFPDLARFLKVRTFPKDIGD  4500

4501  FFLKVVKDTVNYREKNNFTRKDFMQLLIDLKNNKLVGEEGKSERGLTIEEVAAQSFV  4671

4672  FFLAGFETSSTTMTFALYEMVKHQHIQAKVREEINTVLQKHDGKITYEAIQEMKYMGKVVD (1) 4854

6206  ETLRKYPPVPFLTRQCVKDYKISDEDVIIEKGTTVIIPVLGIHYDKDIYPDPEKFDPERF  6385

6386  TEENKNDRHNYAHVPFGEGPRICIGMRFGLMQSKVGLTSLLKKYIFTVNKKSKEPIKFQV  6565

6566  NSLILAAQGEIWLNAERI*  6622

 

Seq 55

 

>CYP6BR1 seq 55, XP_969875.1| PREDICTED: similar to Cytochrome P450 6a2 (CYPVIA2) (P450-B1) [Tribolium castaneum] 59% to XP_969813  seq 56

MNIPSPYFEILGTVLALLVAIIFYYHHAFQFWARKNIPFIPPRFPLGNTNVVLPRGLTIGLLSKTFYDYF

KQRGHKIGGVFLVTEPNLMILDPDYIKNILLKDFHHFVDRGFYFNEKTDPISANLFTIDGDQWRNLRTKL

TPTFTSSKMKIMFQTVKNCCNNMLEAIASNTDLDKDLKEFLGRYTVDVVGSCAFGIECNSFKHPDAEFRK

MGLRAFHFSFLRSIRAFFIAYLPKLSRQMGLPSNNKDIREFFYKVVMETIQKREETQIKRNDFLQILMDL

RKTEILSLDEVAAQVFLFFTAGFETSSSTMAMCLYEIAKEPEYQEKLRQEICEITNGEITYENLFEMKYL

DQVFSETLRKYPPGQTLNRRCVKDYTLPGTSTIIEKGTPILISAIGVHRDPEYYPDPEKFDPERFSEENK

KLRHPFVYLPFGDGPRNCIGMRFGTMQSKLGIASVVKNFKVSVSPITKRVELDPNTFLLNTIDKIYFRVE

KIVK

 

Seq 56

 

>CYP6BR2 seq 56, XP_969813.1| PREDICTED: similar to Cytochrome P450 6a2 (CYPVIA2) (P450-B1) [Tribolium castaneum] 59% to XP_969875 seq 55, 59% to XP_969746 seq 57

MGLFLEDFWTEVFFLLTTLAILVLSYFHNAYKYWEKRGVPTIKPTFPLGNGDTLLPEGFSVGMLSRKFYE

ELKKRGEKFGGVYLVTQPNLVLVDPEYVKDILATDFQYFVDRGFYFNEKTDPLSAHLFALDGTSWRNLRI

KLSPTFSSGKMKMMFKTVLECCGYMRDYIEDILDKDLDIKEIFSRYTTDVIGSCAFGIECNSFKYPDAEF

RKMGKKVFSFGLWRSICSFCIIYFPNLSYHLGVPTNEKDVQNFFRGIVAESVNTRKEQNIKRNDFLQLLI

DLKDHSALSLNEMAAQVFLFFAAGFESSSTTMTFVLYELAKHPDIQQELRNEIRKTLDKHQGQLTYEAVM

EMKYLQQVIDETLRLYPPLATLNRRCIKDYTLRNTGIKIEKGTSVIIPSLGLHMDPELYPDPEIFNPDNF

SEENKKKRPSFVHLPFGDGPRNCIGLRFALMQSKCGIATVVNNFRFSLSPATKPLRLNPNSFVLNTYDKI

YLRAERLAM

 

Seq 57

 

>CYP6BR3 seq 57, XP_969746.1| PREDICTED: similar to Cytochrome P450 6a2 (CYPVIA2)

gene model is too long, revised

(P450-B1), partial [Tribolium castaneum] 59% to XP_969813 seq 56

AAJJ01000871.1

MSVFTEFWPQILVFLALFLLVLVNYFNYCYRYWSKKGVATIKPRFPLGNTNIILPQGLSIGILSKQFYDE

FKAKGHKFGGVYLVTEPNLLIVDPEYVKDIMSKDFQHFVDRGFYYNKEKDVLSAHLFAIDGSDWRNLRIK

LTPTFTSGKMKMMFEAVVQCSKHMIENLDKNLGSDIEIKEVLGRFTTDVIGTCAFGIECNSFKYPDAEFR

MMGKKIFEYDLWKSVKAFFAVNVPKVALQLGLTSTPDDVIDFFTRIVADAVKMRESNNIRRNDFLQILID

LKNTTSLTLDEMSAQVFLFFVAGFETSSTTMTFALYELARNEKMQEKLRFEICQVLDKTGGQITYESLIE

MKYLQQVID (1)

38219 ETLRMYPPLPTLNRRCTKDYVLRDTNIIIEKDTPILISALGLHMDPEFFPKPEKFDPERFT

EEKKKERHPFVHLPFGDGPRNCI (1) 38470

38524 GLRFGVMQSKIGIITIIKNFKLTVSSNMKPVQFNPYVFLLNINDKVLLQVGKL* 38685

 

seq 45

 

>CYP6BK4 seq 45, XP_970415.1| PREDICTED: similar to Probable cytochrome P450 6a23 (CYPVIA23) [Tribolium castaneum] 65% to XP_970481 seq 44

MLITTSLTGDLLAVFLTLVLIIVTYCKWSYQYWERKHLPYLEPQIPFGNVGDSIKGKTNFGITIKKIYEE

MKHNGWKHGGLYVFTEPNYMVLDLEYVKNIMTKDFQYFVDRSTYYNKKEDPLNAHLLNLGGTKWRNLRTK

LTPTFTSGKMKMMFQTLADCQTGLLKRMEKERLTRQPIDIKEVLACFTTEIIGSCAFGLNCKAFEDENSP

FRVYGRKVFATSKLQRLKRTIATIFPTLGYLFNISITPKDITNFYLNVVKDTVEYREKNNYNRNDFMQLL

IDLKNNKLEGGTSNGGFTLKEVAAQSFVFFLAGFETSSTLMTFALYELARHQEIQDIVREEINEVLRKHN

GNVTYDSINDMKYLSQVIDETLRLYPPASLVNRKCIKDYQVPDCDLVIEKGTTVLIPIMGIHYDKDYYPD

PEKFDPERFTEENKNARHNYAHIPFGEGPRICIGMRFGLMQTKVGLSCLLKHYKFTVNKRTQEPLKMQPS

PLILSAEGEIWLDAEKL

 

Seq 46

 

>CYP6BP1 seq 46, XP_970699.1| PREDICTED: similar to Probable cytochrome P450 6a20 (CYPVIA20) [Tribolium castaneum] 49% to XP_969048 seq 47

MILLVLSVVLLVALRIFFFWRFQYWEKLQIPYLRPYCPFGCLPNPLINKEKGGIILKRLYRNVRDKGWKH

AGIFVFVTPVYLPTNLDYIKNILTKDFEHFDDRGLYYNEKDDPLSGHLINLGGPKGVTMRKKLNSLFTPS

SLKMMFQTLNTSIEDLLQQIHSRNTIDIHKLFTCFTIHVIASCTLGLECNIFKEEHLLFESYANKFLVWS

RGKWCLQLLAAMYIDTARKLKVRTVPKETEDFFVKIVTKNIKYREENDYFRQDMMQFFIEQKNANTMSIN

EIIAQCFIFFIAAYETSTTTLTFALYELAQNLDIQDRVRREITSVLLKHQKYSYEAIAEMKYLNQIVDET

MRKYPPFLYVVRRCTKDYTIPGEDVTIKKGIFALISILGIHHDEEIYPNPQKFDPDRFSKENKKMRHPYA

YLPFGEGPRICIGKRFALMQIKFGLAALLEKYKFTLNEKTKVPLEIRTDTLVVAPKGDVLLDIQKIN

 

Seq 49

 

>CYP6BK6 seq 49, XP_970282.1| PREDICTED: similar to Cytochrome P450 6a2 (CYPVIA2) (P450-B1) [Tribolium castaneum] 76% to XP_969107 seq 50, 67% to XP_970215 seq 51

MFRFLDLVGVFIALFAILFAYFKWTYQYWSQKNVPFIQPTIPFGNSNLFRQKESGGIRMKNFYDEMKAQG

WKHGGLYSILKPSYMVIDLDYLKNIMTKDFDYFSDRGFYYNEKDDPLSAHLFAIGGEKWRNLRIKLTPTF

TSGKMKMMFQTLVDCAPGLVKQIDRKMESIDIKEVLGCFTTDIIGSCAFGLDFNTSNDNNSPFREYGRKA

FVPTKFDIVKIIFAMSFPRLAQLFRLTLTRKDVSEFFLKVVRETVEYREKNNYRRKDFIQLLIDLKGEDG

KTLTINEIAAQSFVFFIAGFETSSTTMAFVLYELSRRPDLQQKLRDEINTVLSRYEGSITYEATQEMKYM

DQVINEALRMYPPVPMLGRKCVKDYKIPDQDVIIEKGTSILIPVLGIHYDQEYYPDPKTFDPERFNEENR

KARHHYAHLPFGEGPRICIGMRFGLMQTKVGLATLLKNYKFKVGERTQEPLKFKVASFVLAAEGEIWLDA

EKL

 

Seq 50

 

>CYP6BK12 seq 50, XP_969107.1| PREDICTED: similar to Probable cytochrome P450 6a14 (CYPVIA14) [Tribolium castaneum] 76% to XP_970282 seq 49

MPTLFDILGVSVALLVITYAYFKWRFQYWRQKNVPFLPPTVPFGNFNMLRQRDNGGILLKKFYDEMKSHG

WKHGGFYSLFQPGYLVIDLDYLKNIMTKDFDHFTDRGFYYNEKDDPLSAHLFALGGEKWRNLR TKITPTF

TSGKMKQ MFQILVDCTPDLIERIDSFCREKKPIDIKELLGCFTTDIIGSCAFGLQFNTSKDKNSPFREYG

RKAFTPTYFDIVKMTFAMAFPRLALALKLRMTRKDVSDFFLQLVRDTVKYRVENNYSRKDFIQLLIDLKS

LTIEEIAAQCFVFFIAGFETSSTTMTFVLYELSRRHDLQQKLRNEINTVLAKYDGHMTYEAIQDMKYMDQ

VINEALRMYPPVPLLSRKCVKDYKIPDQEIIIDKGTTVCIPIWGIHYDKDYYPEPEIFDPERFNEDNKKS

RHHYAHLPFGEGPRICIGLRFGLMQ TKVGLATLLQNYNFRVAGRTQEPLKYKVASFVLAAEGEIWLDAEK

L

 

Seq 121

 

>CYP6BK15P seq 121, XP_969180.1| PREDICTED: similar to Probable cytochrome P450 6a14 (CYPVIA14) [Tribolium castaneum] 94% to XP_969107 seq 50

N-term 133 aa not found, this is probably a pseudogene, since the most

similar seq does not have an intron here.

AAJJ01005841.1

1415 TEVTPSFTLGKIKQ

MFKILVDCTPDLIERIDSFCREKKPIDIKEVLGCFTTDIIGSCAIGLQFNTSKDKNSLFREYGRKAFTPT

YFDLIKMSFAMAFPRLALAFKLRMTRKDVSDFFLQLVRDTVKYRVENNYSRKDFIQLLIDLQNLTNEEIA

AQCFVFFIAGFETSSTTMTFVLYELSRRQDLQQKLRNEINTVLAKYDGHMTYEAIQDMKYMDQVINEALR

MYPPVPLLSRKCVKDYKIPDQEIIIDKGTTVCIPIWGIHYDKDYYPEPEIFDPERFNEDNKKSRHHYAHL

PFGEGPRICI (1) 504

GLRFGLMQTKVGLATLLQNYNFWVAGRTQEPLKYKVASFILAAEGEIWLDAEKL* 294

 

Seq 51

 

>CYP6BK7 seq 51, XP_970215.1| PREDICTED: similar to Probable cytochrome P450 6a14 (CYPVIA14) [Tribolium castaneum] 67% to XP_970282 seq 49, 60% to XP_969633 seq 52

MFTFVGVAIALLATLFAYFKWTYKYWERRNLQYLEPKIPYGNGTGPFKRTENAGFRFKRQYEELKSRGWK

HGGLYSILNPIYLVADLDYIKNIMTKDFHYFTDRGIYYNEKNDPLSAHLFALGGPKWRHLRTKLSPTFTS

GKMKQMFQTLVDCVPQLLQQIDKNVPVDIKEVLGCFTTDIIGSCAFGLECKTFEDENSPFREYGRKFFQV

SNLKIAKFLFSGNFPNVARTLGVTITSKDVSDFFISVVEDTVKYREKHNLVRKDFMQLLIDLKNTEKEQM

LTIEELAAQCFVFFIAGFETSSTTMTFALFELAKRPDLQQQVRDEIETVLAKHGNITYDAIQDLKFMDQV

IDETLRMYPPVPVLTRKCVKDYKIPDQDVIIQKGTRVFIPVLGIHYDSDLYPNPSQFDPDRFSEEKKKSR

HGYAHLPFGEGPRICIGMRFGLMQTKVGLTALLKNYKFSVNSKTQTPLKMKPNSFILAAEGDVWLNAQKV

 

Seq 52

 

>CYP6BK13 seq 52, XP_969633.1| PREDICTED: similar to Probable cytochrome P450 6a23 (CYPVIA23) [Tribolium castaneum] 65% to XP_969713 seq 53

MFSCFLTNIIGIFVAFFAVIIAFYKWSFGYWKQKNVPYLPPKIPFGNLANPLRPAENMGVQVQHFYAQMR

AKKWKHGGLFFLANPTYMVVDLEYVKNILTKDFQHFVDRGVYYNEDVDPIGAHLFALGGTKWRNLRTKLT

PTFTSGKMKMMFQTLIDCESNLHKKIQAQKNKPIDIKDVLGCFTTDIIGSCAFGLDCNTFEDEDSPFRKY

GKKVFVATPLERLKIAIFMNFPKVGRFFKMRQVSKDISDFYSKVVKDTVEYREKHNYSRKDFMQLLIDLK

NDGNALTLDEITAQSFIFFLAGFETSSTTMTFALYELAKNSEVQEKVREEVLAVLGKHGGKITYEAIQDM

KYMNQVLNETLRKYPPVPFITRQCIKEYKIPDQEIIIETGTRVIIPILGIHYDPEYYPDPQKFDPERFSE

ENVNKRHHYAHLPFGEGPRICIGLRFGLMQSKVGLASLLSKYRFKLNERTKQPMKFQVKSFVLAAEGEVW

LDAESL

 

Seq 93

 

>CYP6BK16P seq 93, XP_969554.1| PREDICTED: similar to Cytochrome P450 6a2 (CYPVIA2) (P450-B1) [Tribolium castaneum] 65% to XP_969633 seq 52

AAJJ01002474.1 three P450s on this contig XP_969633 11kb region,

XP_969713 7kb region and this one at 15kb region

short missing EXXR to end, pseudogene, this seq is not present before

the end of the XP_969633 is found

MGMFFTQSLLTDVTTLVVTLTVILVTYYKWSYTYWRRRGVPSLTPKIPWGNLSNPLNRKDTIGVDVKKMY

DSMRRQNWKHGGVFFMASPVYLVTDLEYVKDILTKNFQNFVDRGLYYNEKDDPISAHLFAIGGPKWRNLR

TKLTPTFTSGKMKAMFQTLLDCESNLQEKVAAELGKNQAIDIKDVFGCFTTDVIGSCAFGLDCNTFKEAD

SPFRKYGKKVFTNTPIRQLKSSFSNSFPKLAQQFGISVMPKDVSDFFTKVVKDTVEYRQKNNYTRKDFMQ

LLIDLKGEGKQDGKSLTMDEITAQSFLFFAAGFETSSTTVTFALYELAKHQDIQQKVREEIETVLAKFDG

KVTYEAIQEMHYMNQVLNVTIIK 14679

 

Seq 53

 

>CYP6BK14 seq 53, XP_969713.1| PREDICTED: similar to Cytochrome P450 6a2 (CYPVIA2) (P450-B1) [Tribolium castaneum] 65% to XP_969633 seq 52

MEMLFSAIILILALNYFYYKWKFTYWQCKKIPTLAPKIPFGDLPNPLKQAEATGVHIKRLYDQIKGKGWK

HAGLYFLARPVYMVVDLEYVKNILTKDFHHFVDRGFYFNEKDDPISAHVFAVGGQKWRNLRTKLTPTFTS

GKMKMMFQTLLECEANLLKRFEKEHKSAIDIKDILGCFTTDIIGSCGFGLDFNTFEDENSPFRKYGKKVF

ASNLTRRLQIFFFTHFPSMARALKVRHFSKDVADFFTKVVKDTVEFRERNNYKRKDFMQLLIDLKNCNSG

LTLNEITAQSLIFFLAGFETSSTTMTFALYELAKNEKIQERVRDEIFSILGEEKITYEALQKMKYLALVI

NETLRKYPPLSFLTRECVQDYKIPDQDVIIEKGTKVVISILGMHRDQEFYPDPETFDPGRFSEGNVVSRH

QYAYIPFGEGPRICMGLRFGMMQTKVGLVSLLRKFKFTVNGRTKEPIKFDVRGFILAAEGDIWLNAQKVC

 

Seq 54

 

>CYP6BK10 seq 54, XP_969948.1| PREDICTED: similar to Cytochrome P450 6a2 (CYPVIA2) (P450-B1) [Tribolium castaneum] 55% to XP_969633 seq 52

MSLLLSFLLRLGSVIISLIVVVLSVIKWKHQYWANRNIPFFPPSVPFGNLQNPRRKKHSIGYHIKNFYDQ

AKRKGWKHCGLYFFASPVYLVIDVNYVKHIMNTDFHHFVDRGMYSNEKIDPISAHLFALGGTRWKNLRNK

LSPTFTSSKMKMMFPTIVECVSLLLDAMTEKSEQIDIKELLGRFTTDIIGSCAFGLDCNTIKEENSPFRL

YGKKVFFSTKMRTFKLTFASSFPTLGRLLRIRQVSSDVSDFFRKIVKDTIEYRAQNQFSRPDFLQMLIDL

RRDGAEITLDEIIAQCFIFFLAGFETSSTTMTFTLYELAKNHQIQDKLRQEIMTILTKYHGEITYDAISE

MKYLDQVIEESLRKYPPLPFVTRTCVMDYKVPNTDLVIEKGRRVILPILALHHDPEFWPEPQNFDPERFN

DQNRNLRHQFSYIPFGEGPRFCIGKKFGLTQTKVGLVALIQNYKFSVNSRTLDPLKMAPNTFILSAAGGI

WLDSEKL

 

Seq 58

 

>CYP6BK3 seq 58, XP_966437.1| PREDICTED: similar to Cytochrome P450 6a2 (CYPVIA2) (P450-B1) isoform 1 [Tribolium castaneum], this end is a better match to

XP_970415 and is probably the correct C-term

MFVSNSLLGDLIALFVTLGVLLTFYFKWTYQYWTRRNVPQIDPHIPFGNISESIKGREIVGVTFKKIYQQ

LKSQGCRHGGIYIFTQPSYFPIDLDYIRNILTKDFQYFVDRPFYVNEKDPLQAHLLNLSGTRWRNMRSKL

TPTFTSGKMKLMFHIMAESQSDLLKRMDKEAESLEPINIKEVLACFTTNIIGSCAFGLDCKALEDENSPF

RQFGKKLFKISVLHRLKRTFAATFPDFAKFLRMSNSRKEIVKFIMDMVEGTIEYREKNNYSRNDFMQLLI

DMKNNKPKGDHDGKPLTLDEVASQAIVFFAAGFETSSTLMTFAFYELAKNPHIQDKLREEINLILAEHNN

EISYDAIQEMKYLSQVIDETLRLHPPAAQTSRKCIKDYKIPDQDITIEKGTSVTVSILGIHHDPDYYPDP

EKFDPERFTEENKSLRHNYAFLPFGEGPRNCIGMRFGLLQSKMGLVSLIKNYKFTVNEKTK

EPITYQPAHVVLAAQGEIWLNAQKV

 

>gi|91094057|ref|XP_975753.1| PREDICTED: similar to Probable cytochrome P450 6a14 (CYPVIA14) isoform 2 [Tribolium castaneum] 1 aa diff to XP_966437, C-term differs

62% to XP_970415 seq 45

MFVSNSLLGDLIALFVTLGVLLTFYFKWTYQYWTRRNVPQIDPHIPFGNISESIKGREIVGVTFKKIYQQ

LKSQGCRHGGIYIFTQPSYFPIDLDYIRNILTKDFQYFVDRPFYVNEKDPLQAHLLNLSGTRWRNMRSKL

TPTFTSGKMKLMFHIMAESQSDLLKRMDKEAESLEPINIKEVLACFTTNIIGSCAFGLDCKALEDENSPF

RQFGKKLFKISVLHRLKRTFAATFPDFAKFLRMSNSRKEIVKFIMDMVEGTIEYREKNNYSRNDFMQLLI

DMKNNKPKGDHDGKPLTLDEVASQAIVFFAAGFETSSTLMTFAFYELAKNPHIQDKLREEINLILAEHNN

EISYDAIQEMKYLSQVIDETLRLHPPAAQTSRKCIKDYKIPDQDITIEKGTSVTVSILGIHHDPDYYPDP

EKFDPERFTEENKSLRHNYAFLPFGEGPRNCIGMRFGLLQSKMGLVSLIKNYKFTVNEKTK

DVRLNLRSNTLLAIPCDIQGVLK

 

Seq 68

 

>CYP6BQ11 seq 68, XP_975563.1| PREDICTED: similar to Cytochrome P450 6a2 (CYPVIA2) (P450-B1) [Tribolium castaneum] 87% to XP_975564 seq 69, 75% to XP_975567 seq 70

