FASTA File  This is a start on finding all P450s from Xenopus.  This file has 44 
contigs. For an alphabetical accession number list (120 entries) see Alpha list
Alignments of CYP2 and CYP4 sequences are given at the bottom of this file.
CYP8B and CYP46 are present as two non-overlapping contigs for each.  These contig 
pairs are most likely from single genes, even though there is a gap between the 
contigs.  7 protein sequences are complete [1A6, 1A7, 2Q1, 4T4, 17, 19, 26]
Three others are nearly complete [4T3, 27, 51].  19 fragments belong to the CYP2 
family, including a clear CYP2R1 ortholog. Based on sequence alignments there are a 
minimum of 11 different CYP2 P450s.  One fragment is in the CYP3 family.  Seven 
fragments are in the CYP4 family.  There are at least six members in the Xenopus CYP4 
family  Two fragments are in the CYP8B subfamily and two more are in the CYP46 family.  
The 26 family has three different sequences corresponding to orthologs of 26A, 26B and 
26C of mammals.  There is a clear 27C1 ortholog.  There are at least 27 sequences 
represented here from 11 of the 18 mammalian families.  Sequences are absent so far 
from CYP5, CYP7, CYP11, CYP20, CYP21, CYP24, CYP39  
Last modified June 19, 2001 D. Nelson

>CYP1A6 AB022087 AW637318 bl57c05.w1 AW643150 cm26f01.w1 
BG364837 dc92b11.y1 BG364920 dc93c12.y1
MTDWIGSIAGLMANTTITEFLLVSTVFAIVFLVLRSERVKIPPG
TKKLPGPMPYPIIGNLLSLSKNPHLSLTRMSKTYGDVFQIQIGTKPVLVLSGLETLKQ
ALIRQGDEFAGRPDLFTFRLVGDGKSLTFSSDSGEVWRARRRLAHNALKTFATSPSPT
SSSSCLVEENIITEAEYLVRKFKQLIDEKGEFDPYRYVVVSVANVICGMCFGKRYNHD
DEELLNVVNLTDEFGAAAASGNPADFIPILQYLPSSSMKAFKEINRKFLDFIQKLVKE
HYKTFDKNHIRDITDSLIQHSQEKRVDENSNVQLSNQKIVNIVNDLFGAGFDTITTAL
SWSLMYLVAHPNIQEKIQDELDQVIGRERRPRLSDRAQLPYTEAFILEMFRHSSFVPF
TIPHSSTTDTVLNGYFIPKGICVLINQWQVNHDPNLWKDPFKFCPERFLNTDGTTLNK
IEMEKVMIFGLGKRRCVGEVIGRMEVFLFLTTMLQQMQFFKQDGEKLDMSPQYGLTMK
HKRCHVTAKIRFPLLATH

>CYP1A7 AB022088
MTNWIGTVAGMMANTTITEFLVASVVFAIVFLVIRSQRVKIPPG
TKKLPGPMPYPVIGNLLSLSKNPHLSLTRMSETYGDVFQIQIGTKPVLVLSGLETLKQ
ALIRQGDEFAGRPDLFTFRMVGDGQSMTFSSDSGEVWRARRRLAQNALKTFATSPSPT
SSSSCLVEENIITEAEYLVKKFMQLIDEKGEFDPYRYVVVSVANIICGMCFGKRYNHD
DEELLNVVNLTDEFGAAAASGNPADFIPILQYLPSSSMKAFKEINRKFIDFMQKFATE
HYKTFDKNHIRDITDSLIQHSQEKRVDENSNVQLSNQKIVNIVNDLFGAGFDTITTAL
SWSLMYLVAHPNIQEKIQDELDRVIGKERRPRLSDRAQLPYTEAFIFEMFRHSSFMPF
TIPHCTTKDTVLNGYFIPKGICVLVNQWQVNHDPNLWKDPSKFYPERFLNTDGTMVNK
TEMEKVMVFGLGKRRCVGEAIGRMEVFLFLTTMLQQMQFFKQDGEKLDMSPQYGLTMK
HKRCHVTAKLRFPLLTTD

>CYP2Q1 BE509429 dc10f03.y1 BF612309 daa17b09.y1 BG234222 daa38e02.y1
BG515456 dae07h05.y1 BG731252 dae12f07.y1 D50560
MDTSWLWTLLLSLLISCILIYSTWNKMYRKRNLPPGPTPIPLFG
NVLQIKRGEMVKSLIEYGKKYGDTYTLYFGPSPVIILCSYRATKEALIDQAEDFSGRG
AMPSFDQYFQGYGVVFTNGEEWKQLRRFSLTTLRNFGMGKRGIEERIQEEAQFVVEEI
KSYKKKPFDPTDILVQCVSNVICSVVFGNRFEYDNKDFQNLLSLFQSVFRESSSAWGQ
LLNMFPLIMNHIPGPHKKVIRDMNKLEAFVLQRVKENEKTLDSNSPRDIIDSFLIKMQ
QENENPTSAFHMKNLLATVLSIFFAGTETVSTTLRHGFLILLIYPEIEAKLREEIDRV
IGQNRSPTIEDRSKMPYTDAVIHEIQRFSDVIPMNVPHLVTKDTQFRGYTIPKGTDVY
PLLCAVLRDPEKFATPYEFNPNHFLDDNGCFKSNDGFMPFSTGKRICLGEGLARMELF
LFLTNILQHFKLHTESRLIEDDIAPKMNGFANYPTSYQLSFIPR

> BG018440 daa24g05.x1 seq 18 64% to 2d26 68% to BG513901
WGLLFMLLYPNVQRKVHEEIDXVIGRTSKPTMGDVCRMPYTNAVIHEIQRYADIVLLSV
PHMTYRDTHIQGFFIPKGVTIMTNLSSVLKDEKA 354
353 WEKPFQFYPEHFLDRDGKFVKREAFMAFSAGRRVCLGEQLARMELFLFFTTLLQRFSFQI 174
173 PNGEPSPREDPVFVFLQLPHDYKMCAKVR*

