two spotted spider mite, Tetranychus urticae, a chelicerate arthropod ( Acari, the closest genome is from ticks).

 

From R. Feyereisen 9/23/2009

Names revised to fit gene orientation in clusters and and v1, v2 removed since highly inbred.

(should not be any alleles present) 10/15/2009 D. Nelson

added four pseudogenes sent by Rene Feyereisen Oct. 19, 2009

 

CYP2 Clan (Two families CYP307 and CYP392)

 

>CYP307A1v1 08g05380-90-M Translate DNA Sequence 08g05380gene(1,1497)

MDFISLSFVYSTLCLAIICVILKKLFQQEPPKFGKYAPSPSKLPIIGHLHLLAKFPDNPWKGFDLIREQYGDVVSLQLG

SYNALLVSSLDKMKEVLITKGKIFSDRPDFHRYRIIFGGDRENALALCDWSELQKTRRVLCSISTTPKFASASYEMLDK

AIVSELKLFFDFIEASPERILTKCWLRQFSSNVFTEYLCASR

MEYNDPILVKLSYFFDFIFNDISQCGPVDFLPFIR RF

RFLSWLFEKSRRDCCGSK IDLESFDSMISLDLMYKYHLKNPDEFSYEHFLFAIGDLVGGSSAIVNMIMRLVGHLSIDKE

VQEDMYQEVAAVAKQHDTDMISLKQRPDLPLIEAAILEALRISSSPLVPHVPTEDSTIGGY

FVPKGTIVLFNNYNMNFS

TEFYTDPEEFQPSRFLSHSSNNNSQSKWQIKKPEVFLPFSVGQRSCLGFKLTQYITFVALCNILLRYKIEPVDSIETIK

NHIRGGVLALRVDDVFRVKLIPRD.

 

>CYP307A1v2 213g00030nxnx.pro >213g00030 +  0000009094

identical to 08g05380-90-M in beginning and end. Middle does not match

MDFISLSFVYSTLCLAIICVILKKLFQQEPPKFGKYAPSPSKLPIIGHLHLLAKFPDNPWKGFDLIREQYGDVVSLQLG

SYNALLVSSLDKMKEVLITKGKIFSDRPDFHRYRIIFGGDRENALALCDWSELQKTRRVLCSISTTPKFASASYEMLDK

AIVSELKLFFDFIEASPERILTKCWLRQFSSNVFTEYLCASR

WIHDTGxxxxxSLLLIPFHIICLLPKNTFYFNLPLSRL

FVPKGTIVLFNNYNMNFSTEFYTDPEEFQPSRFLSHSSNNNSQSKWQIKKPEVFLPFSVGQRSCLGFKLTQYITFVAL

CNILLRYKIEPVDSIETIKNHIRGGVLALRVDDVFRVKLIPRD

 

>CYP392A4 03g08280.pro >03g08280 -  0000016798

26% to CYP4Z1 (-) strand,

MLLLDYFSEPSPVIYLFLSLSTIWIIKYLYQSVKRLYSLPPGPFGIPIFGYYPFLKHHSYIQFDQLSKKYGPVFSLKLG

QFDTFVVCDWDNLKDAFANDALLARPVKGFISGIENTLSVISMSGEAWREHRRLSLHVLRNVGLGKREMETLISEEIHQ

FLSSLETNVIDLPERLMPSVSNNISALLFGHIFDYNDPEKVTTDQIVARLCNIFQFTGLTSYLPWLTKPLIFLGKANLK

IIQKAQMHLNEFISKEVLKHKNKVDSTEVEDYIDGYLNVQSKRKDEIFNDNVLRRNVITFFVAGSETVTSTLTWTIMYL

VQYPQYQEKIRSEIKEAIGTEKRPDFSDRQKMPFTLAFLYEVQRIESIVATNLIRRASQDTKIGSFNVPKDSLVLFNFW

SVHHDPKLWPNPDKFDPNRFLADNGTKVIKPPYLVPFSAGKRACPGEGLANVELFLYTVGILQRFKIKSGKPLSFEAIN

GLTRRPKYKPDLIFEKISF

 

>CYP392A3P 03g08320co Translate DNA Sequence 03g08320generc(1,1485)

(-) strand,

MLLLDYFSEPSPIIYLFLSLSIIWIIKYIFKSVKRLYVLPPGPFGIPIFGYYPFLKHHQFDQLSKKYGPVFIMKLGQYD

TFVVCDWDNLKDAFANDALLARPAKGFISGIEETLSVIAMSGDVWREHRRLSLNFLRNVGLGKREMETLISEEIHQFLS

SLEDDANDLPQRLMPSVSNNIAALLFGRIFYYDDPDKIMIDQGVQRFSESFQLTGILSFFPWLIKPLIALGKANLKVIS

KTHQRMHAFISKEVLAHKNKVKSTEIEDYIDEYLNAQSKRKDNLFKDMTLRRNVVGFFVAGSETVTSTLTWAIMYLVQY

PQYQEKIRSEIQEVIGTEKRPDFSDRLRMPFTQAFLYEVQRIESVVAFNLIRRASQDTKIGPYNVPKDSLVFFNFWSVH

HDPKLWPNPDKFNPNRFLAENSTKVVKPPYLVPFSAGKRACPGEGLANVELFLYTVGILQRFKIKSDKPLSFDAHFGLT

RRLKYKPDLIFEKYLSNNSI.

 

>CYP392A2 03g08340.pro >03g08340 -  0000016804 (-) strand,

MLLLDYFSVPLPFIYLFLSLSIIWIIKYLFKSVKRIYSLPPGPFGFPIFGYYPFLKDHSYIQFDRLSKKYGPVFSLKLG

QYDTIVVCDWDNLKDAFANDALLARPAKGFLSGIENTLSIISMSGDAWREHRRLSLHVLRNVGLGKREMENLISEEIHQ

FLYSLENDANDLSQRLMQSVSNNISLMLFGHIFDYDDPDKVAIDESLRDYCQAFQFSGITSYLPWLTKPLIALGKANLK

IIQKAQMHLNDFISKELFKHQNGKVENYIDGYLNVQSKRKDQLFNNATLKRNVATFFVAGSETVAGTLTWASMYLVKYP

QYQERIRLEIKEVIGTEKRPDFSDRLRMPFTLAFLYEVQRIESIVATNLIRRASQDTKIGPYNVPKDSLVLFNFWSVHH

DPKLWSNPDKFDPNRFLTENGNKVVKPPYLVPFSAGKRACPGEGLANVELFLYTVGILQRFKIKSDKPLSFEAINGLTR

RPKYKPDLIFQRV.

 

>CYP392A1 03g08380.pro >03g08380 -  0000016808 (-) strand,

MWLLDYFSVPLPFIYLFLSLSIFWCIKYIFKSVKHLCSLPPGPFGFPIFGYYPFLKEHSYIQFDRLSKKYGPVFSLKLG

QYDTIVVCDWDNLKDAFANDALLARPAKGFLSGIEETLSVIAMSGDAWREHRRLSLHVLRNVGLGKREMETLISEEIHQ

FLSSLETNVNDLPQHLMPSVSNNISALLFGRIFDYDDPDKMIIDQSVQGFSESFQFTGITSFLPWLTKPLIALGKANLK

IISKTHKHLNNFITKEVLKHQNKANSKEIEDYIDGYLDAQSKRKDDLFNDMILRRNVISFFVAGSETVTSTLTWTLMYL

VKYPQYQEKIRSEIQEVIGTEKRPDFSDRLRMPFTQAFLYEVQRIESVVAINLIRRASQDTKIGPYNVPKDSLVFFNFW

SVHHEPKLWPNPDKFDPNRFLTDNGTKVIKPPYLVPFSAGKRACPGEGLANVELFLYTVGILQRFKIKSDKPLSFDAKF

GLTRRPKYKPDLIFEKISSQY

 

>CYP392A5 32g02390.pro >32g02390 -  0000014271

MLLFNTLEVSLPLLTTFLVLLSCWLFVHLAKLIRRYNQLPPGPWGLPIFGYFPFLKQNRNLQFDQLSKKYGPVFSMRLG

SKDVVVINDWHHMKEAFANNSLLARPNQLLLLPGIVQVRSIVEMSGYPWREHRRLSLRVLRDVGLGKSRVEKLIMEEIE

QFCGELEKGPFDDFITKLLPSVSNNIANLLLGHCFKYNDPIKISLDNSVNQISKAFQFIGMQVFLPWLIKPLIALKKTN

LNILKEYIAIMDNYVQSELEMHKANFEQGKIDDYIDGYLNELSKRSGESDIFNSDILKRNVIDFFRAGTGTVLATLSWA

ILYLVKYPDYQDKIRSEIHEVIGVNNKPDYSYRTRMPVTMSFIAEVSRLGSVVGSSVIRRASQDTKIGKYTIPEDTIVI

FNFWSIHRDPRLWTNPDEFNPSRFLTQDGKVEKPSYLIPFSGGKRICPGEGFANVELFLYIVCMVQRYKIKTTSEEEIS

LEGDFSTVRRPSNMPRLMFEKIKINQ

 

>CYP392A6 07g04400.pro >07g04400 -  0000024097

MFSFDNDLLTKCVKLVSATCFIYIVHHLLLWIKNVRQLPSGPWGIPIFGYLPFLKQPVYLAFDELAKTHGSVYCVKLGK

HNVVVVTDWDHMKEGFANECLLGRPHETFFPGLTNVRSFVEMSGQSWREQRNTALSIFRTVGFGKSLMEELIKQEIDQL

MNFIEQESAEPIDLEATIMPSVSNNICILLFGHTFDYKDPNKMKLDENYHMIVKNFAFAGVTAFLPWLANILITLGIFD

TAYVAKGVRWTYNYFQTEIDAHEKKFDENVIVDYLDGYLLERKKRKDKGLDPEKGNFSLEILRRNVTDFFGAGTETVTS

TLVWAMLYLVAYPEIQEKIRKEIQEVIGHERKPLYADRNEMPYTMAFIYETHRVSSVIAANLLRRATVDTKIGNYNVPK

ETVVIFNIWSIHYDPKLWVNPTEFNPDRFLSTESGVTKAIKPAYLVPFSGGKRACPGEGLANVELFLYLTCILQRFKIS

TKPGVKISFDSHFGLSRRPAEMPLLKFEKIQS

 

>CYP392A7 09g07500.pro >09g07500 +  0000026462

MFLTDYFVFSQPLYSIASGLIFLFVFNFLVTTVKRLFLLPPGPWGLPIVGYYPFLKDESYLAFDSLSKKYGPVYCLKLG

LHDVVVICDWDHLKLAFADESLLARPYETFFEGLINEPSFIEMSGEPWRAHRRLSLQVLRNVGFGTSKMEDAVSTEIQQ

FLPTIGKSKVDFIAKILPSVSNNISLLLFGHRFDYSDAFKVELDDNMERVNQAVQFAGLTAFFPWLARIFAIFKLSGMD

IIDKCMNAAEDLIQKEIDRHQVKTDMNEIEDYIDGYLVEQKNRHNKDENDEVFNNKVLLRNVTEFFAAGSETVTSTLSW

AMMYLIYKPEYQDKIRTEISDVIGFDREPLYVDRNRMPFTMAFLYEAQRIGSVIAVNLLRRAARDTKIGEYNIPQDTVV

IFNLWSIHRDPKLWPEPEKFDPNRFLSEDGSKAIKPPYLVPFSGGKRICLGEGLANVELFLYLVNILQKYRVRCDPDVK

LSFESVFGVARRPKHLPLLTFEKIASQN

 

>CYP392A8 19g03700.pro >19g03700 +  0000005989

96% to 19g04360.pro

MFLTNYFVFSQPLYSIATGLIFLFVFNFLVTTIKRLFRLPPGPWGLPIVGYYPFLKDESYLQFDSLSKKYGPVYSLKLG

QHDVVVICDWDHLKLAFADESLLAKPHELFFEGIIKYPSFAEMSGDDWRFHRRVSLHVLRDLGLGTSKMEEAIRREIKQ

FLPTIGEGKVDFFTKLLPSVSNNISILLFGHNFSYSDPYKIGLDENMDRVNQTFQFAGLSTFLPWLVKIATALGMFRVS

VISKHVHAVEDLLQKEIDKHQSESRVNEIEDYIDGYLVEQKNRQNKDRNDEMFSMGVLRRNLTAFFAAGSDTVTSTLSW

AMMYLIYYPEYQDKIRAEIADVIGFDREPVYTDRNRMPFTMAFLYEAQRIGSVIAVNLLRRASRDTKIGKYNIPKDTIV

IFNLWSIHRDPKLWPEPEKFDANRYLSEDGSKAIKPPYLVPFSGGKRICLGEGLANVELFLYLVNILQRYQVRYDPSIK

LSLEATFGVSRRPKHLPPLIFEKLTKF

 

>CYP392A9 19g04360.pro >19g04360 -  0000006055

MFLTDYFVFSRPLYSITTGLIFLFVFNFLVTTIKRLFRLPPGPWGLPIVGYYPFLKDESYLQFDSLSKKYGPVYSLKLG

QHDVVVICDWDHLKLAFADESLLAKPHELFFEGIIKYPSFAEMSGDDWRFHRRVSLHVLRDLGLGTSKMEEAIRREIKQ

FLPTIGEGKVDFFTKLLPSVSNNISILLFGHNFSYSDPYKVGLDENMDRVNQTFQFAGLSTFLPWLVKIATALGRFRVS

VISKHLHAVEDLLQKEIDMHQSESRVNEIEDYIDGYLVEQKNRQNKDKNDELFSMGVLRRNLTGFFAAGSDTVTSTLSW

AMMYLIYNLEYQDKIRAEIADVIGFEREPVYTDRNRMPFTMAFLYETQRIGSVVAVNLLRRASRDTKIGKYNIPKDTIV

IFNLWSIHRDPKLWPEPEKFDPNRFLSEDGSSAIKPPYLVPFSGGKRICLGEGLANVELFLYLVNILQRYQVRYDPSIK

LSLEATFGVSRRPKHLPPLIFEKLPKF

 

>CYP392A10 09g08260.pro >09g08260 +  0000026538

96% to 19g04360.pro (allele?)