MSLITDNLTFDLVAILATILVGIIVYFKWQLSYWDRLGVPSLNPVLFFGDIKDFILAKCTLGEQFKEFYG

KFKSKGYKHGGIFLGPKPFYVPIDPELVKHIMQKDFQHFVNHGNYFDEDADPLSGHLFNLEDAKWKNMRI

KLTPTFTSGKIKMMFQTLADCTRGLKEIMDHSALNHAPADIKDILGRFTTDIIGSVAFGIECNSLKDPDA

EFRKYGRKVFEVGFIDRLKTICILSLPHPVLRFFKLKFTKSDVEKFFMSAIRDTVNYREKNNIYRKDFMH

LLLQLKNRGFVADDGKVTDEKENVKEKALTLNELSAQAFVFFLAGFETSSTTMTWALYELATNQDVQEKL

RNEINNVLSRHDNKLTYEAMMEMTYMEKVIHETLRKYPPLPILTRKCNKDYTIPNTSIKLSRGTAVGIPV

LALHTDPEYYSNPEKFDPEHFSEENVKTRPGFTWLPFGDGPRVCIGLRFGMLQSKVGLTALLKNYKIKLS

KKTELPIKLDPKSFITTAKGGIWLDVEKLD

 

Seq 59

 

>CYP6BQ14P seq 59, AAJJ01000098 70% to seq 68

Frameshift in last exon, one stop codon, no start, possible pseudogene

ISLGTTAYLVVLELGIALLVIVISYLKWRMTYWQKLGVPTLNPAMLFGDTKKMFLGECTF

GEQFLDIYNKFKARGVKHGGVYLGIKPFYLPLEPELVKHIMQNDFEHFVNHGLYMDKEND

PLSGHLFNLEDEKWKNMRNKLTPTFTSGKLKMMFQTLANCTVGLQTIMDDADTNHTPLDI

KDILGRFTTDIIGSVAFGLECNSLKDPDALFRKYGRKVFEMDIWERLKMFTQFVLSHRVL

RAIKFKV*KNDVERFFMKVIKDTVEYREKNNVSRKDFMHLLLQLKNRGSVTDDDKVTDDH

GKAQEKALTLNELSAQAFVFFIAGFETSSTTMTFALFELSTNPHIQDKLREEINQVLEKY

DDKLTYDAMMELTYMEKVIN (1)

ETLRKYPPAPVLFRRCNKDYKVPNTSIIIQKGIDVAIPVLGLHTDP

DYYPNPEDFDPERFSEDNKNKRPGFTWLPFGEGPRVCI (1)

GLRFGVLQTKVGLTALLKNYRVKLSPKTKMPLKMDKT

LLTSAEGGIWLDMEKLN

 

Seq 69

 

>CYP6BQ10, seq 69, XP_975564.1| PREDICTED: similar to Probable cytochrome P450 6a23 (CYPVIA23) [Tribolium castaneum] 87% to XP_975563 seq 68, 73% to XP_975567 seq 70

MTLITNNITLDLVAIIATFLVGIIVYFKWQLSYWDRLGVPSLNPTLVFGDFKNYIFAKCSLGEQFKELYD

QFKSKGYKHGGVFVGPKPFYVPIDPEIVQHIMQKDFHHFMNHGNYFDENADPLSGHLFNLEDSKWKNMRV

KLTPTFTSGKIKMMFQTLADCTRGLDEIMYNSALNHAPADIKDILGRFTTDIIGSIAFGIECNSLKNPDA

EFRKYGRRVFEVGIIDRIKIICILALPDSVLRLLKLKFTKSDVENFFMNAIRDTVNYREKNNIYRKDFMH

LLLQLKNRGSVTDDEKVTDDKDNVKEKALTLNELSAQAFVFFLAGFETSSTTMTWALYELATNQDVQEKL

RNEINNVLSRHDNKLTYEAMMEMTYMEKVIHETLRKYPPLPILTRKCNKDYTIPNTCIKLRRGTTVAIPV

LGLHTDPEYYSNPEKFDPEHFSEENVKSRPGFTWLPFGDGPRICIGLRFGMLQSKVGLTAILKNYKVTLS

NKTKFPVTLDPKSFITTAKDGIWLDVKKLD

 

Seq 70

 

>CYP6BQ8 seq 70, XP_975567.1| PREDICTED: similar to Cytochrome P450 6a2 (CYPVIA2) (P450-B1) [Tribolium castaneum] 75% to XP_975563 seq 68, 73% to XP_975564 seq 69

MLLNNFTLNILAVFITVLVGVIVYFKWHLSYWDRLGVPSLSPVLFFGDTKNLILSKCTIGEQFRVFYNKF

KSKGYKHGGIFFGPIPFYIAIDPEIIKHILQKDFQHFMNHGYYINEEDDPLTGHLLNLENVKWKNMRAKL

TPTFTSGKMKIMFQTLADCTTGLKKVMDDSALNHTPVDIKDIFGRFTTDIIGSVAFGIECNSLENPDAEF

RKYGKKVFEIDFFGRIKTLCTFAIPHPILRLFRFKFYNSDVATFFMDAIRETVNYREKNNIYRKDFMHLL

LQLKNRGLVTDDEKITGDKDIVTEALTMNELAAQAFVFFLAGFETSSTAMTWALYELAINPDVQQKLRAE

INDVLRKHNKLTYEAMMDMTYMEKVICETLRKYPPIPVLTRKCTKDYTIPNTSIQLQRGVSVSVPVLALH

TDPEYYPNPEKFDPDRFNDENVKARPGFTWLPFGEGPRICIGLRFGLLQSKVGLTAVLKHYRIKLNHKTQ

LPVTLNPRSFITSAKGGVWLDVEKID

 

Seq 139

 

>CYP6BQ9P AAJJ01000063 between seq 70 and seq 69

cyan = possible duplication or intron seq, one stop codon

possible pseudogene, 78% to seq 68

25815 MTLITNNLMFDLIAILATVLVCVIAYLKWHLTYWNRLGVPSLNPVLFFGDATDYLFGKCGVG

EQFAKFYGKFKSKGYKHGGVFLGPKCYYVPVDPDLVKHIMQKDFQHFMNHGFYINEEVDP

LTGNLFSLEDAKWRNMRVKLTPTFTSGKMKMMFQTLADCTRGLKEIMDNLALNHAPADIK

EILGRFTTDIIGSVAFGIECNSLKNPDAEFRKYGRKIVETGFIDRIKVFLVLSIPHALLR

FLRFKFTNTEVETFFMGAIQDTVNYREKNSVYRKDFMHLLLQLKNRGLVADDEKITDDKG

NIKENDFITINQLAAQAFVFFLGGFETSSTTMSWAL*ELATNQDIQEKLRKEINDVLSRH

NNKLSYDAMMEMTYMDK VIRHNNKLSYDAMMEMTYMDK VIN (1)

ETLRKYPPLPIIPRVCNKDYTI

PNTSTKLSRGTSVAIPVLAIHTDPEYYPNPEKFDPEHFSEENIKSRPGFTWLPFGDGPRICI (1) 27220

27307 GMRFGMMQSKVGLATILKNYKIKLNNKTEFPIKVDPKNFITTAKGGVWLDVEKLD* 27480

 

Seq 90

 

>CYP6BK11 seq 90, XP_968370.1| PREDICTED: similar to Cytochrome P450 6a2 (CYPVIA2) (P450-B1) [Tribolium castaneum] 63% to XP_970415 seq 45, 42% to 6a2

MLLTNSICGDLVTIFLTLVTVLTLYFKWCHQYWEKLNLPSLPPSIPFGTSLGPKGHFGLRMKHIYDKMRQ

KGWKHGGIYLMQRPFYVVVDLDYVKNIMTKDFHHFSDRGIFHNEKADPLSAHLFNISGPKWRNLRSKLTP

TFTSGKMKLMFQTLLDCEVNLRKQVEQHYEAKKPIDIKEVLGCFTTDIIGSCAFGLDCNSFKEENSPFRV

YGRRVFDRSGFIRTLKRTFASNFPNLAKLVNIALVPRDISDFFINIVKDTVEYREKNKIVRNDFLQLLLD

LKTEESGNDGTALTFEEIAAQSFVFFIAGFETSSTTMAFALYELARHQDIQDQVRDEIESVLKKYDGKIT

YEAIQEMSFLGQVIDEALRMYPPGPLVPRRCVKDYKVPNTDVVIEKGVMVLIPILGIHYDEKYYPDPEKF

DPERFSEENKALRHSYAHIPFGEGPRICIGLRFGLMQSKVGLVSLLRNFKFTVNEKTQEPLKMKTNSLVL

AVEGEIWLNVHRL

 

Seq 141

 

>CYP6BK8P seq 141, AAJJ01004329 Pseudogene 61% to seq 90

3214 MFFDSISLNVLSVFIALTAVIFAYYKWTYHYWERQKLPFLTPTIPYGNILSPLSKTENFA 3035

3034 ITCKHLYNKIKQREWKHGGIYAILAPIYFVVNLDYVKNIMTKDFQYLDRGFYHKEKVDP 2858

2857 VSAHFFXXXXXX 2840

2823 QNKLTPTFTSGKMKMMFKTIADCEVNL*EKMLEEHE*KEPIDIKDILSCFTTDIIGSCAF 2644

2643 GLNCNSFKEENSAFRIYGRKVFTPTKTRVLRDTFSFNFPDLARRLNVRAFPKHIGDFFV 2467

2466 NMVKDTVNYREKNNFIRKDFMQLLIDLKNNKL 2371

2365 EEGKSERGLTIEEVAAQSFVFFLAGFETFSTTMTFALYELAKHQDIQDKVREEIDAVL 2192

2191 KKHDGK 2174

2172 AIQEMKYMGQVID (1)

     EILRKYPPIPFLTRQCVKDYRIPEE 2012

2011 DVIIEKGTTVLIPVLAIHHDKDIYPNPEKFDPERFTEERKNARHNYAHIPFGEGPKICIG 1832

1831 TRFGLMQSKVGLTSLLKKYKFTVDN*TQEPIKFQVDSFILAAEGQVWLNAERV 1673

 

Seq 91

 

>CYP6BL1 seq 91, XP_968293.1| PREDICTED: similar to Probable cytochrome P450 6a17 (CYPVIA17) [Tribolium castaneum] 49% to XP_968370 seq 90

MLTSCLATLFITLLSIFAYFYKRFYFSYWERKKIPNLQQHVPRTKPHLGIQLQQLYKIMKEKKWKHGGFY

QQLSPVYVICDLNYVKNIMTRDFNYFPYRGLYYNETSDPLSAHIFNTSGAKWKRMRRKLDQIFTSSKLKT

IFPLLPNCGEKLAGKCEPVDIKKVLDDFISDVIELCVFGSECKVFKQLGRKILNRSRLRRLKGIIINNFP

KLAKILDIVLIPRDASTFFKKVVAEIVEERKKGQTGRNDFLQVLVEMEKKFEITIDEIAAQCFIFLIAGM

STSPTAMTFALYELARHQDIQEKVRQDIAKFGKVTYDSLQEMKYLGQVFDETLRMYPPAAYLNRKCERNY

EIPDGSGIIVEKGTIVAIPVLGIHYDRDYYPDPEKFDPEHFSEENKRLRPNFAFLPFGEGPRICIGMRFG

LMQSKLGLVSLLKRYKFTVSEKTREPLKMKPNSLVLSAEGEIWLDVTEIKI

 

Seq 92

 

>CYP6BT1 seq 92, gi|91084715|ref|XP_969982.1| PREDICTED: similar to Probable cytochrome P450 6a20 (CYPVIA20) [Tribolium castaneum] 45% to 6BK11 = XP_968370 seq 90

missing C-term runs off the end of AAJJ01005307.1

MLLLAESLITLVLLLIAYYKFSFQYWKRQNVPFIQPSIPWGNYPSALKRQDNFGELVVRMYHQMKKQGHK

YFGIYLFFQPCFVPTDPKFIKLILAKDFQHFNFRNFYYNEKDDPISAHLLSLNGEKWKRLRSKLTPTFTA

GKIKMVFKIFVECGKIIEHTLEHHAQNRTSFDVKEMFSSYSTDVIVNCAFGVEVDRLKKTEFKNYSQKAL

DFNTRRCIVMYLGAVFPKLCRKLGFRQIAKSAGDFFINIVRNTVEFREKTNTIRNDFLQLLINLKNDESD

DWGQFSIEEVAAQCFIFFLAGFETSATTMSFALYEIAANPHVYEQIMDEMRRVLDKYNGEMCHDAIKEMT

YLGQVVDETLRIHSPAYAVSRTCTQDYHVPETNIVLKKGFQVLIPIRGIHSDPEFYPEPEKFKPERFHPD

NRQNIEPYSYLPFGEGPRICIG 48

 

Seq 104

 

>CYP345D1 seq 104, XP_966774.1| PREDICTED: similar to Probable cytochrome P450 6a23 (CYPVIA23) [Tribolium castaneum] 63% to XP_969536

MFLVYFASFLLLLYYIYAKNYNYWQSRNVPTDKPFLFFGSFYNIAVRKEHIFERIRTIYNQFSAPYVGIY

IFHQPVLLIRSPEILRKVLVKDFDKFTNRNIATNEAVDPLAFHTLFISKDAVWRNLRAKLSPVFTSGKMK

LMFPLMQECVDDLHRFLAQNTDEIDVKITMKKYSVDIISTCAFGINTFCFRNDNSEILKMATQLVDFKSV

VRSISIFSFFFMPSFVDIFRLTFADKTASDYLLNVFKTTLQEREKKKIIRNDFIDLLNNLRKTETITDGY

KFDNDIKMAAQAIAFFSAGNDTTSITLALTCYELALNKTIQDRLRHEVTEIYNESEAFTYENIARMKYLD

MVLNETLRKYPLAPFLNRKSDVKYTFEETGFTLDKGVSIIVPISGLHYDPEYYPDPEKYDPERFSDENKK

NLTPYTYLPFGEGPRNCIGQRFALLVSKVALASIIKDFAFDATNRTPVPLRFDPGSLFVQNRGGLYLKVS

KVAA

 

Seq 105

 

>CYP345D2 seq 105, XP_969536.1| PREDICTED: similar to Probable cytochrome P450 6a17 (CYPVIA17) [Tribolium castaneum] 63% to XP_966774 seq 104

MIFVYLCCFLLFLYYLYRKNYKYWESKGVLTEKPFFIFGSFYDVALRRKHLFHKVREIYDKFSTPYVGIY

IFNQPTLVIRSPELLKKVLVKDFDKFINRKVAANESVDPVFFHTLFSAKNDNWRNLRAKISPVFTSGKIK

LMFPLMKECGTDLLNYFKKRSGGVIEARNVTKKYAVDIISSCAFGINSYCLKDDNSEIMQIATQLVDFKS

FIRSISIFCFFFMPKLVDIFRLTFADKKASEYLMNVFKTTINERRKKTIVRNDLIDMLHNLKENSSSSDF

TFDDVKMAAQALSFFSAGNDTTSITITFALYELALNTDIQNRLREEIRKRYEAHGDFTYEAIQEMKYLEM

VLCETLRKYPLTIFLNREAVSNYTLEESGLTIDKGTSIMIPVAGLHFDEEYFPNPEKFDPERFSDENKSK

IVPYTYMPFGDGPRICIGQRFAMLVSKVALAYILKDFAVEKTDSTTVPMQLDPGAIFLMNKNGVNLRVVE

VK

 

Seq 71

 

>CYP6BQ7 seq 71, XP_975568.1| PREDICTED: similar to Probable cytochrome P450 6a14 (CYPVIA14) [Tribolium castaneum] 75% to XP_975569 seq 72

MLFSDSLIVDLVTIIST IVVVSIAYCKWKLSYWNNTGLPTLSPVFPFGDTKELLLGQKSFGEQFQDLYKE

IRAKGWKHAGVYLAIQPFYLPVDPKIIKHIWQVDFQHFVNHGNYINEEVDPLSGHLFNLEDAKWKEMRVK

LTPTFTSGKMKMMFQTLADCTHGLKTIMNECATSGTPIEIKDVLGRFTTDIIGSAAFGLECNSLKDPDST

FRKYGKKVFELQGWERIKVLAQFALPHSFLRAIKFKQTQSDVEKFFMKVVRDTADYREKNKIYRKDFMHL

LLQLKNRGKVSDDEKVTQENGKTGEKALTMNEVAAQAFVFFLAGFETSSTLMTFTLYELATNPDIQGKLR

EEINTVLAKHDGQMTYEAMMEMTYMEKVLNETLRKHPPIPFLFRRCTKDYTIPETSVKLRKGDDVGISIV

GIHNDPEYYPNPEKFIPERFNEENKNARPPFTWIPFGEGPRICIGLRFGMLQSKVGLTALLKNYKISLSS

KTKMPLEMEKSGLVTTVEGGMWLNVEKIN

 

Seq 72

 

>CYP6BQ6 seq 72, XP_975569.1| PREDICTED: similar to Probable cytochrome P450 6a14 (CYPVIA14) [Tribolium castaneum] 75% to XP_975568 seq 71

MTFMTESLIFDIVTIISTIVVLTIAFWKWKLSYWDRVGLPTLSPILFFGDTKDVLLGRLTFGEQFQELYK

KLKAKGLKHGGVYLGTRPFYLPTDPEIIKHIWQKDFQHFVNHGNYFDEEADPLSGHLFNLEDAKWKNMRV

KLTPTFTSRKMKMMFQTLADCTHGLKDIMDEGASSGSPVDIKEILGRFTTDIIGSVAFGLECNSLKDPNT

LFRMYGKKIFELSTGRRLHLFLQFILPERVLHAMKFKVTPSDVETFFMKVIRDTVGYREKNNVYRKDFLH

MLIQLKNRGTVTDDEKITEDNGKTGEKALTMNELAAQSFVFFAAGFETSSTTVTFALLELALNQDIQQKL

REEINTCLAKSNGELTYQAIMEMTYMDKVLQETLRKYPPVPFLTRRCTKDYTIPETSIKLRKGDHVGISV

VGIQNDPEYYPDPEKFVPERFNEENKNSRHPFTWMPFGEGPRICIGLRFGMLQSKVGLAALLKNYKITLN

SKTKMPIEMEKSSFITSVNGGVWLNVEKLS

 

Seq 73

 

>CYP6BQ12 seq 73, XP_975562.1| PREDICTED: similar to Cytochrome P450 6a2 (CYPVIA2) (P450-B1) [Tribolium castaneum] 65% to XP_975569 seq 72

MAIFTSSIFIDIITIITTVLALTIAFFKWKLTFWEKLGVPTLNPVLFFGDAKNILLGKRQVGVEFIDYYK

QFKPRGLKHGGVYLGPRPFWVITDPGLIKHILQIDFPHFINHGTYADEENDPLSAHLFSLEGTKWKNMRT

KMTPTFTSGKMKMMFQTLVDCTPGLKDIMDEHASKKKAVNIKNILERFTTDIIGSVGFGIECNSLKDPDS

LFPKYGKKVFDLTPAEQLKQSLLFFLPNPVLKAMKFRITNKDVEDFFMKTVRETVLYREKNNIYRKDFMH

LLLQLKNRGTVTDDEKIIDHSNQKQEPALTMNELTAQAFVFFLAGFETSSTTMTFALYELATNPDIQEKL

RNEICTVLEKHNNELTYNAIAEMTYMDQVLHETLRKYPPLPILQRQCNKDYIVPETNIRIPKGVDVAITI

LALHRDPEFYPNPEVFDPERFNEENKNARTPFTWLPFGDGPRVCIGLRFGMMQSKVGLTALLKDYRVTLN

KKTKVPLEMSKNSFIIAAEGGIWLDIEKINT

 

Seq 74

 

>CYP6BQ1 seq 74, XP_975578.1| PREDICTED: similar to Probable cytochrome P450 6a20 (CYPVIA20) [Tribolium castaneum] 60% to XP_975563 seq 68

gene model too long at N-term shorten it

MNYTFLA

LFVTFLLGVISYLKWKLRYWDKKGLPTIPPKLPFGNLTDVIFGRKSFGEQFVEFYQILKAKGYRHGGIYF

GASPLYVPTDPEIVKHIMLVDFAHFSSHGGYVDEESDPLSGHLFNLDDIKWRNLRVKLTPTFTSGKMKMM

FQTLAEVSYNLKNVLDESVINKTPVDARDVLSRFGVDVISSVAFGLECDSLKDPNVSFRKYGKKAVDFDI

WVRIKLFMQVLLPHCVLRAIGHKFTKTEVEEFFMKSIRDVVEYREKNNIFRKDFMHLLIQLKNLGTVTDD

GQILDETSGSKEVGLTMNQVAAQAFVFFMAGYETSSSTITFALYELAMNPPLQDKLRDEINTILAKHDNK

LTYAAMMEMTYMEKVIQETLRKYPPLPIIMRLCTKDYVVPGTDIEIKKGVGVMIPVLGLQTDPEYFPDPD

VFDPDRFSEEKKKERPGFTWLPFGDGPRICIGMRFGMLQSKVALTTFIRNYRVKLNEKTKIPLKIDKGSF

TTRAEGGVWLNLEKLN

 

Seq 75

 

>CYP6BQ2 seq 75, XP_975576.1| PREDICTED: similar to Probable cytochrome P450 6a20 (CYPVIA20) [Tribolium castaneum] 95% to XP_975572 seq 76

MLLVNGSLTYDLVAILVTVLAGLVVYYKWAFTYWKKRGLEYLEPSIPFGNCASLFKAKYNFGEQFAEFYK

QFREKNLRHGGVFMFARPFYIPVDPAIMKDIMQKDFQHFVDRGFYVNEEIDPLSGHLFSLEGNKWKNLRA

KLTATFTSGKMKMMFETMSRCAEELDNYVNEASKRKETIDIKETLARFTTDIISSCAFGLESNCLKNPDT

KFRYYGKRTFQNTTWENLKNLIQFMTPMYLLNLVKFKTTKQDVEDYMLNLVKKTVDYREKNNVYRKDFLH

LLLQLKNKGKITDDETFLDNNNKSKEVALTINELAAQVFVFFAAGYETSSTAMTFTLYELCLNQKIQDKM

REEIKTVLAKHNNKISYEALMEMTYMEQALNETLRKYPPVPFLNRKCTKAYDVAGTNLHLDEGTMVVLPI

LGLQHDPEYYPDPSKYDPDRFSEENKNSRPPFTWMPFGEGPRICIGLRFGMLQAKVGLATLLENYKVTLS

QKTKTPLEMDCKTFITTTKEGIWLDFTRLN

 

Seq 76

 

>CYP6BQ4 seq 76, XP_975572.1| PREDICTED: similar to Probable cytochrome P450 6a20 (CYPVIA20) [Tribolium castaneum] 95% to XP_975576 seq 75