> BG513901 dac15d01.y2 seq 12 78% to 2d22
RVGFLDDERKFVKKEAFVPFSAGRRSCLGEQLARMEIFLFFTTLLQSLTFLIPDKEPRPREDPLSVFTLSPHSFNVCAKMR*

> BG578904 de98f11.y1 seq 11 55% to 2d11 54% to BG018440
RKLLYKEAFXXFSAGHRVCLGEQLARFELFIFFTTLLRRFNIELPEGITEVNTKYVFKMTLQPHPYEICAVPR*

>AW766873 da61b08.y1 Length = 526 N-TERM AW871763 da93g03.y1 BE576589 dc42b04.y1
 AW636452 bl46g10.w1 seq 29 Length = 564 N-terminal 46% to 2C40 63% to 2Q1
 BG364107 dc77g08.y1  Length = 539 N-term 45% to 2C40 
 AW636520 bl47f09.w1 Length = 575 N-term 46% to 2a5 AW644907 cm46g10.w1
98  MFLGDPVTVLLTVVLCLILANLLYGRKRNNFKNFPPGPKPLPVIGNINIINLKRPYLTY 274
275 LELWKKYGPVFSIQIGGQKMVVLCGYETVKDALVNYAEEFSERPKIPIFRDISKEYG 445
446 VLFAHGENWKVMRRFTLSTLRDFGMGRSSIEDRINEECDFLVEKFKSYKGKPFE
NTMIINAAVANIIVSIILGHRFDYQDPIFLRLMSLINENIRLSGSPTVMLYNVFPSVMRWLPGSHKTIAK
NAAENQRFIRKTFTKHRDKLDVNDQRTLVDAFLVKQQEKNVNEQYFHDENLTMIVSNLFAAGME

>BF024911 dc80h09.x1 79% to CYP2R
FFLGRRHCPGEPLARMEMYLFFTSLLQRFHLHFPQGFVPNLRPKLGMTLQPYPYVICAERR*

> BE507713 dc21g08.y1 Length = 659 87% to BE507714
TALLKLIKIINENVKLMGSPMVMLYNTYPSVVQWLPGNHKTVAENTLKLLNFLQETFTKHRDQLDVNDQRDLIDAFLVKQQEEKSS
STMFFHNQNLTLLVANLFGAGMETTSTTLRWGLLLMMKYPEIQKIIQDEIDRVIGSAQPQAEHRRQMPYTDADIHEIQRCANIAPS
DLPHATTKDVTYRG*CIPERTQVIALLTSGLRDEAEFTKPRQVYPEH

>BE507714 dc21g09.y1 87% to BE507713
AALLKLIKIINENVKLMGSPMVMLYNTYPSVVQWLPGNHKTVAENTLKVLNCLSETFTKHRDQLDVNDQRDLIDAFLVKQQEEKSS
STMLFHNQNLTLLVANLFGAGMETTCTTLRWGLLLMMKYADIQKEVQDEMDRRIGSAQPQAEQRRQMRYTDAVMHEIQRCDSIVAS
DARHATS*RGTL

>BE507857 dc23e11.y1 74% to BG345853 71% to BE507713 
AFPSVMSWLPGNHQTILGNSETLQNFIKDTFTEHKAQLDVNDQRDLIDIFLVKQKEEKPNPGLFFHNQNLTSLVDNLFVAGMETTS
TTLRWSLLIMMKYPEIQKKVQDEINKVIGSAQPQTEHRKQMPYTDAVMHEIQRFADIVPTNLSHATTKDVTFRGYLIPKGTQVI

> BG345853 dg42b07.y1 seq 13 57% to 2d26 BG159752 de68b08.y1 AW641440 cm07d11.w1 58% 
to 2b13 BG023592 de68b08.x1  51% to 2B13 BE506975 db89c06.y1  64% to 2E1 AW766295 
da61b08.x1 BE192232 db89c06.x1
229 EKTNSREYFHDDNLTLLVFDLFAAGMETTSTTLRWG
26  LLLMMKYPEIQKNVQNEIEKVIGQSQPQTEHRKSMPYTDAVLHEIQRFGNIVPMNLPHAT 205
206 AQDVTFRGYFLPKGTFVIPLLTSVLYDQTHFEKPHEFYPQHFLDSEGN
10  RGFVKNEAFLPFSAGKRSCAGENLAKTELFLFFTSLLQNFTFQASPGEELDLTPAVGIT 186
187 TPPLPYNICALSRT*237

>AW640032 bl89h12.w1 seq 24 57% to 2Q1 58% to 2G1 64% to 2A4
TRGNVNTEFDYENLFVTLLNLFFAGTETTSITLRYGMLILLKYPDIQKKIHDEIDCVVGLNRCPSMEDRPKLPYTDATIHEIQRFA
DIVPMGVPRSTNKDTTLRGYDIPKGTTVFPMLTSIMKDPRYFKDPESFNPCHFLDEKGSLKKSDAFLPFSIGK

>BG731067 dae10a02.y1 seq 21 56% to 2Q1 BF426592 daa22f03.y1 56% to 2G1
BF426753 daa23f04.y1 BG515498 dae08d07.y1 BE507762 dc22d10.y1
MEILGATAGLLVICVLFLLLNTIQVIQRQGKGKLPPGPTPLPFLGNFLQLKGKEVFKSLLELSKKYGPVYTIHLGMEPVVVLCSCD
IVKEALNDNGEEFGARGYMPLLDKMSHGGHGVIASNGERWKQLRRFSLTTLRNFGMGKRSIEERIQEEARFLAKEF

>BE509041 dc16c08.y1 52% to BG731067
MAIDTAVTILLTVCVIILLYLVKWSGNSKQKNFPPGPTAFPLLGNFPQIGTTEIPASLVELSKTYGPMYTLYLGGHPLVMLIGYDA
VKEALIDYGDVFSDRGRTGISQAIFSEYGVIMSNGERWKTMRRFTLMTLRNXGMG
KRSLEERIQEEARNLEEAFRKKRDEPFDAIYLLGLAVFNIICSINFGER

