Xenopus tropicalis cytochrome P450s
 
 
The 2006 Bioinformatics class searched the ESTdb for matches to Human P450s in 
the species Xenopus tropicalis.  There are over 1 million ESTs for this frog 
species in ESTdb.  The yellow sequences were turned in for assignment #1.
Additional sequence was added later to complete the sequences, by walking 
upstream or downstream on more X. tropicalis ESTs. The refseq_rna 
database was also searched.
(in progress, Jan. 23, 2006) 
Note: there are 22.9 million reads for X. tropicalis in the Trace Archive.
Incomplete sequences can be completed by chromosome walking with the MegaBlast server.
This file now has 55 sequences. 52 from X. tropicalis and 3 from X. laevis
50/52 are full length CYP sequences. 
I have just added a cluster of 25 genes and some pseudogenes on scaffold 55
That will push the gene count up near 75.
 
June 30 2010, I finished naming the Xenopus tropicalis P450s. This file has the 
sequences as I worked on them, so they are not all formatted in a uniform way.
There are also some X. laevis sequences included for comparison sake. 
 
The set currently has 98 genes and 16 pseudogenes. 
 
D. Nelson  
 

>CYP1A BX728777 CX904306.1 CYP1A1 N. Abdletawab

552208048 411550065 409289324 388847477

62629_prot from UCSC browser scaf 287 (+) 1408174-1414975

62% to 1A1 57% to 1A2, 90% to 1A6, 91% to 1A7

flanked by CSK and EDC3, human 1A2 is next to CSK and 1A1.

1A1 is next to EDC3 CLK3.

THERE APPEARS TO BE ONLY ONE 1A GENE IN X. TROPICALIS

MMDNSTTTEVLVASIVFAIVFLVIRSQRVKLPPGTKKLPGP

MPYPVIGNLLSLSKNPHLSLTKMSETYGDVFQIQIGTKPMLVLSGLETLRQALIRQSDEF

AGRPDLFTFRLVGDGQSMTFSSDSGEV

WRARRRLAQNALKTFATSPSPTSSNSCLVEENIITEAEYLIRKFKELIDDKGEFDPYRYV

VVSVANVICGMCFGKRYNHDDEELLNVVNLTDEFGAAAASGNPADFIPILQYFPNSSMKA

FKEINQKFLAFMQKFTKEHYKTFDKNHIRDITDSLIQHSQEKRVDENSDIQLSNEKIVNI

VNDLFGAGFDTITTALSWSLMYLVAHPNIQQRIQDELDQVIGRERRPRLSDRAQLPYTE

AFILEMFRHSSFMPFTIPH (1)

CTTKDTMLNGYFIPKGICVLINQWQVNHDP(2)

NLWQDPFKFCPERFLNNDGTMVNKTEMEKVMIFGL

GKRRCVGEAIGRMEVFLFLTTMLQQMQFFKQDGEKLDMSPQYGLTMKHKR

CHLTAKLRFALLTN*

 

>CYP1A6      Xenopus laevis (African clawed frog)

            GenEMBL AB022087

            Fujita,Y. and Ohi,H.

            Xenopus laevis mRNA for cytochrome P450, cDNA clone MC1

            unpublished(1999) In press

            clone MC1

            91% to CYP1A BX728777, 92% to CYP1A7 X.laevis

MTDWIGSIAGLMANTTITEFLLVSTVFAIVFLVLRSERVKIPPG

TKKLPGPMPYPIIGNLLSLSKNPHLSLTRMSKTYGDVFQIQIGTKPVLVLSGLETLKQ

ALIRQGDEFAGRPDLFTFRLVGDGKSLTFSSDSGEVWRARRRLAHNALKTFATSPSPT

SSSSCLVEENIITEAEYLVRKFKQLIDEKGEFDPYRYVVVSVANVICGMCFGKRYNHD

DEELLNVVNLTDEFGAAAASGNPADFIPILQYLPSSSMKAFKEINRKFLDFIQKLVKE

HYKTFDKNHIRDITDSLIQHSQEKRVDENSNVQLSNQKIVNIVNDLFGAGFDTITTAL

SWSLMYLVAHPNIQEKIQDELDQVIGRERRPRLSDRAQLPYTEAFILEMFRHSSFVPF

TIPHSSTTDTVLNGYFIPKGICVLINQWQVNHDPNLWKDPFKFCPERFLNTDGTTLNK

IEMEKVMIFGLGKRRCVGEVIGRMEVFLFLTTMLQQMQFFKQDGEKLDMSPQYGLTMK

HKRCHVTAKIRFPLLATH

 

>CYP1A7      Xenopus laevis (African clawed frog)

            GenEMBL AB022088

            Fujita,Y. and Ohi,H.