MLLVNGSLTYDLVAILATVLAGLVVYYKWAFTYWKRRGLEYLEPSIPFGNCASLLKLKYSFGEQFAEFYK

QFREKNLRHGGVFMFARPFYIPVDPAIMKDIMQKDFQHFVDRGFYVNEEHDPLSGHLFSLEGNKWKNLRA

KLTATFTSGKMKMMFETMSKCAEELDNYVNEAAKREETIDIKETLARFTTDIISSCAFGLESNCLKNPDT

QFRYYGKRTFQNTTWENFKDVIQFITPTYLLDLVKFKITKPDVEDYMLNLVKKTVDYREKNNVYRKDFLH

LLLQLKNKGKITDDETFLDHNNKSKEVALTINELAAQVFVFFAAGYETSSTAMTFTLYELCLNQKIQDKL

REEIKTVLAKHNNKISYEAIMEMTYMDQALNETLRKYPPVPVLNRKCTKAYDVAGTNLHLDEGTMVVLPI

LGLQHDPEYYPDPSKYDPDRFSEENKNSRPPFTWMPFGEGPRICIGLRFGMLQAKVGLATLLGNYKVTLS

QKTQTPLEMDCKAFITTTKEGIWLDFTRLN

 

Seq 127

 

>CYP6BS1 seq 127, XP_974742.1| PREDICTED: similar to Cytochrome P450 6a2 (CYPVIA2) (P450-B1) [Tribolium castaneum] 47% to XP_967146 seq 128, 46% to XP_975570 seq 78

MESALMEAGIIFLTIVSFVYLYFKHAYTYWKARNVPQLSPTFPFGDMASVIFRRHNMGDKIKEIYDETKA

RGHKYVGLYFFSRKAFLPIDPVLIKKILAPDFQHFHDRGIYYDEENDPISAHLFSLAGPKWKNLRARLTP

AYSPGKLKFMFDTVLACGEEMADILKEIAKREGKVEIKEILARYSTDVIGCCAFGIDCNSMRNPTAEFRL

MGRRAFTQTIGDVLKMIVIRSFPRLAKLLGFGVFSPTVTGFFQRVVNETIRYREENNVTRNDFMQLLIQL

KNKGKLEGDGEEKDGAPAVGTSLTLDEAAAQAFIFFLAGFETTSTTISFALFEMARNESIRTKARTEINK

VLGKHGGKLTYEATMEMEYLDTVISETLRKYPPAPVFLRKCTKTYRVPDTDVIIEEGLSVLIPAYGLHRD

PEYFPDPETFDPDRFNEDNRSKIWDYTYIPFGDGPRICIGMRFAMIQIKIALALILKSFEFPLSEKTILP

MKMENSGIILAPIGGIWLNLIPLE

 

Seq 128

 

>CYP6BQ13 seq 128, XP_967146.1| PREDICTED: similar to Probable cytochrome P450 6a13 (CYPVIA13) [Tribolium castaneum] 54% to XP_975572 seq 76

MAILTYSWLLDIFGILTALIAVFIAWAQWSHTYWSRRNLIAPKTTFFLGNSKGIVTQKQSFGDFTVEMYE

YIRKHNKPHGGFYLTLMPNYMPVDPEIIKHIMLNDFDHFVDRGIYYNEEVDPLSAHLFSLDGAKWRNLRI

KLTPTFTSGKMKMMFDTLVKCSDQLLVEMNQTAGKAPVDAKNILARFTTDIIGSCAFGIECNSLKNPNDE

FTQYLKLFFVEGFWQNLNGIITFVAPELAKKLNMKVVNPVLSNFFMKVVEDTVNMRERNNIYRKDFMHLL

LQLKNRGELVDDDSILQNNTDAENKEVTLTLNELAAQAFVFFLAGYETSSTTMTFCLYELASNPEIQDKL

RAEINEVLQKHGKLTYDAIMEMRYMDKVVNETLRKYPPLPGLNRVCNKEYKVPGTDFVIEKGTKIWIPVL

GLHRDPEYFPNPEKFDPERFTEENKRQRHPYTYLPFGEGPRICIGLRFGMMQTKVGLSVLLKNYKFSINS

KTKLPLQLDPKSFIMSTEGGIWLDYTRV

 

Seq 77

 

>CYP6BQ3P seq 77, XP_975574.1| PREDICTED: similar to Probable cytochrome P450 6a21 (CYPVIA21) [Tribolium castaneum] 87% to XP_975570 seq 78 pseudogene

AAJJ01000063.1 12 P450s on this contig

14kb region XP_975572

NFHHFMNHGNYFDSENDPLTGHLFNLEDNK*KNLRVKLTPTFILGKIK

12032 MMFQTLADCASGPNTIMDEAAKNQTSLDIKDILARFTTDVIGSVAFGLECNSLKDPDVEFRKFGKRIFQI

DVLDRIKILLQLIFPRNVLQTMKMKTTKSEVKAFFMKAIRDTVNYREKNNIYRKDFMHLLIQLTNRGVVT

DDGNITSDQSKTDKALSLNELAAQVFVFFIDRFETSLTTMI 12574

YEIASNPQVQEKL*EEIVTTLSKYNGELSYNAIMEMTYME

LRKYPPLPLLTRQCTKDY

DPEYHP

RFNPERFSEENKKKRPNFT*ILFGE

GLRFEILQSKVGLTTLLRNLKLL*TKKNKVPLEMDKKAFVSSAEGG

VWIDVEKL

 

Seq 78

 

>CYP6BQ5 seq 78, XP_975570.1| PREDICTED: similar to Probable cytochrome P450 6a14 (CYPVIA14) [Tribolium castaneum] 65% to XP_975563 seq 68 add cyan seq

MNTLLHNFVYDFVALFATVLIGVLLYYKWKFTYWAKVGLPTLAPTFPFGDAKEVMLGRLTFGEQFLEFYK

KFRANGFKHGGVYFCLQQFYVPVDPEIIKHIMQKDFHHFMNHGNYFDSENDPLSGHLFNLEDNKWKNMRV

KLTPTFTSGKIK MMFQTLADCASGLNTIMDEAAKNQTSLDIKDILARFTTDVIGSVAFGLECNSLKDPDA

EFRKFGKRIFQIDVLDRIKILLQLIFPRNVLQTMKMKTTKSEVEEFFMKAIRDTVNYREKNNVYRKDFMH

LLIQLKNRGAVTDD GNITSDQSKTDK

ALSLNELAAQAFVFFIAGFETSSTTMT FALYEIASNPQVQEKLREEIVTTLSKYNG

ELNYNAMMEMTYMEKVIFETLRKYPPLPLLTRQCTKDYLIPNTTIRLKKGDMVGIAAQALHYDPEYHPDP

EKFDPERFSEENKSKRPDFTWIPFGEGPRLCIGLRFGMLQSKVGLTTLLRNYKIALNKKTKVPLEMDKKA

FVSSPEGGVWLDVEKLE

 

Seq 108

 

>CYP346A2 seq 108, XP_968966.1| PREDICTED: similar to Probable cytochrome P450 6a16 (CYPVIA16) [Tribolium castaneum] 63% to XP_967901 seq 109

MLLLTAIELSSVFIISLLFAYYLYYRYCFTYWKKRGAPQLTPTFPVGDLSTAAWGKESVYLRLQTLYHKF

KDAGHKFGGIYFLNGPIYFPVHPDLIKRLLVTDFEHFVDRGMYIDEEKLPLTAHIFSMKGEQWKNVRMKF

TPTFTSGKMKSMYNILVQVSQHLIKTLDPVAEQGLEVDIKELLMRYTTDIIGSTAFGVDCNSLDNPNTEF

NRMVAMIFNNPSWKLYKMALEEGLQNPGNIIKIAHDNKVVQKYFNDLVRDTIEYRDKNNIVRDDFMNILM

QMRSTGMEFKEIVAQAFLFFTAGFETSSSTMSNCIHELAHNQEIQDKLREEIHENLGRESSKYTYDDVLA

LPYLDKCVKETLRKYPPVAMLNRICVKPYKIPDTETVVEVNTPVIVSVLGLHRDPEYFPEPLEFDPERFS

NSNKIAPFTYLPFGDGPRNCIGLRFGLMQTKLGLATLLNDFKFYPSPKSPRHLAVDPSTTTLVFSVLNGV

HTKIVKV

 

Seq 109

>CYP346A1 seq 109, XP_967901.1| PREDICTED: similar to Probable cytochrome P450 6a16 (CYPVIA16) [Tribolium castaneum] 63% to XP_968966 seq 108,

51% to XP_968894 seq 110

MFLFDLQVSVIQLLSLFGVSILSGYYFYYRYCYTYWKKKGVPTSKPRFPFGDLSSSAWGKQSVYSRLETL

YHQFKAKGYKHAGIYFFNGPIYFPIDPDLVKRVLVTDFEYFVDRGMYGNGDELPLSCHIFSMKGEEWKNI

RTKMSPSFTAGKMKSIYNIVVHNCENLVKVFQPLAETRTVIDIKDILMRFTADVIGSTSFGIDCNSLDHP

DTEFSRMVNRISNHSGWKLLRVALEEGLQNPGNIEKIAYNDKVVEDFFTNLVKETMEYRDKNNIIRNDFL

HMLMQLRESAGMSLKEIVSQSFLFFIAGFKTSALTMCYCIHELAHSQDLQDKVREEIHKNLGRDVSKYAY

EELIALPTLDKVVKETMRKYPPLPMLNRICVKSYQVPGTDVVIDKDTPVIIPVLGLQRDPEFYPEPLKFD

PERFSNDNNIVPYTYLPFGDGPRNCIGLRFGMVKTKLAVAALLNNFRFLASSKTRRNLAIDPSTTSILFN

VSEGIYTKIIKV

 

Seq 110

 

>CYP346B3 seq 110, XP_968894.1| PREDICTED: similar to Cytochrome P450 6a2 (CYPVIA2) (P450-B1) [Tribolium castaneum] 77% to XP_968751 seq 111,

73% to XP_968823 seq 112

MFKFDMNNTTVFELLCTFITISLLSWYLYYGYCFNYWKKKGVPTTPPKFPAGNILKPVLGKENLFVTVED

YYREFKREGHKHAGLYFFNGPVYLPIDPEIVKSILTTDFDHFVDRGVFYDEQNFPLSTHLFSMRGTEWKS

LRMKLSPTFTSGKLKTMYEIFIKMTENFINVVKPKAETGEEINIKYTSANFTSDIIFNAAFGMEGHTLEN

PDNELSKVVLNVFNPSNWLFFKSILIEGLQNPGSLLRVVLSNKSMEKFFMDLVRTTVTHRDENKIVRKDF

LSLLLEIRDKEGLSFNEIAAQSFLFFLAGAETSSQTISYCIHQLAYHQDLQDKLRKEILDNLGTDFTKYT

YDDIFKLPYLDKVFNETLRLYPVLGFLNRICVKPYKVPGTNVVIDKGTPVLISLLGLQRDPEYFPEPLKF

DPERFSEGLEQVPFTFLPFGDGPRFCIGMRYGKLQTKLGIAALISQFRFLPSPKTPKFVEYDRPSKSLAM

VPAKGIIVKVEKL

 

Seq 111

 

>CYP346B1 seq 111, XP_968751.1| PREDICTED: similar to Cytochrome P450 6a2 (CYPVIA2) (P450-B1) [Tribolium castaneum] 77% to XP_968894 seq 110

MFKFDVFNTGVFELVCLFISLSIVSWYLYYIHCFNYWKKKQVPTHPPQFPAGNILKPVLGRENLFISVEN

YYKEFKRKGYKHAGLYFLNGPVYLPIDPEIVKSILTTDFDHFIDRGVFVDEQNFPLSAHLFSIKGSKWRS

LRTKLSPTFSSGKLKTMYEIFMKMTQNFIETLEPKAGRKEDINIKYIAANFTADIIFSTAFGLEGNTLQY

PDSKLGNLAKNLFNPSTWIVIKSLALEGLQNPGSILRAFISNKSIEEFFVDLVKKTVKHRDENKVVRKDF

LSLLLEIRDREGLSFNEIVAQCFLFFLAGFETSSQTISYTIHSLAYNQDVQDKLRKEIVDNLGSDFTKYT

YDDVLKLPYLDKVFNETLRLYPVLGFLNRICVKPYKVPGTDVVLDVGTPVLISTLGLQRDPEYFPNPFKF

DPERFSEDNSQVPFTFMPFGEGPRFCIGMRYGKLQTKLGIASLVSQFRFKPSPETPEFIEFDKFSKSLAM

SPVKGITVKIEKL

 

Seq 112

 

>CYP346B2 seq 112, XP_968823.1| PREDICTED: similar to Probable cytochrome P450 6a23 (CYPVIA23) [Tribolium castaneum] 86% to XP_968751 seq 111

MFVLLCLVISLSLVSWYLYYVHCFNYWKKKQVPTHPPTFPTGNILKSVLGKENIFITIENYYKEFKRKGH

KHAGLYFFNGPVYLPIDPEIVKSIMTTDFEHFVDRGVFVDEKNFPLSAHLFSIKGSKWRNLRTKLSPTFS

SGKLKTMYEIFMKMTQNFIETLEPKAGRKEDINIKYIAANFTADIIFSTAFGLEGNTLQNPDSKLGNVVQ

NLFNPSTWIVIKSLALEGLKNPGGIVRAFISDKALEEFFVNLVKNTVKHRDENKIVRNDFLSLLLEIRDK

EGLSFNEIVAQCFLFFLAGYDTSAQTISYCIHSLAYNEDIQDKLRKEILDNLGSDYTKYTYDNVLKLPYL

EQVLNETLRLYPVLGFFNRICVKPYKVPGTNVVLDVGTPVLIPTLGLQRDPEYFPDPLKFDPDRFRKDNS

LVPFTFMPFGEGPRFCIGMRYGKLQTKLGVASLLSQFKFKPSPETPELIKPENFSKSLSLVPVKGVTVKI

EKL

 

Seq 40

 

>CYP345C1 seq 40, XP_970418.1| PREDICTED: similar to Cytochrome P450 6g1 (CYPVIG1) (Cyp6-like protein) [Tribolium castaneum] 46% to XP_970485 seq 39

shorten model at N-term                                            

MMFVIFFAVLFLIYYYLTRNFKHWEKKNVPFIKPLPFFGSI

YDGVLMRHSIGEVFYDLYYKSTKPFVGFFILDKPCLLIRDPKLIKKILVNDFQYFYDRNAVNNKRDDPIS

THILFILKNPDWRELRTKMTPVFTSSKIKIMSELIENASHEMTNYLNNHIKDYNSVEMRDVCLKFTVDVI

GSTIFGVQANSFKDENSQFSSVAKRLIDWDDIVTAFRFRCYLLAPLFVNLFRMKLFPPDCVNFLKNTFLD

IMDKRSVSNKSRNDLIDILLQMKNDNRNFIEGDILVSQALMFFVAGFETTSSTMGFALYEFARNPDIQDK

IRNEIKDISDKYGDIKYDSLKEMEYLDMCVKEVLRKYPVVPFLDRKCNTTYTIPDTNVTIDKDTPIFIPS

LALHYDPQYFPNADIFDPERFSSNNKTGIDSFAYLPFGEGPRNCIGARFGLLTAKLGLVHILKEFVVSCN

EKSNEKIKFNPKGMVLSALNGINLKLSKVEKAT

 

Seq 41

 

>CYP348A1 seq 41, XP_967784.1| PREDICTED: similar to Probable cytochrome P450 6a13 (CYPVIA13) [Tribolium castaneum] weak match to other P450s, new family, short

missing some large seq blocks in the mid region, No Cys at heme signature, no I-helix, probable pseudogene or non-functional as a P450

AAJJ01002935.1

10591 MEQDWFFYSVTLFTFAVIFTFCYIRHVYTFFERKRIPRAGHPTFPFGNLYDVFFEKVPIFMQLWKFYNRF

KRKKCKLGGFYLFLKPAIVLVDTTLVQLFFTDVFAKDERDDLDANFCGQVLASVVKSVEKVWPKLGPFAE

NEANFTQILGQELVGLCAREFFDSNDAKLCEVEGSRVFPLFRKCVSLSYPQFCKNENHRFRGKNFEKAAK

NGVLQVLQKNGFSAKDRVDFIAELVDYLGKSSNLILFTLYELSLNREIQDDLRGEILRFRRNKDTFTYTE

LEQLTYLETVIC (1) 11466

11514 ETLRKYPMKPFVHKVCQKTFEQNGIKFDTNQTVFLSIFGIHHDVDNYINPELFDPDRF

SEENEMFIDPIKYLPFGHQIKNDF (1) 11760

11838 DSLYAKLIMKMILIELLSKYEFALGKKSPKCITFDENLFEIKSREDMWLKIKKL 11999

 

Seq 67

 

>CYP347A1 seq 67, XP_970992.1| PREDICTED: similar to Probable cytochrome P450 28a5 (CYPXXVIIIA5) [Tribolium castaneum] 36% to XP_975563, 35% to 28d1

AAJJ01005243.1 gene model too long, shortened at C-term

MLPIVLFILACTICYFFVKINHAYWKKRGVVGPKPSFLVGNLGKSFILKSSPGEIYTEIYRKYKDASVVG

LFRSETPVLLVRDPELLKEITTKSFQHFRNNDIDVDKKHDPLFGRNPFVLKGDEWKTVRAQLTPGFTSGK

MKWLYSYLETNSKKMVEYILRVPEATNGQGYEAKELCIRYTLNNVGDAVFGIEGKCFEEKNSEFRKLSKE

FLSPGSYGIIIMFLATLFPPITKIFPMRFVTKSVEKKLTNLVSDALKHRQVNNIVRNDFLHIISQLKKTN

QDFTDVDVTAHAAGFFADGSETSSIVMSFVLFQLSINPDVQSKLRAEVTEAFNNNNNNMPYEVVQDLPYL

EAVIQETLRIQPPIHSLQKLCTKSFTWTLKETNKPLVIEEGTPIIIPTHALQSDPQHFEDPESFQPERFL

GENRENIKKCTHMPFGEGPRACL (1) 3393

3443 GQRFGLLQIKVGLAYIVKNFELSLNKKTKLPLKYDPINPLVTPTGGLWIDFKKIEKKKCNQIKSFH 3640

VMYLVIFPNIL*

 

Seq 140

 

>CYP347A4 seq 140, AAJJ01003892 DT790783.1 DT800167.1 = ESTs

59% to XM_965899 seq 67

4005 MLVILIILAIGVAFYFLKLNYQYWKKRGIPGPKPNFLVGNMGRSFILKASPGEIFAEAYQ (2) 3826

     HKYNESEIV 3747

3746 GMYRATTPVLVVRDPDLVKEVTIKSFDHFSENDYEVDKRHDPIFARNPFVLKGEEWRTVR 3567

3566 AQLTPGFTSGK (0)

     MKWLYPYLEKISENLVKFIETQINTNCEVKE 3387

3386 ICRRFTLNNVATCAFGLEGKCLEEENSEFRQLAKDFFTPPSSFFLMTVSPTLSKALAAG (2) 3210

1627 FIKKTIVSKFVDMVTQTLKYREENNIVRNDYLHVVSQLKKNSNNYKFTDIDVTAHAAGF 1451

1450 FGEGYETSSILMSFVLFEIAQNPHVQNKLREEINKAFEENGTLPYEVLQSLPYLDGVVN (1) 1274

     ETLRIHPPMFSLQKICTKNFTYTSKNGNQVTIEAGTPIILPVY 1097

1096 GLHHDPKYYPDPETFKPERFMGENREKLTKYTFLPFGEGPRICL (1) 965

 914 GKRFGVLQIKVGLAYIIRNFELSVNGRTILPIRYDPINIMTAPVGGLWIDFRKIEI* 744

 

Seq 142

 

>CYP347A2 seq 142, AAJJ01002940  57% to seq 67

4106 MIPIILTITVVTIVYYLLHLNYQYWKKRGIANPKPVFLLGNFGKCFFLRASPGQVYYDVYN (2) 4288

4341 KYKNEQVVGLYRATTPVLLVRDPELIKEVMVKSFSSFHNNDVYVYKKRDPIVGRNP 4508

4509 FVLKGEEWKSVRQQLTPGFTSGK (0) 4577

5532 MKWLYPLLDEVAENLVKFIENQPKTLNAKDVCARFTLNNVASCAFGIEGK 5681

5682 CFEEENNHFRQMAIEFLSPSSWSFIGLFLVLLNPSLLKVLPIKFVTKNCEKKLIDLVQQT 5861

5862 VKYREDNNVVRNDFLHILTQLKKTSSEFTDIDVVAHAAGFFGDGYETTAGVMSFVLYCLA 6041

6042 ENLDIQTKLRELVDKVFENNEEKLPYEALQEIHFLDAVVN (1) 6161

6216 ETLRLHPPALHFQKLCTQDFTFVLKNANKSVTIEKGTPVILPVYGLHHDPDYY 6374

6375 ESPDLFKPERFLPENKDKTVKCTFMPFGEGPRSCL (1) 6479

6527 GQRFGLLQVKVGVAHIIRHFELSVNGKTQRPIKYEPTNPVTAPVGGFWVNFRKIR* 6694

 

Seq 143

 

>CYP347A3 seq 143, AAJJ01002940 62% to seq 142, first two exons only,

possibly joins with AAJJ01006489 to make a complete seq

seq 143b

AAJJ01006489 Missing N-term

possibly joins with AAJJ01002940 to make a complete seq

whole seq 62% to seq 142

These two contigs are adjacent in the genome assembly, they are in

The same orientation, so Seq 143a and 143b probably form a complete gene.