> AW646092 cm60g08.w1 seq 32 Length = 636 47% to 2C44 46% to BG731067
219 MALLGIETLLLVCGVTFLLYLITRRQRHLKLPPGPTPLPLIGNILQLVFPNQVKAFV 389
390 KLGSQYGPVSMVFLGQNPVLVLNGYDVVKEAFVENGEVFSNRGKNTFIEMLFKGRGVAF 566
567 SNGETWRQMR 596

> BG020305 dc49e01.x1 seq 22 54% to 2Q1
LITSAFKDSKYLSDPRQFDPTHFLDDNGSFKKNDAFIPFSVGKRSCLGEGLARMEIFLFITTILQTFNLKSDIAPQDIDITPEPK*

> BG232882 daa29e03.y1 Length = 268 N-term 54% to 2S1 55% to 2Q1 seq 28
5  FLTILISLLIFFMIWNRRSKLPPGPTPLPLIGNLLQVRNGEMAKTLMELGEQYGPVFTFYFGPSPVI 205

>BE508772 dc13a02.y1 64% to BE509147  
MDPISILLSIAVCVFLLNLIYGGKGDSKTFPSGPTPLPVIGNLLIMNMKKPHLTFMELAKKYG
SVFSVQLATQKVVGLLGYDARREA

> BE509147 dc17g07.y1 Length = 584 54% to AW636452
MDPISVLLSVVDCIFLFNVFYGGKRESQNFPPGPKPLPLIGNLHMMNMKKPYLTFMELGQKYG 308
309 SVFSVQLGMKNAVVLCGTDAVKDALINHADEFSGRAKIPIFHQASKGFGIVYADGENRTV 488
489 MRRSSITTLIHYGMGNITMGYRIRE 563

> BE509407 dc10c12.y1 Length = 353 51% to AW636452
MDFIFSLATSSVLVLTVIYILNILRNRMNNFPPGPKCWPLVGNVFSIDLKKPQRTYIELSKKYG
PVFSVQIGRKKMVILVGYEMVKDALVNYAEEFGGRAYMPVTNNSKKGLG

>BG019547 daa21d11.y1 37% to 2C29 N-term seq 36
LPLLVNMLQIIAQEFPQSLLKLIEKLRPIFTAYLPDYPAEVSTGYDSVKDALLDDLQGYG 190
191 ARGKSTLKYILLNDHGVNYSNGERWKQMRHYILPCLMDCVMGRRII*ERIQEDAQYVAQY 370
371 LAKHADTPADTTFLLSLLVSYVV*SIMCGELFGYHDDK 484

>BG513166 dae05g07.y1 seq 27 57% to 3A11 1-161
32  MNLIPHLSTGTWILLAALFLLILLYGIWPYGLFKKMGIPGPTPLPFIGTFLEFRKGLVQF 211
212 DTECFKKYGKTWGLYDGRQPVLAIMDPAIIKTILVKECYTNFTNRRNFGLSGPLESAITA 391
392 AEDEQWKRIRSVLSPTFTSGKLKEMFQIMKDYSDILVKNIQ 514

>CYP4T3 AB022672
KQCAGLFCVFASHSNLCIAYEMQKPLIVTQILAGKGLLVLSGDK
WFQHRKLLTPGFHYDVLKPYVRLISDSTNVMLDKWVSFSNKGETVELFHHVSLMTLDS
IMKCAFSFHSNCQTDKDNSYTKAVYDLSFLAHHRARTFPYHNNLIYYLSPHGFLFRKA
CRIAHQHTGKVIKQRKTLLQNKGEFEKVKQKRHPDFLDILLCARDENGKGLSDEDLRA
EVDTFMFEGHDTTASGISWILYCMAKYPEHQQKCREEIREVLGEKDSYEWEHLSKIPY
TTMCIKESLRLYPPVPGVSRELNKPITFYDGRSLPAGSVIFINIFCIHRNPSVWKVPE
VFDPLRFSSENSSKRHSHAFVPFAAGPRNCIGQNFAMNELKVAVALTLNRYELSPDLS
KPPLKSPQLVLRSKNGIHVYLKKAS

>CYP4T4 AB022671
MWNALVWQQVAALLCLLAVLLKATQIYLSKKRQERILEQFPGPP
RHWLLGNVDQIRRDGKDLDLLVNWTQSHGGAYPVWFGNFSSFLFLTHPDYAKVIFGRE
EPKRQLSYNFLVPWIGNGLLVLTGPKWFQHRRLLTPGFHYDVLKPYVKLISKCTTDML
DNWEKLITKQKTVELFQHVSLMTLDSIMKCAFSYESNCQKDSDNAYIKAVFDLSYLAN
LRLRCFPYHNDTIFYLSPPWVSISPSLQNNSEHTDKVIQQRKESMKHEKELEKIQQKR
HLDFLDILLFARDEKGHGLSDEDLRAEVDTFMFEGHDTTASGISWILYCMAKYPEHQQ
KCREEIKEVLGDRQTMEWKDLGKIPYTNMCIKESLRIYPPVPGVARMLRNPVTFFDGR
SIPAGTLVGLSIYAIHKNPAVWEDPEVFNPLRFTPENSANRHSHAFVPFAAGPRNCIG
QNFAMNEMKIAVALTLNRFHLAADLENPPILIPQLVLKSKNGIHVHLNKVQ

> BG018182 de66c08.x1 seq 31 Length = 298 54% to 4T4
IYHLVPLDRREVAIPILSMIGTSSAAGILVSLKTYAIHENPDVSKDPEIFDHLRWSPESSCKRHSHAFVPSAAGPRKCIVQNFAMN
DMKVDGTVSLTRY

>CYP4V4 confidential sequence, full seq known

>BE506010 dc18b09.y1  51% to 4V3 seq 33 96% identical to CYP4V4 (confid Xenopus seq)
MELKGDVNVLLWTAVIVVLLTLLVFSALPVLLDYVRKCKVMRLIPGPGPNYPLVGDALLLKSDAREFFLQMCEFAEDFRSEPLLKL
WIGPIPFLIVYHADTLEPFLSTCKHMDKAYLYKYLHPWLGKGLLTSTGEKWRVRRKMITPTFHFAVLSDFLEA