MFLTDYFVFSQPLYSITTGLIFLFVFNFLVTTIKRLFQLPPGPWGLPIIGYYPFLKDESYLQFDSLSKKYGPVYCLKLG

QHDVVVICDWDHLKLAFADESLLAKPHELFFEGIIKYPSFAEMSGDDWRFHRRVSLQVLRDLGLGTSKMEEAIRREIKQ

FLPTIGQGKVDFFTKLLPSVSNNISILLFGHNFSYSDPYKIGLDENMDRVNQTFQFAGLSTFLPWLVKIATALGLFRVS

VISKHVHAVEDLLQKEIDMHQSESRVNEIEDYIDGYLVEQKNRQNKDENDELFSMGVLRRNLTGFFAAGSDTVTSTLSW

AMMYLIYNPEYQDKIRAEIADVIGFEREPVYTDRNRMPFTMAFLYETQRIGSVVAVNLLRRASRDTKIGKYNIPKDTIV

IFNLWSIHRDPKIWIEPEKFDPNRYLSEDGSKAIKPPYLVPFSGGKRICLGEGLANVELFLYLVNILQKYQVRYDPSIK

LSLEATFGVSRRPKHLPPLIFEKLPKF

 

>CYP392A11 19g04440.pro >19g04440 +  0000006063

MFLTDYFVFSQPLYSLATGLIFLFVFNFLVTTIKRLFRLPPGPWGLPIVGYYPFLKDESYLEFDSLSKKYGPVYSLKLG

QHDVVVICDWDHLKLAFADESLLAKPHELFFEGLIKYPSFAEMSGEHWRSHRRLSLHVLRDLGFGTSKMEEAISKEIQQ

FLPTISEGKVDFFEKLLPSVSNNISILLFGHNFKYSDPFKVDLDHNMDRVNQAFQFAGLSAFFPWLFKLSTFLGIFRMS

VAYNHVLAVEGLLQKEIDKHQAKSGKSEIDDYIDGYLVEQKNRQNKDENDQVYSMGVLRRNLTAFFAAGSETVTATLAW

AMMYLIYNPEYQDKIRAEIADVIGFDREPVYTDRNRMPFTIAYLYEAQRIGSIIAVNLLRRASRDTKIGKYNIPKDTIV

IFNLWSIHRDPKLWPEPEKFDPNRFLSEDGSKAVKLPYLVPFSGGKRICPGEGLANVELFLYLVNILQKYRVRCDPDVK

LSFEATFGVSRRPKYSPPLIFEKIG

 

>CYP392A12 09g08030.pro >09g08030 -  0000026515

97% to 19g04440.pro (alleles)

MFLTDYFVFSQPLYSLATGLIFLFEFNFLVTTIKRLFRLPSGPWGLPIVGYYPFLKDESYLEFDSLSKKYGPVYSLKLG

QHDVVVICDWDHLKLAFADESLLDKPHELFFEGLIKYPSFAEMSGEHWRSHRRLSLHVLRDLGFGTSKMEEAISKEIQQ

FLPTISEGKVDFFEKLLPSVSNNISILLFGHNFKYSDPFKVDLDHNMDRVNRAFQFAGLSAFFPWLFKLSTFLGIFRMS

VAYSHVLAVEGLLQKEIDKHQAESGKSEIDDYIDGYLVEQKNRQNKDENDQVYSMGVLRRNLTAFFAAGSETVTATLAW

AMMYLVYNPEYQDKIRAEIAEVIGFDREPVYTDRNRMPFTMAYLNETQRIGSIIAVNLLRRASRDTKIGKYNIPKDTIV

IFNLWSIHRDPKLWPEPEKFDPNRFLSEDGSKAVKLPYLVPFSGGKRICPGEGLANVETFLYLVNILQKYRVRCDPDVK

LSFEATFGVSRRPKHSPPLIFEKIG

 

>CYP392A13 13g00750.pro Created: lundi 17 août 2009 10:42

99% to CYP392A11v2 (only 3 aa diffs)

MSLLDNFQVSEPLVNALIGIALFWLVKYLFNTIKRIRSLPPGPWGLPIVGYLPFLGDHVYLQFDQLSKKYGPVYCLKLG

YFDVVFVCDWPHMKEAVSNDALLARPHAAFFPGAVDDRSFGEMSGNPWREHRRLSLHILRDVGLGTSTLETLVKEEIDQ

FLTTLDNDGKPVDFKKKISHSIVNNISILLFGHKYDHDDPAAIAISAANEEIGSSLNFAGVMAFLPWLTTIVFKFKLFN

LAKVLKCFQIVDSHIQDEIDKHQEKNSQEVVDYIDGYLAEMKRREKQTKVDDNFSIDILRRNAASFYGAGTETVASTME

WVMIYLVKYPEYQDKIRSEIADVIGFERRPDFVDRNRMPFTMAFIHEAHRIGSVVANNLLRRASSDTKIGNHNIPKDSL

VIFNFWSINRDPKLWPNPNKFDPTRFLTEDGTKVVKPPYLIPFGAGKRNCPGESLANVELFLYIVCIIQKYRVKVKPGT

EISTEASFGLSRRPSELPTLIFEKI

 

>CYP392A14 647g00020.pro Created: lundi 17 août 2009 10:53

 

MSLLDNFQVSEPLVNALIGIALFWLVKYLFNTIKRIRSLPPGPWGLPIVGYLPFLGDHVYLQFDQLSKKYGPVYCLKLG

SFDVVFVCDWPHMKEAVSNDALLARPHAAFFPGAVDDRSFGEMSGNPWREHRRLSLHILRDVGLGTSTLETLVKEEIDQ

FLTTLDNDGKPVDFKKKISHSIVNNISILLFGHKYDHDDPAAIAISAANEEIGSSLNFAGVMAFLPWLTTIVFKFKLFN

LAKVLKCFQIVDSHIQDEIDKHQEKNSQEVVDYIDGYLAEMKRREKQTKVDDNFSIDILRRNAASFYGAGTETVASTME

WVMIYLVKYPEIQDKIRSEIADVIGFERRPDFVDRNRMPFTMAFIHEAHRIGSVVANNLLRRASSDTKIGNHNIPKDSL

VIFNFWSINRDPKLWPTPNKFDPTRFLTEDGTKVVKPPYLIPFGAGKRNCPGESLANVELFLYIVCIIQKYRVKVKPGT

EISTEASFGLSRRPSELPTLIFEKI

 

>CYP392A15 13g00920.pro >13g00920 -  0000002289 2 clan

31% to CYP2J2

MFSINNLFESQPLVNTLIGVALFWLVKYLFYTIKRIRSLPAGPWGLPIVGYLPFIRDHTYLEFDRLSKKYGPVYCLKLG

VYDVVLVCDWPHLKDAVSNDALLAKPHASLLPGGGEGRSLGEMSGSPWQEHRRLSLHILRDIGLGKSTIETLVKEEIDQ

FLTTLDNDGKPVDFKKKIGHSIVNNVSILLFGHKYDLNDPAAIEISAANDEIASSLNFAGVMAFLPWLSSFVFKFKFIN

LTRLIKCFQIVDTHIQNEIDKHQEKNSQEVVDYIDGYLAEMKKREERNQIDDNFSIEILKKNAGAFYGAGTAAVSSTME

WMMVYLVRYPEIQDKIRSEIADVIGFERRPDYVDRIRMPFTMAVIHEAHRIGSVAPNNLLRRASSDTKIGNYNIPKDSL

VIFNFWSINRDPNLWPNPDKFDPTRFLTEDGTKAVKPPYLIPFSAGKRNCPGESLANVELFLYLVCILQKYRVKVKPGT

EISTEATFGLSRRPSNLPNLIFVKISNSD

 

>CYP392A16 13g01940.pro >13g01940 -  0000002391

MFSLFNFQLPQPLLNVLIGVTLFRLVKYLFNTIKRTLSLPAGPWGLPIVGYLPFLGDHVYLQFDQLSKKYGPVYCLKLG

DFDVVLVCDWPHLKDATSNDALLARPYETLVPGSERSFAEMSGDPWRQHKRLSLHILRDVGLGKNKIETLIKEEIDQFL

TTLDTDGKPVDFSQKIGPSISNNIAILLFGHKYDYNDPVKIEMDRARAAFTRLFKFAGILTFLPWLTKVLILLGKFDVH

LIKKNFMIVDEFVQDEVNRHRENYNENHEVVDYIDGYLEERKNREKQNIPEDTFTLNTLKRNSAAFFGAGSETVYSTME

WAILYLVKYPEYQDKIRSEMADVIGFERRPDYADRARMPFTMAFIHEVQRIESIIANNLLRRASEDTKIGNHFIPKDTL

VMFNFWSVNHDPNLWPNPDKFDPTRYLTEDGSKAVKPPYLIPFSAGKRNCPGEGLANVELFLYLVCMVQRYRIKVEPGT

ELSFEAVFGISRRPANLPLFIFEKVVH

 

>CYP392A17 119g00020.pro >119g00020 +  0000000788

97% to 13g01940.pro (alleles?)

MFSLFNFQLPQPLLNVLIGVTLFRLVKYLFNTIKRTLSLPVGPWGLPIVGYLPFLGDHVYLQFDQLSKKFGPVYCLKLG

SFDVVLVCDWPHLKDATSNDALLARPYETLVPGSERSFAEMSGDPWRQHKRLSLHILRDVGLGKNKIETLIKEEIDQFL

TTLNTDGKPVDFSQKIGPSISNNIAILLFGHKYDYNDPVKIEMDRARASFTRLFKFAGILTFLPWLTKVLILLGKFDVH

LIKKNFMIVDEFVQDEVNRHRENYNENHEVVDYIDGYLEERKNREKQNIPEDTFTLNTLKRNAAAFFGAGSETVYSTME

WAILYLVKYPEYQEKIRSEIADVIGFERKPDYADRARMPFTMAFIHEVQRIESIIANNLLRRASEDTKIGNHFIPKDTL

VMFNFWSVNHDPNLWPNPDKFDPTRYLTEDGTKAVKPPYLIPFSAGKRNCPGEGLANVELFLYLVCMVQRYRIKVEPGT

EISFEAVFGISRRPANLPLFIFEKVVH

 

>CYP392A18 595g00030inc Created: lundi 21 septembre 2009 13:22

97% to 13g01940.pro (allele?)

IIPCKYPEYQDKICSEIADVIGFENRPDFADRARMPFTMAFIHEVQRIESIIANNLLRRASEDTKIGNHFIPKDTLVMF

NFWSVNHDPNLWPNPDKFDPTRYLTEDGSKAVKPPYLIPFSAGKRNCPGEGLAYVELFLYLVCMVQRYRIKVEPGTELS

FEAVFGISRRPANLPLFIFEKVVH.

 

>CYP392A19 13g02080.pro >13g02080 -  0000002405

MFSLPVFSLLVNTLIGVALFWLVKYLFYTIKRIYQLPAGPWGLPIVGYLPFLGDHVYLQFDQLSKKYGPVYCLKLGKHN

VVLVCDWPHLKDAISNDALLARPHEALVTGVYDTRSFVEMSGDPWRQHKRLSLHILRDVGLGKSKIETLIKEEIDQFLT

TLDNNSEPLDFSRRIGPSISNNVAILLFGHKYDYNDPVKIEMDRAQNVFTRLFKFAGILAFLPWLSKLLIFLGKLNLDI

IKQNLIIVDKFIQEEIDRHRGKHNNTHEVVDYIDGYLEERRNRERQNISEGSFSEMVLRRNVAAFFGAGSETVYSTMEW

TMLYLVKYPEYQDKIRSEIADVIGFERRPDYADRARMPFTMAFIHEVQRIESIIANNLLRRASEDTKIGHYSIPKDTLV

IFNFWSINRDPKLWPNPDKFDPTRYLTEDGTKAVKPPYLIPFSAGKRNCPGEGLANLELFLYLVCMVQRYRIKVEPRTE

LSFEAVFGISRRPANLPAFIFEKIVH

 

>CYP392A20 13g537944UP Created: mardi 18 août 2009 13:30

MFSLFSFQLPQPLLNVLIGVVLFWLVKYLFYTIKRIRSLPPGPWGLPIVGYLPFLKDHVYLQFDQLSKKYGPVYCLKLG

DFDVVLVCDWPHLKDATSNDALLARPYETLIPGGGDDRGFSEMSGEPWRQHKRLSLHILRNVGLGKSKIETLIKEEIDQ

FLATLDTGGEPVDFSEKIYPSISNNISILLFGHKYDYNDPAKIAMDRAQMGFTSLFKFAGVLAFLPWLTKVFFLLGKFD

VQFIQKNAQAIEKFIQDEVDRHRENYNENHEVVDYIDGYLEERKRREKQNIPEDTFTLDTAKRNAGAFFGAGSETVHST

MEWAILYLVKYPEYQDKIRSEIADVIGFENRPDFADRARMPFTMAFIHEVQRIESIIANNLLRRASEDTKIGNHFIPKD

TLVMFNFWSVNHDPKLWVNPDKFDPTRYLTEDGTKAVKPPYLIPFSAGKRNCPGEGLAYVELFLYLVCMVQRYRIKVEP

GTEISFEAVFGISRRPANLPLFIFEKI

 

>CYP392A21 06g06430.pro >06g06430 -  0000023041

MFLISNLLSSQPLVNSLIGLALFWLVKYLFNTIQRIRSLPAGPWGLPIVGYLPFIKDDIYLVFDQLSKKYGPVYSLKLG

SFDVVLVCDWPHMKDAVANDALLARQHEVFFPGVVEGRSFAEMSGDPWREHRRLSLHILRDVGLGKSTIETLVKEEVDQ

FLSALENNGKPADFEKCISRSVTNNVSILLFGHKYERDDPTAIAISSANTEVGRSFSFAGVVAFLPWLAELVFKFELFN

VTRLKKCFQIVDTHIQDEIVKHQEKNSQEVVDYIDGYLVEKKNREKQNKVDDNFTIEILRRNAGAFYGAGTETVSSTME

WIMVYLVKYPEYQDKIRSEIADVIGFERKPDYVDRNRMPFTMAFIHEIHRIGSVVANNLLRRAASDTKIGNYNIPKDTL

VILNFWSVNRDPKLWPNPDEFDPTRFLTEDGSKVVKPPHLIPFSAGKRNCPGESLANVELFLYLVCMLQKYHVKVKPGT

KISTEAIFGLSRRPSQLPTFIFEKISNSN

 

>CYP392B1 17g02620.pro >17g02620 -  0000004863 (-) strand

MFLISLLSNNFISSKLIYNISTGLIAFWCVTYLIPTIKRLLTLPPGPWGLPIVGYLPFLEKNNEYKVLDRLAKKYGPVY

SLNLGKDTAVIVNDWNHAKEVFKNDELLARPGRFAKNKFGVSIVEMSGEPWRVHRQNTVHLLRDLGLGKSSFDDKIIEE

IQQFLPKLEKGPVKNVFKTFLSTATNTISILLLGHGFEDDDDPVKQTLVDALMITSQSGSQFSFFSSGLHPKINRLLMK

PTELTNEEAKMFESTRALPKYMQNEIDQHKKKQSKEFDDYIDGYLEEQKKRKNNDSNGNVPFDEETLRSNVVAFYVAGS

ETVSTTLTWAILYLIKYPEYYEKIRAEISDVIGFERLPDYSDRNQMPMTMSFIYEVHRAATIVPANLFRAASRDLKIGN

FNVPKDSTVILNFWTINRDPSLYIKPDEFDPSRFLTDNGTKAVKPQFLTPFSKGKRGCPGEGFANIEIFLYLVSIVQRY

KIECEPGSILSFEADYTTIRRPKSIPPLIFTKVSEKN

 

>CYP392B2P 17g02680 pseudogene from Rene (-) strand

MSLISLLSNNFISSQLIYNIATGLIAFWCVTYLIPTIKRLFTLPPGPWDLPFVGYLPFLQKNNEYKVLDRLAKKYGPVYSLGLGKDTVIVVNDCDHAKEVLKNDDLLYRPESFAKNNYVVSIIEMSGSPWRVHRQNTVHLLRDLGLGKSSFDDKIIEEIQQFLPKLEKGPVENVSNTFLSTITNNISFLLLGHGFEDDDPVKQTLVDGFMIGSKIGSQFSFFSSGLPPKINRLLMKPTDLKIEPANYEVIKAIPKYMQNEIDQHKKKQTKEFDDYIDGYFEEQKKRKNSDLDNSVPFDEATLLANLVDFxQAGSETVSTTLTWAILYLFKYPEYYEKIRdVIGFERLPDYADRNQMPMTMSFIYEVHRAASIVAVNIFRAATCDLKIGNFSVPKGAAFIVNFWTINRDPSLYIKPDEFDPSRFLTDNGTKAVKPSFLNPFSKGKRGCPGEGFANIEIFLYLVSIVQRYKIECEPGSKLSFEAHYSTTRKPKSIPPLIFTKISEKKTKFYI

 

>CYP392B3P 17g02820 pseudogene from Rene (+) strand

MFLLLLLSNNFISSQLFYNISTGLIAFCCVTYLITTIKRLLTLPPGPWGLPFVGYLPFLEKNNEYKDLDRLAKKYGPVYSLSMGKDTVIVVNDWNHAKEVLKNDDLLARPEAYVAGSPVVSFIVMSGEPWRVHRHNTVHFFVIFGKSSFDDKIIEEIEKFLPKLGKGPVDDPVKQTLIDSLMIAAQMGSQFSIFTSGLPQKINIAHEADGSVEIEAPVGYQEKLKALPKYMQNEIDQHKKKQSKEFDDYIDGYLQEQKKRKNNDLNSNVPFDEETLQANMVSVYQAGSETVSTTLTWAIILYLVKYPEYYEKIRGEIASVIGFERLPDYSDRNQMPMTMSFIYEVHRAALILGVNLFRAATCDLKVGNFSVPKGAAVIVNFWTINHDPFLYIKPDEFDPSRFLTDHGTKAVKPPFLTPFSKGKRGCPGEGFANIEIFLYLVSIVQRYKIECEPGSILSFEAHYSTIRKPKSIPPLIFTKISEKT.