 9930 MLPIILIVTAVTIICYLIHLNYQYWKKRGVKGPRPHYLVGNIGKVLLLQASPGQVFAEAYN (2) 10112

10166 EFKDEDVVGLYRAMSPIILIRDPELVKEVILKSFNSFHDNDMYIDKGTDAIAGRHPFLLR 10345

10346 GDDWKITRQKLTPGFTSGK (0) 10402

403 MKWLYPLLEEVSATLIKFIETHPETTNGTGCDIKDLCGRFTLNNVASCAFGIEGKCLEEK 582

 583 NSQFQQLALDFMSPGSTAFFTFFLSTIIPSLSKILKVRFISQDVENRLVDLIGQTVKYRQ 762

 763 ENNVLRNDFLHILIELTKTHKDYQLIDVTSHAAAFFADGYETSASVMSFVLYELAANPGV 942

 943 QERLREEVGEAFAKNGTLPYDGLQEIHFLDAIVSETLRLHPPLQHLQKVCTKDFTFVAK 1119

1120 NTNKTVTIEKGTTTIIPIYGLQHDSKFFENPDSFQPERFLGSNKDSIAKGTFLPYGDGPR 1299

1300 ACL (1)

     GIRFGLLQIKVGVAYIIHHYELTVNKKTKVPLKFVATSPVTAPVGGFWLNFRKLK* 1521

 

seq 1 CYP9D1

 

>CYP9D1 seq 1, gi|62082614|gb|AAX62142.1| cytochrome P450 monooxygenase [Tribolium castaneum]

missing some seq after heme signature, also missing N-term

AAJJ01000243.1 around 11kb region

MWPFVVQKKHITEIIADIYRQFPTDRYVGYYHFMTPTLLLRDVELIKQIGVKEFDSFHDHVSVSNTNTEP

LLSEALTNLPGEKWKEMRATLSPAFTSSKIKNMYSLISECAENFVDFFQGREQDVEIKEVFSRFSNDVIA

TAAFGIRVNSVQEPNNEFYAMGRSLTTFSAFQILKIFLAHLVPKIAEFFEYRVLPRKVTDFFEGLILDNM

QKREAEKIVRPDLIHLLMEARKGKLKHDNSNEGGEGFATVEESEIGKNTKQVELTDEKIVAQALLFFFAG

FETVSTGVSFMAYELATNPHVQKKLQKEIDLTLQENHGKISYNVLQSMKYLDQVVCESLRLWPPAPQTDR

LCNKNFVIEASKPHERTFTVEKDTMVMISMFAIHRDPQYFPDPEKFDPERFSDENKAKIVPGTYMPFGVG

PRNCI AKFDIVPNGKTVIPIKISPSTANMVPQEGIHLTFKPRL

 

>gi|86515430|ref|NP_001034541.1| cytochrome P450 monooxygenase [Tribolium castaneum] = NM_001039452, AY920544 from Jeff Stuart

MWPFVVQKKHITEIIADIYRQFPTDRYVGYYHFMTPTLLLRDVELIKQIGVKEFDSFHDHVSVSNTNTEP

LLSEALTNLPGEKWKEMRATLSPAFTSSKIKNMYSLISECAENFVDFFQGREQDVEIKEVFSRFSNDVIA

TAAFGIRVNSVQEPNNEFYAMGRSLTTFSAFQILKIFLAHLVPKIAEFFEYRVLPRKVTDFFEGLILDNM

QKREAEKIVRPDLIHLLMEARKGKLKHDNSNEGGEGFATVEESEIGKNTKQVELTDEKIVAQALLFFFAG

FETVSTGVSFMAYELATNPHVQKKLQKEIDLTLQENHGKISYNVLQSMKYLDQVVCESLRLWPPAPQTDR

LCNKNFVIEASKPHERTFTVEKDTMVMISMFAIHRDPQYFPDPEKFDPERFSDENKAKIVPGTYMPFGVG

PRNCIAKFDIVPNGKTVIPIKISPSTANMVPQEGIHLTFKPRL

 

>CYP9D1 Tribolium castaneum (red flour beetle) Jeff Stuart 8/14/98

MLTLILGVILGAIIYYKLRKPAHFWAKKTSPTCHHGPLLGNMWPFVV

QKKHITEIIADIYRQFPTDRYVGYYHFMTPTLLLRDVELIKQIGVKE

FDSFHDHVSVSNTNTEPLLSEALTNLPGEKWKEMRATLSPAFTSSKIKNM

YSLISECAENFVDFFQGREQDVEIKEVFSRFSNDVIATAAFGI

RVNSVQEPNNEFYAMGRSLTTFSAFQILKIFLAHLVPKIAEFFEYRVL

PRKVTDFFEGLILDNMQKREAEKIVRPDLIHLLMEARKGKLKHDNSNEG

GEGFATVEESEIGKNTKQVELTDEKIVAQALLFFFAGFETVSTGVSFMA

YELATNPHVQKKLQKEIDLTLQENHGKISYNVLQSMKYLDQVVCESLRLW

PPAPQTDRLCNKNFVIEASKPHERTFTVEKDTMVMISMFAIHRDPQYFP

DPEKFDPERFSDENKAKIVPGTYMPFGVGPRNCIGSRFALLEIKTLFC

HLLAKFDIVPNGKTVIPIKISPSTANMVPQEGIHLTFKPRL*

 

Seq 30 CYP9D2

 

>CYP9D2 seq 30, Tribolium castaneum (red flour beetle) Jeff Stuart 8/14/98

9 diff with genomic seq below (98%)

EFDSFHDHLPFVTEATEPLLSKSLLNLLGDEWRKMRATLSPAFTSSKMKHM

YQLIYECAERFTQHFGNRTVDVEIKDVFSRFSNDVIASAAFGI

QVDSLKEPGNEFYSMGKAVTSILNGFQMVKVFLAFLFHAIFQLVQFRAI

PPKVTSFFYDIIIDNIKKRKNEGIVRPDMVHLLMEAQSGKLKHDNNTEQ

VDGFATVEESEIGKNSNKIQLTNELIVAQALIFLLAGFDSVSTGLSFMA

YELATNPDVQKKLQEEIDSVLKKNQGEVTYIEIQSMKYLDQVLCETLRLW

PPAPQTDRYCNKDFPIDANFTIEKGVMIEIPIFAIHRDPQYFA

DPDKFDPGRFSDENKSKIVPGTYIPFGVGPRNCIAPGSRFALLEIKILFW

HLLSKFDILPNEKTVVPFKLCKRSSSLVPNEGIHLRFRPRK*

 

>CYP9D2 seq 30, AAJJ01000243.1

MLTTILLTLLSALIYFKLIKPASFWETRNVPHVTSWPLVGSMFPVLTQKKHFVEISQNIYTQFPNAK (2)

      CVGYVLFTKPTLLIRDLDLLKQIGVK

8454  EFDSFHDHLPFVTEATEPLLSKSLLNLLGDEWRKMRATLSPAFTSSKMKHMYQLICECAE  8633

8634  RFTQHFGNRTVDVEIKDVFSRFSNDVIASAAFGIQVDSLKEPGNEFYSMGKAVTSILNGF  8813

8814  QMVKVFLAL (2) 8840

8887  LFHAIFQLIQFRAIPPKVTSFFYDIIIDNIKKRKNEGIVRPDMVHLLMEAQSGKLKHDNN  9066

9067  TEQVDGFATVEESEIGKNSNKIQLTDELIVAQALIFLLAGFDSVSTGLSFIAYELATNPD  9246

9247  VQKKLQEEIDSVLEKNQGKVMYNEIQSMKYLDQVLC (1) 9354

9922   ETLRLWPPAPQTDRYCNKDFPIDANFTIEKGVMIEIPIFAIHRDPQYFADPDKFDPGRFS  10101

10102  DENKSKIVPGTYIPFGVGPRNCI (1) 10170

10212  GSRFALLEIKILFWHLLSKFDILPNEKTVVPFKLCKRSSSLVPNEGIHLRFRPRK*  10379

 

Seq 86

 

>CYP9W1 seq 86, XP_972391.1| PREDICTED: similar to Cytochrome P450 9c1 (CYPIXC1) [Tribolium castaneum] 51% to XP_973677 seq 2

MWYVYLSIFCGFLALFIYYKIIKPANFWKKRNVPHESTFALLQRKHPATILTQLYQKHKDQRYVGYLQLN

HPFLMIRDLELIKQLTVKDFESFHDHYPFSYAKNDPILGKSLLMLNGQDWKQMRATLSPAYTTNKLKNMH

QLMTECAQNFVGHFKGREKVAVDMKDIFTRFTTDVIASTAFGIKTDSLNQPNNRFFLMAKSLSKFGFIQV

VKILISSFAKVGIFPSSVVNYFGTIIKSNIRERKQSCIVRPDMIHLMLEANKGQANQLTDDDIVAQAMTF

FFAGFETVATACSFMAYELAIHPEIQQKLQAEIDSVGGVTYESLLSMKFLDQVVSESLRLWPPGFQIERM

CTKSYKIEPKNHNEKGIVLEEGVSLIIPVIALHHDPDLFPEPDRFDPERFSEANRSQIVPGSYLPFGVGP

RNCIASRFALLEIKTLFFHMLSKFDIVPIDTTQIPLKLSTKKMHLEPEKGFRLGIRPRKV

 

seq 31 9D like

 

>CYP9D3 seq 31, AAJJ01000243.1

MLTIILSVVLGALIYYKLIKPASFWEERNITHASAWPLIGSMWESVIQKKNFNEISADIYKKYPNDR (2)

      YVGYMQFSNPALLIRDLNLIKQIGVKA

6156  FDHFHDHLAFVGVKAEPLFSKSLAILQGEEWKQMRATLSPVFTSSKMKNMYHLIYECAEN  6335

6336  FAKHFQGRKEDVEVKDIFSKFTNDVIATAAFGIQINSLEEPNNEFYLMGKLLTTFKGWQ  6512

6513  LIN (2)

      NNTILYRLIFEILFQLTKLNIFNQKVIKYFYDIIIDNIHKREK  6692

6693  EGIIRPDLIHLLMEARKGKLKHDNSNEGGDGFATVEESDIGKNSKQLELTEDLMVAQALI  6872

6873  FFFAGFETISTSFSFTAYELATNPDVQKKLQKEIDSAFQENHGKISYNVLQSMKYLDQVV  7052

7053  S(1)ESLRLWPPAPQTDRFCNTDFVLEPTKPDERRFTIEKGVTTIIPI  7232

7233  YGIHRDPQYFPNPDKFDPERFSDENKAKIVPGTYMPFGVGPRNCI (1)

7413  GSRLALLELKTLFFHLLSKCDIVTNSKTVIPLKISPNNGNITPKEGIHLSFKPRKINGKM*  7595

 

seq 32

 

>CYP9D8 seq 32, XP_973646.1| PREDICTED: similar to Cytochrome P450 9c1 (CYPIXC1) [Tribolium castaneum] AAJJ01000243.1 around 88kb

89% to XP_967481 seq 3, runs off the end of the contig

MLTIILSVVLGALIYYKLIKPASFWEERNITHVSAWPLVGN

87975MWSTFIQKKNFNEISNDIYKKYPNDRYVGYMQFTDPVLLIRDLDLIKQIGVKVFDNFRDHHAVAGFKTEP

LFNKSLAFLEGEEWKQMRATLSPAFTSSKMKNMYHLIYECAENFAKHFQGKKQDVEVKDVFSRFTNDIIA

TVAFGIQINSLEERNNEFYLSGKSVTTFSGKQLLKFFAAQVIPQVFEFFKVGVFDQKIVKYFNDIIIDNM

HKREKEGIIRPDLIHLLMEARKGKLKHDNSNEGGDGFATVEESDIGKNSKKMELTDELMVAQALLFFFAG

FETISTGASFLAHELATNPDVQRKLQEEIDSVLEENQEKISYTTIQSMKYLDQVIS

 

Seq 2

 

>CYP9D7 seq 2, XP_973677.1| PREDICTED: similar to Probable cytochrome P450 9f2 (CYPIXF2) [Tribolium castaneum] fused to another seq (this seq only seen in tribolium) delete the fusion part

78% to XP_967481.1 seq 3

MLTIILSVIFCALIYYKL

MKPANFWKKRNITHVPSWPLVGNMLDSIIQKKHILEISTDIYKKYPDDRYVGYMQFTNPTLLIRDIDLIK

QIGVKIFDSFHDHVTAAGIETEPLLNQSLISLHGEDWKRMRATLSPAFTSSKMKNMYHLIYECSENFAQH

FQDGKQNVEVKDIFSKFTNDVIATAAFGIQVNSLKEPDNEFYSMGKALTTFQGFQLIKFFFVQLVPKIAE

ILKVRFLNPKVANFFTSIIINNMQKRERDGIIRPDLIHLLMEARKGKLKYDKGNEFGDGFATVEESEIGK

NTKQVELTDDLIVAQALLFFFAGFDTVSTGASFLAHELATNPDVQKKLQEEIDMVLEENHGKISYTRIQS

MKYLDQVISESLRLWPPAPQTDRFCNTDFVLEPTKPHERRFTIEKGVTTIIPIYGIHRDPQYFPNPDKFD

PERFSDENKAKIVPGTYMPFGVGPRNCIGSRFALLELKTLFFHLLSKCDVIPNEKTVIPLKISPNNASIT

PKEGIHLTFRPRNFVQFKKSF

 

Seq 134

 

>CYP9D6 seq 134, 93% to seq 3

AAJJ01000243.1 runs off the end

  2 TDRFCNTHFVLEPTKPHERRFTIEKGVTVVFPIYGIHRDPQYFPNPDKFDPERFSDENKA 181

182 KIVPGTYMPFGVGPRNCI (1) 235

283 GSRLALLELKTLVFHLLSKCDIVTNSKTVIPLKISPNNANITPKEGIHLTFKPRNVA 453

 

seq 135

 

>CYP9D5 seq 135, 87% to seq 31

AAJJ01000243.1

1081 MLTIILSVVLGALIYYKLIKPASFWDERNITHASAWPLIGSMWESVIQKKNFNEISSDFY 1260

1261 KKYPNDR (2?)

1333 YVGYMQFSNPVLLIRDLDLIKQIGVKVFDNFHDHLAITGIKTDPLFSKSLIVLRGEEWK 1509

1510 QMRATLSPAFTSSKMKNMYHLIYECAENFAKHFQDEKKNVEVKDIFSKFTNDVIATVAFG 1689

1690 IQINSLKEPNNEFYSMGKLLTTFKGFELMKFFFALALPQIFE (0) 1815

1868 LTKLSLFNQKVTNFFRNIIIDNMHKREKDGIVRPDLIHLLMEARKGKLKHDNSN-EGG 2038

2039 DGFATVEESEIGKNSKKMELTDDLMVAQALLFFFAGFETISTGFSFMAYELATNPDVQKK 2218

2219 LQKEIDLTLQENHGKISYNVLQSMKYLDQVV 2311

2376 ESLRLWPPAPQTDRFCNTDFVLEPTKPHERRFTIERGVTIIIPIYGIHRDPEYFPNPDKF 2555

2556 DPERFSDENKAKIVPGTYMPFGVGPRNCI

     GSRLALLELKTLFFH 2735

2736 LLSKCDIVTNSKTVIPLKISPNNGNITPKEGIHLTFKPRNVA 2861

 

Seq 3

 

>CYP9D4 seq 3, XP_967481.1| PREDICTED: similar to Probable cytochrome P450 9f2 (CYPIXF2) [Tribolium castaneum] 78% to XP_973677 seq 2, 67% to AAX62142 seq 1

MLTIILSVILGALIYYKLIKPASFWEERNITHASAWPLVGSMWESVIQKKNVNEVSTDIYNKYPNDRYVG

YMQFTDPVLLIRDLDLIKQIGVKVFDNFRDHHAIAGFNAEPLFTKSLIFLEGEEWKQMRATLSPAFTSSK

MKNMYHLIYECAENFAKHFQDKKQDVEVKDIFSRFTNDIIATVAFGIQINSLEERNNAFYLNGKSVTSFN

GKQLLKFFVAQLAPQIFEFFKLCVFDQNSVKYFYNIIIDNMHKREKEGIVRPDLIHLLMEARKGKLKHDN

SNNEGGDGFATVEESDIGKNFKKMELTDELMVAQALLFFFAGFETVSTGASFLAHELATNPDVQRKLQEE

IDSVLEENQEKISYITIQSMKYLDQVISESLRLWPPAPQTDRLCNTDFVLEPTKPHERRFTIEKGVTIII

PFYGIHRDPEYFPNPDKFDPERFSDENKAKIVPGTYMPFGVGPRNCIGSRLALLELKTLFFHLLSKCDIV

TNSKTVIPLKISPNNGNITPKEGIHLTFKPRNVA

 

Seq 85

 

>CYP9AF1 XP_972495.1| PREDICTED: similar to Probable cytochrome P450 9h1 (CYPIXH1) [Tribolium castaneum] 46% to 9D4, 56% to 9Z14 (potato beetle C-term fragment)

AAJJ01001543.1 deletion in mid region 37% to 9P1, belongs in 3 clan

Note XP_972546 is at 14kb region

MLLSLFAVFLSVLIFFKFVSPCTYWKEKGVKHAQAWPFIGSMGRVFFKKQPYVEFLTELYNKFPNER (2)

YVGFMKFTQNHILIRDIELIGKITGKEFNFFTDRTVSSRLRKDKILSQSLISLTGDHWRD

MRATLSPAFTSNRTRNLYTFIETCARNFVNHYKAEVEIEVKEVFAKFANDVIASVAFSTELNSLKEPNDFYTN

ASQLKPDFFKQFI

TTSDKNRQDLISLLKDESLKFETYKRAKGEGFAIGEEPQIDPLSRKIQLTDEQI

LAQALLFFLTGFETISTSASFLAYELAVNLDVQKKLQREIDKVVQITGDRIPYDALLSMKYLDQVISESL

17091 RKWPPKFETDRVCTRDYHIKAQKGEKSLLIRKGMSVVIPIMAIHRDPDYYPNPNRFDPERFSDENRDKVV

PGTYLPFGAGPRNCI (1)

GARLALLEMKTVFGYLLAKFDIVQAKKTQMPIKLSAKCLDMEPEEGFWLGFRPRN 17561

 

Seq 20

 

>CYP9AC1 seq 20, XP_969007.1| PREDICTED: similar to Probable cytochrome P450 9f2 (CYPIXF2) [Tribolium castaneum] 50% to XP_975385 seq 21

MINMNYMITKHNKEQKNHGNKIQQHRKRITGTIYLGIFCAIFGYFYYYVKRQQNVWHQKGIKYCKPKFLL

GSLEIIRSKSLAQIIQELYNAFPEERYHGFYQFLLPTLIIKDPDLIKQITIKDFDHFVNHRRFVNADDDP

FWSRNLRGILVFARRDEKWRDMRATLSPSFTSSKMRIMFELMDECAREFVQHFKSQNSDTVELEMKDTLR

RFTNDVIASTAFGLKINSLKDRKNEFLLMGAAATDFGYIRTMKFLLYTLSPKLCQLLKMKIIPTKVADFF

TVIIKDTIKKRKEKNIIRPDMIHLLLEAQKGRQHPEEHLDIDEGFSSVSESKLTKPNEKLEITTEDIISQ

ALIFFLAGFDTVSTLLNFLFYELAVNPDVQTRLRTEIQSVDEKITYETLLKLKYLDMVMSEALRKWPPAI

ATDREVAKNYTIEPTKPDEKPLLLEEGMLCSIPICAIHRDEKYYPEPEKFDPERFNDENKHKINPLTFIP

FGAGPRNCIGSRFALLESKLLVFHVVKNFEIVPIDKTLIPLVMDKYQINWSVKGGTWLGLKNI

 

>gi|91095321|ref|XP_974706.1| PREDICTED: similar to Probable cytochrome P450 9f2 (CYPIXF2), partial [Tribolium castaneum]

MRATLSPSFTSSKMRIMFELMDECAREFVQHFKSQNSDTVELEMKDTLRRFTNDVIASTAFGLKINSLKD

RKNEFLLMGAAATDFGYIRTMKFLLYTLSPKLCQ

 

Seq 21

 

>CYP9Z2 seq 21, XP_975385.1| PREDICTED: similar to Probable cytochrome P450 9f2 (CYPIXF2) [Tribolium castaneum] 69% to XP_975395

MFWILIVIAAIIAISYHQLRRYHKYWSEKGVQQGDPLPLFGHCLGTTLQKQSLSEFIQMSYNVAPDARYC

GIYQFYSPILIVRDPELIKQITVKDFDHFVNRMAFIPEDCDPLWGKNLVALTDQRWRDMRSTLSPAFTSS

KMKYMFSLISESAEQFAQYFANQDQDLITIEMKDIFTRFTNDVIANTAFGVKIDSLEERNNEFYLMGIEA

TDFRGFWRNMKIVIYFIFPTLFKSLGWRFFSKNVADFFVKLVRDNIAKREKHGIVRPDLINLFLEARKNG

LKYEEQEHALDTGFATAEESEIGKNGMVRQTLTDVDIAAQALLFFFGGFDSVSSMMCFMSYELALNPDVQ

AKLLREVDETFESCDGKLTYEALIKMKYLDMVVSETLRLWPTNVSADRVCTKPYTIEPKNPNEKALHLEK

NTNVIVPIFGIHRDAKNFPEPNRFDPERFSDENKANIRPYTYLPFGAGPRNCIGSRFALLETKALFFHLL

SKFEITPVEQTQIPIQLNRKSFNMTAENGFWLGLKRRKNDN

 

Seq 22

 

>CYP9Z4 seq 22, XP_975395.1| PREDICTED: similar to Probable cytochrome P450 9f2 (CYPIXF2) [Tribolium castaneum] 69% to XP_975385, 68% to XP_975390 seq 23

MLWILVSIAIIALSYLFLIRPFKYWTNLGVEQGNPVPVFGHSWGTIVHTQSFADLVQMVYNIAPGARYSG

MYQFFTPTLVLKDPDLIKQIAVKEFDSFLNHRSFIPEDVDPLWSKNLFSLTNQKWRDMRSTLSPAFTSSK

MKYMFVLISESAEQFIGHFLKQKEDVITIEMKDTFTRFTNDVIANTAFGVKIDSLEERNNEFYLMGKEAT

DFKGFWRNLKFLILLSCPTLFKYLGINFFPKAVSSFFRRLVKDNINNREKHGIVRPDMINLLLEARKNVE

ESDIGKNGAIKQKITDDDITAQALLFFFGGFDSVSSLMCFMSYELGINPDVQEKLHQEIDETLEACKGKL

TYEALMKMKYMDMVISETLRLWPTAVASDRLCNKPYTIEPKDPTEKPIHLEKNSVVWIPIFAIHRDPQYF

PEPNRFDPERFSDENKNNINPYAYMPFGVGPRNCIGSRFALLETKALFFHILSKFEIVPIEKTEIPLQLN

RKSFSMTAENGFWFGLKRRESNK

 

Seq 23

 

>CYP9Z3 seq 23, XP_975390.1| PREDICTED: similar to Probable cytochrome P450 9f2 (CYPIXF2) [Tribolium castaneum] 61% to XP_975381 seq 24