            Xenopus laevis mRNA for cytochrome P450, cDNA clone MC2

            unpublished(1999) In press

            clone MC2

            91% to CYP1A BX728777

MTNWIGTVAGMMANTTITEFLVASVVFAIVFLVIRSQRVKIPPG

TKKLPGPMPYPVIGNLLSLSKNPHLSLTRMSETYGDVFQIQIGTKPVLVLSGLETLKQ

ALIRQGDEFAGRPDLFTFRMVGDGQSMTFSSDSGEVWRARRRLAQNALKTFATSPSPT

SSSSCLVEENIITEAEYLVKKFMQLIDEKGEFDPYRYVVVSVANIICGMCFGKRYNHD

DEELLNVVNLTDEFGAAAASGNPADFIPILQYLPSSSMKAFKEINRKFIDFMQKFATE

HYKTFDKNHIRDITDSLIQHSQEKRVDENSNVQLSNQKIVNIVNDLFGAGFDTITTAL

SWSLMYLVAHPNIQEKIQDELDRVIGKERRPRLSDRAQLPYTEAFIFEMFRHSSFMPF

TIPHCTTKDTVLNGYFIPKGICVLVNQWQVNHDPNLWKDPSKFYPERFLNTDGTMVNK

TEMEKVMVFGLGKRRCVGEAIGRMEVFLFLTTMLQQMQFFKQDGEKLDMSPQYGLTMK

HKRCHVTAKLRFPLLTTD

 

>CYP1B1 CX846813.1 C.Blackwell 1B1 as query 55% to 1B1 ortholog
CL126458.1 from GSS, Trace archive 483147144 391272900 233714403
422555774 (from Trace search with Human DNA for last part) 483233841
MNWKIWEDLGQSSVPKLLLSFLCALTVAHILKWIHEWIIPRWIRS

SQPPGPFPWPLFGNALQMGSYPHLAFIDLAKRYGNIFQIKLGSQKIVVLNGDLVIRHALL

HKGEDFAGRPKFTSYQFVSGGRSLAFGCYTEKWKAHRKLAHSTVRAFSTGNPQTKRCLAE

NVLKEARDLIALFSELGQGGKYFYPGRHTVVSVANVMSAVCFGRRYQHGDLEFQSLLSNN

DKFTRSVGAGSLVDVMPWLQRFPNPVRSVFRSFQQ (1)

VNYEFYDFVYKKFLLHRNTANQAV

TRDMMDAFIHILITKEGKVRADDADGGEEKGKNGQYFFHSLEAEHVPS

TVTDIFGASQDTLSTALQWVIFFLVR (2)

YPEIQTKLQDEMDRVIGKDRLPCIEDQPKLPYLMAFLYEF

MRFSSFVPITIPHATTKNTTIMGYQIPKDTVVFVNQWSVNHDPQKWSNPGEFNPSRFLDD

NGLINKDLVSNIMIFSVGKRRCIGEELSKIQLFMFSSILLHQCIFTALPADNLNPKGDYG

LSIKPKPFRISMTLRHGSMDLLNNSVLSGMAE*

 

>CYP1C1 scaffold_627:21880-23454 (-) strand

MTPMDTAEPPAEWKDSVQPALVFSFLILICLEVCLWLRNNGQRRSPP

GPFPWPVVGNAMQLGQLPHLTFCKMSQKYGNVFQIRLGTQDIVVLNGDSTIREALVKHSK

EFAGRPNFSSFQLISGGKSIAFGGYSTLWKAQKKIAHSTLRAFSTVNSKTQKLFEKHVVA

EAQDLIDVFLRLTSEEEYFDPTRECTVAAANVICALCFGKRYSHDDEEFKALIGRNDKFG

QTVGAGSLVDIMPWLLTFPNPVRSLYQSFKDLNWEFYGFVKEKVSHHRQTYNPEITRDMS

DAFISHIDNAEGIEAGDGLSKDYVESIVNDILGAGQDTTATALTWILLLLIKYPDIQQKL

QEEIDLVVGPNRLPTADDKVQLPYVQAFIYEALRFSSFVPVTIPHSTTSDVVIDGFYIPK

DTVVFVNQWSVNHDESKWKNPDVFDPSRFLDEEGQLDRDAAFGVMIFSVGKRRCIGDQLS

MLQIFLFTAIFLHQCTLHGNPKEIPTMDCISGLSLKPLPYGMSVRARVGRTTMKEPV*

 

>CYP1D1 DN053435 DN024870 51% to CYP1A8P ortholog DN024871 mate pair to DN024870
DN025714.1, 55% to CYP1D1 anole_ENSACAP00000011966