>gi|13486089|gb|BG515432.1|BG515432 dae07c11.y1 NICHD XGC Lu1 cDNA clone Length = 515
98.5% identical to CYP4V4 only 2 diffs probably same gene
114 MELKGDVNVLLWTAFIVVLLTLLVFSALPVLLDYVRKCKVMRPIPGPGPNYPLVGDALLL 293
294 KSDAREFFLQMCEFAEDFRSEPLLKLWIGPIPFLIVYHADTLEPFLSTSKHMDKAYLYKF 473
474 LHPWLGKGLLTSTG 515

>BE131871 db38h08.y1 CYP4 family seq 20 75% to 4T3 62% to 4a14 67% to 4b1
9   GHDTTASGISWILYCMAKNPEHQQKCREEIRELLGDRETMEWDDLGQIPYTTMCIKESLR 188
189 LYPPVPGIGRRLSKPITFCDGRSLPEGAGIIVSIYSINRSPSLWKDPEVFDPLRFSPENS 368
369 DNRHPHAFIPFSAGPRNCIGQNFAMNEMKVAVALTLQRYELFPDPDNEP 515

>BE490930 db38h08.x1 probably same as seq 20 (91%)
RTGIGQTFAMNEMKVAVALTLQRYELFPDPDNEPQKVPQIVLRSLNGIHVKLRRVQKKENKKEM*

>BF426603 daa22g05.y1 54% to 4f18
MLQFLDHFLDSLNPSHTTFRVYIFAAIILIFSLIIFRTILKMVKFIYAYIINARRLRCFPEPPRRSWLLGHMG
LIKNTEEGLLVVDSLVKTYIYACSWWFSLCYPIVRLFHPSSIKPILQVSAAIAQKDELFYGFLRPLLEDGLLLSHGEKWG

>BG553469 dab84f10.y1 53% to 4B1 62% to 4T4
MMASGLWKVLSSSWLPVNVAQIGQFAILLCVVLLVLKACALYSRG
170 RKFTAALTPFPGPPSHWLYGHVNQFRRDGKDLDRLMVWAKKYPNAFPLWIGKFFGTLIIT 349
350 HPEYAKLVFGRPDPKTSTGYSFLIPWIGKGLLVLSGDTWFQHRRLITPGFHYDV 511

> BE189745 db59e09.y1 CYP4 fam seq 19 61% to 4T4
LRANDQFPGPGARGRFSPFPGPKCHWLYGNAHEFLQIGKDLDLVLGFAQV
FPYGMPLWLGNFYASLIITHPDYAKAVLARQDPKDDMAYKFIVPWI
GEGLLVLSGPKWFQHRRLLTPGFHYDVLKPYVSLMSDCTRVMLDKWDKLMPNEK
TFELFHHVSLMTLDTIMKCAFXYNSXCQNNRXNAYIKAVYELSYLVDQRF
HFFPYHNELMFYVSPLEFLFTNT*DTQHIQIIDEPIK

> BF231653 de90a08.x1 12-ALPHA HYDROXYLASE CYP8B1 Length = 258 68% to 8B1
HQQRAEQGMPEHMQDRFMFLLLWASQGNTGPASFWFILYLLKHPEAMRAVREEVEAVLKETGQEVKPGGPLFNGSDKDRSSSQPKG

> BF426447 daa14g11.y1 seq 30 60% to STEROL 12-ALPHA HYDROXYLASE CYP8B1 Length = 460
2   MDSAVEETLRLTAAPVLIRAVKQDMKIKMASGNDFSIRKGDRVALFPYIAVQMDPEIHP 178
179 EPEKYKYNRFLNEDGTKKTDFFKNGKKVKYYTMPWGAGSTICPGRFFATNELKQFVFLMLTYFEFE 376
    LVNPDEEIPGIDPNRWGFGTMQPTHDVQ 460

>CYP17 AF325435 AW639059 bl78a09.w1 AW634003 bl14g07.w1 AW638539 bl71c05.w1
AW639868 bl88e07.w1 AW640378 bl94e08.w1 AW640811 bl99b10.w1
BE131888 db39e04.y1 BE131756 db35g03.y1 BG363813 dc94b02.y1
BE027018 db35h02.x1 BF048873 db80d06.y1 BE027013 db35g03.x11871
MISYVAGALLLAFGLALISVWKFAGGKHRGAKYPNSLPCLPFIG
SLLHIGNHLPPHILFCKLQEKYGSLYSFRMGSHYIVIVNHHEHAKEVLLKKGKTFGGR
PRAVTTDILTRNAKDIAFANYSPSWKFHRKVVHAALSMFGEGTVAIEKIISREATSLC
QSLISFQDNPLDMAPELTRAVTNVVCALCFNTRYKRCDPEFEEMLAYSKGIVDTVAKD
SLVDIFPWLQIFPNKDLDILKRSVAIRDKLLQKKLKEHKEAFCNEEVNDLLDALLKAK
LSMENNNSNISQEVGLTDDHLLMTVGDIFVAGVETTTTVLKWTMAYLLHYPEVQTKIQ
EELDFKVGFGRHPVLSDRRILPYLDATISEVLRIRPVAPLLIPHVALQESSIAEYTIP
QDARVVINLWSLHHDPNEWENPEEFNPERFLDENGNHVYSPSQSYLPFGAGIRVCLGE
ALAKMEVFLFLSWILQRFTLELPAGDSLPDLDGKFGVVLQVKKFRVTTKLREAWKNID
LTT