MIWFSTAVITIIALFYWLLIRPFKHWIKKGVAQGNPVPVFGHLLGTILHKQSFSEMIQTVYNIAPDSRYC

GMYQFFQPMLVLRDPELIKQITVKDFDLFMNHKGFIPPDCEPLMGKVLILLTDQKWKDMRNTLSPAFTSS

KMKYMFGLISESAQRFTGHFSKKNDNVITIEMKDIFSRFTNDVIANTAFGVEIDSLEEPNNEFYLMGLEI

TNFQGVVTFLKFLTFVILPRVAKFLKLTFFSKKVGKFFTKVIKENIANREKHGIVRPDMVNLLLEARKNS

DTQKITDEDITSQAIIFFMGGFDPVSSLMSFMSYELAANPDVQTKLLREIDKTYERCDGKLTYEALVEMK

FMDMVVSETLRLWPANGMTDRVCNTSYIIEPKDSTEKPLRLEKGDVVMVPIFGIQRDPKYFPEPNRFDPE

RFNEENKIKIKPYTYLPFGTGPRNCLGTRLALLETKALFFHLLSTFEIIPVEKTEIPLRLTRKSFNMTAE

NGFWLGLKRRSDKL

 

Seq 24

 

>CYP9Z1 seq 24, XP_975381.1| PREDICTED: similar to Probable cytochrome P450 9f2 (CYPIXF2) [Tribolium castaneum] 66% to XP_975395 seq 22 56% to XP_975402 seq 25

MILLCLIAVIVILSYRFLYRPHKYWLERGVIQGNPKPLLGHFMGTTFHKQSFADCIQMVYNMAPNSRYCG

MYQFTMPTLVVRDPDLIKQITVKDFDYFLNHRTFIPEECDALWGKNLFALTNQKWRDMRSTLSPAFTGSK

MKFMFPLISETAEYFIRHFLSKQEDVVTVEMKDAFTRFTNDVIANTAFGVSCDSLKERENEFYLMGKEAT

DLKGFWKNIKLLLFFLIPQVFKLCKVRFFSKSVANFFTNLIKGNITKREEFGIVRPDMIYLLMEARKNVS

NEPISDEDITAQALIFFFAGFDTVSSAMCFMSYELATNPEIQEKLLQEIDSVEGKPTYDTLMNLKYLDMV

VSETLRKWPISVATDRICNKPYTIEPKSPDKRPLLLEKNLAVWIPVYALHRDPNYFPDPNRFDPERFNEE

NKANIKPYTYLPFGLGPRNCIGSRFALLEMKILFFYILSHFEITPIPRTQIPLKINKTQFALTAEDGFWL

GLKRRQK

 

Seq 25

 

>CYP9Z5 seq 25, XP_975402.1| PREDICTED: similar to Probable cytochrome P450 9f2 (CYPIXF2) [Tribolium castaneum] 57% to XP_975395 seq 22, 52% to XP_972755 seq 26

MFWALILAAVLLVTYWLLSRPYKYWTERGVKQGKPVFIFGDYWGPMLRKQTNAEVVDMLYNQIDKEARYC

GIYQFLTPVLLIRDPELIKKITVKDFEHFVDHRIVIPEESDPLSGQKWRDMRSTLSPVFTSSKLKYMFSL

ISERGEQFAQSLLKENKDVITLDIKNSFTRYTNDVMASTMFGITCDSLQEPKNEFYSLAQKSQDFSGFWK

NVKLLGYFLFPEFCKSLEISFYSKEVNSFFEKLVTENIGSRQKHGIVRPDLIHLLMEAKNHAKKSTGYQE

SNKMKTEITDQDIATQALIFFFGGFDTVASLMSFMSYELATNPDCQEKLRQEVDEVMQNCNGKVTYEAIV

NMKYMDMVTSETLRKWPNAPAVDRVCTKPYTIEPARPDEKPIHLKENDTVLLPIYALHRDPKYFPNPDRF

EPERFSEENKANIEPYTYMPFGSGPRNCIGQRFALIETKLFFFYILANFELIPVERTQIPLKLTKNPFTM

TAEKGFWLGFKKR

 

Seq 26

 

>CYP9AA1 seq 26, XP_972755.1| PREDICTED: similar to Probable cytochrome P450 9f2 (CYPIXF2) [Tribolium castaneum] 52% to XP_975402 seq 25

MWWLLIAAFTLLYALYIRLKKKNEYWIKKGVKQGSPVLIFGDKWRAIAHNESLADMVQKIYNVGPGDRYC

GAYDFMSPALVLKDPELIKDILVKDFDHFVDHKRVIPEGSDPIWDKNLFFLTGQKWRDMRSTLSPVFTGS

KMRFMFNLIAKSADQFVQHFVKQEETLIQIEMKDACARLTNDIIASTVFGFESDSVEDPDSKFYEMARKI

TDFSGLWQGLKILGFFIFPKYFENQNLSTEISNFFYNIVKENIRSRQLQNISRPDMISLLMEARENHKLI

HGVEISDEDVTAQALVFFFAGFDSVSSLMTFMSYELALNPEIQKKLIEEIDTTTKTLDYDVVKSMKYLDM

VVSETLRKWPITPFVNRVCTIPYTVQPKRPDENPIHLKKDAIVFLPIYGLHHDPKYFKDPERFDPERFSD

ENKAKIVPYTYVPFGAGPRKCIGYRFALLEIKILFFFLLSKFEIVTVDRTEIPVKICKKALNMTPEGGLW

LGLKPRK

 

Seq 27

 

>CYP9AB1 seq 27, XP_972546.1| PREDICTED: similar to Probable cytochrome P450 9f2 (CYPIXF2) [Tribolium castaneum] 51% to XP_975395

MWWFFVLLLGAPIVFFIFLYRTQKHWERRGLKQKNMGVTIPDNWAETKYPITFPDYVQKFYEMFPNRRYV

GYYTISNPSLFIRDLDLIKQIIVKDFEYFTDHQHFIWEENDPLWSQNLFSLKGKKWREMRTTLSPTFTSS

KIKYMFTLVQKNGEQFARYFLDKNENFMVFEMKDIFTRFTNDVIASSAFGVECDSLREPQNEFYLMSKAV

TDFTGLWKIVAGTFYFLMPSVAKFLNISLFPKKGSKFFSNLVKSNIKSRLQHGIVRPDMINIMLEARKHG

LKHEETQPSQDTGFATIEESELGKSGKVKKEITDDDITSQALVFIFAGFETVSSMMCFLSYELALNPDIQ

KRLIQEIDQTLDACGGSITYESLMGMKYLDMVLTESLRKWPISAGLDRVCTKEYVIEPKLPGENPVRVDK

GTTILVPVYALLRDPKYFPNPEKFDPERFSDENKGKIVPYTFLPFGAGPRSCIGTRFAIMETKVLFFSIL

RHFEIVRVEKTAVPIRYIPQQITLSSADGFWLGFKRRVKV

 

Seq 28

 

>CYP9X1 seq 28, XP_972443.1| PREDICTED: similar to Probable cytochrome P450 9f2 (CYPIXF2) [Tribolium castaneum] 52% to XP_973677

MLLLLVLGVLLSCIWTYYKIIKPVKYWQERDVTHARAWPIVGSLNQVTLKKKHIADAIDEIYQHFPNQRC

VGYMHFTTPFLMVRDLDLIKKITVKDFDHFQDRLASKTIKTDPLLSKSLLSLGGENWKRMRATISPVFTS

SKMKFLFGLMDECAKNFTGHFTQNETKLEMKDVFSKFANDVIASTAFGIRIDSLQDPTNEFYKLGSSFIN

FGWWDIAKVLVMQLSPGLANLLQLRVFSEETSTFFRSLVKDNIRKRQSEGIIRPDLIQLLMQAQNGDEIQ

HSSEKIALTEDHFVSQALTFFIAGFETVSTAACFMAQELALNPHIQKRLQVEIDSVLENHKGDISYETLQ

SMKYLDQVVEETLRLWPPATQTDRLCVKSYVIEPVNPKEKVVFVEKGVSVLVPVMSIQRDSSFWEKPNKF

DPERFSEENRAKIVPGTYLPFGTGPRNCIGSRFALLELKILFFHLLAKFILVPCDNTPIPLKLDPKKLTM

SPENGFQLSLRRRLLSP

 

Seq 29

 

>CYP9Y1 seq 29, XP_972348.1| PREDICTED: similar to Probable cytochrome P450 9f2 (CYPIXF2) [Tribolium castaneum] 49% to XP_972546, gene model too long

delete the fusion part at N-term

MLAVLLLVFVFLAVIYFKLVVPFFYWQKRDIFYVKPWT

RFRKVFLGKESFAEAVRAAYDEHPDKRYYGSYQFLQPSLFVRDLDLIKAITVKDFEHFTDHSAFTSEKTD

PILGLNLFSLKGQKWREMRSTLSPAFTGSKMRAMFTLIAQTAESFTQYLLGLGQGVVEVEMKDTCTKFTN

DVIANCAFGIECNSLLNPENEFYKMGTMVSKPSPWRLFKTLPPTISDFFLRIIKDAIIVREQQGIVRPDM

IHLLLEARKGRLKHDKIESNEPGFATVQESTIGQNEKSLQITDELITAQALVFFIAGFTTSSSLMSFLAY

ELVVNPEIQKKMQKEIDAFLDREFSYEQVLQMKYLDQVVSEALRKYPPGYVLNRICVKDYVIKPKQEGEK

VAVIEKGCLVAIPVIALHYSPEFFPDPEKFNPERFSDENKGKILPGSYIPFGLGPRNCIGSRFALLEIKV

LLVKLLAKFDLVPVDKTVIPLKFAKTLGLDAKGGIWVGLKKRT

 

Seq 33

 

>CYP9Z7 seq 33, XP_972840.1| PREDICTED: similar to Probable cytochrome P450 9f2 (CYPIXF2) [Tribolium castaneum] 63% to XP_972794 seq 34

MLLVLLAIATLIYFYWKIIYPHKYWTRKGVPQSKPVFLFGDIWPMIIRKYSAPELVDEFYKIDQNARYCG

VYQFLSPGLILRDPELIKEITVKDFDHFVDRRVFVKENVDPVFGRSLLSLDGEKWRNMRAAVSPVFTSSK

MKYMFPSISQCGEDFANYFLKQNKDLLELEMKESITKFTNDVIANTVFGFTCNSLENPNNEFYKMGDEVG

NMTSMRTRIVFLMNALAPKILSFFKIYLFSPRIYTFFRQVVNENISSREKHGVTRPDMIDLLVKAKNNSL

KNEEADDLPEAGFTTVKDTENGKKSRKYQITDEDIVAQALLFFFAGFDSVAGVISYMCYELAVAQDAQEK

LRQEVDETREKCGGKISYEELMKMKYMHMAVSETLRKWPTAIASDRVCVKPYTIQPKLPNEKPLHLKVGD

TVNIPIYAIQRDPQYFPEPDRFIPERFSEENKSKIVPYTYMSFGTGPRSCIGYRFALLEMKILMYHLISN

FEIVPVAKTQIPIRFNPKAVNMTAEKGFWVGLKRRVKV

 

Seq 34

 

>CYP9Z6 seq 34, XP_972794.1| PREDICTED: similar to Probable cytochrome P450 9f2 (CYPIXF2) [Tribolium castaneum] 63% to XP_972840

MFWILVGLALVALYWALSRPHSYWKRKGVVQGSPVFLLGDSWPMLFRKYSPPEMTELFYKASPNTRYFGI

YEFLTPGLLLRDPDLIKQITVKDFDHFVDRRPFVPEKADPLFGKSLFSLKGPKWRAMRSTLSPVFTSSKM

KYMFQLMSQTGERFINHFLNQKEEVVTVEMKEITTKFANDVIGNIVFGYECDSVKDPKNEFYVMGADLTN

FRSLRFLLVFSAKSIFQLFKIPLFPKKVSDFFVRVVNDNIESREKHGIVRPDMIHLLLKMKSNNLKHEEV

ETVPDAGFASVEESELGKNAKTVTKITNEDIAAQALLFFFAGFDSVSSLISYMAYELAVNPDVQTKLLQE

VDETRQKSDGKITYEALMSMKYMDMVVSEALRKWPNAIATERVCTKPYTIEPKLPDEKPLRLEIGDVVAI

PMYAIQRDPKYFPEPERFIPERFSDENKSKVQPYTFMSFGTGPRSCIGSRFALLETKLLFYYFLTNFEFV

PVEKTQIPIKFNRKALNMSPENGFWLGLKRRV

 

Seq 35

 

>CYP9AD1 seq 35, XP_973619.1| PREDICTED: similar to Probable cytochrome P450 9f2 (CYPIXF2) [Tribolium castaneum] 49% to XP_975385 seq 21, shortened at N-term

MLLLLLGTLIVILVLYLVNLSTKNFDHWEKRRVKYVKPFPFVGNLLPTVLKTKSTA

ELIQHLYKAFPNERFVGIFQFNTPILLIRDPELIKSIAIKNFDNFVDHYGFANDDIDPLWAKNLFASQGE

RWRDLRQTLSPVFTSSKMRTMFVLMDECVKQLTEYFKDQKQDVIDIELKDIFSRYTTDVIATTAFGIKVD

SLRNRNNDFVVSGREFTDFSGLRGLAFFINGSYPRLAKFLNIKIVSDRLGNFFRTIIKETLTLREEKKIV

RPDLIHSLMLARKGKLKYEELMELPEAGFAAVEESNLTKSNNNVNFLTDEDITAQALVFFLGGFDTTSSL

MCFAGYELAINPHIQKRLKDEVLATDRECNGQITYEKLLNMKYLDMVVSETLRKWNQAVWLDRKCTKEIE

IESETSGEPSVTLKVGDIIWMPAYAIHHDPKYYPNPELFDPERFSDENKDKIRTGTYLPFGVGPRNCIGS

RFALLETKLLLYNLLLNFDLVTNHKTENPIKLRRDTPLLMPQNGFQVSLRKNDAFSEK

 

 

CYP4 clan (44 sequences)

 

This clan includes the CYP4 and CYP311, 312, 313, 316, 318, CYP325 families

 

Seq 8 CYP4G7 GenEMBL AF265300

 

>CYP4G7 seq 8, gi|91081697|ref|XP_975951.1| PREDICTED: similar to Cytochrome P450 4g15 (CYPIVG15) isoform 2 [Tribolium castaneum]

MVVVEESLNHSLNLGNSVLISLGVVAVILAVYHFWLQSLRYTKLGNKIPGYDPLPIIGNAHMVMNKNPTQ

VMELALRVASEKGSVVRFWFGSKLGVALLDPRDIELILGSNVHLEKSSEYRFFEPWLGDGLLISKGDKWR

SHRKMIAPTFHQSILKTFVPVFNKNAMDLVEQLRNEALDQICDVHDYLSGATVDVLLETVMGVKKTKEAR

TSYKYAKAVMDMCTILHFRHVKLWLRSDWIFSFTKLFKEQTSLLRIIHNLTDRVIKQKKKETEEENLKIK

NEQTFNFGSGLRDDLDENDENLGEKKRLAFLDFMVEASQTEGNKLNDEEIREEVNTIMFEGHDTTAAASS

FFICILGVYPEIQEKVYQELRDIFQDSDRPITFNDTLQMKYLERVLLETLRMYPPVPIITRVINEEVKLA

SGDYTLPVGTTVGIGQFLVHRNPKYFPNPDKFDPDNFLPERCQQRHYYSFIPFSAGPRSCVGRKYAMLKL

KILLASIVRNFKIKSVVKEKDFQLQADIILKRADGFRVILTSRT

 

>gi|91081695|ref|XP_966683.1| PREDICTED: similar to Cytochrome P450 4g15 (CYPIVG15) isoform 1 [Tribolium castaneum]

MVVVEESLNHSLNLGNSVLISLGVVAVILAVYHFWLQSLRYTKLGNKIPGYDPLPIIGNAHMVMNKNPTQ

VMELALRVASEKGSVVRFWFGSKLGVALLDPRDIELILGSNVHLEKSSEYRFFEPWLGDGLLISKGDKWR

SHRKMIAPTFHQSILKTFVPVFNKNAMDLVEQLRNEALDQICDVHDYLSGATVDVLLETVMGVKKTKEAR

TSYKYAKAVMDMCTILHFRHVKLWLRSDWIFSFTKLFKEQTSLLRIIHNLTDRVIKQKKKAYFERVKDGD

VSLYNNAVKETEEENLKIKNEQTFNFGSGLRDDLDENDENLGEKKRLAFLDFMVEASQTEGNKLNDEEIR

EEVNTIMFEGHDTTAAASSFFICILGVYPEIQEKVYQELRDIFQDSDRPITFNDTLQMKYLERVLLETLR

MYPPVPIITRVINEEVKLASGDYTLPVGTTVGIGQFLVHRNPKYFPNPDKFDPDNFLPERCQQRHYYSFI

PFSAGPRSCVGRKYAMLKLKILLASIVRNFKIKSVVKEKDFQLQADIILKRADGFRVILTSRT

 

>gi|10443927|gb|AAG17643.1|AF265300_2 putative cytochrome P450 monooxigenase [Tribolium castaneum] 69% to AF263514_1

TAAASSFFICILGVYPEIQEKVYQELRDIFQDSDRPITFNDTLQMKYLERVLLETLRMYPPVPIITRVIN

EEVKLASGDYTLPVGTTVGIGQFLVHRNPKYFPNPDKFDPDNFLPERCQQRHYYSY

 

Seq 9 CYP4G14 GenEMBL AF263514 + AAJJ01000136

 

>CYP4G14 seq 9, gi|91080899|ref|XP_973423.1| PREDICTED: similar to Cytochrome P450 4g15 (CYPIVG15) [Tribolium castaneum] 82% to 4G29 (shortened N-term)

MSTTVPTPDISTPSGILSASNVFYFLLIPALLLWYAYWRISKRHMLELAAKIPGPP

GLPILGNALDLVGKPHQVFSHVYQKSFEYKKVVKMWAGPKLLVFLTDPSDIELILSSYVHIDKSSEYRFF

KPWLGDGLLISTGQKWKAHRKLIAPTFHLNVLKSFIDLFNANSRDVIRKLQKEIGKEFDCHDYMSEATVE

MLLETAMGVSKKTQDQSGYDYAMAVMKMCDILHLRHTKFWLRPDIIFNQTKYAEYQKSLINTIHSLTRKV

IKRKRADFDKGIRGSTAEVPPELQTKNYDKTESKTVVEGLSYGQSAGLKDDLDVDDNDIGEKKRMAFLDL

MIEASQNGVVINDEEIKEQVDTIMFEGHDTTAAGSSFFLSMMGVHQDIQDKVVQELYDIFGDSDRPATFA

DTLEMKYLERCLMETLRMFPPVPIIARQLNQDLKLASGDYTVPAGCTVVIGTFKVHRLEEYYPNPDKFDP

DNFLPERTANRHYYSFIPFSAGPRSCVGRKYAMLKLKILLSTILRNYRIYSDLKEKDFQLQGDIILKRAE

GFKVRLEPRKMAKA

 

>gi|8248467|gb|AAF74206.1|AF263514_1 cytochrome P450 monooxygenase [Tribolium castaneum] 70% to XP_975951 seq 8

TAAGSSFFLSMMGVHQDIQDKVVQELYDIFGDSDRPATFADTLEMKYLERCLMETLRMFPPVPIIARQLN

QDLKLASGDYTVPAGCTVVIGTFKVHRLEEYYPNPDKFDPDNFLPERTANRHYYSFI

 

Seq 13 CYP4H10 not a 4H change name

 

>CYP4BR1 seq 13, old 4H10, XP_966411.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) isoform 1 [Tribolium castaneum], 53% to XP_967724 seq 14

AAJJ01002884.1 45% to 4H11, 43% to 4D23, 53% to 4AN3 frag., 48% to 4H22 frag

Note: name conflict with CYP4BP1 Dendroctonus ponderosae

Changed this name to 4BR1 to avoid this conflict

6659 MILAIVIALISAPFIWWMLILSKYRSLSNVPGPKPSPVIGNSLHIGYRPQDLFNNIVKWAKEYGTVYKIF

VANDVRVLITNPELTELVLSSNVHITKSNAYDLLKPWLGIGLLIST GKKWKSRRKLITPTFHFKILDQFL

DVFNSCGNVLVQRLSSQVGKDSFDVYPFINLCSLDIIC ETSMGVKIKAQQGNNTEYVEAVRRFLDIFIIR

TFSVWKGIDALFKFSSAYSVYKRLLKILHQFTINIIVQRRGEKAQQKTQNVTSDDGIKRKVALLEMLLES

EDNNMLSNEDIREEIDTFMFEGHDT TTSGIAFAILCLAENPKVQEKLYEEVVAVIDNIENITMQQLQEMK

YLEMVLKEAQRLYPSV PVIERRLEVDCNIGGYDFPKDTFLSLFIYGMHHNEKYFPEPEKFDPNRYLPENQ

AKRHNYAYVPFSAGPRNCIGQKFAMLEMKTTIAKIVKHFKILPVPDYKPDLGIAAILKSYNGVCVRLQHR

HGN 8527

 

>gi|10443923|gb|AAG17641.1|AF265298_2 putative cytochrome P450 monooxigenase [Tribolium castaneum] 48% to 4C30, 1aa diff to XP_966411

TTSGIAFAILCLAENPKVQEKLYEEVAAVIDNIENITMQQLQEMKYLEMVLKEAQRLYPSVPVIERRLEV

DCNIGGYDFPKDTFLSLFIYGMHHNEKYFPEPEKFDPNRYLPENQAKRHNYAYV

 

>gi|91078610|ref|XP_975718.1| PREDICTED: similar to Probable cytochrome P450 4e1 (CYPIVE1) isoform 2 [Tribolium castaneum] same as XP_966411, but missing an exon

MILAIVIALISAPFIWWMLILSKYRSLSNVPGPKPSPVIGNSLHIGYRPQDLFNNIVKWAKEYGTVYKIF

VANDVRVLITNPELTELVLSSNVHITKSNAYDLLKPWLGIGLLIST ETSMGVKIKAQQGNNTEYVEAVRR

FLDIFIIRTFSVWKGIDALFKFSSAYSVYKRLLKILHQFTINIIVQRRGEKAQQKTQNVTSDDGIKRKVA

LLEMLLESEDNNMLSNEDIREEIDTFMFEGHDTTTSGIAFAILCLAENPKVQEKLYEEVVAVIDNIENIT

MQQLQEMKYLEMVLKEAQRLYPSVPVIERRLEVDCNIGGYDFPKDTFLSLFIYGMHHNEKYFPEPEKFDP

NRYLPENQAKRHNYAYVPFSAGPRNCIGQKFAMLEMKTTIAKIVKHFKILPVPDYKPDLGIAAILKSYNG

VCVRLQHRHGN

 