MESAVKKTLMDMMPMLLKASISFLTVLLVMSILWKKRNSLPGPWAVPI

VGNFFQLGDQIHITLTDMRNRYGDVFQIKLGLMPIVVVSGLETVKRVLLKEGENFADRPN

FYSFSLFSNGSSMTFSEKYGESWKIHKKIMKNALRNLSNESTNSSNCSCRLEEYVCAEAS

DLVQELTDLSAEKVAFDPSQSIVITVANVVCALSFGKRYDHHDKEFLTLIDFNNDLRKA

AGGGLLADFIPILRFIPSSSVKALKKFVQSFHSFIAKCVKDHFATFEENNIRDITDA

LIQLCKERKSEDKNQLLSDDQIISTVNDIFGAGFDTITSALLWAIFYLLRYPEFQDKIHK

EIEEKIGCNRAPRFNDRKDLHYTEAFINEVLRHSSFVPFGLPHCTTMDTKLNGYFLPKGT

CVFTNLYQVNHDNTVWKDADMFMPERFLDQNGQIIKSLTEKVLVFGMGVRKCLGEDVARN

EMFVIMTIMMQRLKLVKSTKHELDPIPVYGLTLKPKPYYLVAKVRT*

 

>CYP2D45

NM_001015719.1 CX969358.1  54% to 2D6 E.Mahrous

MSLLSQLCPFALGCNVFTLGIIFTLLLLLLDFMKRRKPCTDFPP

SPPSWPFVGNLLQMDFRDLHNSFKQLSKQYGDVMSLRVFWKPTVVLNGFEVIKEALIQ

KSEDTADRPPFNLYEILGFVGNNKAVVLANYGQSWKDLRRFTLSTLRDFGMGKKSLEE

RVRDEAGYLCDAFQSEQGGPFDPHVLINTAVSNVICSIIFGERFEYDDHKFLKLLCLI

EESIKAESGPVPQIISSLPWSSKVPGLARLFFQPRIHMLQYLQEIINEHKQTWDSGHT

RDFIDAFMLEMKKAKGVKDSNFNDQNLLLTTADLFSAGSETTTTTLRWGLLFMLLYPD

VQRKVQEEIDQVIGRTRKPTMGDVLQMPYTNAVIHEIQRYADIIPLSVPHMAYRDTHI

KGFFIPKGTVIMTNLSSVLKDEKVWEKPFQFYPEHFLDRDGKFVKREAFMAFSAGRRV

CLGEQLARMELFLFFTSLLQRFSFQIPDGEPCLREDPVFVFLQVPHDYKICAKVR

 

>CYP2D52 CYP2D.2 scaffold_160:866974-882965 (-) strand UCSC browser

DR873330.1 Trace archive 408392602, 234381521

93% to CYP2D.1,

scaffold_69:2444151-2452065 exons 4,5,6,8,9 (+) strand

MSLLSQLCPFALGCNVFTLGIIFTLLLLLLDFMKRRKPCTDFPPSPPSWPFVGNLLQMDFSSLSFRQ (0)

LRKQYGDVFSLQLGWQNVVVLNGYEAIKEALLQKSEDFADRPPFELYEGIGFTGNNK (1)

GVVLANYSQSWKDLRRFTLSTLRDFGMGKKSLEEKVREEAGYLCDAFQSEQ (1)

GQLFDPHYKLNTAVANIMNSIVFGDRFDYDDYKFQKLLNLNQEMFEVEFGTMAQ (0)

IATAIPWLAKLPGLAKMIYRPHVDVLEYLQKIISDHQKTCNPACTRDLIDAFTLEMEK (0)

VKGDKENYFNEKNLLFTAFDLFTAGSETSSTTLRWGLLYMLLYPDVQ (1)

RKVQEEIDQVIGKSRKAAMADVLQMSYTNAVIHEIQRCADLVPLSVTHMTYRDTEVQGFSIPK (0)

GVAVCPNLSSVLKDEKVWEKPFQFYPEHFLDADGKFVKQEAFLPFST (1)

GRRACLGERLARMELFLFFTSLLQRFSFQIPDGEPCPRDDPIVYIVQFPHPYKLCAKIR

 

>CYP2D53 CYP2D.1 scaffold_160:807096-818137  (-) strand UCSC browser

52% to 2D6, 73% to CYP2D45

scaffold_69:2500902-2511943 (+) strand

MSLLSQLCPFALGCNVFTLGIIFTLLLLLLDFMKRRKPCTDFPPSPPSWPFVGNLLQMDSSSLSNSFRQ (0)

LKKQYGDVFSLQFYWQNVVVLNGYEAIKEALLQKSEDFADRPPFELYEGIGFTGNNK (1)

GVVTAKYGQSWKDLRRFTLSTLRDFGMGKKSLEERVGEEAGYLCDAFLSEQ (1)

GQLFDPHYKLNTAVANIISFIVFGDRFDYDDYKFQKLLNLNQAMFEVESGTMAQ (0)