 

>CYP392B4 17g02840.pro >17g02840 +  0000004885 (+) strand

MFLTSWLVDNLGSYQLLFNASIGLILFWFVSYLLPKIKRVRSLPPGPWGLPFVGYLPLLQKNNEYEDLDRLAKKYGPVY

SLSMGKDTVIVVNDWNHAKEVFKNDDLLARPIGFGNNKHGVSFIQSSGAHWRDHRRLSFHVLHDLDQVRSSFDDKIKTE

IQQFLPKLGKGPVKNLYKTFLSSATNTISFLLLGHGFEDDDPVKQTLIDTLMVSSHTGSQFGAFSSGLRPRIERLFMKP

ILKKEAPVNYHEKTKALPKYLQNEIDQHKKKQTTDFDDYIHGYLQEQKNRKDSSGNVPFDDETLRANIVSLYQAGSETV

STTLVWAILYLIQNPDYYEKIRGEIASVIGFERLPEYSDRVKMPSTMSFIFEVHRIASLVPVNLFRVATRDLKIGNFNV

PKDSTVIVNFWTINHDTFLWIKPYEFDPTRFLVDHGAKSVKPPFLTPFSGGERNCPGEGFANVEIFLYLVSIVQKYKIE

CEPGSTISFEAEYDSIRRPKSIPPLIFTKI

 

>CYP392B5 39g00500.pro x is stop small cap is frameshift

MFLLSLLSSNFISSQLIYNILTGLLTFWFVTYVIPTIKRLFTLPPGPWGLPFVGYLPYLQKHHEYKDLDRLAKKYGPVY

SLSLGKDTVIVVNDWDHAKEVFKSDDLLARPEGFGSNVDGASILEMSGEPWRVHRQNTVHLLRDLGLGKSSFENKINEE

IEEFLPKLEKGPVKNLFKTFLLTATNTVSILLLGHGFEDDDPVKQTLIDALENASKIGSQFMIFKSGLPRKIERLLIKP

ADLNLEVLGDYYQQTMAIPKYMQNEIDEHKKKQSKEFEDYIDGYLKEQKKRENSDSNSNVSFTDKTLRSNMVTFYQAGS

ETVSTTLTWAILYLVKYPEYYEKIRAEISDVIGFERLPDYSDRNQMPMTMAFIYEVHRAASIVGVNLFRAATRDLKIGN

YNVPKGATVMVNFWTINHDPSLYIKPDEFDPSRFLTDNGTKAIKPPFLNPFSKGKRGCPGEGFANVELFLYLVSIVQRY

KIECEPGSTITFESDYVSTRKPISLPSLIFTKVSE

 

>CYP392C1 02g02940.pro >02g02940 +  0000012587

29% to CYP4V11

MLIKSVSLVPRSVLSHYPKVCIPLTSLLVGWGLVWLAKAVRKSIKRRGELPSGPWGLPLLGYLPFMKKHTYLQFDELAK

KYGPLFRLKLGGCNVIVVSEWSHVKDAFANDALLARPEQTLFPGIIDHLSILEMSGEDWKEHRRLSMQILRSIGLTKST

LEIKVKEEINKFLELLGEGKPVDFGEIIGRSVSNNITILVFGHTYDYDDPAKTELDEHINTVFREYQFAGLLAFAPWLA

KIYIALGKGNLDRIAEAVLYGDKFVQLEVDKHRAELNLDSDPVDYIDGFLKEMAKREEKRIPEGTFNLEVLKRNVVAFY

GGGIETVASTMMWIMYYLVSYPDTQINIRQEIAQAIGFSRQPEYSDRSRMPYTMAFINEVHRMGSVLAVNLLRRASKDT

YVGKYLIPKDTYVLFNFWSVHRDPKLFKDPETFDPTRFLSKDGTQLLKVPHLVPFSGGKRMCPGESLASMELFLYVTFI

IQKFKIKVQPGSVISSEAEFGIARRPANLPPLIFEEVGECSCDHD

 

>CYP392D1 23g00450.pro >23g00450 -  0000009957

MFLNVNPTLLNIFFGCLTVWLIKYLFNFIYRLKKLPPGPWGLPFVGYLPFIKKDAYIQITELGKKYGPVFSFKCGQFDV

VVINDALAIEEAFRNDHLLARPNTSFIPGFKRDQSLVEMSGEPWKQQRRVALTILRKVGFGKKTLEDKVKQEINMFIDS

LKSANGAEVDFGEVIKLSVANNISILLFGHRFEYDDPLASEMCRSVKHLVENASYFSKFVFMPSITFLVSLASQFSSEL

NKITSSSEELEKKVTIEVGKHREKKATHEIEDYIDGFLEEMDKQKDPNSSFNMNTLRRNTADFYAAGADTTTLVLNFIM

LYLITYPEYQQKIRDEIKQTIGFERQPDYADRNSMHLTMAFVYESLRMSTIAPLNVHRRASQDTQVMNYSIPKDAIVIF

NFWAVHRDPKLWNDPYSFKPERFLNEDGTLVAKQPNLMSFSGGKRMCPGANLALMELFLYLVSILQNFRVSIPEGYEIS

NEVKYALNRMVKKTMKVHFRDWKDN

 

>CYP392D2 02g04260.pro >02g04260 +  0000012719

25% to CYP4V11

MFLDHFNVNPTLFDIFCTCTTVWLIKHLFNFINRLQKLPPGPWGLPIVGYLPFIKKDAYIQMTELGKKYGPVFSFKGGQ

FDVVVINDGKAIEEAFKNDHLLARPNTTFIPGQDHSIFEMSGETWRQQRRVALTILRNVGLGKSTLEEKIKEEIGLFID

SLKSAQGKLVDFSEVNGLSVANNISILMFGHRFEYNDPFGIELRHNMKQVSDNVDYFTKFIFTTSLSFLIPLAAHFSSD

HEKVTSNQKDLEDKVTIEVAKHREKQTTHEIEDYIDGFLQEMDKQKDSNTSFNINTLRRNAADFYAAGSDTTTHVLNFM

MLYLVTYPEHQQKIRDEIKQTIGFDRQPDYADRASMPFTMAFIYESLRMSTLVPLNVLRRATQDTKVMNYSIPKDTLVI

LNFWAVHRDPKLWNDPHSFKPERFLSEDETTVVKSPYLMPFSGGKRICPGATLALIELFLYLVSIVQNFQVSVPKRTKI

SDESKYLFLRTVKNPVKLNFHTLNEN

 

>CYP392D3 02g04270.pro >02g04270 +  0000012720

24% to CYP4V11

MFLNVNPTLFNIFCAFLTVWVIKHLFNFINRLQKLPPGPWGLPFVGYLPFIKKDAYIQMTELAEKYGPVFSFKCGQFDV

IVINEVKAIEEALKNDHLLARPASTYVPGLKRDPSLIEMSGEPWRQQRRVALTILRNVGLGKSTLEEKIKEEIGYFIDS

LKSAHGNEVDFGDEIKTSVSNNISILLFGHRFEYNDPIGSEMRRNMKQVIENVPYFSKFMFMPVMLVFVSLAAHFSSDL

RKMTSNQKELEKKVTKEVAKHREKQTTHEIEDYIDGFLQEMDKQKDSNTSFNINTLRRNTSDFYAAGSDTTTHVLNFMM

LYLVTHPEYQQKIRDEIKQTIGFERQPDYADRTSMPFTMAFIYESLRMATIVPLNVHRRAAQDTKVMSYSIPKDTIVIL

NFWAVHRDPNLWNDPHSFKPGRFMSDDGQKVIKSPNLMPFSGGKRVCPGATLALIELFLYLVSIVQNFQVSASERDEIH

DEAKYAFLRMVKKPVKLNFHTLKVN

 

>CYP392D4 02g04280.pro >02g04280 +  0000012721

MLFGFNVNPTLINIFCGCLIVWLIKYLFNFINRIHKLPPGPWGLPIVGYLPFIKKDAYIQMTELAKKYGPVFSFKCGQF

DVVVINGTELMKEALVNEQILDRPKDFFTPGMTKIPSLVEMSGEVWRQQRRVALTIFRNVGLGKSKLEEKIKEEINFFT

RKIDSFEGKKFNFDDLIHLSVANVVSIILFGHRYDYEDPFAIEMANSLKKVNQNFHYFYGLTFLPSFYNFISSLSFLSP

NYKKMVQNQMQLEDKVTTEVKEHLEKGDSREINDYIDGYLEAINKQKGENNYSFNLETLRRNVADFYAAGSDTIAATLK

WIMLYLVLYPECQQRIQDEIKETIGSEREPEYADRQQMPYTMAFLYESLRLSSIVALNVYRRATRETHIAGYIIPKDAF

VVMNFWSVHRDPNLWDDPDSFKPERFLNEDGSKVVKSFNFFPFSAGKRVCPGENLSWMELFLYLVSILQKFRIAAPEGE

RISLESKFMFTISPKKPVELVCKRT

 

>CYP392D5P 02g04290stopfs.pro first X is stop codon 457/458 FLW/LVSI is frameshift / indel

MFLDHFNVNPTLLNIFCTCTTVWLIKHLFNFINRLRKLPPGPWGLPIVGYLPFIKKDAYIQMTELGKKYGPVFSFKCGQ

FDVVVINEVKAIEEALRNDHLTARPNETFIPGADPSLIEMSGEPWKQQRRVALTILRNVGFGKSTLEEKIKGEIASFID

VLNSACGKEVDFSEVVGLSVANNISILMFGHRFEYNDPIGIEMRRNLKQASDAFKYFNNFTFMPAMNFFTSLTAKFSSD

LNELISSQNELEKKITEEITKHEEKKATHEIxDYIDGFLQEMDKQKDPNTTFNMNTLRTNTATFYSAGSDTTTHVLNYI

MCYLITHPEYQQKIRDEIKQTVGFERQPDYADRTSMPFTMAFIYESLRMATLVPLNLLRRASQDTKVMSYSIPKDTLVI

FNFWAVHRDPKLWNEADSFKPERFLSNDAQKVIKSPNLMPFSGGKRICPGANLALTELFLWLVSIVQNFRVSAPEGEEI

SDEVNFIFLRMLKNPMKLIFNSLKEN

 

>CYP392D6 02g04320.pro >02g04320 +  0000012725

MLLNVNPTLFNIFCTCTTVWLIKHLFNFINRLRKLPPGPWGLPFVGYLPFIKKDAYIQMTELAKKYGPVFSFKCGQFDV

VVINEVKAIEEAFKNDHLLARPTTSFIPAFKRAPSIIEMSGEPWRQQRRVALTILRHVGLGKSTLEEKMKEEVRYFIES

LKSTHGEKIDFSEVIKSSVANIISILLFGHRFEYNDPMGIEMCRNVKQISDNAEYFSRYIFMPLITFFVSLAAQFNSEL

KKVTINQRELEKKITIEVAKHKEKDSTHEIEDYIDGFLQEMDKQKDSHTSFNMDTLRRNTADFYSAGSDTTTIVLNFIM

LYLITYPEYQQKIRDEIKQTIGSERQPDYADRNSLPFTMAFIYESLRMATIVPLNAHRRASQDTKIMNFFIPKDTIVIL

NFWSVHRDPNLWNDPLSFKSERFLSEDGTKVIKSPNLMAFSGGKRICPGSTLAMTKLFLYLVSILQNFQVSAPEGDKIS

EEVKYNLNRMLKKPMKVHFHV

 

>CYP392D7 02g04330.pro >02g04330 +  0000012726

MFLNVNPTLFNIFCGCLTVWLIKHLFNFINRLQKLPPGPWGLPFVGYLPFIKKDAYIQMTELAKKYGPVFSFKCGQFDV

VVINEVKAIEEALRNDHLLARPDANFVPGFKRAPSLIEMSGEPWRQQRQVALTILSDVGLGKSTLEEKIKEEIGFFIES

LKSANSKNGDFNEIIGLSVANNISILLFGHRFEYNDPVGIEMYRNVKQVIESVTYFSKFMFMPIMLVSVSLTAHFNSAL

RKLTSNSQQLEKKVTIEVAKHREKGATHEIEDYIDGFLQEMDKQKDSNSSFNMDTLRRNTADFYTAGSGTTTHVLNFMM

LYLITNPECQRKIRDEIKQTIGFERQPDYADRTSMPFTMAFIFESLRMATLVPLNPHRRAARDTKVMNFFIPEDTIVIL

NFWAVHRDPNLWNDPHSFRPDRFLDKDETTVIKSPNLMPFSGGKRICPGATLALMELFLYLVSILQNFQVSAPEGDNIS

DEVNYVFLRMVKNPVKLYFNPLKEN

 

>CYP392D8 02g04420.pro >02g04420 +  0000012735

MFLDHFNVSPNLFNIFCGCLTVCLIKYLFNFINRFRKLPSGPWGLPILGYLPFIKKDAYIQMTELAKKYGPVFSFKCGQ

CDVVVINEVKAIEEALKNDHLLARPKTTFIPGRNPSLAEMSGETWKQQRRVALTILRNVGLGKSTLETKIKEEIGHFID

VLKSTHGKEVSFKELSGLSVANNISILMFGHRFEYDDPIGNEMRRNMQKVSDNIEYFTKFVFMPAIFFFVSLAAKFSPE

LRNANSSQKELEEKITEEVTKHREKKATHEIEDYIDGYLQEMDKLKDSNLSFDMNTLRRNTADFYAAGSDTTTNTLSFM

MLYLITYPEYQQKIRDEIKETIGFERQPDYADRTSMPFTMAFIYESLRMSSLVPLNILRRASQDTKVMNHSIPKDTLVI

FNFWAVHRDPNLWNDPHSFKPERFLSDDGTQVIKSPYLMPFSGGKRICPGATLALIELFLYLVSIVQNFIVSPPEGHKI

SDEINYIFIRMVKNPVKLTNFHTLKH.