Seq 10 CYP4H11 completed, not a 4H change name to CYP4BN6

 

>CYP4BN6 seq 4H11, AAG17642.1|AF265299_2 putative cytochrome P450 monooxigenase [Tribolium castaneum] AAJJ01000217.1, DT795816 = EST

76% to XP_971854 seq 11, 46% to 4d2, 50% to 4D24, 51% to 4AW1, 43% to 4H8

       MNIILEFFSALAVIIVLSWWYLFLKNYKVGKFFKNFSGPPGVPLLGNALDFKNKTK (1)

41530  GVLPAFLNYNKNFGGLVKVQIGPFRKLLLVSDYKFLEFVLSSTKIINKSQNYRTMLPWLGTGLLTS  41727

41728  EGIKWKKHRRIITPTFHFKILEQFINSFDAAGDVMINKLRKKVGIESVDIYPFVTLCALD  41907

41908  IIC (1) 41916

41969  ETAMGTTINAQNNEESEYVTSVKEMGRIIIERAIAPQKNNEFLFRFTKDY  42118

42119  QLQKSALKVLHNYTNNVISKRREELLKDQASKVSENVIDMGIKKKMAFLDLLLQATVDGR  42298

42299  PLTNEEIREEVDTFMFE (0)

       GHDTTASGISFALYCLANNPEAQEKAYEEQVALFGKEKKPIVSYSDLQEMKYLELVIKEALRLYP

       SVPFYARETNQEVEFGDI  42696

42697  KIPKGVNITIFAYGIHRDPKYFPEPDKFDPGRFETIDGKLPYAYIPFSAGPRNCI  (1) 42861

42915  GQKFAMLEMKSTISKVLRNFKLCPATPHHTLDLVAETVLKSDNGVRLSLMERQ*  43076

 

seq 136

 

>CYP4BN11 seq 136, AAJJ01000275 53% to CYP4BN4 seq 12, 49% to CYP4H11 seq 10

73454 MEILFTLFILLLCLLLYFYNKYVYIFDKNLKDYPAPPQVPILGHTLDF (0) 73597

73690 LIFLGFLDVLLSYTHKYGDIVRIRPGPIRQLLLTSNYKLFEAVLSNAKITKKSADYKFFHRWLGTG 73887

73888 LLTSDGAKWKKHRQIITPTFHFQILENFVDVFEKNGKILTKQLEKHLNEDSVNVYGFVNL 74067

74068 CALDIIC (1) 74088

74133 EAAMGTSVKAQENMNSEYVRSVKDLLDTLMGRIFSPYKMIDFIYFFTEDYKKEMKALQ 74306

74307 VIHSYTRNVIKSRQAAINSGEFEQKTKKNFLDLLLAANEQQMTLEEIREE 74456

74457 VDTFMFA (0) 74477

74527 GHDTTASTISFALFCLANHPDEQ (0) 74595

74648 ARVYREQKDIFGDDFKRAVTFQDLKKMKYLEYVIKETLRLYPVGPFFSRELDKDVPFAG 74824

74825 KVLPKGLTITLFIYAMHRNPEYFPDPEKFNPSRFETFDGKMPFAFVPFGAGPRNCL (1) 74996

75039 GQKFAMLEMLSVVSRVVRTYKILPSIPRHEINVAAQVVLISTNGMRMRFEKR 75194

 

Seq 17 CYP4Q1

 

>CYP4Q1 seq 17, XP_971238.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) [Tribolium castaneum] 69% to CYP4Q2 seq 16, 63% to 4Q7 seq 7v1

MLLSTTLVCAIGLLGVFHLLAWIKFHASNYMKMCVIPGPPQKGILIGNMTYLQTTPEKIFLRLREATKNF

YPIYKLNALHKCAANILNPEDCELIMSNSAHNQKGQIYDLLRNWLKDGLLTSFGAKWQTRRKILTPAFHF

SILQQFVQIFNEEAEILVEDLKKDCSKSYISISSHITKFTLKTIAETAMGSKLKFETQKEIDYYQAVYDV

GKILLYRLTHPWFIFHYVNFFSPWYLQEVKVTKTLHNFTREVIKHREENFKDIELPTEEHEVYKGKKRLA

MLDLLLSAKHKEGIVENDGIQEEVDTFMFKGHDTTSAALCFALMLIASHSEVQESIVAEMREVLGDLSKK

PSYNDLQNLKYLERCIKETLRLYPSVHFISRTLGQDLITTGGYTLPKESNAIIHIYDVHHNADIYPDPEK

FDPDRFLPENVQKRHPYAYLPFSAGPRNCIGQRFAMLELKTAICAILANFTLQPIDTPETIILVVDIILR

TKEPIKIKFVPRS

 

>gi|8453181|gb|AAF75272.1|AF264720_1 putative cytochrome P450 monooxigenase CYP4Q1 [Tribolium castaneum] 3aa diffs to XP_971238 seq 17

TSAALCFALMLIARHSEVQESIVAEMREVLGDLSKKPSYNDLQNLKYLERCIKETLRLYPSVHFISRTLG

QDLITTGGYTLPKESNAIIHIYDVHRNADIYPDPEKLDPDRFLPENVQKRHPYAYL

 

Seq 16 CYP4Q2

 

>CYP4Q2 seq 16, XP_971175.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) [Tribolium castaneum] 69% to XP_971238 seq 17

MFASTLILTTIFAIVSVLAFKRIKYHVKNYILLNKLPGPPPDGLFVGNMPYLQTTPEDIFNRLREANKKF

YPIYKLFAVHRMGANILSPEDSEIVLSNPIHNEKGYIYKLLHHWLKEGLLTSKGEKWQLRRKILTPAFHF

NILQQFIMILNEEAEKLVEGLRKECHKPYINITPHISQFTLKSITETAMGTKLDFTTKKEIRYKEAVYKI

GKILTYRITHPWFIEPLLNIFSPCFIQERRVTSTLHKFTKEVIEDREKNFKDFELPTEEHDVYKGKKRLA

MLDLLLSAKKKDGIIDNKGIQEEVDTFMFEGHDTTAVALNFALMLIACHKDVQETILQEMRDVLGDIHAK

PTYSDLQNLKYLERCIKESLRLYPSVHLISRALGEDVRTQKGYLIPKDTITIIHIYDLHHNPDIYPDPEK

FDPDRFLPENCQNRHPFAYLPFSAGPRNCIGQRFAMLELKAAICAILANFVLEPIDTPETIVVVVDIVLR

TKEGIKIRFVPREQ

 

>gi|8453183|gb|AAF75273.1|AF264721_1 putative cytochrome P450 monooxigenase CYP4Q2 [Tribolium castaneum] 3 aa diffs to XP_971175 at end

TAVALNFALMLIACHKDVQETILQEMRDVLGDIHAKPTYSDLQNLKYLERCIKESLRLYPSVHLISRALG

EDVRTQKGYLIPKDTITIIHIYDLHHNPDIYPDPEKFDPDRFLPENVQKRHPYAYL

 

Seq 6 CYP4Q3

 

>CYP4Q3 seq 6, XP_971112.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) [Tribolium castaneum] 66% to 4Q7 seq 7v1, 66% to AAP94192 seq 7v2

(shortened N-term)

MLLSSSVLFVISFFLVLYFFKKLKCVSAKLYNLGKLDGPSNHNIIIGNVLRLH

AAPEVIFKKLRQWARDYYPVYQLRAIHIPAACILAPEDFEAILSNPRHIEKSMVYLLLHDWLGTGLLTSG

GQKWATRRKILTPAFHFSILQQFITIFNEETDKLVDTFKQQCDQPIEITSHITQFTLKTIGETAMGTKFE

FTTRKQIEYKQAILEIGEILLYRLLNSWLISDYLNFFSPHRLREKRLVKTLHTFTRDVITEREKTFEKFQ

LPTEEHDVYIGKKRLAMLDLLLTAKNEERTIDEDGIREEVDTFMFEGHDTTSAALSFALMLLANHKNVQD

QIVDEMVTVLGDLHQKPTYNNLQEMKYLERAIKESLRLYPSVHFISRKLGEDFVTCNGLKLPKSTITHLH

IYDLHHNPDIYPDPEKFDPERFRPENSQKRHPFAYLPFSAGPRNCIGQKFAMLELKAAICGILANFILEP

VDTPESIVLVVDLVLRTKNGIKIGFIPRVK

 

>gi|8453192|gb|AAF75277.1|AF265213_1 putative cytochrome P450 monooxigenase CYP4Q3 [Tribolium castaneum]

TSAALSFALMLLANHKNVQVGDLVQKIAQKLQVLFQDQIVDEMVTVLGDLHRKPTYNNLQEMKYLERAIK

ESLRLYPSVHFISRKLGEDFVTCNGLKLPKSTITHLHIYDLHHNPDIYPDPEKFDPERFRPENSQKRHPF

AYL

 

Seq 4 CYP4Q4

 

>CYP4Q4 seq 4, AAP94193.1| cytochrome P450 monooxygenase [Tribolium castaneum]

98% to AF251548_1 (7 aa diffs) 4Q4, 57% to XP_971423 seq 5

MFLAPIILCLVLLALLVSSLRKKGRFWECLAPIPQPPAYPIIGNLFDIMRTPEQMFLADRERGLKYYPIY

KLDVCGTGGVNLLNPEDVELVLTDTKQNTKSFIYHFLHSWLGTGLLTSRGPKWQNRRKILTPAFHFNILQ

EFIQIFNEETKRLVEDLEAESHKPYIDVVVPITQFTLLSIGETAMGIKLNASDNDKDGYKRAVYKIGQLL

TYRAPRPWIHNETIYSLTPQGRKEQKVLKSLHSFSNNVIAERKKHFSSSSYSSRKRLAMLDLLLKYKSEG

ANIDDEGIREEVDTFMFEGHDTTSVSICYTLMLLANHREVQEEILKEMEAVLDEEPPTYAKLQELKFMDR

VIKESLRLYPSVPFISRVSGSEIQTKTGYTIPKDCMVNLQIYDMHHNPNVFPDPEKFDPDRFLPENIQKR

HPFAYIPFSAGSRNCIGQKFAMLEIKTVLCGILKKFILEAVDTRKDMAFVSDLVLRPKGSIKVKFVPRRA

N

 

>gi|7804914|gb|AAF70178.1|AF251548_1 cytochrome P450 monooxigenase CYP4Q4 [Tribolium castaneum]

MFLAPIILCLVLLALLVSSLRKKGRFWECLAPIPQPPAYPIIGNLFDIMRTPEQLFLAERERGLKYYPIY

KLDVCGNGGVNLLNPEDVELVLTDTKQNTKSFIYHFLHSWLGTGLLTSAGPKWQNRRKILTPAFHFNILQ

EFIQIFNEETKRLVEDLEAECHKPYIDVVVPITQFTLLSIGETAMGIKLNASDNDKDGYKRAVYKIGQLL

TYRAPRPWIYNETIYSLTPQGRKEQKVLKSLHSFSNNVIAERKKHFSSSSYSSRKRLAMLDLLLKYKSEG

ANIDDEGIREEVDTFMFEGHDTTSVSICYTLMLLANHREVQEEILKEMEAVLDEEPPTYAKLQELKFMDR

VIKESLRLYPSVPFISRVSGSEIQTKTGYTIPKDCMVNLQIYDMHHNPNVFPDPEKFDPDRFLPENIQKR

HPFAYIPFSAGSRNCIGQKFAMLEIKTVLCGILKKFILEAVDTRKDMAFVSDLVLRPKGSIKVKFVPRCA

N

 

>gi|86515410|ref|NP_001034529.1| cytochrome P450 monooxygenase CYP4Q4 [Tribolium castaneum]

MFLAPIILCLVLLALLVSSLRKKGRFWECLAPIPQPPAYPIIGNLFDIMRTPEQLFLAERERGLKYYPIY

KLDVCGNGGVNLLNPEDVELVLTDTKQNTKSFIYHFLHSWLGTGLLTSAGPKWQNRRKILTPAFHFNILQ

EFIQIFNEETKRLVEDLEAECHKPYIDVVVPITQFTLLSIGETAMGIKLNASDNDKDGYKRAVYKIGQLL

TYRAPRPWIYNETIYSLTPQGRKEQKVLKSLHSFSNNVIAERKKHFSSSSYSSRKRLAMLDLLLKYKSEG

ANIDDEGIREEVDTFMFEGHDTTSVSICYTLMLLANHREVQEEILKEMEAVLDEEPPTYAKLQELKFMDR

VIKESLRLYPSVPFISRVSGSEIQTKTGYTIPKDCMVNLQIYDMHHNPNVFPDPEKFDPDRFLPENIQKR

HPFAYIPFSAGSRNCIGQKFAMLEIKTVLCGILKKFILEAVDTRKDMAFVSDLVLRPKGSIKVKFVPRCA

N

 

Seq 5 CYP4Q5

 

>CYP4Q5 seq 5, XP_971423.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) [Tribolium castaneum] 57% to AAP94193 seq 4, 51% to XP_971112 seq 6

MIQSTLLLIFIVILSVIIYIWWYQNFSRFFSLLNKVPGPPGYPIIGNIIQFLATPEELFKIDRELGRRFY

PIYKEWTLTYGAVNLLHPDDIELVLSNSKYNDKSAIYDFLHCWLGTGLLTSSGTKWQTRRKVLTPAFHFN

ILQQFLPIFNEETVKLIKNIKNDQPIDVIPPVTQFTLLSIAETSMGVKLDASPKSCDDYKNAIHVFGYAL

TYRLGRPWLHNPFVFFNLTRLGHLTKKSIKILHDFSRNVIEQKKRTFEGEKRGKRLAMLDLLLLAKHQGA

DIDDEGIAEEVDTFMFEGHDTTSIAICYTLLLLANHPDIQDELYSELKSVLSDPTQTPSYSDLKQLNLME

RCIKESLRIFPSVPFISRLLTEDLTTASGYVIPRGSMAHIHIYDLHNNPEIYPDPKKFDPDRFLPENCQK

RHPFAYLPFSAGPRNCIGQKFAMLELKVVLSGILGNFVLEAVDKPKDVTMITDLVLRCKGPIRVKFVPRY

KIN

 

Seq 18 CYP4Q6

 

>gi|8453178|gb|AAF75271.1|AF264718_1 putative cytochrome P450 monooxigenase CYP4Q6 [Tribolium castaneum] 5 aa diffs to XP_970404

TSMAISFILLTLANLQDIQTKVREEILSVVGKEKIPTYNDLQELKYTKRCIKETLRLFPSVPFISRYASE

DFVTKTGNTIPEGTVLHIHIFDLHRNAEIYPDLLKFDPDRFLPDKVNERHPFAYI

 

>CYP4Q6 seq 18, XP_970404.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) [Tribolium castaneum], probably the seq seq as the 4Q6 fragment

54% to 4Q4 seq 4, 55% to XP_971423 seq 5

AAJJ01002630.1

MLSFYLLLTGVGLILLLQTWRFFRKYFKNKTILKKIRGPPETPIFGHMYIFTQDP (1)

DLLFSRIRKYSREYYPIFRFSALYVDIVNFLEPNDIELILSTTKHLSKSKIYTFLNNWLGTG

LLTSTGAKWHQRRKILTPAFHFNILQQFLNIFNDETEKLVLRLGEDCGRTIDVVPPVTNFTLQSIAETAM

GLSNINELTQKEYKKAIYKIGHIFLKRLSKPWYRLDAIYNYSKLAEEENATVKILHDFSNGIISEREKER

TTNLSQNLASYSKKKRMAMLDLLLAAKNEGADIDYEGIREEVDTFMFEGHDTTSMAISFILLTLANLQDV

QTKVREEILSVVGKEKIPTYNDLQELKYTERCIKETLRLFPSVPFISRYASEDFVTKTGYTIPEGTVLHI

HIFDLHRNAEIYPDPLKFDPDRFLPEKVNERHPFAYIPFSAGPRNCIGQKFAFLELKTVLCGILRKFKLE

KVDDMYEIEFRPDLVLRPKNDVKVRIEKL

 

Seq 7v1 CYP4Q7

 

>CYP4Q7 seq 7v1, AAF70496.1|AF254755_1 cytochrome P450 monooxigenase CYP4Q7 [Tribolium castaneum] 99% to AAP94192 3 aa diffs) seq 7v2, 66% to XP_971112 seq 6

MLVLTTVLTAAAVFLLFYLFYCYKTIKQHIYSLISLSYLPGPPVNDIISGNILPLYTSAENIFKQLREWG

RLYYPIYKLNAAHLAAANILSPEDCELVLSNPTHMEKSAIYNLLHDWLGTGLLTSTGLKWQTRRKILTPA

FHFSILQQFVAIFNEETDKLVEVLKEECYKPFINVNAHVAQFTLKTIAETAMGTKLRFTTRKETIYKQSI

VDMGEFLLYRLLRCWLISKCIYVFNPRYYLEKKVTRRLHRFTKSVIAERQENFKEIVVPETDEVYTGKRR

LAMLDLLLTAKNKEGLIDDEGIREEVDTFMFEGHDTTAAALGFALMVLAGHKEVQDKIVEEMNEVLGDIK

KKPTYQDLQEMKYLERCVKEVLRLYPSVHFISRKLGEDLVTHSGHKLAKGSIVNLHIYDLHHNPAIYPDP

EKFDPDRFLPENCQKRHPFAYLPFSAGPRNCIGKKFAMLELKAAICGILANFTLEPIDIPETIVLVVDIV

LRTKEGIKVRFIPRV

 

>gi|86515404|ref|NP_001034530.1| cytochrome P450 monooxigenase CYP4Q7 [Tribolium castaneum]

MLVLTTVLTAAAVFLLFYLFYCYKTIKQHIYSLISLSYLPGPPVNDIISGNILPLYTSAENIFKQLREWG

RLYYPIYKLNAAHLAAANILSPEDCELVLSNPTHMEKSAIYNLLHDWLGTGLLTSTGLKWQTRRKILTPA

FHFSILQQFVAIFNEETDKLVEVLKEECYKPFINVNAHVAQFTLKTIAETAMGTKLRFTTRKETIYKQSI

VDMGEFLLYRLLRCWLISKCIYVFNPRYYLEKKVTRRLHRFTKSVIAERQENFKEIVVPETDEVYTGKRR

LAMLDLLLTAKNKEGLIDDEGIREEVDTFMFEGHDTTAAALGFALMVLAGHKEVQDKIVEEMNEVLGDIK

KKPTYQDLQEMKYLERCVKEVLRLYPSVHFISRKLGEDLVTHSGHKLAKGSIVNLHIYDLHHNPAIYPDP

EKFDPDRFLPENCQKRHPFAYLPFSAGPRNCIGKKFAMLELKAAICGILANFTLEPIDIPETIVLVVDIV

LRTKEGIKVRFIPRV

 

Seq 7v2

 

>gi|33113212|gb|AAP94192.1| cytochrome P450 monooxygenase [Tribolium castaneum]

99% to AAF70496 (3 aa  diffs) seq 7v1, 66% to XP_971112 seq 6

MLVLTTVLTAAAVFLLFYLFYCYKTIKQHIYSLISLSYLPGPPVNDIISGNIPPLYTSAENIFKQLREWG

RLYYPIYKLNAAHLAAANILSPEDCELVLSNPTHMEKSAIYNLLHDWLGTGLLTSTGLKWQTRRKILTPA

FHFSILQQFVAIFNEETDKLVEVLKEECYKPFVNVNAHVAQFTLKTIA ETAMGTKLRFTTRKETIYKQSI

VDMGEFLLYRLLRCWLISKCIYVFN PRYYLEKKVTRRLHRFTKSVIAERQENFKEIVVPETDEVYTGKRR

LAMLDLLLTAKNKEGLIDDEGIREEVDTFMFEGHDTTAAALGFALMVLAGHKEVQDKIVEEMNEVLGDIK

KKPTYQDLQEMKYLERCVKEVLRLYPSVHFISRKLGEDLVTHSGHKLAKASIVNLHIYDLHHNPAIYPDP

EKFDPDRFLPENCQKRHPFAYLPFSAGPRNCIGKKFAMLELKAAICGILANFTLEPIDIPETIVLVVDIV

LRTKEGIKVRFIPRV

 

Seq 19 CYP4Q8

 

>CYP4Q8 seq 19, XP_970987.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) [Tribolium castaneum] 68% to AF254755_1 seq 7v1 (partial), this seq short

AAJJ01001877.1 N-term only runs off this contig

AAJJ01002307.1 C-term part, missing ETAM exon

MVLENIIIGLAAATAICYLFKQLIEMALVIFFVQKMPGPRKFNLFYGNMRPLHSSPAEIFNVLRKWGLEY

YPIYKLWLFFVSVANIMSPEDLALILPDMKHSKKSIAYDLIHRWLGSGLLTSYGTHWQVRRKILTPAFHF

SILQDFILTFNESTEELVELLKKEVEKPFVEITPLITXXXXXXXX

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

PKFYEERKLIKLLHNFTNDIIAKRRKDFHQGIVASQ

KKKRLAMLDLLLTVQKEEGIIDDEGIREEVDTFMFEGHDTVSSAINFALMVLANHPTVQEEIVQEMKDVL

GDTKKKPVYNDLQELKYMERVIKEVLRLYPSVHYISRELGEDMVTTTGYKLRKGTILQLHIYDLHYNPVI

YPEPEKFDPDRFLPENCDKRHPYAYIPFSAGPRNCIGQRFAMLELKAVLCGILSNFTLQPVDTPESIVMV

EDIVLRTKENIKVKFVPREM

 

>gi|8248469|gb|AAF74207.1|AF263515_1 cytochrome P450 monooxygenase [Tribolium castaneum] CYP4Q8

VSSAINFALMVLANHPTVQEEIVQEMKDVLGDTKKKPVYNDLQELKYMERVIKEVLRLYPSVHYISRELG

EDMVTTTGYKLRKGTILQLHIYDLHYNPVIYPEPEKFDPDRFLPENCDKRHPYAYI

 

Seq 15 CYP4Q9P

 

>CYP4Q9P seq 15, AAG17640.1|AF265297_2 putative cytochrome P450 monooxigenase [Tribolium castaneum] 66% to AF254755_1 seq 7v1

AAJJ01002307.1 6 P450s on this contig, 60% to 4Q7

Some frameshifts and a bad boundary, probable pseudogene

MIILLIIVALVLALFLKPLGHYISIIKYVQQLPGPPCENFLHGNITHLYGPP (1)

EKMFKTVRKWGLEYYPIYQNWIAHVAVANVMNPYDFEV (1?)