>CYP19 AB031278
MEALNPVQYNITEAVPTLAPATTLSLLLFIFVLIILWNQEETSL
IPGPAYCMGLGPLISYGRFLLTGIGKAANYYNNMYGEFVRVWINGEETLIISKSSATF
HIMKHSHYVSRFGSKLGLQCIGMNENGIIFNSNPSLWKVIRPYFIRALSGPGLMQTTE
NCIRSTNHYLDNLSNVTNELGNVDVLKLMRLIMLDTSNNLFLRIPLDESEIVLKIQKY
FDAWQALLLKPDIFFKISWLYKKYEKSANDLKEAIELLIEQKRQKLSSSEKLDEDMDF
SSELIFAQNHGDLTAENVNQCILEMLIAAPDTMSVSLFFMLVLIAQHPKIEEGIMNEM
DKVIGNRDVESNDIPNLKILESFIYESMRYQPVVDLVMRKALEDDIIDGYYVKKGTNI
ILNLGRMHKIVYFPKPNEFTLENFEKTVPYRYFQPFGSGPRACAGKYIAMVMMKVILV
TLLKRYKVQTLRGRCLENIQNNNDLSMHPDESQPSLEMIFIPKNTAEFKL

>CYP26(1st) BG553607 df04c02.seq 15 BG555211 de99c02.x1 BG486543 dd01g02.x1 BE191823 
db83b11.x1 AW198806 da06g04.x1 AW639706 bl86a09.w1 AW641576 cm08h09.w1 AW766054 
da81f06.y1 BG161868 df69e06.x1 BE188917 db61c05.x1 AW460650 da29g11.x1 AW767659 
da77a02.x1 AW640733 bl98d01.w1 AW199734 da06g04.y1 AW595907 da29g11.y2 
AI031132   BE506442 db83b11.y1 BG038344 dg34a01.y1 BG486410 dc93f02.x1 
AF057566   BG578446 de99c02.y1
MDLYTLLTSALCTLALPLLLLLTAAKLWEVYCLRRKDAACANPL
PPGTMGLPFFGETLQMVLQRRRFLQVKRSQYGRIYKTHLFGSPTVRVTGAENVRQILL
GEHKLVSVHWPASVRTILGAGCLSNLHDNEHKYTKKVIAQAFSREALANYVPQMEEEV
RCSVNLWLQSGPCVLVYPAIKRMMFRIAMRLLLGCDPQRMDREQEETLLEAFEEMSRN
LFSLPIDVPFSGLYRGLRARNLIHAQIEENIKEKLQREPDEHCKDALQLLIDYSRRNG
EPINLQALKESATELLFGGHGTTASAATSLTSFLALHKDVLEKVRKELETQGLLSTKP
EEKKELSIEVLQQLKYTSCVIKETLRLSPPVAGGFRVALKTFVLNGYQIPKGWNVIYS
IADTHGEADLFPDTDKFNPDRFLTPLPRDSSRFGFIPFGGGVRCCIGKEFAKILLKVF
VVELCRNCDWELLNGSPAMTTSPIICPVDNLPAKFKPFSSSI

>CYP26(2nd) seq 26 hybrid seq AW765767 da77a02.y1 1-204 BE189825 88% 42-271
AW199734 da06g04.y1 BF047649 dc80h02.y1 BF426259 df69e06.y1
BG364937 dc93f02.y1 BG408452 dd01g02.y1
35  MDLYTLLTSALCTLALPVLLLLTAAKLWELYCLRRKDPTCANPLPPGTMGLPFFGETLQM 214
215 VLQRRKFLQMKRRKYGRIYKTHLFGSPTVRVTGAENVRQILLGEHKLVSVHWPASVRTIL 394
395 GAGCLSNLHDSEHKYTKKVIAQAFSRDALDNYVPQMEEEVRRSVNLWLQSGPCVLMYPAI 574
575 KRLMFRIAMRLLLGCDPQRMDSQHEETLLEAFEEMTRNLFS 544
545 VPIDVPCSGLYRGLRARDLIHARIDENIEEKLLREPDDNCRDALQLLIDY
SXRNESPXNCSTEESXLEL 

>CYP26C1 homolog BG264135 de80c01.y1 seq 25  embryo
BG439345 de80c01.x1 67% to 26C1 57% to 26B1 45% to 26A1
108 NLEKLKSLHYLECVVKEVLRLLPPVSGGYRTALQTFELDGYQIPKGWSVMYSIRDTHETA 287
288 AVYQNAEMFDPERFSTERDEGKLGKFNYIPFXGGVRSCIGKELAKVILKILAMEL 452
VTTAKWELATPSFPKMQTVPVVHPVDGLQLSFSFLSDSDTEAKNGSRANP*

>CYP27 composite seq 14 58% to 27A1      BG554727 dac30e04.y1 BG731192 dae11g03.y1 
BG345818 dg41f04.y1 BG023437 dg41f04.x1  BG348981 daa35e09.x1 BG552024 dae12f10.x1
BG515454 dae07h01.y1 BG731762 dac30e04.x1
46% to 27A1 39% to 27B1 35% to 27C1 so this is the 27A homolog
    NTPISTTPRPTDRGPGSAAAIMAGQCTNCAKKDTLGVSGATVVEKKTLKTLD 196
6   DLPGPNSLKAFYWIFLRGYLFRTHELQVLFKKTYGPMWKISDGQQDMVYVACPDVLESVL 182
183 RNEGKYPTRRDMFIMKEHRDLRGHSYGPVTEEGHQWHRLRTVLNQRMLKPKESMVYAESM 362
363 NQVVSDLLVKIKEITAQSSSGTTVNGVADLMYRFAFESICTVLFETRIG 506
191 CLNKEILPETQKFIDSIGNMLKYLTVVMRLPQWTKGILPYWGRYIEAWDTIFEYGRKLID 370
371 NKMKEIDDRLKRGEEVEGEYLTYLLSSGKLSMKEIYGSVGEMLQGGVD
207 TTSNTLTWALYQLSRNPEIQNNLYQEVISVIPGETTPNSEAFARMPLLKAVIKE 368
369 TLRLYPVVPENARMINEKEVIINDYVFP 452
VMTQLFLGHYVIAQDETTFPEADRFLPERWLRESGIKHHPFGSIPFGYGVRACV 470
GRRIAELEMQLALSRIIKMFKVIPDPDLGEVGAINRATLVPNRPVNLQFIERQRPE*