IATAIPWLAKLPGLAKMIYRPHVDVLEYLQKIISDHQKTWNPACTRDLIDAFTLQMEK (0)

AKGDKENHFNEKNLLFTTFDLFTAGSETSTTTLRWGLLYMLQYPDVQ (1)

RKVQEEIDKVIGKSRKPVMADVLQMSYTNAVIHEIQRCADLVPLSLIHMTYRDTEVQGFSIPK (0)

GVAVIPNLSSVLKDEKVWEKPFQFYPEHFLDADGKFVKQEAFLPFST (1)

GRRACLGERLARMELFLFFTSLLQRFSFQIPDGEPCPRDDPIVYIVQIPHPYKLCAKIR*

 

>CYP2D.3 scaffold_160:1923301-1927860  (+) strand then a gap  UCSC browser

Trace archive to fill in seq gap with exon 4 387743496

241672823 to finish exon 7

418485537 walking down, 479264026 = exon 8, 248788894 = exon 9

5aa diffs to 2D45

scaffold_69:1386615-1401510 (-) STRAND part of two genes

X. tropicalis Aug. 2005 (JGI 4.1/xenTro2) assembly

MSLLSQLCPFALGCNVFTLGIIFTLLLLLLDFMKRRKPCTDFPPSPPSWPFVGNLLQMDFRDLHNSFKQ (0)

LSKQYGDVMSLQVFWKSMVVLNGFEVIKEALIQKSEDTADRPPFNLYEILGFVGNNK (1)

AVVLANYGQSWKDLRRFTLSTLRDFGMGKKSLEERVRDEAGYLCDAFQSEQ (1)

GGPFDPHVLINTAVSNVICSIIFGERFEYDDHKFLKLLCLIEESIKAESGPVPQ (0)

IISSLPWSSKVPGLARLFFQPRIHMLQYLQEIINEHKQTWDSGHTRDFIDAFMLEMKK (0)

AKGVKDSNFNDQNLLLTTADLFSAGSETTTTTLRWGLLFMLLYPDVQ (1)

RKVQEEIDQVIGRTRKPTMGDVLQMPYTNAVIHEIQRYGDIIPLSVPHMAYRDTHIKGFFIPK (0)

GTVIMTNLSSVLKDEKVWEKPFQFYPEHFLDRDGKFVKREAFMAFSA (1)

GRRVCLGEQLARMELFLFFTSLLQRFSFQIPDGEPCPREDPVFVFLQVPHDYKICAKVR*

 

>CYP2D.4 scaffold_160: 1936385-1938199 (+) strand (exons 6-9)

BX707908.1, CX969358 mate = CX969359 3aa diffs to 2D45

MSLLSQLCPFALGCNVVTLGIIFTLLLLLLDFMKRRKPCTDFPPSPPSWPFVGNLLQMDFRDLHNSFKQ

LSKQYGDVMSLRVFWKPTVVLNGFEVIKEALIQKSEDTADRPPFNLYEILGFVGNNK

AVVLANYGQSWKDLRRFTLSTLRDFGMGKKSLEERVRDEAGYLCDAFQSEQ

GGPFDPHVLINTAVSNVICSIIFGERFEYDDHKFLKLLCLIEESIKAESGPVPQ

IISSLPWSSKVPGLARLFFQPRIHMLQYLQEIINEHKQTWDSGHTRDFIDAFMLEMKK

AKGVKDSNFNDQNLLLTTADLFSAGSETTTTTLRWGLLFMLLYPDVQ

RKVQEEIDQVIGRTRKPTMGDVLQMPYTNAVIHEIQRYGDIIPLSVPHMAYRDTHIKGFFIPK

GTVIMTNLSSVLKDEKVWEKPFQFYPEHFLDRDGKFVKREAFMAFSA

GRRVCLGEQLARMELFLFFTSLLQRFSFQIPDGEPCPREDPVFVFLQVPHDYKICAKVR*

 

scaffold_69: 1395631-1401510 1 aa diff with CYP2D.3, 3 aa diffs to 2D45

1401510 MSLLSQLCPF ALGCNVFTLG IIFTLLLLLL DFMKRRKPCT DFPPSPPSWP FVGNLLQMDF

RDLHNSFKQL SKQYGDVMSL QVFWKFMVVL NGFEVIKEAL IQKSEDTADR PPFNLYEILG

FVGNNKAVVL ANYGQSWKDL RRFTLSTLRD FGMGKKSLEE RVRDEAGYLC DAFQSEQ

(missing exon 4)

IISSLPWSS

KVPGLARLFF QPRIHMLQYL QEIINEHKQT WDSGHTRDFI DAFMLEMKKA KGVKDSNFND

QNLLLTTADL FSAGSETTTT TLRWGLLFML LYPDVQ 1395693

1394589 RKVQEEIDQVIGRTRKPTMGDVLQMPYTNAVI 1394497

 