ILSNMKH TSKSMIYDMLHCWLGTGLLTSDGIKWQTRRKILTPAFHFNILQEFIKIFNEETETLVQQL

KKHSNSSVDVTEYISAFTLNTIG (1)

ETAMGTSFGTETSTGREYKKSIQEIGEILKYKLLRPWLLSKFVYVCDPNYWKEIKLVKIL

HNFTNNVIANRQSNFKPVEQKSDEFSYSRRKRMAMLDLLLTAKNEDNLIDDEGIREEVD

TFMFEGHDT

2269 TAVAICFALMCIACHPDIQ (0)

ERIFEEIEETFSDDTKPDYKSLQELKYMERCIKEVLRLYPSVPFIARSLGE

DIVTYSGHKLKAGSMVHLHIYDMHHNPQVYPDPEKFDPDRFLPENCLKRHNFAYVFP 2694

SAGPRNCIGQKFAILEMKAVLVGILKEFTLEPVD

VDTPETLVMKTDLVLRAMNGVRVKFVPRICAK*

 

Seq 11

 

>CYP4BN1 seq 11, XP_971854.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) [Tribolium castaneum] 66% to XP_971963 seq 12, 48% to 4AW1, 48% to 4BH1

MGALALVVFAVTTLLFLIWFIRLVRKNNDYYKDIPGPRPLFFFGNVFEVSTTRDILNVMHKYALQFNGLY

KIHLGPVRKLIIASDYKFLECVLSSMKILNKSEDYLYLRPWLGTGLLTSDGPKWKKHRKIITPAFHFQIL

EQFVEVFESGGNRFVQQLQKEVGKKSVDIYPYVTLCTLDIICESAMGISINAQFDDNSDYVRSVKAMCRI

TMERLFHLLEMNDVTYPLTKNYYTQKKSLNVLHNQTNSVINRRRKELENKTEAINVTNEDKADNNDTLFG

RNKKAFLDLLLQATVDGRPLTQEEIREEVDTFMFEGHDTTASAISFAIYCLANNADVQAKAYEEQIALFG

GNKSPAVTYSDLQSMKYLELVIKETLRLYPSVPMFARKTSEPVQYENIFIPEGVTVNIFAYGIHRDPKYF

KDPEKFDPSRFETVDGKLPYAYIPFSAGPRNCIGQKFAMLEMKSTISKVLRNFELQPATPTHTVQLAAES

VLKSANGVKIALKNRN

 

Seq 12

 

>CYP4BN4 seq 12, XP_971963.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) [Tribolium castaneum] 66% to XP_971854 seq 11, 52% to 4AW1, 51% to 4BD1

MCCCFPLALAALHWPRDARVDDCRLCYPMPMRDAGQQLLQHQKLSGTLRMDTQAAAKTPTLALRHDAMQS

FNRPTFYLVLDIMMKYMKIYGGVVKFHGGPIDKTLLVSDYNFLENVLSSTKILNKTDDYKFLHSWLGTGL

LTSAGPKWKKHRRILTPAFHFKILEQFIDVFESAGNKLVKKLEKVVGKDSVDIYPFVTLCTLDIICETAM

GIKINAQDNGESEYVRSVKQMCKIIIERSFSLLQMINLTYPLTKNFYIEKNALKILHQQTNSVINQRRQE

LKNQSKNIEQENDLGTKTRKAFLDLILEATVDGRPLTDTEIREEVDTFMFEGHDTTASAISFALFCLATH

PEVQARALEEQKALFGDTKNPTPTYTDLQNMKYLEQVIKEALRLYPSVPFHGRKTNEAVEFNNGTVVPKD

VTITVFTYGIHRNPEYFKDPEKFDPSRFDTIDGKLPYSFIPFSAGPRNCIGQKFAMLELKSTLSKVVRKF

ELRPATPEHKLQLTAETVLKSVNGIKISLKLRQ

 

Seq 14

 

>CYP4BR3 seq 14, XP_967724.1| PREDICTED: similar to Cytochrome P450 4d2 (CYPIVD2) [Tribolium castaneum] 53% to XP_966411 seq 13

MFVVAFFVTLTVILCTPLIWWYLTLAKYSSLKKVPGPPPLPVIGNSNVIGKTTVDLLHSFMNLQDKYGTV

VKVWLGPRLHLLITKPEMVEFFLNSTVHLNKSDGYDLFKPWLGDGLLVSTGSKWKTRRKLITPTFHFKIL

ENFLETSFNKQINILLDVLLKEASQTDKSIEIHSLINLCSLDIICETAFGTELNAQAKCNPKYVEAVTGF

LEIFTLRFFSAWLRHPLIFRLSDKYAKYMEYLKILHDFTNTIIKRRKEEFKLLQDNAKISEEGIKRRAAL

LDMLLEVSDNGKNLTDEDIREEVDTFMFEGHDTTTTSICFVLYAIAQNPDVQKKIYDELVSVLGPDCKKE

ITFSDIQELKYLDVVIKEAHRLYPPVPLIERSLEEDCTIDGLTIPKNTNISIFLYGMNYNKDVYPEPHVF

DPDRFLPEKQGERHTFAYVPFSAGPRNCIGQKFALLELKTTIAKLLRCFEISPDPKNPPQVGMCSVLKSR

NGIHMFLKKKN

 

Seq 137

 

>CYP4BR2P seq 137 AAJJ01002884 pseudogene between 4H10 = 4BR1 name change, 4BR3

 9437 SGKKWKTRRKMITPTFHFKILDQFIEVFNSCGNVLVEKLSSHVGKESVDVYPFINLCS 9610

 9699 TKRNGIKRKVAXXX

 9737 MLLESEHNNVLSNEDIREEIDNFMIRG

 9823 HDTTAFGIAFAILALADN

 9876 PKVQDKVYGEILSVIGDYEDVTMQ*LQDSRYLEMVIKEA 9992

      GGYDFPKDTAFSTFXXXXXXXXXX 10083

10082 FPNPEKFDPNIFLPENQS 10135

 

Seq 62

 

>CYP4BN5 seq 62, XP_967939.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) [Tribolium castaneum] 72% to XP_971905 seq 63 AAJJ01001774.1

MITIVIILIFILVSINFITKYLKKLKQNKDFYQNIRGPRGLPILGSALDFKTTK (1)

DVLQNLINYTRDYGEVVTAQIGPFHRYILVSNYDFLECVLSSTKLSSKSHNYNFLRPWLGTGLLTSD (1)

GAKWKTHRRILTPAFHFQILEQFIEVFEKCGNTLLEKLRNEVDKETCDIYPYVTMCTLDIICESIM

GISINAQEDSTSDYVQSVKNVCRIMVERSISPLQMCPFMYPLTKNYWTEKKSLKILHKQTNDVINARRKE

LESSKEVSSYEENFTKKKKPFLDLLLETKIDNRLLTQEEIREEVDTFMFEGHDTTASAVSFTLFCLANNL

ESQQKAFEEQQAIFGNIQNVTASYTDLQNMKYLEQVIKEALRLYPSVPFYGREITENVEYDGKLLPKGDI

LLIFAFGIHRNEKYFPNPEKFDPDRFHNMDNKTPYAYIPFSAGPRNCIGQKFAMLEMKSTVSKVLRQYKL

LPTTPQHELELVGETILKSTNGIKIRVTLRN

 

Seq 63

 

>CYP4BN2 seq 63, XP_971905.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) [Tribolium castaneum] 72% to XP_967939 seq 62 AAJJ01000053.1

MILPILLCLIFSFLIWSLYQTCKKNSFYKNIPGPSGVPIFGIAFEFKSTQ (1)

DVLINLTSYIKTYGDIVTAKIGPFR

86921 RYLLVSDYNFLECVLSSTKLIKKSHHYTFFQGWLGTGLLTAD (1)

GAKWKTHRRILTPAFHFQILEQ 86682

FIEVFEKCGDVLVKKFENEVGRKSFDIYPYVTLHTLDVICESIMGISVNAQNNSTSEYVNSVKNICKIFV

ERSVSPLQMCRFMYPFTKNYWAEQKALKILHQHTNSVIDARRKELHKAENGHNTNPKKSKKPFLDLLLET

KIDGIPLTQEEIREEVDTFMFEGHDTTASAISFTLYSLANNLHVQEKAVDEQKKIFGERKDVTAAYADLQ

NMKYLENIIKESLRLYPSVPFYNREITDDIMFDNKLLPKGDTIMVFAFAIHRNAKYFDNPEQFNPDRFND

LENKLPYAYIPFSAGPRNCIGQKFAMLEMKSTISKILRKYKLLPADPQHELNLVSELILKSSNGIKISIE

PRC

 

Seq 64

 

>CYP349A3P seq 64, XP_968399.1| PREDICTED: similar to Probable cytochrome P450 4ac1 (CYPIVAC1) [Tribolium castaneum] very similar to XP_973195

AAJJ01001569.1 pseudogene

KCDKGEIDHYKFVTNFAVDVV 15027

15074 SETIFEVPLNGQITNANYSRTFDKIMEVVFMRIFRVDYHS 15193

15192 LFSWTKEYKAEQENVKLVKETTRDLIERKKEQITCQLEVE (1)

15360 EEKKRPFLDVLVEKYLNEELSYQELEDEVNTFLLA

VIFCNVF

GSDTNATAGCFVLTLLGMHQDVQ 15554

16828 DKHYEEIIKVIGPEKSPTLDDLPKL

 

 

Seq 65

 

>CYP349A2 seq 65, XP_973195.1| PREDICTED: similar to cytochrome P450, family 4, subfamily v, polypeptide 2 [Tribolium castaneum] N-TERM OFF THE END

AAJJ01007805.1 (1302-549), POSSIBLE AT BOUNDARY INSTEAD OF AG AT SETI

AAJJ01008257.1 (293-855)

AAJJ01008667.1(517-1079)

68% TO XP_973153 SEQ 66

1302 (1) VKIWKKHRRIIVPTLNQSILNTFPQIICQQCDILLEILEK

     KCDKGEIDHYKFVTNFAVDVV (1) 1120

1073 SETIFGVPLNAQITDANYSRTFDKIMEVVFMRIFRVDYHS

     DFLFSWTKEYKAEQENVKLVKETTRDLIERKKEQITCQLEVE (1)

     EEKKRPFLDVLVGKYLNEELSYQELEDEVSTFLLA (0) 675

617  GSDTNATAGCFVLTLLGMHQDVQ 549

 

293  EKLYEEIIEVLGPEKYPTLDDLPKLKYTERVIKETLRLFPGAPFIARIASDDID

     LGDYVIPRGSNIAVGYVHLHRSEKYWEEPLKFNPERFLPENVAKRHPYTWLPFSGGLRNCV (1) 637

697  GGKFGMMVMKIMISMIIRKFRVKSSVKSVGDIELTANIVLKPKNGFRLAFTLR 855

 

Seq 66

 

>CYP349A1 seq 66, XP_973153.1| PREDICTED: similar to Cytochrome P450 4g15 (CYPIVG15) [Tribolium castaneum] 60% to XP_973195

MFLLLVFLSLCFIWCLQFHWKRFRLYKLSRKIPGPLNLPLIGCAHLFFTGNAAEIAKRFMQMFDDYPDLA

KAWMGPELYYLITKPEYLEVVLNHNATLEKMDLYKFIRPIVGDGLISSP VKVWKRHRKIIAPTFNQKVLN

EFPGVICEQVNFLIELLRKECDKGEIDHCRYVTNCAIDIVGETIFGVSIGAQTGGKSYSLIFDKWMEVVF

MRIFRLDYQFEWIFSWTKASKIQEEVKRIIHTMTRDIIEKKKEQIGCQLEADDEKKKPFLNLLVEKHLNN

ELTLQELEDEVNTFLLAGSDTNATSGSFILTLLGMHQDVQDKLYEEVSKILGPERPPTLDDLPKLKYTER

VIKESLRVFPGAPFVARVVEEDVNLGDVIVPKGANIGLGYLHLHRSEKYWKEPLKFDPDRFLPENSINRH

PYTWLPFSGGSRNCIGWKYGMMVMKIMTAMVIRKFRVKSSIKSIGDIELTANVVLKPKNGFRLAFEMR

 

Seq 106

 

>CYP351C1 seq 106, XP_969850.1| PREDICTED: similar to Cytochrome P450 4g1 (CYPIVG1) [Tribolium castaneum] 43% to XP_973698 seq 94, MODEL TOO LONG REVISED

AAJJ01003994.1

MFVVSAFLVGIVVLLLLRKRVTLWYYSAKLPGPFGLPFLGSLHLLVKGPKEIHQTLANIYKSYPKVVKIW

FGPWLYVSTTEPSDLKVILTHHLDKGEFYELMSEYFRRALAAAPVDLWKKHRKNINPTFNTTILNTFIGA

FAKQAEILVKNLEKYQSDEDIFPIVWKCTLDSACETLADVDPIFIDTEACLRRVFRIEEILLERFFNPLC

HLNILWKFSPLRKELAVLWKQNSTFITQMIDIMKQSDNLDKKRFLNHLIPSHDLNYTIEEAQIMFFVGTE

TSGVAISSVLLILGMFPQIQEKIFIEIDQVFGSTTGSTLDEINHLDYLERVIKETLRLLPPIPFVMRSLD

ENLKLSCGTFPAGSRVIVPIMMVHRREDFWPEPLKFDPDRFLEERPSGTYIPFSYGTRNCL (1)

5448  GYKYAMLSMKVILATILRKYRVKSSNYKSIDEVVLLIHIIAKATNGYKIVLEKRNK*

 

Seq 129

 

>CYP352A1 seq 129, XP_970947.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) [Tribolium castaneum] 35% to XP_973423 seq 9

MLFLLLVILIICCLVKYHWDRRKLYLFAAKLQGPKAYPVVGNGPLFWCKNEEIFNNFMAATAPYPSPVRL

WVGPKLVLFVKDPNQLQLILQSSKITTKSFLYRFLEPFLGKGLFTSSGPRQKHHRKLLQPLFSQRMIEGY

CHLFQKHSKKFVEDLRKNANGPEFNISTFLQFTAFEATMDLLLEDQDTHSIDYNEIPNYVRKFYEIVFTR

VKSFWLHLDIFFKLSSYYREQTKLQSLATTVINEITETNVPKIIEKIKAERKLADAEIRVPSMLESIAEM

VMENPDCLTMQDCTDHLMTFMATSQDTQSSAVAFTCMMLGAYPHIQDLVVQELREVMGKKTSLDLTDVSQ

LKYLEMCLKESMRLFPVGPFIFRDTTEDFQFDKMVIPEGVTVILSIYHAHRSPEHWEKPDEFYPEHFAPE

AMSKRHPCAFIPFSAGPRRCIAQHYSYTYMKILLATIVLNYEIECRFKAEDVKLIADISIRPQQGYLIKL

KDRTN

 

Seq 130

 

>CYP352A2 seq 130, XP_970893.1| PREDICTED: similar to CYtochrome P450 family member (cyp-31A3) [Tribolium castaneum] 63% to XP_970947 seq 129

AAJJ01004849.1 runs off the end of the contig

5530 MSEVLSNKTCVTLDELSKLNYLDMCLKESMRLFPVAPFIFRDTTEEFQLENLTIPGNVTLALSIYHAHRD

RNFWEKPDDFYPEHFAPEAVKNRHPFAFLPFSAGPRKCIAQQYSTTYMKIQLCTILQNYEIQCQYNTKNI

KLTTDISVRPVQGYMLKIRKRRV 5042

 

Seq 83

 

>CYP350C1 seq 83, XP_967642.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) [Tribolium castaneum] 40% to XP_968884 seq 84

MQSTTILVALSAFTAFIYFLAEYFSKKQRLLRFHAAKLQGPPALPLIGSAYYLFGSNKSIVNNVIHLVKK

YKSPWKIWLGRQLYIVVTEPEDIEVVLNKALEKAENYNFLACLLQEGLFTGPVEKWKRHRKVILSTFSMP

ILKSFVEIFSENSLRMLPKLDKFVGKGTFDVCPILTNTALEITCETAMGTKIYEQAHSDYAYNLSKALEL

VFMRMFQYWLHPNFIWSLSIYSKQLKQLSKQLEIFVQGIVTEKKVQYRDKKHDLCLETKRRKCFIDHLIE

MSEDDNWHDHELLEEAQTMVAAGSESLGSVKSFTLIMLGMHPLIQDKVYNEMYNIFGPSDRTVTPDDLTE

MTYLDMVIKETLRLFPVTAAVGRRVSQDIVTDRYTLPEGCECIVSILSAHRNPKIWPKPLDFNPDRFLPE

EVAKRHPYSYLPFSNGPRNCIGFKYAMMAIKTVISTIVRRYKISTEFKSVPEIEFSPGVVLKSRKGYRTQ

LESRC

 

Seq 120

 

>CYP350B1 seq 120, XP_968812.1| PREDICTED: similar to Probable cytochrome P450 4ac1 (CYPIVAC1) [Tribolium castaneum] 42% to XP_968884 seq 84

AAJJ01000155.1 (also on this contig is XP_968884)

MSISLLFYVFVCFLLILLWQKKRLLYYSWNIDGPLSIPLFGNPFVIFGGKY (1)

YVLNNMSLYSRKYKPICKFWVLGQLI

FWVSHPKYVEIILNKCLEKERSYKYLEVVLGRGLFTIP (1)

ANKWKKRRQVIESILDDDLIDSFAQIFKDYSDILLKKLGKFEGQYVDVMPIMTQFSLDIMF (1)

STILGTKVNALDEDTKIVIGVKD (2)

LIESIIKRLSNIMLRPNLFWKLLYLSQKSEELDRRIDHYFRTVLFQQK (2)

CKSTTGGKVFLDFLLNQTDENWTDDELLAETRTLIIAGTDAIATATSFCLVMLAMHPEIQ (0)

63877 DRLYNETGTAYLECVIKETLRLFPTYSFIGRELDEDVVL (1)

63717 GRYTLPKGSSVVVPLLDVQRSQKYWPQALEFKPDRFLPPKRGYFPFSVGPRNCL (1)

GREFALKAMKILLSNLLRTFQITETPFKSISDIKVSTNVVTRSFQGCMIKLQPR* 63346

 

Seq 84

 

>CYP350A1 seq 84, XP_968884.1| PREDICTED: similar to Cytochrome P450 4g1 (CYPIVG1) [Tribolium castaneum] 40% to XP_967642 seq 83 deleted small intron after LCS

MYFVTPGLIFTVIALWLLWSFLWKNFFATKIKGPWAFPLIGSAYVLFGGTHNILENTVRVVSKYRPLCKL

WLGNKLTIFPSNPDDIQMILNRSLEKEEGYRYIKTVFGHGLFTSPVSEWKGHRKVIVSTLNQQVLNSFMD

TYNIYTRELIEKLKIDTKDGQHIDMFPIMTQCTLDIICSSIMGTQMNAMKEESQFIMWMTRVAELAIIRM

FNIYLWPELFWKLSPISKESHELDQKIYNYVKTVIHNKRHKGLKSHTGKKIFLDYLVELTDREGRWTDEE

LTNETRSVIMAGSDATALTLSYCLVMLAMFQDIQDKVYEELCS

YLDRFIKET

LRVFPVTSMIGRELTTDMTIDGHFIPKGTSIGFPILYIHRNPEYYPDPLKFDPDRFLPEEVAKRHPCTFI

PFSFGPRNCIGYRYAMMTMKVILATLLRSFKMVHTPYKEISELKIKFDIATKVDEGYPVRMELRKNVAAG

TK

 

Seq 89

 

>CYP4BM1 seq 89, XP_966563.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) [Tribolium castaneum] poor match 42% to 4C3

MDFTYLLLFTFFTIGFVNFCKWLKDRKRIWDAIEPIGGEKWYPLIGTCLELIKTKRKDFYDVYCARNMKY

GPFFRTWMGFIPAVHVMKPDHVERILSSTVNLTKGDNYRFVVPWLGEGLITGSNHKKWRVHRKLITPTFH

FSILDNMMEVMAEKGQFLAEQLVPKANGQFFNIYPFLTLCELDIICETAMGVEVNAMKHSQSEYVRSVYG

ISDIMLYRMFHPYLHPDFVFNLSSKGRQHKKYLSILHGFTRKVIQERKEKLTSGRDVVQELSEEDKLLGK

KKRLAFLDLLLEANKNSEGGLTDEDIREEVDTFMFAGHDTSTVTVGWTLFTLSNYPEYQEKVHQELDEIF

QGEERPITPQDVLKMQYLDKVIKETQRLIPVVPVIARTLDQDLEIVASSRTIPAGVMVVIHLARLHKDPD

QFPEPDRFDPERFLPENVSKRHPYSFVPFSAGPRNCLGQKFALRNTKVLLASILRKYKVRAEKKIDEMKY

NIEIVLRPQGGLSVALEPRRR

 

Seq 94

 

>CYP351A8 seq 94, XP_973698.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) [Tribolium castaneum] 73% to XP_973664  seq 95

MQPDIDVTSALTWAISALALFFLVKYNWKRRWLYYHGSKIDGPFGWPIIGSAHYFIGGQKVFYQKMVKVF

ETQPSVFKFWLGKDLLVVTSKPEDVEIVLNNNSCFGKPKFYDFAFKLFRNGLLIAPASIWRDRRRVINPT

FNPKILNSFIEIFGKHGNKLVKVLEESCSESDIFLKLFRCTFDIACETLADVDSELIKGQDKYLQTVIRM

EDILAIRSFSIWLHPDFLWKRSFYGKEMEKASAEVFAFVKQILALKKASVTDDENYKKKRFLNHLLTTSE

TNPQIDELAILEEIQTILVTGSETTAITIGMVFIILGIYPEIQEKVRSELELILGPDDREITLEDINNLE

YLERVIKETLRVLPIVPLITRTVEQDVKLGTKTIPSGSFVLVPIASIGKKAEFWAEPKKFDPDRFLPENN

ANRPRCSFIPFSYGPRNCIGFKYGMMSLKVLLATVIRKFTFKPSQYRRIEDVRLIYGMVAKPKHGFKVKI

ERIKT

 

Seq 102

 

>CYP351A1 seq 102, XP_973429.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) [Tribolium castaneum] 59% to XP_973698 seq 94 AAJJ01001080.1