> AW637606 bl60c07.w1 Length = 434 seq 34 N-term 75% to 27C1 BE669236 dc59c04.y1
AVLGHLLKGSARLEGLARGFHQFPKIQAAGQALEQEQ
AEGELGARAKEAPMMKSLKDMPGPSTLANLVEFFWRDGFGRIHEIQ
QKHTRQYGRIFKSHFGPQFVVSIADKDLVAQVIRAERDAPQRANMESWHEYRELRGRSTGLISAEGEKWLNMRSVLRQKILRPRDV
AMYTGGVNEVIGDLVKKIHKLRAQESDGLTVTNVNDLY

>CYP46 BG018841 dab13d08.y1 45% to CYP46 N-term 1-200 opposite ends to seq 16
MGLWTLIGWATLLLLALALICFLLYCGYIQYIHMKYDHIPGPPRDSFLLGHSPTMLRLMKNNLLMYDHFL 254
255 ELVQKYGPVIRINGLHRAIILVVSPEAVKELLMSPKYTKDRFYDVIANMFGVRFMGNGL 431
432 VTDRDYDHCHIQRRIMDPAFSRTYLMGLMGPFNEKAEELMERLMEKADGKCETKMHDMLS 611
612 RLTLDVIAR 638

>CYP46 BG022212 dab13d08.x1 seq 16 74% to CYP46 391-498
515 LQLNSYIMGRMEEFHTDPLTFNPDRFSXDAPKPYYSYFPFSLGPRSCIGQVFSQMEAKVVMAKLL 321
320 QRYEFELAEEQSFKILDTGTLRPLDGVICRLRPGTSNKAAAPK* 189

>CYP51 from parts BE669335 BE026950 BE026223 BE575528 seq 17
51-324
IPFLGHAIAFGKSPISFLENAYDKYGPVFSFTMVGKTFTYLVGSDAAALMFNSKNEDLNA 
EDVYSRLTTPVFGKGVAYDVPNPIFLEQKKMLKTGLNIAHFKTHVEMIEEETQEYFERWG 
DSGVRNLFEALSELIILTASRCLHGKEIRSMLNERVAQLYADLDGGFTHAAWLLPGWL   
PLPSFRRRDRAHREIKNIFYQVIQKRRNSAEREDDMLQTLLDATYKDGTPVNDDEIAGML 
IGLLLAGTHTSSTTSAWMGILLAQNKSLQNQCFAEQ 
325-336
KPDSGEDCLPLN
337-484
YDQLRDLQVWDRCIKKTLRLRPPIMTMMRMARTPQSVAGYNIPPGHQVCVSPTVNHRLKD 
TWDKNTEFNPNRYLHDNPAAGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMIRLYEFE 
LVDGYFPTINYTTMIHTPNNPVIRYKRRKI*






alignments

CYP2 family, problems underlined

CYP2Q1       MDTSWLWTLLLSLLISCILIYSTWNKMYRKRNLPPGPTPI
AW766873    MFLGDPVTVLLTVVLCLILANLLYGRKRNNFKNFPPGPKPL
AW646092       MALLGIETLLLVCGVTFLLYLITRRQRHLKLPPGPTPL
BE509041     MAIDTAVTILLTVCVIILLYLVKWSGNSKQKNFPPGPTAF
BG731067    MEILGATAGLLVICVLFLLLNTIQVIQRQGKGKLPPGPTPL
BG232882                 FLTILISLLIFFMIWNRRSKLPPGPTPL
BE508772        MDPISILLSIAVCVFLLNLIYGGKGDSKTFPSGPTPL
BE509147        MDPISVLLSVVDCIFLFNVFYGGKRESQNFPPGPKPL
BG513166 MNLIPHLSTGTWILLAALFLLILLYGIWPYGLFKKMGIPGPTPL
BG019547                                            L
BE509407       MDFIFSLATSSVLVLTVIYILNILRNRMNNFPPGPKCW

CYP2Q1     PLFGNVLQIKRGEMVKSLIEYGKKYGDTYTLYFGPSPVIILC
AW766873   PVIGNINIINLKRPYLTYLELWKKYGPVFSIQIGGQKMVVLC
AW646092   PLIGNILQLVFPNQVKAFVKLGSQYGPVSMVFLGQNPVLVLN
BE509041   PLLGNFPQIGTTEIPASLVELSKTYGPMYTLYLGGHPLVMLI
BG731067   PFLGNFLQLKGKEVFKSLLELSKKYGPVYTIHLGMEPVVVLC
BG232882   PLIGNLLQVRNGEMAKTLMELGEQYGPVFTFYFGPSPVI
BE508772   PVIGNLLIMNMKKPHLTFMELAKKYGSVFSVQLATQKVVGLL
BE509147   PLIGNLHMMNMKKPYLTFMELGQKYGSVFSVQLGMKNAVVLC
BG513166   PFIGTFLEFRKGLVQFDTECF-KKYGKTWGLYDGRQPVLAIM
BG019547   PLLVNMLQIIAQEFPQSLLKLIEKLRPIFTAYLPDYPAEVST
BE509407   PLVGNVFSIDLKKPQRTYIELSKKYGPVFSVQIGRKKMVILV

CYP2Q1     SYRATKEALIDQAEDFSGRGAMPSFD-QYFQGYGVVFTNGEE
AW766873   GYETVKDALVNYAEEFSERPKIPIFR-DISKEYGVLFAHGEN
AW646092   GYDVVKEAFVENGEVFSNRGKNTFIE-MLFKGRGVAFSNGET
BE509041   GYDAVKEALIDYGDVFSDRGRTGISQ-AIFSEYGVIMSNGER
BG731067   SCDIVKEALNDNGEEFGARGYMPLLDKMSHGGHGVIASNGER
BE508772   GYDARREA
BE509147   GTDAVKDALINHADEFSGRAKIPIFH-QASKGFGIVYADGEN
BG513166   DPAIIKTILVKECYTNFTNRRNFGLSGPLESAITAAEDEQ
BG019547   GYDSVKDALLDDLQGYGARGKSTLKY-ILLNDHGVNYSNGER
BE509407   GYEMVKDALVNYAEEFGGRAYMPVTN-NSKKGLG