(gap)

 

second sequence after the gap CYP2D51

94% to CYP2D45

1391855 IVSSLPWSSKFPGLARLFFQPRLRMLQYLQEIINEHKQTWDSGHTRDFIDAFMLEMEK

AKGVKDSNFNDQNLLLTIAELFVAGTETTTTTLRWGLLFMLLYPDVQ 1391124

1388429 RKVREEIDQVIGRTRKPTMGDVLQMPYTNAVIHEIQRYGDIIPLSMPHMAYRDTHIKSFFIPK

G TVIMTNLSSV LKDEKVWEKP

FQFYPEHFLD RDGKFVKREA FMAFSAGRRV CLGEQLARME LFLFFTSLLQ RFSFQIPDGE

PCPREDPVFV FLQVPHDYKI CAKVR* 1386612

 

 

There are some assembly difficulties at scaf 160 in this region.  Some duplicate exons exist.  The D.3 and D.4 may be the same gene.  Only 4 aa diffs

 

Xenopus CYP2ABFGST cluster derived from CYP2Y fish genes

 

>CYP2AS1 1ENSXETT00000040508 length=495

100% to DN017333.1   51% to 2C8

scaffold_481:386505-397104 (+) strand

55% TO 2C84, 55% TO 2AM2, 55% TO 2Q8, 54% TO 2G3 anole

MSPSIFTLLIFVLLVLLSIMWWKKNLKDRSLLPPGPTPLPFLGNLLQVK

PKEFLKALDKLKEKHGSVFTVYFGARPTVILCGYQTVKEALIDQADTFSS

RGKMALAEHILKGYGITGSNGERWKQLRRFALTTLRNFGMGKRTIEKRIQ

EETTFLIEEFRNAEGMPFDPTFYLGCAVSNIICSIVFGERFDYNDKQFLF

LLKNINKVLRFMNSTWGVVFFTFDKIMCHIPGPHQKAMKHLVDLKAFVQQ

RVRESKEILDINSPQHFIDCFLIKMQEEQENPHSEFHMDNLIGSALNLFF

AGTETVSTTLRYGILILLKWPHIQGRIQEEIDDVIGRQQCPKIEDRSKMP

YTDAVIHEIQRFSDIVPTGLPHTATQDTTFRGHTIPKGTDVFALLTTVLK

DPEVFQNPEEFNPERFLDENGILKKSQAFMPFSAGKRMCPGESLARMEIF

LFLTTLLQKFTLIPTVPSVDLDVTPEISSSGHLPREYKMCVLPRQ

 

>CYP2AS1 DN017333.1 51% to 2C8, Ramy Naguib Attia

cannot extend in the ESTdb, 55% to CYP2C84_Phalacrocorax, 55% to CYP2C45

MSPSIFTLLIFVLLVLLSIMWWKKNLKDRSLLPPGPTPLPFLGNLLQVKPKEFLKALDK (0)

LKEKHGSVFTVYFGARPTVILCGYQTVKEALIDQADTFSSRGKMALAEHILKGY (1)

GITGSNGERWKQLRRFALTTLRNFGMGKRTIEKRIQEETTFLIEEFRNAE (1)

GMPFDPTFYLGCAVSNIICSIVFGERFDYNDKQFLFLLKNINKVLRFMNSTWGV (0)

VFFTFDKIMCHIPGPHQKAMKHLVDLKAFVQQRVRESKEILDINSPQHFIDCFLIKMQE (0)

EQENPHSEFHMDNLIGSALNLFFAGTETVSTTLRYGILILLKWPHIQ (1)

GRIQEEIDDVIGRQQCPKIEDRSKMPYTDAVIHEIQRFSDIVPTGLPHTATQDTTFRGHTIPK (0)

GTDVFALLTTVLKDPEVFQNPEEFNPERFLDENGILKKSQAFMPFSA (1)

GKRMCPGESLARMEIFLFLTTLLQKFTLIPTVPSVDLDVTPEISSSGHLPREYKMCVLPTT*

 

>CYP2AR1 2ENSXETT00000040493 length=496

100% to NM_001001212.2   51% to 2C18

scaffold_481:355382-379903 (+) strand

MDWALEINGLPILLLIAALLLLLARKVGKKVKGCLPPGPKPLPILGNLLQ

LKSREIHKPLLEFNKKYGPVYTLYMGSMPAVVLCGYEAVKEALVDNAEKF

SGRAEVPIVNLTTQGYGIAFSNGERWKELRRFSLTTLRNFGMGKRSIEER

IQEEIHFLLEAFHETQGSFFSPAFIIRRSVSNVICSVVFGKRFDYTDQKL

QILLDLIAENLRRVDNIWVQVYNFIPKLLNILPGPHHKLTENYKAQLRYV

EEIVQEHGKTLDPSAPQDYIDAFLLKMEQERKKAHTEYNVQNLLSCSLDI

FFAGQESTSSTLGYGLLILMKYPHIKEKVQAEIESVIGRSRRPCMDDRAK

MPYTEAVIHEIMRFIDFFPLGVPHSVTEDTLYRGYVIPKGTTIFPFLHSV

LFDPSMFERPQEFYPGHFLNQDGSFRKNEGFMAFSAGKRACPGKSLARVE

IFLYLTSILQQFDPQPALSPKDIDLSPEYSGFGKMAPSFQLKLVPH

 