 

>CYP392D9P 02g04440co.pro frameshift at 288

MFLNVNPTLFNIFCGCLTVCLIKYLFNFINRLRKLPSGPWGLPILGYLPLTKKDAYIQMTELAKKYGSVFSFKCGQFDV

VVINEVKAIEEAFKNDHLLARPNTTFIPGFERASSLLEMSGELWKQHRRVALTILRNVGLGKSTLETKIKEEIGHFIDV

LKSTHGKEVDFKEVIGLSVANNVSILLFGHRFEYSDPMGIEMCCNEKQVSDNVQYFSKMFMPSISFFVSLATQFSSVLR

KMTNSQKEIEKKITAEVRKHKAKKATHEIEDYIDGYLQEMDKQKDSGTSFNMDTLRRNTANFYAAGMDTATHVLSFMML

NLITYPEYQQKIRNEIRQTIGLYRQPDYADRVSMHFTMAFIYESLRISTILPLNVHRRASQDTKIMNFFIPKDTIVIFN

FWAVHRDPNLWNDPHLFKPERFLSEDKQKVIKSPNLIPFSGGKRICPGATLALTELFLYLVSMLQNFQVSASEGEEISH

EVKYAFLRNVEKLAKLNFHILTEN

 

>CYP392D10P 02g04450-70-Mps Translate DNA Sequence 02g04470pseudogenecds(1,1506)

MLLDHFKSNSTLFNIFCACLTVWLIKHLINFINRLRKLPSGPWGLPIVGYLPFIKKHAYIQMTELAKKYGPVFSFKCGQ

CDVVVINEVKAIEEAFKNDHLLARPNTTFIPGFKRASSLLEMSGEPWKQQRRVALTILRNVGFGKLTLEEKVKQEINMF

IDSLKSANGAAVDFGEVIKLSVANNISILLFGHGFEYTGSGNXEMCRNMRQVINNIEYFSKFMFMPSIKFFVFLAAQFN

SELKKVTSNQKELEEKITVEVIKHKEKKATHEIEDYIDGYLQEMDKQKDSNTSFNMDTLRRNTADFYAAGADTTTLVLN

HMMLYLITYPEYQQKIREEIKQTIGFERQPDYEDRTSMPFTMAFIYETLRIATITPLNLHRRSAQDTKVMNYFIPKDSI

VIFNFWAVHRDPNLWNDPHLFKPERFLNDDGTKAVKSPNLIPFSGGKRVCPGANFAMTELFLYLVSILQNFQVSAPKGD

KISHEVVYAFNRILKKPLKVHFHILSL.

 

>CYP392E1 02g05150.pro >02g05150 +  0000012808

MPALVLLGYRLELNSSSINLLLTCVALFLVTCFINLIQRLRKLPPGPWGLPIVGYLPFIKQDAHLQFYEFTKRYGPICS

FACGQFDVILINEWKSIKKALASDDLLARPDQVFLPEVIDAPSFFEMSGEPWKAHRRLALKTLRDVGLGKTKMENQIKD

EIKTLITEIKRHNGKPSNIFQLLSMSVSNNISILLFGHRFDYSDSKTIEMSKALEELNHFGHFFNAATFLPWLAKILVR

LDYQKLEKMRQLFTAIEGHVLSEVESHQQNKETSQIKDYIDGFLEEMDSGTRQDKSTFNITTLRRNASIFYTAGSDTIS

LTLHWIFLYLVTYPKYQDEIRNEIRETIGLDQPPDFVNRLRMPLTMAFIYEVLRFSSIVPVSPLRRATKDIEIDGNLIP

KDSLVVFNLWYTHHDPKLWDNPNIFFPERFLSEDGTKAVKPSYLIPFSGGKRVCPGESFAILQLFLYLVSVVQKFQVTV

ELGETISLESYYVFTRRPKNQVNFIFQEI

 

>CYP392E2 06g03390.pro >06g03390 +  0000022737

MFSTFSKVNSFLIKFFYGLVALFLGNYVIKFVQRVRKLPPGPWGLPFVGYLPFIRQDEYNHVTQLAAKYGPVFSFKCGQ

FDVIVINQWKFIKEALANEHLLGRPKATFIPGVMEHSSFAEMSGEPWKQQRRIALTTLRDVGLGKSEMEDSISDEIKSF

IEVIKSYEGEPISISNKLSLSVSNNISTLIFGHKYAYDDPVILVLEKLRVLTNDTLRYFNVAAFLPTIVSLIIKLNLFS

LSNFKELFKKFESHLDDEIDEHRKKDNNGYEINDYIDGFLNEMSKRQNEKDSTFNINTLKRNAATFYGAGSDTIANTLE

WIMIYLVKYPEYQERIRDEIKQTIGLNRQPENVDRKEMPFTMAFLYESLRFNSLVPLNLLRRATEDTKVGEYSIPKDSL

VTFNFWSVHHDPNLWDNPELFKPERFLNEDKSKAIKPPYLVSFSGGKRVCPGESFAYLQLFLYLVSILQPFEISAETGK

DISLERVQKFLIRPKILPDFIFKNID

 

>CYP392E3 06g04000.pro >06g04000 -  0000022798

MYFTVFNVNLFLIQFLYGLVILFLVNYVIKFVIKVCKLPSGPWGLPFVGYLPFIRQDAYNHMTELAEKYGPVFSLKCGQ

FDVVVINQWKFIKEALANEHLLGRPKEISLPGIIEQSSFAEMSGERWKEQRRIALTTLRDVGLGKSAMEDSIRDEIKSF

TEVIKSFEGESISISDKLSLSVSNHISTLLFGRKYAHDEPLSQVMAKLLAQSDMMKYFNVVTFMPAIARFVIKLNLIDM

AETFSIFKKLESHIGDEVNEHRKKNADCNEMKDYIDGFLGEMSKRQNEKNSTFNLKTLQRNAILFYGAGSDTISSTFKW

IMLYLVKHPEYQKRIRDEIKQTIGLNRQPENVDRKEMPFTMAFIYEALRHSSLVPLNSPRRATEDTKLGGYSIPKDSLV

IFNFWSVHRDPNLWDNPELFNPERFLNEDKSKAIKPPYLVAFSGGKRVCPGESFAYLQLFLYLVSFVQQFEISAELVED

ISLEKVHKHALRKKDVPNLMFKSVD

 

>CYP392E4P 21g00620/30 Pseudogene from Rene

MFFTVSNVNIFLVKFFYGLVTLFLVNHVIKFVQRVRKLPPGPWGLPFVGYLPFLRHDSQNQMTELAAKYGPVFSFKCGKFDLIVINQWKFIKEALTNEHLLGRPKETILPGVIDHHSFAEMTGEPWKQQRRIALTTLRDVGFGKSEMEDSIRDEIKSFSEVLKSFKGKpisisnklsLSVTNNISKLVFGHKYAYDDPVALDMENLLVKSNVLIRYFNVVTFLPTIASMIIKLKLFNMAETFSLFKKFESHIIDEVDEHRKKDIDDNSIKDYIDGFLNEMSKRQNEKDSSFNLDTLQRNAALFYGAGSDTISNTLKWMMLYLVKYPEYQIKIRDEIKQTIGLNRQPENVDRQQMPFTMAFIYESLRFSSIVPLNLLRRATEDTKVGGYSIPKDSLVVFNFWSVHHDPNLWDNPELFKPERFLNEDKSKAIKPPYLVAFSGGRRVCPGESFAYLQLFLYLVSFLQQFEISAESGKDISLERAYYFLVRQKSLPNLIFKSVD

 

>CYP392E5 21g00640.pro >21g00640 +  0000009172

MFFIDSYVDPTLLNFFYGLVTLFVVHYVIKFVRRVRALPPGPWGLPIVGYLPFIRQDECNHMTELAAKYGPVFSLKCGQ

FDVVVINQWKCIKEALANEHLLGRPKETILPGVIEHFSFVEMSGERWKEQRRVALTTLRDVGLGKSKMEDSVRDEIDSF

TERIKSFEGKPISISNKLSLSISNNISTLVFGHTYAYDDPVALDMENMLVQANGMLRYFNVAIFMPSVASLILRLNLFG

LSKFGDLFRKFESHINDEVIEHRKKDIDDNGIKDYIDGFLHEMSKRQNEKDSTFNVNTLQRNASMFYAAGSDTITTTLQ

WIIMYLVKYPEYQNKIRDEIKQTIGLNRQPENIDRQQMPFTMAFIYEALRHSSIIALNLARRALEDTKVGGYSIPKDSF

VIFNFWSVHHDPNLWDNPELFKPERFLDEDKSKAIKPPYLVAFSGGKRVCPGESFAYLQIFLYLVSILQQFEISVESGK

DISLERVQKFSIRPKILPDFIFTNID

 

>CYP392E6 21g0650-60-Mco Translate DNA Sequence 21g0650cds-fs(1,1497)

MFFIDSYVNPTLLKLFFGLVILLLVNYAIKFVIRVRALPPGPWGLPFVGYLPFIRQDAYNQMTELAAKYGPVFSFKCGQ

FDVVVINQWKFIKEALANEHLLGRPKGTAIPGVIKHASLIEMTGEPWRQQRRVALTTLRDVGLGKSEMEDSIRDEIKSF

IELIKSFKGKPISISDKLSLSISNNISTLLFGHTHAYDDPVALDMDHVLFKANDVVRYFNVVRFLPNIASMIIKLKLFN

MAENFHFSKNLNLISNDEVDEHRKKDDNVTKDYIDGFLNEMAKRQNEKDSTFNLDTLPRNAALFYIAGSDTISNTLKWS

MIYLVKYPEYQIKIRDEIKQTIGLNRQPENVDRQQMPFTMAFIYETLRFSSIVALNLLRRATEDTKVGGYSIPKDSLVI

FNFWSVHHDPNLWDNPEQFKPERFLNEDKSKAIKPPYLVSFSGGKRVCPGESLAYLQIFLYLVSFLQQFEISAESGKDI

SAERAFYLLLRQKIQPKLIFKSID.

 

>CYP392E7 21g00780.pro >21g00780 +  0000009186

MFFIDSYINPALLKFFYGLVILLLVNYVIKFVIRVRALPPGPWGLPFVGYLPFIRQDAYNQMTELAAKYGPVFSFKCGQ

FDVVVINQWKCIKEALANEHLLGRPKGTVIPGVIEHASLIEMTGEPWRQQRRVALTTLRDVGLGKRETEDSIRDEIKSF

TELIKSFEGKPISMLHRLSLSVSNNISTLLLGHKHSYDDPVATNMESLFFNANKMLRFFNITSFLPKIARLIIKLNLSG

LREFNSSFKKFESYIDAEVNEHRKKDIDDKEIKDYFDGFLHEMSKRQNEKDSTFNLNTLKRNGTLFYTAGSDTISFTLQ

WMMLYLVKYPEYQAKIREEIKQTIGLNRQPENVDRQQMPLTMAFIYETLRFSSLVPLNLMRRATEDTKVGGYSIPKDSF

VTFNFWSVHYDPNLWDKPEQFKPERFLDEDESKAIKPPYLLAFSGGKRGCPGESYAYLQLFLYLVSFLQQFEITAEPGK

DITLEGIHHFIFLPKTLPNFIFKSTDQTI

 

>CYP392E8 21g00790.pro >21g00790 +  0000009187

MLFEGCCVNQTLLKFFYGLVALFVVNYVIKFVIRVRALPPGPWGLPIVGYLPFIGQNAYNQMTELAAKYGPVFSFKCGQ

FDVVVINQWKFIKEALANEHLLGRPKETFLPGIAEVSSLVEMSGEQWKEQRRVALTTLRDVGLGKSEMEDSIRDEVKSF

TKLIKSFEGKPISISDRLSLSVSNNISKLVFGHKYAYDDPVSLDMESLIAKFNGLFPYFGAGKFLPTIAILMVKFKLFS

LAKIESLYKKFIVHILNEVNEHRNRDAEDNQIKDYIDGFLVEMSKRQNEKDSNFNLDVLERNVAIFYFAGSDTISNTLK

WMMLYLVKYPEYQIKLRDEIKQTIGLNRQPENIDRQQMPLTMAFIYETLRFSSIVPLNLLRRATEDTKVGGYSIPKDSL

VIFNFWSVHYDPDLWDNPELFKPERFLNEDKSKAIKPPYLIAFSSGKRVCPGESFAYLQLFLYLVSFLQQFEIAAEPGK

DVSLEGVHLFLKKQKSLQNFIFKSID

 

>CYP392E9 21g00800.pro >21g00800 -  0000009188

MFFIDSYVSPTLLKFFYGLVTLSVVNYVINFVQRVRKLPPGPWGLPIVGYFPFIRRDAYKQMTELAAKYGPVFSFKCGQ

FDVVVINQWKFIKEALANEHLLGRPKETFLPGVIEHASLIEMTGEPWRQQRRVTLTTLRDVGLGKRETEDSIRDEIKSF

TELIKSFEGKPISMLHRLSLSVSNNISTLLLGHKHSYDDPVATNMESLFFKVNEMLRFFNITSFLPAVARLIIKLNLSG

LREINSSFNGFESYINDEVNEHRKKDIDDKEIKDYFDGFLHEMSKRQNEKDSTFNLNTLKRNGTLFYTAGSDTISNTLK

WMMLYLVKYPEYQVKLRDEIKQTIGLNRQPENVDRQQMPLTMAFIYETLRFSSLVPLNLMRRATEDTKVGGYSIPKDSF

VTFNFWSVHYDPNLWDKPEQFKPERFLNEDKSKAIKPPYLLAFSSGKRVCPGESFAYLQLFLYLVSFLQQFEITAEPGK

DISLEGIHHFLFLPKTLPDFVFKTADQTI

 

>CYP392E10 21g01640.pro >21g01640 +  0000009272

MFFTVSNVNMFLVNFFYGLVTLFVVNFVVKFVQRVRALPPGPWGLPWVGYLPFIRQDAYNQMTELSAKYGPVFSFKCGQ

FDVVVINQWKFIKEALANEHLLGRPKETTIPGVIEHASLIEMSGESWKQQRRVALTVLRDVGLGKSEMEDSIRDQIKSF

TEVIKSSEGKPITVADKLFLSVSNNISKLVFGQTSAYDDPASLLMAKMMPEAGKMKFFNVQQFMPIIANLVIKLNLFNM

TEIISHIRKFESHILDEVNIHKTKNTDDNSIKDYIDGFLHEISKRQNEKDSTFHVNTLQRNAALFYFAGSDTITTTLQW

MMFYLVKYPEYQNKIREEIKQTIGLNRQPENVDRKQMPFTMAFIYETLRHSSLVPLNILRRATEDTKVGDFSIPKDSLV

TFNFWSVHRDPNLWDNPELFKPERFLNEDKSKAIKPPYLIPFSGGRRVCPGESFAYLQLFLYLVSFLQQFEISAEPGKD

IHLESVQNFVTRKKELPNLIFKSVD

 