MKPEKITSALIWVLFIIVLYFLLKYNWSRRWLYYYGSKIDGPFAWPIIGSAHHFIGGQKVFYKKMTQIFE

TYPTLSKFWLGKDLIVITSRPEDVEIVLNSCFEKPKFYKYAYKLFRTGLLIAPVNIWKERRRMIGPTFNS

4548 KTLQTFTEIFGKQANRLVRVLEQECGREFDIFLKLFRCTLDTAC (1)

EALVGVDSSLLQGQDNYLQKLIR (2)

AEDIATIRSFSPWLQ 4192

VDFFWKKSPLGREMDKACAESFTFIKQILSLKKCDFKDTTNPFTNYLQHLNKSNDDSPVEDEIQNILITG

SESSALALALVLVVLGIYPEVQQKIALELDSIFGDDEREPTFEHINQMEYLECVIKETLRILPIVPIIMR

LAEQDIKLEHCTIPAGSTVLVPIVHISKKSEFWKEPNKFNPDRFLPKNNSERHRCTFLPFSYGPRNCV (1)

GFKYGLMSMKVILATVLRKFTIKPTRYQSLEDIELIYGAVAKPKHGHKIKLEKKY*

 

Seq 98

 

>CYP351A3 seq 98, XP_973499.1| PREDICTED: similar to CYtochrome P450 family member (cyp-31A3) [Tribolium castaneum] 84% to XP_973531 seq 99

MIEKIDLTSVFLTLFLAFIIKYNWDRRWLYYYGSKIDGPLGWPIFGSAHYLMGGHK (1)

VFYKNVNMLLKSYPSEVAKIWVGPTLLVSITKPEDVEIVLNKCLERPKFYEFGKEIVGSG ILTAP (1)

IDVWKSRRKMINPTFNPNILNSFVEIFGRHAFYLTNALEENCGKDSFDILPKLFRCTFDTAC

ETFGDVDSTLLHGRDEIFQNLTK (2)

AEDLVKTRGFTVWLHFEFFWNMTSLCKEYNQACNLLISIVKQ (0)

IIQLKKPSY (1)

NNNHREKRLLNHLLKLSKINAK

IDQTALEDEIQTILLTGSETTALTVGLTLIILGIYPEIQKKIGKELDVIFGKDDRVPTLEDINRMEYLER

VIKETLRFLTPVPFMLRTNNQDITLDSNTIPAGSCIMIPIFHIHKKPEYWKNPNEFDPDRFLPENSSKRP

RCAFIPFSSGPRNCIGFKYGMMSVKVLLAVILRKYTVVATEYKKVEDIEMLFYVVNKPISGCKIKLEKK

 

Seq 99

 

>CYP351A4 seq 99, XP_973531.1| PREDICTED: similar to family 4 cytochrome P450 [Tribolium castaneum] 93% to XP_973499 seq 98

MFDFIFVSLTLILAFIIKYNWDRRWLYYYGSKLDSPIGWPIIGSAHYIIGGHK (1)

VFYKNVNMLLKSYPSEVAKIWIGPTLVVSITKPEYVEIVLNKCLERPEFYEFGKQIIG

AGILTAP (1)

IDVWKSRRKMINPTFNPNILNSFVEIFGRYAFHLTNALEENCGKESFDILPKLFKCTFETAC (1)

ETLGDVNSNVLQGPEEIFENLTK (2)

AEDLITTRAFSLWLYLDFFWNMTSFCRELDKASKSIISIAKQ (0)

VIQIKKSSRNQKPSEPMIQ (1)

DNTYKEKRFVNHLLKLSETNAKLDQTALADEIQTFLLAGSETTALTVGLTLIILGIYPEIQKKIGKE

LEVIFGKDARVPTLEDINRMEYLERVIKETLRFLTPVPFMLRTNNQDITLDSNTIPAGSCIMIPIFHIHK

KPEYWKNPNEFDPDRFLPENSSKRPRCAFIPFSSGPRNCIGFKYGMMSVKVLLAVILRKYTVVATEYKKV

EDIEMLFYLVNKPISGCKIKLEKK

 

Seq 95

 

>CYP351A7 seq 95, XP_973664.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) [Tribolium castaneum] 73% to XP_973698 seq 94

AAJJ01001080.1

MKRDYIDITCALTWAFSALALVFIIKYNWSRRWLYYYGSKISGPFAWPIIGSAHHFIGGQKVFYKNMIKL

FETQPPIFKFWLGKDLIVVTSRPEDVETVLSNCFGKPKFYDYSYKLFRDGLLIAPAKIWKDRRKIINPTF

NPRILNSFLDIFNKHANRVVDVFAEGCGKESFDVFLKLFRCTLDIACETLADVDSDLIKGQDAYLQKAIR

MEDVLAIRSFSVWLHPDIVWNNSSFGKEVAKASPEVFGFIKQIIGLKKLNPVPEDEFCKKKRFVNHLLTA

SETNPHFDELAVEEETQTILITGSETTAITIGMVLIILGIYPEIQEKIMDELDLVLGPDDRTITLEDINK

MEYLERVIKETLRVLPIVPIILRSVDEDIKLDPYTIPAGSFVLVPIGHIGKKPEFWKEANKFDPDRFLPE

NNSNRHRCTFIPFSYGARNCV (1)

GFKYGMMSMKVLLAAILRKYNVKPAQYKSLEEIELIFGMVTKPKHGFKIKLEKKTKKIVNV*

 

Seq 117

 

>CYP351D1 seq 117, XP_969258.1| PREDICTED: similar to Cytochrome P450 4g15 (CYPIVG15) [Tribolium castaneum] 44% to XP_973664 seq 95

AAJJ01003014.1

MGARFSFDLKCVLLYISVLLLLVFLLKYVWNKRFLYYYGSKISGPFALPLIGSAYYFTGGAK (1)

VLYDKLWQICEKYQPLAKIWLGPHLMVIPSHPKDVEYLLHNFVSKGQLYEYITPLFGHGLLTGT (1)

VEKWKDHRKLINASFNSKILNSFIDIFVTHAKSSLDVFKE

FCGKGQVDILPVFLRINIDGIC (1)

ETAMGVKPGTLSDRYDYLDWMMR (2)

AEHLIMVRMFRPWLYPDFIWKNTNMGKEQKQLCKKSWKFIANV

QKRGEKINTLHNDLKKLSFLEYFIDLTDEQQKWCEKELIEEAQT

1535 MVFTGSGSLAITECYVLLMLAIHPEIQEKIYEELLTIFGNSDRDLCFKDLSKLCYLDRVIKETLRLFPIA

PYIARLLDSDIHM () 1287

1173 EKYVIPKGTFALIPITYLQRNSNLWSEPLRFDPDRFLPEQVATRERCVYLPFSYGSRNCI (1) 996

GLKYAEISLKATLATILRKYKVTSCIYKSVEEIEFEFTMFIKPTRGSFVQIEERIR*

 

Seq 103

 

>CYP351B1 seq 103, XP_973400.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) [Tribolium castaneum] 49% to XP_973664 seq 95 AAJJ01004605.1

first exon on AAJJ01001080.1

MKKTEFTITTILSLVILVLVFFFFIKYHWNRRWLYYHA

MKLPGPWALPILGSAHLFHGGYD (1)

DMYQAMLRLTKSQPPLFKIWLGQDLIFVTSRPEDCEIILSKCFTKGK

FATFMDPIFWEGLLTAPAIKWKSHRKIINPSFNIQILNSFIGVFNKHSKKLVEKMRKHAGSDSVDVSYWL

FRNTIDISCETLMDIDADLIKGQEEYIDDCIKAEKYSSTRMIGVWYHPEFIWKHSPLGKLTKATSDKILD

FVRKIIKLKKLEPEPLLKNCGDFPDDSMRKKHFLNNLLKMSENMTDDDILEETQTMLVAASETTALTMAT

VLLTLAIFPQVQEKIYEELDAILWNTDEITLEHINKMVYLEAVIKETMRILPTVPFINRRMTEDLHLNDC

VVPTGSNIIISIKNIHDSPLLWENPDKFDPERFLTERDPNRSRCAFMPFGYGPRNCIGFKFAMLSMKVMM

ASLLKNFTFEPAVYKSIAEIECFYNIVAKPKKGYKVKFSERKLYNNNDKL

 

Seq 96

 

>CYP351A6 seq 96, XP_973634.1| PREDICTED: similar to Cytochrome P450 4g15 (CYPIVG15) [Tribolium castaneum] 66% to XP_973568 seq seq 97

MFSNATSVLLYTFLTLILFLVLKNFWKKRRLYYYGSKISGPFSWPIIGSAHLFFSGPK (1)

VFYKTLVHFVETQPEIFKFWLGQHLLVVTSRPEDVDCVVNKFFEKGPFFEFGKQLLGDGL

LRAPAHIWKDRRKMFNPTFRTKILNTFIGTFGRHANKLVVELEECCGKQSCDLLFKLLRCSLDTAC (1)

ETLTDVDSTLLEGKNYLRNMIRC (1)

EDIVSVRTLSFWYHVDIFWKMSPLSREMDKGCEELFSFIKQ (0)

VIELKKLNRSQNNRDKDNAIKEKLFINHLLNLSETDRKIDDRVVEEEIQNILLTST

ETSTLGVGMVLIILGILPKIQGKVSEELKTIFGTDDRQPTLEDINKLEYLERVIKETFRLFPVVPMFIRS

ADHDIKFDCYTIPAGSIILIPIFQLNKKPEFWNEPQKFDPDRFLPENNSNRHRCTFIPFSYGPRNCLGLK

YGMMSMKVVLSTVLRNYTIKPTVYKKLDDIEMIFGIVNKPSLGFKVKLEKKCNFEI

 

Seq 97 + seq 100

 

>CYP351A5 seq 97+100, XP_973568.1| PREDICTED: similar to Cytochrome P450 4g15 (CYPIVG15) [Tribolium castaneum]

56% to seq 94

>gi|91084377|ref|XP_973599 = seq 100

MICENVLVWLFSTLIA

FLLLNAWHKRRLLYYASKINGPFSWPIIGSAHYFIGGQK

VFYKKITQLLETQPEIFKIWLGGQLVVVTSRPEDVE VIVNKFFEKGPIVEYSKKFLGNSLLRAP (1)

AHIWKDRRKMLNPTFNQKILNTFMGTFATHAHKLVKELEEHCGKDYDVFSNLIRCTLNLAI (1)

ENLADVDSDLIQGQDNYLQNVKR (2)

LEDLLAIRIFTFWFHADFFWKMSPLSREMHKATEETFAFVKQVI (0)

IIKTKKMNVKQDNNSPTKGKLFINHLIKVSKTDAKIDDLAIEEEIQNILIASSETTALTAGLVLTILGIFPEIQFK

VSNELGAVFGHDGRAPSLEDINKMEYLECVIKETLRLFPVLPIILRFLDQDIKLGAYTIPAGCSIAIPIC

HLNKKADFWENPEKFDPDRFLRMNSSERHRCTFIPFSYGPRNCIGLKYGMMSLKVLLSTILRNYTIKPSV

YEKLEDIEMVFCVLSKPSLGFKVKLEKKM

 

Seq 101

 

>CYP351A2 seq 101, XP_973464.1| PREDICTED: similar to cytochrome P450, family 4, subfamily v, polypeptide 2 [Tribolium castaneum] 60% to XP_973698 seq 94

AAJJ01001080.1

MNFETINTTSALTWALLFIVLFFIIKYNWNRRWLYYYGSKIDGPFAWPIIGIAHYFIGGQKVFYNQLTKL

FEAQPPIFKFWLGQDLVVATSRLKDVEIILNNCFEKPKFYNFMCEVTGNGLLTARENIWKERRKMINQAF

SLKVLHSYVDIFSKRAKCLISWFEEDFGKEDVFFKLYRCTFDTAC (1)

7113  EALADVDPTLLHGKNNYINNLKR (2)

MIDILTIRSFSIWLHDDFFWKLSPLSKEMSKASAETFSFIKQ (0)

IIGLKKLDPKNHTSKRFLNHLLTLNETNPKFDDSAIEE

ELQTILITSSESTALTVGMIL

TVLGIYPEIQ (0)

6561 KKVSKELDSIFGHDDRETTLEDVQKMKYLECVIKETSRVLPAVPLLARLADKDIKLDNYT

IPAGSIIVIPIWQIGKNADFWKNPKKFDPDRFLPENCDPNRPRSSFIPFSYGPRNCIGFQYSNMLVKVLT

ATILRKYTIKCPQYTSFEQVEIIFSITARPKHGFKIQMEKKL

 

Seq 114

 

>CYP4BN3 seq 114, XP_966858.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) isoform 1 [Tribolium castaneum] same ae as XP_975914, 56% to XP_971854 seq 11

MALLTDVFLPLVIILLIFWYWYRSQKNKKYYQNVATPPTVPILGNALDFTTTTELLGTFMRYRKDYGGLV

KVHIGPLRHFLLVSDYKMLEYLLSSPKIVDKSEDYKFLSSWLGTGLLLADGGPKWKKHRKILTPAFHFQI

LEQFVDVFDSCSNVLIQKLDKEVGNTSVDVYPFVTLFTLDVICESTMGTKINAQDDVTSDYVQSVKHMCR

IIIERSISPVQMYDFLFVFTRNYFIQRRALRILHDKADGVISQRLRELQAQTKTDSEGDSEGIKKKKAFL

DLILEAKVDGKPLSQDDIRQEVETFMFAGHDTTASAISFTLYCLANYPEVQKMAYEEQLSIFEDNNEPDV

TYANLQSMKYLELVIKETLRLYPSVPIIGRQSGEDFQF

DNSWIPKGDTMLLFLYGIHRDPKYFKDPEVFD

PNRFENPDNKMPYSYIPFSAGPRNCIGQKFAMLEMKCVLSKILRKFELQPAVPQHNLLLTAETVLKSANG

IKIGIKLRK

 

>gi|91082455|ref|XP_975914.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) isoform 2 [Tribolium castaneum]

MALLTDVFLPLVIILLIFWYWYRSQKNKKYYQNVATPPTVPILGNALDFTTTTELLGTFMRYRKDYGGLV

KVHIGPLRHFLLVSDYKMLEYLLSSPKIVDKSEDYKFLSSWLGTGLLLADGGPKWKKHRKILTPAFHFQI

LEQFVDVFDSCSNVLIQKLDKEVGNTSVDVYPFVTLFTLDVICESTMGTKINAQDDVTSDYVQSVKHMCR

IIIERSISPVQMYDFLFVFTRNYFIQRRALRILHDKADGVISQRLRELQAQTKTDSEGDSEGIKKKKAFL

DLILEAKVDGKPLSQDDIRQEVETFMFAGHDTTASAISFTLYCLANYPEVQKMAYEEQLSIFEDNNEPDV

TYANLQSMKYLELVIKETLRLYPSVPIIGRQSGEDFQF

GKVFIKNVFLQFSK

 

>gi|91082457|ref|XP_975954.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) isoform 3 [Tribolium castaneum] same as XP_966858

MALLTDVFLPLVIILLIFWYWYRSQKNKKYYQNVATPPTVPILGNALDFTTTTELLGTFMRYRKDYGGLV

KVHIGPLRHFLLVSDYKMLEYLLSSPKIVDKSEDYKFLSSWLGTGLLLADGGPKWKKHRKILTPAFHFQI

LEQFVDVFDSCSNVLIQKLDKEVGNTSVDVYPFVTLFTLDVIC

GKFSV

 

Seq 115

 

>CYP4BN8 seq 115, XP_972624.1| PREDICTED: similar to Probable cytochrome P450 4d14 (CYPIVD14) [Tribolium castaneum] 66% to XP_972577 seq 116

55% to XP_971963 seq 12 AAJJ01005264.1

MFIFAALFFLIIFYLYHQNVKLNRILCTFPEPPKKFLLGHVLDITSTT (1)

DVLNVFSK YINNYGPTIKLRAATLFAGLGTTDYKLCELLLSNNRILSKSLNYQYAR

NWLGNGLLISDGDYWRRHRKILTPAFHFEILKQFVETFESVGKVFVEKLDISQGPSVDLPPLVTLCTLDV

ICETAMGTQINAQKGQNAKYVQSVREMCRILIDRGLSPLKILNNTYWMTKDYYIEKKSLKVLHSFTSSVI

EKRKAERNERNCTKLAFLDLLLKFSNEGELLTDQELREEVDTFMFEGHDTTASSISFVLFCLANHPEVQE

KVLREQNELFGDDKDPSVTYHELQKMKYLEQVIKETLRLYPAVPIIGRCTSEDITFGEHFIPKDTNIAIY

IYGIHRNPEHFPEPETFNPDRFKNSNSLPPYAYIPFSAGPRNCIGQKFAMLEIKSIVSRVVRCFELRPAE

PYHSLVLSAETVLKSANGIKIGIRKRI

 

Seq 116

 

>CYP4BN7 seq 116 XP_972577.1| PREDICTED: similar to Probable cytochrome P450 4d14 (CYPIVD14) [Tribolium castaneum] 66% to XP_972624 seq 115

MYLIAIVIVLISLYLIVKPVKKTGNIDDFPEPPSKVFFGHALDAKSTTEILNVTTNYVKKYGKIVKLRLG

PFFKALVVTDYKLVEFFLSSNSLLTKSQNYAFARSWLGNGLILANGTHWKQHRKILTPAFHLEILREYLE

TFDSVGRIFIEKLKSLDNVQSVDLDALVPLCTLDVICETAMGTKINAQKGENSEYVSSVKEMCRIIVARF

LSPLKILKCTYWMTHDFYTERKVVNILHSFTSKVIDGRKTNRNETEKSGKKKAFLDLLLKFSDIEKLSDR

DIREEVDTFMFAGHDTTATGVCFALYLLANNPEVQEKVLSEQKELFGDEKNPCVTYQELQNMKYLEYVIK

ETLRLYPSVPVIGRYLKEDTTFGDRVISAKTNVAIFIYGIHRNPDYFPEPEKFIPERFENMTNLPPYAYI

PFSAGPRNCIGQKFAMLEMKSLISKVIRHFELTPANPHHELVLAAETVLKSANGIKIGLRARSENKM

 

Seq 122

 

>CYP4BN10 seq 122, XP_971570.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) [Tribolium castaneum] 66% to XP_971513 seq 123

MSVLTEFFIALVALILLPFYFYYTKIRRIENFFKHFPSPAGVPILGVAPEFKTTSSVLDNFHKYAKAHGT

MVHLKFGPFKHALLCTDTKFLEFLLSSNKLLKKSVNLRFLEPWIGTGLVTADGGPKWKTHRKLITPAFHF

KILEQFVDIFESGGDILVKKLSEVSGSKSCDIYPYITKCTLDIICETAMGTKVDVQNTENSAYFESIKEM

CRIFTVRTVGAFLSNDFIFRFSKDYKIQTKAVKVLHNHSNEVIVNKRKELKEKNNENTSDIDELGRKKKK

VFLDLILSATTDGQSLSPEEIREEVDTFMFGGHDTTGTATSFILYCIANNKEAQEKILEEQKQLFGDERS

PKVTYSTLQEMKYLENAIKEGLRLYSPVPIYGRLIDQDTEYNGTMIPKGVGVIIFAHGIHMNPKYYPNPE

KFDPSRFENTTGKDPFTFIPFSAGPRNCIGQKYAMLEIKSLVSKVVRNFELFPASPTHEMHLAPETVLKS

LNGVKIGLKMR

 

Seq 123

 

CYP4BN9 seq 123, XP_971513.1| PREDICTED: similar to Cytochrome P450 4c3 (CYPIVC3) [Tribolium castaneum] 66% to XP_971570 seq 122, 51% to XP_971963 seq 12

AAJJ01000614.1 also has XP_971570 seq 122

MIVFTGYLIAIVLILFPLYYYYAKCYALEKFYHQFPSPPKTPFFGNALDLKTTK (1)

DLFQSFHRYVKAYGT

17128 MVHLKIGPFDHMLLCSNPKFLEFLLTSNTLLKKSPNLRYLVPWIGTGVATAY (1) 16970

16925 GPKWKLHRKLVTPAFHYS

VLSQFVNTFESSGNILVEKISKLCDGQKVDNFDLYPHITRCTFDIICETAMGTKSNVQTNETSVYFESIK

EMCRIFMSRTMAVFQRYDFIFRFSKDFHLQKKALDIIHNYSNEVIATKRKELDENVKQKESVDDLGRKEK

MVFLDMILNKAIDGHIFSQEAIRGEVDTFMFAGHDTTATAISFILLCIANHNEVQDKIIEEQERLFGCEK

NPKVTFAHLQEMQFLENVIKEGLRLYTPVPLYGRQIDKNVEFEGMLIPKGVNVVIFNHGVHMNPEFYPNP

EKFDPNRFESMEDKHPFAFIPFSAGPRVCIGKKFAILEIKSILSKIVRNFELFPASPSYELDLAAETVLK

SLNGIRIGIKRRETF

 

Seq 125 CYP4AA1

 

>CYP4AA1 seq 125, XP_973810.1| PREDICTED: similar to Probable cytochrome P450 4aa1 (CYPIVAA1) [Tribolium castaneum] 44% to CYP4aa1 Dm, 37% to XP_972624 seq 115

41% to 4aa1 bee, 43% to 4aa1 anopheles

AAJJ01000447.1

MWTDICTYLVILAVMLMSIYFKNYIRSVYLAFQLSGPPAVPLIGNVL

LMKNDRSKYQFFRGHILS (1?)

EMYSPFMRCWLSIFPVFFIYEPKALQLIMGTNRYTSKNIFYNCLHNVVGDGLITSS (1)

GEIWKQHRKLIQPYFHISVLKVYFDIFYKWS

41760 MAMVQDLENETEVNITKYANKFVFD (0)

SQYWAFLGKDQSRLLIGGNLVQHIHQ (1)

CQFLMLHRITRPWLLFNTIFKRTDFSKVEENQKNILQQYTKS (0)

41348 ILDGKKQNSHGTAMNNLMEMMMEISNMNPEFTDDDIVNETCTFMLA (0)

41162 GQDSVGAALSFALYSLAAHQDIQEKVVQELNGIFKDGNQAATFEDVAEMKYLEQCIKETLRLYPSVPM

ITRKITEDVPL 40926 (1)

GKYTLPTGTNIVISPFVTHRLPHVFPDPLKFDPDRFS

PENKAKIHPYGFIPFSAGPRNCI (1)

GYKFAIIELKTVLSQILRKYHVSLVPGREKLILSYRMTLKAKKGIWLRLKKRSV*