>CYP2AR1 NM_001001212.2 51% to 2C18

53% to CYP2C100v1 anole_ENSACAP00000003921

MDWALEINGLPILLLIAALLLLLARKVGKKVKGCLPPGPKPLPI

LGNLLQLKSREIHKPLLEFNKKYGPVYTLYMGSMPAVVLCGYEAVKEALVDNAEKFSG

RAEVPIVNLTTQGYGIAFSNGERWKELRRFSLTTLRNFGMGKRSIEERIQEEIHFLLE

AFHETQGSFFSPAFIIRRSVSNVICSVVFGKRFDYTDQKLQILLDLIAENLRRVDNIW

VQVYNFIPKLLNILPGPHHKLTENYKAQLRYVEEIVQEHGKTLDPSAPQDYIDAFLLK

MEQERKKAHTEYNVQNLLSCSLDIFFAGQESTSSTLGYGLLILMKYPHIKEKVQAEIE

SVIGRSRRPCMDDRAKMPYTEAVIHEIMRFIDFFPLGVPHSVTEDTLYRGYVIPKGTT

IFPFLHSVLFDPSMFERPQEFYPGHFLNQDGSFRKNEGFMAFSAGKRACPGKSLARVE

IFLYLTSILQQFDPQPALSPKDIDLSPEYSGFGKMAPSFQLKLVPH

 

>CYP2AM1 3ENSXETT00000040442 length=488

76% to CYP2AM2 14945_prot (new), 51% to CYP2C8

scaffold_481:338490-348628  (-) strand

TILLTACVTILLFLFKWRGKIKIKNLPPGPTPVPLLGNIPQINTTELPTS

LLELSKTYGPVYTLHLGSYRSVMLIGYDAVKEALIDRSEVFSDRGIMDFT

ELIFKNNGVLMTNGERWKTMRRFTLMTLRNFGMGKRSIEERIQEESQSLA

EAFEKNKGGQPFDPMYLLVLAVSNIICSIIFGERFDYEDQKFLTLLKYLR

EIIRLSNTFIGQLLNFFPNVLQYIPGPHQNIFTYFDKLKEFVREEANAHK

DTLDKNCPRDFIDCFLMRMEEVSSSKSEFHNENLNQVIFDLFIAGTETTS

VTLRYAFLILLKYPEIQEKIHKEIDQVIGQDRCPSVVDRSKMPYTEAVIH

EVQRFADIVPAGLAHAASKDTTFRGYNIPKGTLIFPVLTSVLKDPKFFKN

PYQFDPGHFLDNEGNFRKNDAFMPFSGGKRVCAGEGLARMELFIFLTTIL

QKFILKPTVDIKDIEITPEPKTNGSQPRSYKMFVVPRC

 

>CYP2AM2 4ENSXETT00000040456 length=465

77% to CYP2AM2 14945_prot new 51% to CYP2A6, 53% to CYP2C19

scaffold_481:304400-318686 (-) strand

MALGFVGTILLTACVTILLFLFKWRGKIKIKNLPPGPTPIPLLGNIPQIN

TTELPNSLLELSKTYGPVYTLHLGSYRSVMLIGYDAVKEALIDRSEVFSD

RGIMDLTELIFKNYGVIMTNGERWKTMRRFTLMTLRNFGMGKRSIEERIQ

EESQSLAEAFEKNKGGQPFDPMYLLVLAVSNIICSIIFGERFDYEDQKFM

TLLMYLREIIRLSNTFIGQLLNFFPKVLQYIPGPHQNIFTYFDKLKEFVR

EEANAHKDTLDKNCPRDFIDCFLMRMEEEKMNPNSEFHNENLNEVIFDLF

FAGTETTSVTLRYAFSILLKYPEIQEKIHKEIDQVIGQDRCPSVEDRSKM

PYTEAVIHEVQRFADIVPAGLAHAASKDTTFRGYNIPKGTLIFPVLTSVL

KDPKFFKNPYQFDPGHFLDNDGNFKKNDAFMPFSAGKRVCAGEGLARMEL

FIFLTTILQKFILKP

 