>CYP392E11 21g01650.pro start at 577460

MRLFLTRAKIFFTVSNVNMFLVNFFYGLVTLFVVNYVIKFVQRIRKLPPGPWGLLIVGYLPFLRQNSYDQMTELAAKYG

PVFSFKCGQFDVVVINQWKFIKEALANEHLLGRPKGSAIPGVIEHASLIEMSGPRWKEQRRVALTTLRDVGLGKSEMED

SIRDEIKSFTEVIKSFKGKPISVSDKLSLSVSNNISKLVFGHTYAYDDPLSLTMAKILAQSNAMSFFNVVQFMPIIARL

IIKLNLFNMGETSSLLKKFESHVIDEVDEHRKKDIDDNVIKDYIDGFLHEMSKRKDEKDSTFNLDTLQRNASLFYGAGS

DTIASTFKWMMLYLVKYPEYQNKIRDEIKQTIGLNRQPENVDRKQMPFTMAFIHESLRHSSLVPLNIFRRATEDTKVGD

YSIPKDCLVVFNFWAVHRDPNLWDNPEQFKPERFLNEDKSKAIKPPYLVAFSSGKRVCPGESFAYLQLFLYLVSFLQQF

EISAEPGKDISLEKLQTFVVRKKEPPNLIFKSVD

 

CYP3/4 Clan outgroup

 

>CYP382A1 13g00230.pro >13g00230 -  0000002220

weak resemblance to CYP3 clan members

28% to CYP3A18 rat

MFCVKVFFAYIIGSSIAWIYRKYQLFQTFTRKGIKGPKPNLLVGNYWDLRQPPDNKLPHEVMNDWIDQYGNILGYYSPN

RCHLVINDVHILKKISVHKAFQDREPLVLDVDPLRHSLFAIGGESWRRSRKTISPLLSRFKVNSPPISDVIDDCVNNYI

SHLRPEEVPTDEPFTINIVENVHRFTFDVICRTSLGMKTDCYSENDQLVQAVVDFFENAFNNAVLLGEMFPFFASILTF

INNYLTAGKMTDTIVGHLKHQVKQFLDSKGKDNQQNEKVVFLKAMLTFLAEEKLTQQEFTGNIYLIVLAGFEATANALI

FCLYLIAKHQHIQDKIRSDLHLEPSNERSYIDMVWLESLRYYPPPISVVNRQASQTVNIEGLTIEKGWVVEAPVWQIHH

SDVYWTDPWLFDPERFSPDNSKSIEPAAFLPYGFGGRTCLGMNLANLEARKFLTTILSKYRITFSEKTMDPIKFKVPTS

ILNPDGPVYLKFEPL

 

>Asterina pectinifera starfish EST DB408526.1 mate = DB394794  N-term

46% to 13g00230.pro in C-term

MELLGFDLSVTWLLIIGFVLIAVWYDWWCHQYFQ

RRGIPVADYIPFFGNILRWRHGVQTTFTEYVKKHGRVVGMYDFRRPVLIITDPDILKNVL

VKNFSSFYNRRKLPLGQKPLNRGLNQLLNEEWKEIRNVITPSFSASKMRLM

 

VIAKMEYLDMVINESLRMYPPAVIFDRMCNETITYEGLTIEKGVNVFASLWTLHYDEEFW

PNPTKFDPERFSPENKDSIKPCTYMPFGFGPRNCIGMRFALLEAKMALVRVLQQYRFDVC

SETEIPPKLGKTSFLAPKSMKLSAVPRN*

 

Query  354  SYIDMVWLESLRYYPPPISVVNRQASQTVNIEGLTIEKGWVVEAPVWQIHHSDVYWTDPW  413

             Y+DMV  ESLR YPP + + +R  ++T+  EGLTIEKG  V A +W +H+ + +W +P

Sbjct  792  EYLDMVINESLRMYPPAV-IFDRMCNETITYEGLTIEKGVNVFASLWTLHYDEEFWPNPT  616

 

Query  414  LFDPERFSPDNSKSIEPAAFLPYGFGGRTCLGMNLANLEARKFLTTILSKYRITFSEKTM  473

             FDPERFSP+N  SI+P  ++P+GFG R C+GM  A LEA+  L  +L +YR     +T

Sbjct  615  KFDPERFSPENKDSIKPCTYMPFGFGPRNCIGMRFALLEAKMALVRVLQQYRFDVCSETE  436

 

Query  474  DPIKFKVPTSILNP  487

             P K    TS L P

Sbjct  435  IPPKLG-KTSFLAP  397

 

CYP3 Clan

 

>CYP319A1 Boophilus microplus also Rhipicephalus microplus

AF261081

MLYIVYA

LIGALLLVGAVILTTRVACCRTWKHVKRMPGPDACGMPMRTILQVQMKAWAMKNVLPATV

VYMQSRFALTLRYQKEGFFAFYLGTRPCITIYKAEHVEVFLNNRHTQSKSIHYELLHSWL

RTGLLTSAGPKWKSRRRMLTPAFHFKILEDFVAPMNKMARLTAARITDRIKEPWIDVVPM

AAACALDVLLDVAERMVRRSQAPWLVLDCLYYRTEDGRQYQKNVSAIHAFTTKVISKRRE

GIINEIHAANSKKDNTPKMDEDFHLTGRTFKRLTFIDILLRYSIEVDSTLTTDDIREEVD

TFMFEGHDTTAMGIAWSLYMIASHHHVQAKIHKELDSVLQSDLDADITLEKIKELKYFDR

VLKECQRLFPSVPVIGRATSEDISLGKHVVPADSDVDIFIYALHRDQVCFQIRSLRPRQV

STGERCTPAPYAYVPFSAGPRNCIGQRYALMEVKIIVATILRRFTLEAVDQRDQLMLACE

LVLRPLNGLKVSFTPRSRSI

 

>CYP383A1 12g02140 Translate DNA Sequence 12g02140trycds(1,1404) 3 clan

30% to CYP3A5 missing ~22 aa at C-term, 32% to CYP3A2 rat

MAIISFLLIVLLIMVLFWLFHRFTFWSRQGVPHESLIKSAYTRYTRPLHIADRDTYTKLGRVFGLFEGFRPCLMIGEPE

YIRKVLVQEFDKFPNHRIFYDGDQISGKSLVALENDEWKCVRKIMTSLFSTGNLKKMKPSIDRCTSSLIEKLRKQIEIS

STVDMKKMMGAYSLDVLASTAFGIECLDSDKTNDVATIVSDFFGHHISIKSIILLWFPFLIKHLNLYVFQYEILTYLKS

IVQKIFDRSRLLKSQTNSNENQVDSVNKNFVTLLDEAQIKIKDKELDNEKFVIDNGVLLVIAGYDTTSTTLSLIIYCLA

IFPEHQQKIVDELESLYLQLARTELTIEEINSLDYLNAVILEVQRYFPVRRAARDCTLGTIKLLKDSLVAIPSYAINHD

PSFFKNPDQFDPTRFLNNNSEQQTIIPDVFLPFAAGPRSCIGKRLALLEIKICLTSLLTHYRFSISLETKVS.

 

>CYP384A1 43g00890.pro >43g00890 +  0000017830 3 clan

34% to CYP3A7, 32% to CYP6AA1

MTLLTSLTSPFASNDVNFWLFIAITAISWLIYKLTHWQRQGIPNDVASLWNRWTKPFHESDTQAYEKYGRVVGMYEFLQ

PVLMCGDAELVKEILVKRFNLFPNHRFYGGINQIGGKSIFVLKLEQWKRVRSIVSPTFTASKLKGMQSQISEAVDTLVD

NIGEAALKNQSIDVKTFLLSFTLDTFSSCAFGVKVDSLRDPYNPLVANSKKLFNTNINWLSLIAFQCPSMAPIGSLFNL

SIFDSSALNYFGQLILNLISKRHELQVDRVDFVKLLQDAEIIDSDAAEHLAKRKLTLDEIVDQALIFLIAGHDTTATTL

SMLLYTLTRHQEVQEKLIDELSTLTDEECSDWDKIKSLPYLDAVVSEILRFCPPVPRVERRTAEPCQLGGIQLKAGQLI

TIPVHAMHHDPEYFPEPEKFKPERFLPESKDENNLTAYLPFAYGPRSCIGTRFAFMEIKICLVKIFRNFRFVPSDQAKD

ELEYYRGQLVTTAKEIILRPIKL

 

>CYP385A1 03g07270.pro >03g07270 -  0000016697 3 clan

32% to CYP3A43

MFFWFILLFIFYLLIYYRQKHGYWKKFGLKGPLPVPFLGTSYVYLRRPLHVVETELIQKYGQIVGMFEGAKPTLLVSDP

EFIKTIALKEFHSFPQSFTFSSYKHPLEQLFPELIWGSKWKHSRGQITQCFTVAKLRKAFPMIEKCSDMCVKSLADEIQ

RCDAIEMKSFWFKYYCDTIFQFCLNLDAHVYQSRDNIIVEKMIDLSRPFIPAFIMNMFLPEWIMKTFHLSALDKKALDY

LEKLVTHLIETRRLRKDERQTDVLNRLIAINETSSEQSTEIELVAAIVDLLFNGFETSSSLLAWCSWRLAFNQDVQDRL

TKEIDSLNSLDYDSLLSAQYLDAVISESLRIDPPETHNERVCHTTYHHPETGIVIPAGSKVSMPIYAMHHNPDNFPDPE

KFNPDRFLPDNRNAIKPFTYIPFGVGYRACLGTKYALLVSKMALAKLLQSYRFVVTPSTTIDLDYDWGSILLCADEINV

GIEKRM

 

>CYP385B1 01g17950.pro >01g17950 -  0000007884 3 clan

33% to CYP6AM1   Hodotermopsis sjostedti, 35% to CYP3A4 human

33% to CYP41 tick

MLPLALADVIQSTKGLSIYFIGFLIFCLIYNRWKISYWYRNGIPGPKSIPFVGNALDLLFKPSFETELDYVRKYGKIVG

IYHGCQPNLIIADPDLIKSITVKEFSCFPESFSFPYLSPIERKFLTVLYGNEWKRVRSLLSQTFTTGKLKKVFELIKSC

MVSRLDDLRLSQDNLESSFIDVKHFWGRYNLDVTAKAFFGTDLNVYSQSKAQQVLYNFEQTFKTNPISMIINMVAPEWF

NRLTRQSAFNTENLEYLEKLAEAVIEARKEHNPNHKYNDFLQLLLESEVNEDTNESNCEGKSVSNDINRQRLSTDEIVS

SAVIFLIAGYETTSTLLSWTCYELTRNPDIQEKLYSEIDSLTDVNYETINECVYLEAVINESLRLHPPVILLPRVAHSD

YQLPGKGSPVLPKGSKAFISIYALHHNPEYYPEPYVFQPERFLPENRSKIKPFTFLPFGSGPRLCIGMRFALINAKLAL

ALFLKQYKLVDNVHTTKDIEHIFQFGVLAAKNLKVGIEKRN.

 

>CYP41 Boophilus microplus AF086809 also Rhipicephalus microplus

MFFFSFLVFYDWLFLAITIAVLLYLRASRHRNYWRNQNVVHEKF

SLFFGSQIKHLYKPLHVVDDELYRKHGRLFGSFEDGKPVLYVAEPELLKSILVKDAAL

TQRKVVEFDDPILSNLMVNVPPEQWKKLRTATSPAFTSGKLRKMQAIIDSCAHFTSER

LKKAATASEDVDMKGFYGHFTLDAVASCSFGVKLSPNSPEEGSFIRSAKNVFFAEVTP

AVMLSTLVQKAGQAFRKRVFNEKAFTFYKNATIDIIKKREENNIRHEDFLQMMMNAKE

VAEQTTVSGEMASEDPGFEGRQQKPQDVKSLSEDEALAQCVLFFLAGQDTASTTTSFA

SYLLAVNPQAQEKLQAEVDECFRKHGSSPSYDIVSKLPYLDCVVNETLRMMTPGTRLE

RVFHEDYMLGETGIKLSEDCTVVVPVYSLHHDPEFFPEPDVFNPDRFSEENINSIRPY

TFLPFGAGPRNCIGSRFAHQLVKTCLLHAVHSVCFVKCPKTKVPLEYRPGFGLLHPKD

LVIGVRERSS

 

>CYP385C1 01g03430.pro >01g03430 +  0000006432 CYP3 clan

30% to CYP6M1 Anopheles, 32% to CYP6a23 D. melan., 33% to CYP6AM1 Hodotermopsis sjostedti, 34% to CYP3A43 human

MLNVTLWIVVFLVSFISWFIFYVKKKHSYWERQGIKGPKPLFLVGTTFAGVDKPIVEANRDFYKKFGNLYGLYDGLQAH

LVVGDPELLRHICVKDFHIFPQGFHFPSLHEIEKSFLINLYGEKWKRIRTLLTPTFSTGKIKRMFNLMKICNKDAQLQL

KNLTKSGEAQFDPKYFWGRYNMDVIAKCCFATNLDVYSNEEDVFLRNFIEFFQGNPLKLLCAAVFPGWFSRLLKLSLFP

PKNLEFLRDLTLTLIENRKNGQNKADDFLQTLIDLETSTEDGDLNKAKLSTDEIVGASMISLVAGYETTSTLLTWSCYR

LAKNPDIQEKLYQQISEVDLDDYETLNSLSYLDAVISETLRIDAPIVLFQRLSHSDYKFPGTNVEIKKGTTISIPVYAI

HHDPANYPDPEVFDPQRFLDGSVKPFTFLPFGSGPRLCIGMRFALINAKLSLAYLVKNYHIFTTDATPSKIKYARGSII

LAAEDLKLGIKPR

 

>CYP385C2 32g01750.pro >32g01750 -  0000014207 3 clan

33% to CYP3A7

MFDFLNQWVVVGIISAISWLFFYIKQKQSYWEKQGVKGPKPLFLLGNVGFSKPITDNLIDNYTKYGKVYGTYQGTNPHL

VVGEPELLRQICVKDFHIFPQGFEQNYLGPVERNFLTALYGEKWKRMRSTLSPTFTTGKMKKMFDLIKICNQEAQKELV

KLTSSKDPDFDPKYFWGRYNLDVITKCCFATSFDVYNSSDDEILRHFVEVFEPNKLKIFILLTAPKWVSRMMKISGSST

ESLDYLKQLTLPIIEQRKKGNFKGNDFLQLLIDAEVVSKEGEELKGEAKKLSPDEIVSSAVIFLIAGYETTSTLLTWAC

YRLATNPDIQEKLYQEVSQANIEDYEVLQDLPYLDAVISETLRIDSPILLFQRVPHSDYILPGTDIKIQKGTVVTIPVY

AMHHDPENYPEPEVFDPNRFLEGSPKPFTFLPFGAGPRTCIGMRFALINAKLSLASLVRNYQLFPNDKTPSKIEHVIGA

VIKTAKTLTLGIKPRC

 

>CYP385C3 63g00030.pro >63g00030 +  0000022222 3 clan

33% to CYP3A5 95% to 32g01040.pro (allele?)