CYP2Q1     WKQLRRFSLTTLRNFGMGKRGIEERIQEEAQFVVEEI
AW766873   WKVMRRFTLSTLRDFGMGRSSIEDRINEECDFLVEKF
AW646092   WRQMR
BE509041   WKTMRRFTLMTLRNXGMGKRSLEERIQEEARNLEEAF
BG731067   WKQLRRFSLTTLRNFGMGKRSIEERIQEEARFLAKEF
BE509147   RTVMRRSSITTLIHYGMGNITMGYRIRE
BG513166   WKRIRSVLSPTFTSGKLKEMFQIMKDYSDILVKNIQ
BG019547   WKQMRHYILPCLMDCVMGRRII*ERIQEDAQYVAQY

CYP2Q1     KSYKKKPFDPTDILVQCVSNVICSVVFGNR
AW766873   KSYKGKPFENTMIINAAVANIIVSIILGHRFDYQD
BE509041   RKKRDEPFDAIYLLGLAVFNIICSINFGER
BG019547   LAKHADTPADTTFLLSLLVSYVV*SIMCGELFGYHDDK

BE507857                             AFPSVMSWLPGNHQTILGNSET
BE507713   TALLKLIKIINENVKLMGSPMVMLYNTYPSVVQWLPGNHKTVAENTLK
BE507714   AALLKLIKIINENVKLMGSPMVMLYNTYPSVVQWLPGNHKTVAENTLK
AW766873   PIFLRLMSLINENIRLSGSPTVMLYNVFPSVMRWLPGSHKTIAKNAAE
CYP2Q1     KDFQNLLSLFQSVFRESSSAWGQLLNMFPLIMNHIPGPHKKVIRDMNK

BE507857   LQNFIKDTFTEHKAQLDVNDQRDLIDIFLVKQKEEKPNPGLFFHNQNL
BE507713   LLNFLQETFTKHRDQLDVNDQRDLIDAFLVKQQEEKSSSTMFFHNQNL
BE507714   VLNCLSETFTKHRDQLDVNDQRDLIDAFLVKQQEEKSSSTMLFHNQNL
AW766873   NQRFIRKTFTKHRDKLDVNDQRTLVDAFLVKQQE-KNVNEQYFHDENL
BG345853                                     EKTNSREYFHDDNL
AW640032                                     TRGNVNTEFDYENL
CYP2Q1     LEAFVLQRVKENEKTLDSNSPRDIIDSFLIKMQQENENPTSAFHMKNL

BE507857   TSLVDNLFVAGMETTSTTLRWSLLIMMKYPEIQKKVQDEINKVIGSAQPQTEHRK-QM
BE507713   TLLVANLFGAGMETTSTTLRWGLLLMMKYPEIQKIIQDEIDRVIGSAQPQAEHRR-QM
BE507714   TLLVANLFGAGMETTCTTLRWGLLLMMKYADIQKEVQDEMDRRIGSAQPQAEQRR-QM
AW766873   TMIVSNLFAAGME
BG345853   TLLVFDLFAAGMETTSTTLRWGLLLMMKYPEIQKNVQNEIEKVIGQSQPQTEHRK-SM
AW640032   FVTLLNLFFAGTETTSITLRYGMLILLKYPDIQKKIHDEIDCVVGLNRCPSMEDRPKL
BG018440                       WGLLFMLLYPNVQRKVHEEIDXVIGRTSKPTMGDVCRM
CYP2Q1     LATVLSIFFAGTETVSTTLRHGFLILLIYPEIEAKLREEIDRVIGQNRSPTIEDRSKM

BE507857   PYTDAVMHEIQRFADIVPTNLSHATTKDVTFRGYLIPKGTQVI
BE507713   PYTDADIHEIQRCANIAPSDLPHATTKDVTYRG*CIPERTQVIALLTSGLRDEAE
BE507714   RYTDAVMHEIQRCDSIVASDARHATS
BG345853   PYTDAVLHEIQRFGNIVPMNLPHATAQDVTFRGYFLPKGTFVIPLLTSVLYDQTH
BG020305                                               LITSAFKDSKY
AW640032   PYTDATIHEIQRFADIVPMGVPRSTNKDTTLRGYDIPKGTTVFPMLTSIMKDPRY
BG018440   PYTNAVIHEIQRYADIVLLSVPHMTYRDTHIQGFFIPKGVTIMTNLSSVLKDEKA
CYP2Q1     PYTDAVIHEIQRFSDVIPMNVPHLVTKDTQFRGYTIPKGTDVYPLLCAVLRDPEK

BG513901           RVGFLDDER--KFVKKEAFV
BG578904                   R--KLLYKEAFX
BE507713   FTKPRQVYPEH
BG345853   FEKPHEFYPQHFLDSEGNRGFVKNEAFL
BG020305   LSDPRQFDPTHFLDDNG--SFKKNDAFI
AW640032   FKDPESFNPCHFLDEKG--SLKKSDAFL
BG018440   WEKPFQFYPEHFLDRDG--KFVKREAFM
CYP2Q1     FATPYEFNPNHFLDDNG--CFKSNDGFM

BG513901    PFSAGRRSCLGEQLARMEIFLFFTTLLQSLTFLIPDKEPRPREDPLSVFTLSPHSFNVCAKMR*
BG578904    XFSAGHRVCLGEQLARFELFIFFTTLLRRFNIELPEGITEVNTKYVFKMTLQPHPYEICAVPR*
BF024911 2R     GRRHCPGEPLARMEMYLFFTSLLQRFHLHFPQGFVPNLRPKLG-MTLQPYPYVICAERR*
BG345853    PFSAGKRSCAGENLAKTELFLFFTSLLQNFTFQASPGEELDLTPAVGITTPPLPYNICALSRT*
BG020305    PFSVGKRSCLGEGLARMEIFLFITTILQTFNLKSDIAPQDIDITPEPK*
AW640032    PFSIGK
BG018440    AFSAGRRVCLGEQLARMELFLFFTTLLQRFSFQIPNGEPSPREDPVFVFLQLPHDYKMCAKVR*
CYP2Q1      PFSTGKRICLGEGLARMELFLFLTNILQHFKLHTESRLIEDDIAPKMNGFANYPTSYQLSFIPR*