>CYP2AM3 5ENSXETT00000040443 length=497

80% to 14945_prot (new)  51% to CYP2C8

scaffold_481:286338-294185 (-) strand

MDSAGTILLSVCVIILLYLVKWRGKSKSKNLPPGPTAYPLLGNFPQIGLR

EIPSSFVQLSKTYGPVYTLYLGGHRLIVLIGHDAVKEALIDQSDVFSDRG

RLGISQVLFDEHGVIMSNGERWKTMRRFTLTTLRNFGMGKRSVEERIQEE

ARSLEEAFRKKKGLKTDEPFDPVNLLGPAVSNIICSIIFGDRFDYEDEKF

TTLLKCMRELINLLNSLFGQLVNVFPNLSQHIPGPHQNIFTYFNKIKQFV

KDEAKSHKDTLDANCPRDFIDCFLIRMEEEKMNPNTEFHNDNLFAVIFDL

FFAGTETSSLTLRYAFLIFLKYPEVQEKVYKEIDQVIGQNRYPSFEDKIK

MPYTEAVIHEVQRFADIVPTGLEHKTSKDTTFRGYDIPKGTSVFPVLTSV

LKDPKYFKNPDQFDPGHFLDENGCFKKNDAFMPFSAGKRMCAGEGLARME

LFIFLTSILQKFTLKPTVPAETIKITPQPKTNASQPWPYKMYAVPRC

 

>CYP2AM4 6ENSXETT00000019327 length=495

100% to 14945_prot 52% to CYP2C8

scaffold_481:264840-277155 (-) strand

MAMDSAGTVLLAACVIVLFYLVKWRGNNKRKNLPPGPTAFPLLGNFLQVS

TTEIPSSCVELSKTYGPVFTLYLGGHRSIILIGYDAVKEALIDNSDVFSD

RGEGGVSEMIFKNYGVILSNGERWKTMRRFTLTTLRNFGMGKRSVEERIQ

EEARSLEEAFRKKKDEPFDPIYLLGLAVSNIICSIIFGERFDYEDEKFMT

LLMYIREFVKLLNSFFGMLFNFFPNLFCYIPGPHQNIFTYFNKLKQFVKD

EAKSHKDTLDANCPRDFIDCFLIRMEQEKNNPNSEFHYENLFGTILDLFL

AGTETTSSTLRYAFLILLKYPEIQENVYKEIVQVIGQHRYPSVEDRSKMP

YTEAVIHEVQRIGDILPLGLEHAASKDTTFRGYDIPKGTLIFPLLTSVLK

DPKYFKNPDQFDPEHFLDENGCFKKNDAFMPFSTGKRVCAGEGLARMELF

IFLTTILQKFILKSTVATEEIKITPEPNTNGSRPWPYKMFVVPRC

 

>CYP2AM5 52542_prot scaffold_1232:27024-44511 (+)

57% to 14945_prot, 55% to 14947_prot

scaffold_481:233222-250706 (-) strand

MELGVTWSLILAVIVSFLVYSFTWRRKLRKINMPPGPPLYPLLGNMLQIS

AKEFPQSLVKLSEKYGTVFTVYLPSKPAVILSGYDCIKEALLDNNESFGA

RGESPLGYLLFKDYGVIFSNGERWKQLRRFSLSCLRDFGMGKKSIEERIQ

EEARCLVEELGKNGDTPMDPTYMLTLAVSNVICTVVFGERFDYKDEKFMT

LISLLKIVSRDFSSAWGIRSRRPRTRSCAQKLLNLFPNTLSRLPGPPQRL

FRNFDKLKAFVAESLKSHQETLNSDCPRDFIDCFLIKMEKEKNNPQTEFH

SDNLFGTVLDLFFAGTETTSITLKYSFLMLLKYTEVTRKAMEEIDNIIGQ

ERCPFYEDRIKMPYTNAVIHEIQRMADIVPLGVPHATTHDIIFRGYNIPK

DTIIFPLMTSVLKDPKYFNDPKQFDPAHFLDENGSFKKNDAFQPFSIGKR

SCLGEGLARMEIFLFITSILQAFNLKSDTAPQDIDITPEPDKNGAIPRTY

KMYFVPK

 

>CYP2AM6 7ENSXETT00000019332 length=492

100% to 14947_prot  50% to CYP2C18

scaffold_481:214755-230628 (-) strand

MAVLGIETLFLVCSFTFLVFLFSRRQRHARLPPGPTPLPLLGNVLQLDFS

KQVKEFVKLGSQYGPVSMVYLGPYPVLVLNGYDVVKEAFVDNGEVFSNRG

KNAFIEMIFKGRGVAFSNGERWRQMRRFSLSTLRDFGMGKRRVEERVQEE

ACALVEEFKKTKGTPFNSTYLMTLAVSNVICSVVFGERFDYQNETFLSVL

ALLKDTFKIITSPWTQLFSFAPGLLKHLPGPHKKAAENLDRLKTFVTEFV

ASHEETLEENFPRDYIDCFLIKMRQEKDNVNTEFDYENLFVTLMNLFFAG

TETTSITLQYGMLILLKYPDIQKKIHEEIDSVIGFNRCPSMEDRPKMPYT

DATIHEIQRFADIVPMGVPRSTNKDTTLRGYDIPKGTTVFPMLTCILKDP

RYFKDPESFNPCHFLDEKGCLKKTDAFIPFSIGKRVCLGEGLARMEIFLF

LTSILQRFELKCHMDPKDIDISPVPSKSAYMPRPYELYITPR

 