MNNFIDLSTPQWIILGTISFISWYFFYVKRKRSFWERQGVKGPEPPSMFPSILTKSS  PKPKPLTKVYLEGVETYGKIYG

TYDGVDPTLVLSEPDLLRAVCVKDFHSFPQGFNQVFVASIERNFLTVLYGEKWKRLRSILTPTFSSAKIKKMFHLIKVC

NEEAQKQLLKLASSSKPDLNPPQFWSAYNLDVIAKCCFATNLDVYNSSGNKLLEVFNSTFSRNKYKHLFMALAPKWLVR

LLDMSSVSVEHITILKQLALAVIEQRKQGKNKTNDFLQLMLDSEADAQDGEMLKDEDKKLTPDEIVCSCILFLLAGHET

TSTLLTWACYRLATNPDIQEKLYQEVAQANIEDYEVLQSLSYLDAVIQETLRMDPPILLFQRVCHSDTTLPGINVQIKK

GTPVNIPTYAIHHDPENYPEPEVFDPNRFLQGCPKPFTFLPFGAGPRTCIGMRFALTNAKLSLATFVRSFQVFTSDKYA

NQIDPMPGSLINRPMSMLLGVKTRSS

 

>CYP385C4 32g01040.pro >32g01040 +  0000014136 3 clan

33% to CYP3A5 95% to CYP385C5 cyan = indel check intron boundary

MNNFIDLSTPQWIILGTISFISWYFFYVKRKRSFWERQGVKGPEPPSMIPSILTKSS

LK

PKPKPLTKVYLEGVETYGKI

YGTYDGVDPTLVLSEPDLLRAVCVKDFHSFPQGFNQVFVASIERNFLTVLYGEKWKRLRSILTPTFSSGKIKKMFYLIK

LCNDEAQKQLLKLASSSKPDLNPPQFWSAYNLDVIAKCCFATNLDVYNSEGNKLLEVFNSTFSRNKYKHLFMALAPKWL

VRLLDMSSVSVEHITILKQLTLAIIEQRKQGKDKVDDFLQLMLESEADTQDGEKLKDEDKKLTPDEIVCSCILFLLAGH

ETTSTLLTWACYRLATNPDIQERLYQEVSQANIEDYEVLQSLSYLDAVIQETLRMDPPILLFQRVCHSDTTLPGINVQI

EKGTPVNIPIYAIHHDPENYPEPEVFDPNRFLQGSPKPFTFLPFGAGPRTCIGMRFALTNAKLSLATFVRSFQVFTSDK

YANQIDPMPGSLINRPMSMLLGVKTRS

 

>CYP385C5 63g00060.pro >63g00060 +  0000022225 3 clan

32% to CYP3A5, 97% to 32g01070.pro (allele?)

MNNFIDLSTSQWIILGTISFISWYFFYVKRKRSFWERQGVKGPEPPSMIPSILTASSPKPKPKPLTKVYLEGVETYGKI

YGTYNGLNPALVLAEPDLLRAVCVKDFHSFPQGFNQVFVSSIERNFLTVLYGQKWKRLRSILTPTFSSAKIKKMFHLIK

VCNEEAQKQLLKLASSSEPDLNPAQFWSAYNLDIIAKCCFALNLDVYNRSGNKLLELFNSTYSSNKYKHLFMAWAPKWL

VRLLDMSSISVENINKIKQLTYAVIEQRKQGKNKINDFIQLMIESEADTQDGEKLRDEDKKLTPDEIVCSSVLFLSAGQ

ETTSTLLTWACYRLATNPDIQEKLYQEVAQANIEDYEVLQSLSYLDAVIHETLRMDPPLLLFQRVCHSDTTLPGINVQI

KKGTPVSIPTYAIHHDPENYPEPEVFDPNRFLQGSPKPFTFLPFGAGPRTCIGMRFALTNAKLTLARFVRSFEVFTSDK

YANQIDPMPGSFMNRPVSMLLGIKTRSS

 

>CYP385C6 32g01070.pro >32g01070 +  0000014139 3 clan

32% to CYP3A5 97% to CYP385C3

MNNFIDLSTSQWIILGTISFISWYFFYVKRKRSFWERQGVKGPEPPSMIPSILTKSSPKPKPKPLTKVYLEGVETYGKI

YGTYNGLNPALVLAEPDLLRAVCVKDFHSFPQGFNQVFVSSIERNFLTVLYGQKWKRLRSILTPTFSSAKIKKMFDLIK

VCNDEAQKQLLKLASSSEPDLNPAQFWSTYNLDIIAKCCFALNLDVYNRSGNKLLELFNSTYSSNKYKHLFMAWAPKWL

VRLLDMSSISVENINKIKQLTYAVIEQRKQGKNKINDFIQLMIESEADTQDGEKLKDEDKKLTPDEIVCSSVLFLSAGQ

ETTSTLLTWACYRLATNPDIQERLYQEVSQANIEDYEVLQSLSYLDAVIQETLRMDPPILLFQRVCHSDTTLPGINVQI

KKGTPVSIPTYAIHHDPENYPEPEVFDPNRFLQGSPKPFTFLPFGAGPRTCIGMRFALTNAKLTLARFVRSFEVFTSDK

YANQIDPMPGSFVNRPVSMLLGIKTRSS

 

CYP4 Clan

 

>CYP4CF2 01g21010L Translate DNA Sequence 01g21010cds(1,1770)

77% to CYP4CF1   Panonychus citri (citrus red mite)

47% to CYP4C60 Nasonia, 51% to CYP4W1 cattle tick partial seq

MLHLLPSWLDSDNRLTLSFSSLLPIHLFLVASVFSFFVIRRLIEWRRVCQLMAKIPGPPCHWLLGHAKIVLELDKVKFP

YGTYVLIYQMLTSTPLIYGKERIVSMWLGIRPFVFLFTPEAVEVVLSSHSLIEKAAEYDFLKPWLGLGLVTSSKNKWKS

RRKLLTPAFHFRILNDFLPIINENAEILINKLNQLTDNQSGQSSVIDILDYVTLTTLDVICETAMGIKVNCQTQESEYV

TCLHQVSELFLIRISRPWLWPDWAFAISPHGRRYKRCLNVMKTFTMKVIKQRKAEWIEAHENGCKSQEHLTEDQDVLNE

KTHKLENKYETKRMAFLDLLMEHHLKNNVMTIEDVREEVDTFMFAGHDTTAMSISWTLYILGLYKDIQEKVRDEIDAIL

ESSYDNCETNGFTVEQLKQMKYLDCVLKEVQRVYPVAPFIGRELSEDTMINGYLVPKGTTCAIFTYLLHRNEETFPKPE

EFDPDRFLPENSSGRHPYAYIPFSAGPRNCIGQKFAVMEEKAILARVLSHFIIHSVDQRDKLIISGEMVLRSRNGLRIV

LTRRNSKLDTPIKNKYNNNNVIKQSCDTLGMASRNI.

 

>CYP4CF1 Panonychus citri (citrus red mite) 47% to CYP4V2 human

FJ480404 Jiang Hongbo (still confidential)

MLTSASLIYGKERIVSMWLGTRPFVFLYTPEAVEVVLSSNTLTDKAAVYDFLKPWLGLGLVTSKGNKWKQRRKLLTPAFHFRILNDFLPIINENAEVLINKLNQFTDNQSRESKVIDILDYITLTTLDVICETAMGIKVHCQTKESEYVSCLHQVSELSLIRISRPWLWPDWSFALTSHGQRYKRALNVTKTFTMKVIKQRKAEWIETHSKSGQQSKSSSNNQLSSDDQIDGKPTNEFGAKRKAFLDLLMEHHLQNNVMTVEDVREEVDTFMFAGHDTTAMSVSWTLYILGLYNDIQDKVRDEIDSVLESDYNNQDERFTGFTINQLRQMKYLDCVLKEVQRVYPVAPFIGRELSEDTMINGYLVPKGTTCAIFTYLLHRNEETFPNPEHFDPDRFLPENCSGRHPYSYIPFSAGPRNCIGQKFAVMEEKAILAVVLRSFSVRSVDERDKLVISGEMVLRSRNGLRIVLSRRKLGKDFDETSIGSKCNNNQLNCKHNSLSNQPVTRNI

 

>CYP4CL1 50g00750inc Translate DNA Sequence 50g00750tentative cds(1,1653)

48% to CYP4W1

44% to CYP4CF1 mite, 45% to CYP4CF2 mite, 45% to CYP4C53 Daphnia

note: magenta revised later to include 23 aa seq

IILSVLVCFLGYYYLYKKAQAMRRRNQMVDKLPGPKSFNPLMGNLPIEILKYIGADYEASKDLYYIETILSNNFLLDKS

SQYDLLHPWLGTGLLTSTGNKWRSRRKLLVPAFHFKILHDFVPVFNEQGSIMVSRLREIARSGEAIDIVPVVTACTLDI

ICETIMGVSIGAQNNPNNSYCRAVYEVGECFLERLMQPSYWPDAIYYRLERGKEFRRKVQHLHDFTMGVIRDRKDEMMN

KQGRRQSTISLSTGSGEPISLSMPASGERRLAFMDLLLKHHINGGELSEEDIREEVDTFMFEGHDTTAMAMSWIIYLLG

HNMEVQDRLALEVDSLFDDLHSEMRNESNSSSTTEITLDAIKQLKYLDCVVKEGLRLCPSVPLIGRSATEDMTISGHVV

PAGTVIYCFIYQLHRDPEIFPDPEVFNPDRFLPENSGGRHPFAFVPFSAGPRNCIGQKFALAELKIVLARLIRHYRFVS

LDQPDKVLFTMEMVLRPKVPIKVKVYERVFNRTPYGSLNMVQ.

 

>CYP4W1 Rhipicephalus microplus, Boophilus microplus

AF081807

MNAVAFHVLHDVLPALLASFLLYSVAAAAAAFACLAGLLYYIKY

KQRETLVYMGKFPGRTEPIPLVTTWSIHRALSNEAHRLDISTHLFQVAFGFSRIYKNH

GMFRFYDATHPVLVLFKAEAVEELLTSNTVLKKGHEYELIKPWLGTGLLTSSGSKWRS

RRKLLTPAFHFRILEDFLPAVNDQSNILVRKLGQLGKDRSCNIVPLVTLCALDIICET

IMGYTINAQSNQDSEYVQAIKVLGHSFTRRLETPLYWIDAIFQLSKPGREFARKVKEL

HQFTLKVIRERKREILSCPELQESYEETASESDVYGLKGTARKPFLDILLREHIKDPE

NFTEEHVREEVDTFMFEGHDTTAMGMSWAIYLIALHTEHQDLIHQELDTIFGSDKTRP

VTSEDLKQMKYMECCLKESQRLYPSVPFISRKCEEDAVICGRKVPKGTDIQVAIYNLH

HDEQVFPKPDEFRPDRFFPENVRGRHAFAFVPFSAGPRNCIGQRFAMMEEKVVIANIL

RNYKLVALHYRDKIHVMAELVLRPTSGLHVIFIPRVSAKQQ

 

>CYP386A1 32g00230-40-Minc Translate DNA Sequence 32g00230/40Ph2cds(1,1410)

26% to CYP4W1, revised seq has 50 aa where magenta is

MFIMTISALILFYVAYLIYNWIVWMRKFDQYPSYSLSPSQCIFALKEIIKGPEYILKN CN FTQAFKPFLSDGLVLKNGE

RWKKFRKIGEMNLKTKMLSSFIPTMSKHGNTFITKLYSKTDSWVDLQKNLSLTTFNVISECAMGISTESDNLQNDAETL

FSLAPDAPAYAIKRLFNPLLWPEFIYLGYCDYATSGKIKVCSTLFKHLVNKEISRQQIYYVNDIDHSDEEKEEIFLDKI

RDNYLSHLVSLYIDGLNGNDDEIPIEDIEYEINNFIIAGFETVKVSVLWTLACIASEPEIQERIYREINDVLDDDGYDI

EKLNQLTYLDCCVREGLRLFPPIFSTGRTSQTDGAFAGRLLPKSTEIITIIWAVHHDETIYPEPEKYDPDRFSSERVES

IPSSAWIPFGFGPRTCIGYRFALCEAKLLISLIIKHFTIQTNKFYDQIDFTAVITLKPIEPMLFKFTPRGQILL.

 

>CYP387A1 13g04130-50-M Translate DNA Sequence 13g04130-40cds(1,1548)

30% to CYP4CE1, 56% to 05g07300.pro

MDYIKTLFNAKLLQIVVFGPISLLLFVLIRKVYQILSWILHFRSFPQNRGHFILGNVKQLVPSFPSFASSATSTTISEF

ISECMKVDNEGVFVFWLGWYPMVAITDYKGAEAVLSKPNQKKGEEYKFLGLQDGIVASHGQKWRARRRMIDPFFNAKSL

TSYIPLMNQAFSLVTKDLKEEKVETIDMAHNIHIGSLNVIMESTMSIPVDSMKDYKKVILSDLESVEKIALTRILNPIL

WFDKIFFQTKGGKFFKEAVDRFDAVLIDKITERLDSRKLKVDEKEQKMRHDLIDLLAVHHDPNSNDVTQSIDIEGMKAE

IVNVIIAGHDSIAAGIRWTLFLLGNHIECQEILYNEIATSFADDQYPTTLDEINRLTYLDQCVKESMRLYPPIPLTSYQ

LEYDAEVGKYVVPKGTAVAFSFYTIHRDEKIWENPNQFDPDRFSPERYSKIPRYGYIPFGLGKRSCVGQKFAMIEMKVF

IIHLIKHYSWISTKNVDEVKFAMDVSTKPLEPLNIKLTPRN.