CYP4 family alignments


CYP4T4                       MWNALVWQQVAALLCLLAVLLKATQIYLSKKRQERILEQFPGPPRH
BE189745                                          LRANDQFPGPGARGRFSPFPGPKCH
BG553469      MMASGLWKVLSSSWLPVNVAQIGQFAILLCVVLLVLKACALYSRGRKFTAALTPFPGPPSH
BE506010               MELKGDVNVLLWTAVIVVLLTLLVFSALPVLLDYVRKCKVMRLIPGPGPNYPLV
BF426603  MLQFLDHFLDSLNPSHTTFRVYIFAAIILIFSLIIFRTILKMVKFIYAYIINARRLRCFPEPPRRS

CYP4T4     WLLGNVDQIRRDGKDLDLLVNWTQSHGGAYPVWFGNFS
BE189745   WLYGNAHEFLQIGKDLDLVLGFAQVFPYGMPLWLGNFY
BG553469   WLYGHVNQFRRDGKDLDRLMVWAKKYPNAFPLWIGKFF
BE506010   GDALLLKSDAREFFLQMCEFAEDFRSEPLLKLWIGPIP
BF426603   WLLGHMGLIKNTEEGLLVVDSLVKTYIYACSWWFSLCYPIV

CYP4T3     KQCAGLFCVFASHSNLCIAYEMQKPLIVTQILAGKGLLVLSGDK
CYP4T4     SFLFLTHPDYAKVIFGREEPKRQLSYNFLVPWIGNGLLVLTGPK
BE189745   ASLIITHPDYAKAVLARQDPKDDMAYKFIVPWIGEGLLVLSGPK
BG553469   GTLIITHPEYAKLVFGRPDPKTSTGYSFLIPWIGKGLLVLSGDT
BE506010   FLIVYHADTLEPFLSTCKHMDKAYLYKYLHPWLGKGLLTSTGEK
BF426603   RLFHPSSIKPILQVSAAIAQKDELFYGFLRPLLEDGLLLSHGEK

CYP4T3     WFQHRKLLTPGFHYDVLKPYVRLISDSTNVMLDKWVS
CYP4T4     WFQHRRLLTPGFHYDVLKPYVKLISKCTTDMLDNWEK
BE189745   WFQHRRLLTPGFHYDVLKPYVSLMSDCTRVMLDKWDK
BG553469   WFQHRRLITPGFHYDV
BE506010   WRVRRKMITPTFHFAVLSDFLEA
BF426603   WG

CYP4T3     FSNKGETVELFHHVSLMTLDSIMKCAFSFHSNCQTDKDN
CYP4T4     LITKQKTVELFQHVSLMTLDSIMKCAFSYESNCQKDSDN
BE189745   LMPNEKTFELFHHVSLMTLDTIMKCAFXYNSXCQNNRXN

CYP4T3     SYTKAVYDLSFLAHHRARTFPYHNNLIYYLSPHGFLFRKACRIAHQHT
CYP4T4     AYIKAVFDLSYLANLRLRCFPYHNDTIFYLSPPWVSISPSLQNNSEHT
BE189745   AYIKAVYELSYLVDQRFHFFPYHNELMFYVSPLEFLFTNT*DTQHIQIIDEPIK

CYP4T3 GKVIKQRKTLLQNKGEFEKVKQKRHPDFLDILLCARDENGKGLSDEDL
CYP4T4 DKVIQQRKESMKHEKELEKIQQKRHLDFLDILLFARDEKGHGLSDEDL

CYP4T3   RAEVDTFMFEGHDTTASGISWILYCMAKYPEHQQKCREEIREVLGEKDSYEWEHLSKI
CYP4T4   RAEVDTFMFEGHDTTASGISWILYCMAKYPEHQQKCREEIKEVLGDRQTMEWKDLGKI
BE131871           GHDTTASGISWILYCMAKNPEHQQKCREEIRELLGDRETMEWDDLGQI

CYP4T3   PYTTMCIKESLRLYPPVPGVSRELNKPITFYDGRSLPAGSVIFINIFCIHRNPSV
CYP4T4   PYTNMCIKESLRIYPPVPGVARMLRNPVTFFDGRSIPAGTLVGLSIYAIHKNPAV
BG018182             IYHLVPLDRREVAIPILSMIGTSSAAGILVSLKTYAIHENPDV
BE131871 PYTTMCIKESLRLYPPVPGIGRRLSKPITFCDGRSLPEGAGIIVSIYSINRSPSL

CYP4T3   WKVPEVFDPLRFSSENSSKRHSHAFV
CYP4T4   WEDPEVFNPLRFTPENSANRHSHAFV
BG018182 SKDPEIFDHLRWSPESSCKRHSHAFV
BE131871 WKDPEVFDPLRFSPENSDNRHPHAFI

CYP4T3   PFAAGPRNCIGQNFAMNELKVAVALTLNRYELSPDLSKPPLKSPQLVLRSKNGIHVYLKKAS
CYP4T4   PFAAGPRNCIGQNFAMNEMKIAVALTLNRFHLAADLENPPILIPQLVLKSKNGIHVHLNKVQ
BE490930       RTGIGQTFAMNEMKVAVALTLQRYELFPDPDNEPQKVPQIVLRSLNGIHVKLRRVQKKENKKEM*
BG018182 PSAAGPRKCIVQNFAMNDMKVDGTVSLTRY
BE131871 PFSAGPRNCIGQNFAMNEMKVAVALTLQRYELFPDPDNEP