 

>CYP387A2 05g07300.pro >05g07300 -  0000021571

MDIAMYFIKSVWLNSKLLQLLTLGPLSILLFVLFKKLYNAVRFILHYRSFPSKKSHLFFGDLKELIPSFPSLSSKASST

YAAEFILDQQAKNENEGVFVLWVSWYPVVSACDYRAAEAILTKPNHDKGSFYKFLGLKDGLVVSHGPKWKARRRMIEPF

FSTKTLSSYLPSMKQSFRSMIKELGEEKMESIDMGENIHKCSLDIIMKSTMSISIESLRERKNEMIRDLDFCEKTVITR

MLNPLLWPENMFYNSELGKIFKECENRIDHFTESKIKERLESRTELPKVNESEREMRNDFIDLLLNHYKPDSTDVTKSI

DIEGMKEEILNLIIAGHDTIASGLRWTLFLLSCNLDCQEKLYNEISSSLDDDDNLTDLEAISKLTYLDQCIKESMRLYP

PVPILARILDHDAQVGKYRILKGTVIIFSYYAIHRDSKVWENPDSFDPDRFSEERFAKIPKFAFIPFGHGQRSCIGQRF

AMIEMKLFIIHLVRKYKLVSTQTVDQVKFDMDVTMKPKTPLTLKLFPRETLA

 

>CYP388A1 02g04700.pro >02g04700 +  0000012763

29% to CYP4V1

MLILDYIIYPASKLAIIWIIYKLLEISIRAYRLAAHYQDFPCEKSHWLFGDLLKIAPRLPKTDREEIASNVRKFIYRNY

FETEKRNDILIAWMSWIPVVICSSHKTLEPIITKPETRKHHIYRWLGMRDGLVSSSGSKWKARRKIFEPLFASKQLSQF

TTFIRSNTVDIVNSMESKCHQPINLSDYIHQLTMNSIFEAAFKLPPDSYKQQKKVLIEGIAAFEDSLMERICNPLYWSD

WIFEQFNLGKQLNEVQKYGDVEFNKIINKRLQTNNNTDHLQLDDSRTSRDMIDLMFKHNNGKGNIDRSGMIEEMLTMVA

AGHETIANSLSWLIFTLGNHPEIQDRIAEEINEVIGDLDDFSDLSILKQLVYMEQCIKESLRLVPPLPVVLRHLESDVQ

VGSKVLLKDSVVVLFILGAHHDPTVYPDPFTFNPDRFAPENIDSIPKYAFLPFGLGPRMCIGYRYAMMEIKIFLSQFLR

RYRVKSCKTMEEVTYYIELITRPSCPLEVIISPREL

 

>CYP389A1 27g03020.pro >27g03020 -  0000011597

30% to CYP4BM1, 28% to CYP4v3 mouse

MSGLLHDNVISVNQFIVKLIGITIIYYLFTKIVYFFKWFNRFHRFPSEPSSFLFGHALKFIPSKASTFIEKLTQFIERN

VKANRDKSGLFAIWITWKPMICCCSHQAIEAVMSKTNITKPSFYKFFGLKDGLVTSNPTKWKLRRKMVEPFFVSKQQKL

FINTMNHVFDKLVNQTLVELSIRGQPVNLHSYIHQSMLDIIINATLHIPMESRKSEKKHIIDTIDLIEKAAYGRIFNPV

LWFNSIFSSTKLGKKFIKDTNIFYDFLTTQINSKLDNNSNVIESRSQESLPCDLVSLLMQTSGGDIDINGINEELVTII

CAGHETTSVSLNWTLFVLGNCQDVQEKLYREISSVFHESGQMNDLEKINQCHYLDMCLRESLRLYPPIAYVFRDLDEDA

SINKDYTIPKGTTVLINILSAHRDPQVYPNPDDYIPERFDNTNKNNIPKGSFLPFGFSPRNCVGYRFALIEMKIFIIHI

LRRFRVESTKKLDDVQYIVEFALKPTRPLDFILHERSTQ

 

>CYP389B1 27g03030.pro >27g03030 +  0000011598

MDHNIWISFPKAISLVGYLIIAYFIHITLLKPTLNLLHKIYHYHGLHCLPKNFLFGHLKLLSPNFPFPSNMEDISRNMY

TWFEQTISTNKDRSLSVMWLGLFPVIIISDHAAVEAVMTKTNVKKPFFYKYIGLKNGLITSDPSLWKIRRKAIEPFFVT

KRQKHFVKLMEQEIREIPEKLLNQIDKPIDMEHLIHTSTLRIIERVVGSIPLDDLKEEKEITLDLLTSIEQIAMKRAMN

PLLWFDILINFFETGKSYLKNLERIETLMHSYMEHRKKVITLSPPKQPEEYDLVHLLEKHTDQTGTLEELVTSIAAGHE

TVSVSLRWTLFSLGNHPEIQERLYHEIIEHFPGDTPTDDFDKINACTYLDKFLKESLRLNPPVHFIGRVLDEDIKVNGT

KIFKDTNIFICITSTHRDPSIYPDPDKFDPERWNPENSSKIPKSAFIPFGYGPRNCIGYRYAMMELKVYLIHILRKFSM

KSTRTSESIPLKSEISLKPALPLEIILTTRHNINQEMKDL

 

>CYP389C1 03g11140-50-M Translate DNA Sequence 3g11140/50cds(1,1524)

MANVQLFTIETVKIISLSTVSYFVYIYLLKPVLDFVYSIIYYHGFNYYPKSLLLGHFRQIMPNFPFTDNMENATRNLYE

AIDKNIKHNQDGSLSVFWLSVIPVVLISDHEAVRIVNNKTNLKKPYLYKLIDFGTGLLTSKPDIWKVRRKLIEPFFATK

KLKGFVKVMNEEVTSFTEQLNGEIGKPVNLESQIHYSTLNIILKVVTSLPLKDSFLVKKAAVEIINEKTEYVIKRGANP

FYWFDWIFRFFQFGRTYFKNKEDGEKLLSYALHRRKQLSLSNEPEDQDLIHLLECKVDEKGVFDEFITMIGAGHDTVAV

ALRWILFNLGNHLDKQERVYQELVDLFPDDTPVDDLDRINQCQYLEQFIKESLRLNPSVHGTAKVLEEDVTIRDKKLLK

GSYVWTIISSTHRDPSVYPDPDKFDPERWTPENASKIPQGAFIPFGYGPRSCIGSRYAMAKLKIYTIQIVRKFSLKSTR

KTESIPVKFEVTLKPVLPLEIILTPRNGNNNQS.

 

>CYP389C2 42g01090.pro >42g01090 +  0000017664

MAFSGLMSVESLKLGLLPIVSYFIYVYLLKPALHFVHRAIHYHGFPCYPRNFIFGHSLLFWTNFPFPYNLESFQRMFHE

ATNKLAAHDQDQSLTVCWLTLHPNVLPVSHEAVEVIMNKKNVRKQFFYKFMGLGNGLVASEPALWKVRRKLIEPFFSTK

KIKGYAKHMDQEVKSFTQQLNTETGKPVDLEDQIHSSTLNIILKSALSIPLDDSIEDKKSLTELVNKVEPNLVRRSLNP

LYHIDWVAKFTKFGRYYFETLDLVEKVLARMLNRRKQLLSSTSHESENQDFVSLLEGKVDQQGFFDELITMIAAGHETT

AVGLRWILFNLGHHPDVQERLYREIVQFFPDDTPVDDMDKINQCNYLDQCIKESLRLNPPIHVFARYLEEDVVVKDKRL

LKDTGVLVSCPIIHHNPNVYPDPEKYDPDRWTPENASKIPKAAYIPFGYGPRSCIGYRYAILELKIYTIQIIRKFSLRS

TRKHESIPSKFEITLKPCLPLEIIVTPRNNN

 

>CYP389C3 42g01110.pro Translate DNA Sequence 42g01110transcript(1,1518)

MAFSGLMSVQSLKLGLLPIVSYFIYVYLLKPALNFVHIVIHYHGFPCYPKNFLLGHLKLLWTNFPLPYNVERMKRKFYE

VTNKMAAHDQDQSLTVGWISLHPIIIPVVPDAVEVIMNKKNLKKQFFYKFMGLGNGLIPSEPALWKVRRKLIEPFFSTK

QMKGFAKHINQEVESFTKQLYGETGKPVDLEDQIHSSTLNIILKSSLSIPLDDSIEDKKSLTELVNKVELNGVKRCLNP

LYYIDWIAKFTNFGRYYFETLDSVEKILKKMLIRRKQLISSTSHESENQDFVLLLEGKVDERGFFDELITMIGAGHETT

SVGLRWILFNLGHHPDVQERLYQEIVQFFPDDTPVDDMDKINQCNYLDQCIKESLRLNPPVHALSRDLTEDIMVKDKRL

LKGSIVVVSISIIHRNPNVYPEPDKYDPDRWTPENASKIPKAAYIPFGYGPRSCIGYRYAILELKIYTIQIIRKFSLRS

TRKHGSIPVMSAVTLKPCLPLEIIVTPRNNN.

 

>CYP389C4 42g01120 Translate DNA Sequence 42g01120transcript(1,1518)

MAFSGLMSVQSLKLVLLPIVLYFIYVYLLKPALHFVQQVIHYHGFPCYPRNFLFGHLLLFWTNFPFPFNVESFQRKFYE

ETNKMAAHDQDQSVTVCWRSLMPTIIPVSPDAVEVIMNKKSVKKLFFYKFMGLGNGLIASEPALWKVRRKLIEPFFSTK

KIKGYAKHMDQEVKSFTQQLNTETGKPVDLEDQIHSSTLNIILKSAISIPLDDSIEDKKTFTELINEGESNLVRRSLNP

LCYIDWVAKFTKFGRYYFETCDSLEKVLKKMLNRRKQLLSSTSHESENQDFILLLEGKVDEQGSLDELITMIGAGHETT

AVGLRWILFNLGHHPDVQERLYQEICQFFPDDTPVDDMDEINQCNYLDQCIKESLRLNPPVHVFIRELEEDVMVKDKRL

LKGSTVLVSCPIIHRNPNVYPDPEKYDPDRWTPENASKIPKAAYIPFGYGPRSCIGYRYALLELKIYTIQIIRKFSLRA

TRKRESIPIKFEVTLKPCLPLEIIVTPRNNN.

 

>CYP389C5 14g01180-90-M Translate DNA Sequence 14g434531RCorf(1,1533)

MASIGLFSVESMKLVLFSIVSYFLYVYLLKPTLNFVRMVIHYHGFHCYPKHWLFGHGKEVWPNFPFPIETKRLAMNLYE

FFPKIIGPNQNLTVLWISMFPVVFASGHEAVEIVLNKKQLKKPHIYKFMGLRSGLLTSEPAIWKVRRKLIEPFFSTKKM

KGYAKAIYEEVESFSQHLEGEVGKPVDLVNQIHTSTLNIILKSTASIPLDDLIEDKKILIELVSAVEKNSVKRVSNPFY

QFDWLFKFFKFSKIYYKTMEDAEEMIHKILNRRKQLLESSPPNGPEDQDFVHLLEDKVDREGLHDEMMTLIAAGHETTA

VALRWLLFNLGNHLGVQEKLYQEIIEFFPDDTPVDDMDKINQCNYLDQCLKESLRLNPPVNGAGRVLEEDIMVKDKRLL

KGSIVGVTCLACHHDPSVYPNPDEYDPDRWNSENVSKIPKASFIPFGYGPRICIGLRYAMIELKIYTIQIIRKFSIRST

RKHGNIPILYEITFQPALPLEIIMTPRNENQQKLFH.

 

>CYP389C6 14g03530 Translate DNA Sequence 14g1239659gene(1,1533)

MSYIGLFSVDSLKLLLFSIISYFIYVHLLKPLLHYIYIVIHYHGFHYQPKNFFLGHWKEIWPNFPFPIDLENFSKNLTE

FTYRAIGSNPLQSLQILWISIFPVVFAFGHEAVELVLHKKNLKKPKAYTFIGIGDGLLASEPEVWKVRRKLIEPFFTTK

KMRDHAKHMYEEVKSFGQQLDGEVGKPVDLVHQIHTSTLNIILKATASIPLDDLSEDKERYVELVNKVEKNAVKRVVNP

FYQLDWMFKLFKFSQVYYKTIKNFEKATDKILSRRKQLLKSSPSNETENQDFVDLLEGKVEKQGLYNELVTLIGAGHET

TAVALRWLLFNLGNHLDVQEKLYQEISEVFLGDTPLNDTDKIKECIYLDQCVKESLRLNPTVVGVSRELEEDIILNDTK

LIKGSICGVASLAVHHDPNVYPNPTKYDPDRWSPENASKIPKTAFIPFGYGPRICIGYRYAMLELKIYTAQIIRKFSLR

STRPHGSVSMLYEVTFQPSLPLEIIMTPRNNNQSNL.

 

>CYP389C7 14g03550 Translate DNA Sequence 14g1243188orf(1,1533)

MDFYSGLFSVGSLKVLLFSVISYFVYVYLLKPALHYIYIVIHYHGFHYQPKSFLLGHVKQIWPNFPFPIEMKTVAGNLY

EKMLKIVGPNPSRSLSVLWISIFPVVFASGHEVVEILHRTNLKRPHFCKFLGLGDGLISSEPDVWKVRRKLIEPFFTTK

KMRDHAKHMYEEVKSFGQQLDKEVGKPVDLVHQIHTSTLNIILKTSASIPLEDSIEDKERYVELVSTVERNAVKRAANP

LYQLDWMFKLFQFSQVYYKAISSTVEIINKMFRRRKQLLKDSSSNEPENQDLVGLLEGKVDEQGLLDELITLIGAGHDT

TAVALRWNLFNIGNHLDVQEKLYKEIIQFFPDDTPIDDMDKLKECVYLEQVIKESLRLNPSVPGTTRVLEEDIMLNDER

LIKGSMVNVSSLATHYDPNVYPNPTKYDPDRWSPENASKIPKTAWIPFGYGPRICIGYRYAMVELKIYTAQIIRKFSLR

STRPHGSVSMLYEVTFQPSLPLEIIMTPRNNNQSNL.

 

>CYP389C8 14g03570.pro >14g03570 +  0000003266

MVDIGLLSLQTLKLFLFSATLYYIYVYLLKPALNFVYMVIHYHGFPSYPKNFLLGHLKHFWTNFPFPNDAASVSKNVYE

AVNKIVAHNPDESLSVAWISIYPVIILTGHEAVEILLDKKNLKKPHFYKFMGLGDGLIPSDPEIWKVRRKLIEPFFSTK

KMKDHAENMYQEMESFGQRLHDEVGKPIDLVHQIHTSTLNIILKSATSIPLDDSMEDKKKFTKLVDKIEPNLCRRGTNP

FYYFDWLFKFFEFGRAYNKTNDMIAEFINHILTQRMEIFENALNEPENQDFIHLLEDKIDEQGIHNELLTLIIAGHETT

AVALRWILFNLGNHLDVQEKLYKEIIQFFPDDAPIDDMDKIKQCNYLDQCVKESLRLNPPVYGIARVLEEDIMVKDKRL

IKGSVVGVMIEATHRDPKVYPNPKKYDPDRWNPENASKIPKAAFIPFGYGPRSCIGYRYAMIELKIYTIQIIRKFSLRS

TRPHGSIPLKADITLRPVEPLEIIMKPRNHN

 

>CYP389C9 14g03590 Translate DNA Sequence 14g1249462orf(1,1536)

MAFYSELFSVGPLKLLLFSIVSYFIYVHLLKPALHYIYIVIHYHGFHYQPKSFLLGHLRQIWPNFPFSIDRKSLAASII

KQLCKTVGPDPSRSLSVLWISLFPLVCASGHEIVEEILHKKNLRKPRINNFVGLGDGLLISEPALWKVRRKLIEPFFTT

RKMRDHVKNMYQEVKSFGKQLDEEVDKPVDLINHIQTSTLNVILKSSAGIPLDDLKEDKEKLVELIAIGERYGVQRMGN

PFWHFDWIFNMSTFSKAYYKTIENMKEMAHTIFRKRKQLLQSLPSNQPENQDFLFLIEGKVDDQGLLDEMNTLIAAGHE

TIELALRWTLFNLGNHLDVQEKLYKEIVQFFPDDTPIDDMDKLKECVYLDQCVKETLRLNPPVWGFARQLEDDIMVKGQ

RLIKGSIVGIVVEATHHDPKVYPNTKKYDPDRWNPENASKIPKTAFIPFGYGPRMCIGYRYAIIELKIFTIQIIRKFSL

RSIRPHGSIPQKAEITLKPVEPLEIIMKPRTTTKLVN.

 

>CYP389C10P pseudogene from Rene = 14g03600

SVHLLNKFSGNVFRHQDCRAGSIIKGFNFSFFSFFAFFFIYSENAVNKIVAHNPDESLLVAWISIYPVIRLFASFILLDKKNLKKPHFYKFMGLGDGLIPSDPEIWKVRRKLIEPFFSTKKMKDHAENMYQEMESFGQRLHDEVGKPIDLVHQIHTSTLNIILKSATSIPLDDSMEDKKKFTKLVDKIEPNLCRRGTNPFYYFDWLFKFFEFGRAYNKTNDMIAEFINHILAQRMEIFENALNEPENQDFIHLLEDKIDEQGIHNELLTLIIAGHESTAVALRWILFNLDVQKKLYKEIIQFFPDDAPLDDMDKIKQCSYLDQCVKESLRLNPPVYGIARDIMVKDKRLRKGSVVGIVVEATHHDPKVYPNPKKYDPDRWSPENASKIPKAAYIPFGYGPRSCIGYRYAMIELKIYTIQIIRKFSLRSTRPHGSISLKAELL.

 

>CYP389C11 14g03610.pro >14g03610 +  0000003270

MAFYSGLFSVGSLKLLLFSIVSYFIYIHLLKPALHYIYIVIHYHGFHYQPKSFLLGHLRQIWPNFPFYIDRKTLEASIY

KQLHTIVGPDPSRSISVFWVSLFPLVFASGYEIVEEILNKKPLKKPMIYRFLGLGDGLISSPPAIWKVRRKLIEPFFTT

RKMRDHAKNMYQEMESFGKQLDGEVGKPIDLIHHIHTSILNIILKSSAGIPLDDCMEDKKKIVELVATGERNAVQRLIN

PFYQFDWIFNLSTFSKAYYKAIENFEEMAYNIFRKRKQLLQSLPSNQPENQDFLFLIEGKVDDQGLLDEIYTLIAAGNE

TIELALRWNLFNLGNHLDVQEKLYQEIVQFFPDDKPIDDMDKLKECVYLDQCVKESLRMNPPVWGFARVLEEDIMVKDK

RLIKGSVVSVLVEATHHDPKVYPNPKKYDPDRWSPENASKIPKAAFIPFGYGPRSCIGYRYAMIELKIFTIQIIRKFSL

RSTRPHGSIPQKAEITLKPVEPLEIIMKPRNNN

 

>CYP389C12 14g03620.pro >14g03620 +  0000003271

MSYIGFISVDSLKLLLFSIVSYFIYVHLLKPLLHYIYIVIHYHGFYCQPKSFLLGHLRQIWPNFPFSMDRKTLAVSIYK

QLYKNVGPDPSRSLSIFWASLLPLVFASGHEVVEEILHKKNLKKPMIFKFIGVGDGLLSSEPALWKIRRRLIEPFFTTR

KMRDHAKNMYQEVESFGKQLDEEVDKPIDLIHHIHTSTLNIILKSSAGIPLDDLKEDKAALVELVATLERNAVHRIGNP

FYHFDWIFNLSTFSKAYYKTIETIEGKIYNIFRRRKQLLQSLPSNESENQDFLSLIEGKVDDQGLYDELITLIGAGHET

TAVALRWNLFNIGNHLDVQEKLYQEIIQFFPDDKPIDDMDKLKECVYLEQVIKESLRLNPSVAGSARVLEDDVMVKGQK

LIKGSVVGVSGLATHHDPSIYPDPEKFDPDRWSPENASKIPKTAWIPFGYGPRMCIGYRYAMVELKIYTAQIIRKFSLK

STRPHGSIPITYEITYQPTLPLEIIMTPRNNNQ

 

>CYP389C13 14g03630 Translate DNA Sequence 14g1260949orf(1,1533)

MYYSGLFGVDSSKLLLFSIVSYFIYVHLLKPLLHYIYIVIHYHGFHYRPKSFLLGHLKQIWPNFPFPIDTERRTRNIYE

LTDKIFELNPSRSLTVLWISLFPIIFASDSETVEMILHKKNLKKPHFYQFMGLGNGLLSSAPALWKVRRKLIEPFFSTR

KMRDHAKHMFKEVESFSRQLDDQVGKPVDLVNQIHSSTLNIILKSATSTSLDDSFDDKKRFLELIESLEKNCVRRLSNP

FYQLDWTFKLFKFSQFYHQTIQDIEKFINTILSRRKQQLQCSTSNEPENQDFVDLLEGKVDEQGLLDELVTLIGAGHDT

TALTLRWILFNLGNHLDEQEKLYQEIIQFFPDDTPLGDMDKINQCIYLEQCIKESLRLNPPAHITLRALEEDIIVKDKR

LIKGSIVCVSFTATHHDPNVYPNPDKYDPERWNPENASKIPKTAFIPFSHGPRSCIGYRYAMLELKIYTIQIIRKFSLR

STRKHGSIPLKAEVTLKPVLPLEIIMTARNNNQPEL.

 

>CYP390A1 13g00830 Translate DNA Sequence 13g0830yellow(1,1545)

37% to Chicken 4V over 375 aa. 34% to CYP4W1

MWSSTHLMFTSSSHFLTTTSIVQGTFVALITIILYKIIKYLIFLSKFKGLPQEKTNFIFGDLHQFRFANIIKPFINLQQ

SETCRHQSFRLISSVILSSRHHINKGLFYKIIAPFMKDGLITSKGDKWRNRRRLIGPAFNTTIISQFIPLMINNASMLV

KSFREASSSSKRAVNIVDYIHLTSMDIICKTAMGISPEAQSKPSSLVVQAVTWMTKELAHRIYNPFLWVDLIFVKSPMG

QSFRRHLQNFEHFTHSIIHSKLKLLRDKSTIELEKADQKDSSFLDLLLEKHLQPSANDGKPIIDLEGVQEEISTFLFAG

YETTGTAIMWIIYLLGLHTEVQDKIHAEINSILDDNIDDLSYNQIHKFNYLDQCIKEGLRLFPPVPMIARELDQEVILD

GFKIPRGASVAIMIYSIHRDPIIYPDPDSFNPDRFDSDHISSIPAYAYIPFSAGPRVCIGQRFALIEMKIILIQIIKNF

RLISTKPLNQIPYEFEVTIRPKVPLDVNFIPRNSNCDDVL.

 

>CYP390B1 03g09030inc Translate DNA Sequence 03g09030partial cds(1,1290)

missing N-term ~117 aa

31% to CYP4C1, 32% to CYP4C39

LFLGNRNNLEKGWFYNFLDPRFKNGLIGATLDKWSKRRKLVLPALNRRAMENFVPIVVNSCHSLINDLTSTSSCPIDIK

DPIYLATFNIICQLVMGAITSFTKPIMSRVVNPLFRLDWLFHCTSLGKTYRHHVNIFNTFSNQAITNRLKTIQSTRPHS

VNHRPSDLEQTFSGLEYNSMRKSTTKSILDYLLTIYLDNKDSLESQSSSFKLKSHHSIDIKGIKEELDNTLAAGYETTA

IAIMWTIYLLGLNPEIQRKAYEDVLDLPLDESDSSTLTLDHFNGLTYLDQCVKESIRLIPPLPMIARKLDSDVVCEGVK

IPAGSTVGIMIHMIHRDENIFPNPNVYNPDRFNPERLTSIPACGFIPFSMGPRNCIGQKFAYLEIKIVLAFILKHFTII

STEPMDKITYEHEMITSPKVPLNVKFISRETHIH.

 

>CYP391A1 01g01050-3i Translate DNA Sequence 01g01050cds?(1,1599)

33% to CYP6CF1 Pediculus humanus, 32% to CYP4C3, 32% to CYP4V2 human

36% to Xenopus 4V

MIEYSLLLVALNRLIITLALLVLIKFIYNYFKVVRHFSKFPHVKGHCILGNLVDIKTNLLKSDEFAEQQLQIQFMQKHA

QPVQKEGVFLAWIFCKPMVFLTNYQSIKLVLSSSKHLEKGDVYYFWHPQMGLGLLTQHVNKWRSRRKMLEPAFHIDNLR

NSVETVGKHADSLVKYFQGHVGTVLDVKELMPRAALDIVCDTVLGVSPDAINVPNSSYVRAIMNLKKRVITRLFNPHYW

LDFIFYRAQIGKEYKKDIDTINAFSTQVINEWKSRAVKEKKMMNGNDLNANSQVDDDDDVFSSKKRPNLMDILLRHHLD

DSITDESLKIDEIDMQDEVNTFIEAGHDPAGVVLTWIMQLLGCHTDIQERVYNEIKETLADVPFPYSWNDLANLTYTEA

VIKECLRIRPPVPFLQRILDEDVTYGPYVIPKGECVTLSIFSLHQDPEIYPEPHVFNPDRFLPEQIKSIPPFAFLPFSG

GKRGCLGQRFTYMELKMILSRLLLRYRFKSVKPFESIPYAFELVNRPKAPVEILIEQR.

 

mito Clan

 

>CYP302A1 42g00720.pro >42g00720 +  0000017627 mito clan

35% TO CYP302A1 TRIBOLIUM 33% to CYP12A1

MVANHHLIKSLSCHSSLSPGKAAKIISTRSFTSPNTVCQAKPYNQIPGPKPMPLIGNTWRYLPYIGEYDIEKTPENCEA

NLKKYGPLVREVLFGKFSILHVFDPSDMDSVFRNEGKYPYRRSHRALCKYRHDRPHIYSSGGMFTENGDAWYRSRKLVQ

SMLLNQSQINQFIPEISLTADQLISNILEIRSLSGSVENLMPHLYRWALETNGRVFVGQQLGCLNLNGTSESEALFGAI

HETHEAIMATELAATNLWQYFPTSDYKRLVKSQDVMGDIISKFIENIDHNSTSIHGAKSIVSQLFNQPEATKKDIFTII

MDLFLAAFDTTSFVVAFALYHLSCNQKCQDQVRKELFEIFPSGKEPISVESLQQMKYLKACVKESMRINPFSIGTGRVT

TRDMTIRGFHIPTGTMIIVQNQVACMQESNFPRPNEFIPERWLTLERGNWPKASPFAMLPFGYGARMCIGRRLSELELY

ILIAKILRNFRVEFDHDEPFRAKTRFINVPVGPLKLRFIDISN

 

>CYP314A1 02g01690inc.pro >02g01690 +  0000012462

MIGTKLKQVISQYFSRLSIFKLHEALEAKHSRYGSIKIEKRYWPIKRTIVYVFNPADIEKILRAQGKCPYRPANEFLVK

YRKSRPDRYPTVGFSNLQGEDWFSQRLLIAPVLLSNSIANVYTPQLNIIVNDFVNYLQHQSQQKDGIIEDLLKCTDQFA

LESIALISLNTRLGCLSTGGSSEDAKRLIAADKSLFEAFQVLYHGIPWWKFWPTPSYRKFVSAEDEIYNISSKYVDSAF

DDLVSSKTLNSTDPDGTSLGKNQDDDSSSLMKTLLKTKGLEKAHLKTLAIDFMVGGVNTVSSSLCFLLYHLAQNPLHQE

KLFSELDKVIGDPNVDMNEKHLSQLPYLKACLKESFRLTTVIPNLVRVLPEPITLSGQTIPAGVPIMLNFGVICKHADY

FENPELFKPERWIGEARRSIHPFSLLTFGLGNRMCAGRRISEIELYLAAAKIILKYRLISKTPDLKLKQDFIIVPENKI

KVALEIR

 

>CYP315A1 06g08300 Translate DNA Sequence 06g08300cdsshort ?(1,1590)

MQSQCPFSGSKQFAQSSVNNSGMDGRLVYKDIHQLRCPNYSSAQPFEEMPTPKSYPVVGTTLTLMAFGGAAHLHEYCDS

RHKELGPIYREKLGPTECVFIADSSMVQKVYSNEGRFPNHMVPEAWTIYNEITGVKRGLFFMDGPEWERRRKGMNKVFL

AQPIISEYTESFNEVVTDVLNKWSSLVESNKDENGRSGLLTQLERELYNWSIESLSTMIFGRRLGCVETSHDLRYKTHK

MDQVHLFVQCVQQLFVESAKLTLLPARLAQRFNLPVWQRFMEAADQALRLARSYVEENVKAAQDDPENGSRGVLEMLLA

QPQIDQEELIRIIVDLFLAAADTTSHATQWALYLLSKNPEYQEKILKQVESVVGKNGTVREEHLKHFTLVKGVIKETLR

LYPVAPFISRKLDRDIVLGGYQIPANTLLAISLYTTGRDEKYWTDAKSFKPERWVREESNKKIINSHASLPFGLGIRSC

VGRRVAEVQMQFLLSRIIQKFYFEPGNKEDIGIKLRMITTPESPIHLRLVERSAV.

 

>CYP381A1 10g02190.pro >10g02190 +  0000000297 mito clan

28% to CYP49A1

MASKSVSYLGRQLTSYQVQNGSFNTAVRKLTNIAATDLKPFSDVPSLSKIPYVGMHHYVPALGGYDIAKVHEFAEKNYY

KLGPIYKEDLRALNAPGDFAFWLSDADDIEKVYRSGGKFPIRGGFDSLAVYRKTRPDVYKALGLLILNGKDWHTFRSKI

QPVLLQPRVISNYSNSISSIADEMINVIRQSRDEKTLEIADLGPELYRYTLESIAFIALDKRLNCLSDYGTTQRNIVAS

VKELFHLEATLNESFLWRIIGRPYGKNWKRFMQINDEFTSMVFEFVQEKIKQLASEPVKNPEDDVSVLELFLSRPDCTP

EDAVTMTMDMFYAGIDTTAHLILFTLHHLANHSDFQERVYQEIMDLSNGTGHLDSEQLSNLTFLKACIKETSRLTPVVP

ILMRISQEPIALSGYAIPARSFLILNHYTVHHRPDYFTDPLSFKPDRWARKSREEIKAHLFAVLPFGHGPRMCIGRRIA

ELETLSLLSKIIYNFKVTAKHTELPLSLKIISYPDNKMTFTFNERQR

 

>CYP381A2 10g02200.pro >10g02200 +  0000000298 mito clan

29% to CYP49A1

MVLKSVSYLGRQLYSYPLRNGGFNIAVRKLASIAVSDLKSVSDVPSSSKIPYIGALIQHIPALGGFDLAKMHESAEKNY

YKLGPIYKEDLRALNDPVDFAFWLSDADDIEKVYRSDGRFPVRGGFDSLGIYRKIRPDVYKALGLLILNGKDWHTFRSK

IQPVLLQPRVISNYSNSISSIADEMINVIRQSRDEKTLEIADLGPELYRYTLESIAFIALDKRLNCLSDYGTTQRNIVA

SVSELFHLEATLNESFLWRFINRPFGKKWKRFIQINDEFTTMVFEFVQDKIKQLASEPAKNAEDDVSVLELFLSRPDCT

PEDAVTMTMDMFYAGIDTTAHLILYTLHHLANHSNFQERVYREIMDLSNGNGNLDSDQLSNLTFLKACIKETSRLTPVV

PISSRINREPIALSGYSIPAHNYLILNHYTVGHRPDYFSDPLSFKPDRWARESREEIKAHPFAVLPFGHGPRMCIGRRI

AELETLSLLSKIIYNFKVTAKHTELPLSFKIISYPDNKMTFTFNERQK