>CYP2Q4 8ENSXETT00000019340 length=440

99% to 52548_prot N-term does not match

67% to CYP2Q2, 56% to CYP2A6, 57% to CYP2G2P human

scaffold_481:119494-131087 (-) strand

VFYIQQFGKQYGPVYTLYLGPRPVIVLNGYQAVKEALIDQGEEFSGRGKL

VVADLIFGGFGVVFSNGDRWKQLRRFSLMTLRDFGMGKRSIEERIKEEAQ

CLQVELHKYKQTPTDPQNILVQAVSNVICSVVFGNRFEYENSEFLKLLRL

FNETFQMMSSTWGQLQQIIPFIMNYIPGPHQKIDKVVARQLEFVSERVKK

NQETIDFNSPRDFIDCFLIKMQQETQNPTSEFNLKNLLMTVLNLFVAGTE

TVSSTLRNGILLLLKYPHIQEKLHKEIDVVIGQNRSPNIDDRSKMPYMDA

VIHEIQRFTDILPMNLPHSVIKDTAFQGYTIPKDTDVYPMLCSVLRDPTQ

FTTPENFNPEHFLDDSGCFKKSDAFMPFSTGKRICLGEGLARMELFLFLT

TILQNFTLTSETQITESDITPRMAGFANVPISYKVSFVPR

 

>CYP2Q3 9ENSXETT00000019347 length=501

100% to CYP2Q3, 54% to CYP2A6

scaffold_481:88528-107073 (-) strand

MDTTWLWSLQLFLLIATMLIYSTWNKMYRKRNLPPGPTPIPLFGNVLQIK

RGEMVKSLLELGKKYGPVYTLYFGPSPVIILCDYQSIKEALNDQAEEFSG

RGKIPSWDQFFQGYGESFSNGDEWKQLRRFSLTTLRNFGMGKRGIEERIQ

EEAQFLVAEIKSYKGKPFDPTKILVQCVSNVICSVVFGQRYEYSNKDFHK

LLYMFQAVFEDTSSTLGQLMTLLPNIMNHIPGPHKTVVNKLNKVNDFILQ

RVKENEKTLDPNSPRHFIDSFLIQMQKEKDNPVTKFHWKNLLCTIMNLFF

AGTETVSTTLRHGFLMLLIHPEIEEKLHEEIDRVVGQDRSPTIEDRSKMP

YTDAVIHEIQRFSDVLPMSLPHLVMKDTQFRGYTIPKGTDVYPLICAALR

DPKQFATPNKFNPQHFLDDNGLFKSSNAFLPFSTGKRICLGEGLARMELF

LFLTNILQNFKLHSENQFAEDDIAPKMNGFANYPLSYEFSLIPRVQSLLV

L

 

>CYP2Q2 10ENSXETT00000019348 length=494

100% to CYP2Q2, 55% to CYP2A6

scaffold_481:62341-74973 (-) strand

MDTSWLWTLLLCLLISAMLIYSTWNKMYRKRNLPPGPTPIPLFGNVMQIK

RGEMVKSLIELGKKYGDIYTLYFGPSPVVILCSYRAIKEALIDQAEEFSG

RGAIPSFDQYFQGYGVVFTNGEEWKNLRRFSLSTLRNFGMGKRGIEERIK

EEAQFLVAEIKSYKEKPFDPTNILVQCVSNVICSVVFGNRFEYANKDFQN

LLSLFQSVFQETSSSWGQLLNMLPAVMNHVPGPHKNIIRDMNKLEDFVLQ

RVKENEKTVDPNSPRDLIDSFLIKMQQENKNPTSPFHMKNLIATILSIFF

AGTETVSTTLRHGFLILLIHPEIEAKLQEEIDRVVGQNRSPTIEDRNKMP

YTDAVIHEIQRLSDVIPMNVPHLVTKDTKFRGYTIPKGTNIYPLLCAVLR

DPEQFDTPSKFNPNHFLDDKGCFKSNDGFMPFSTGKRICLGEGLARMELF

LFLTNILQNFKLHSESGLTEDNIAPKMKGFANYPTSYQLSFIPR

 

>CYP2Q9 11ENSXETT00000021283 length=494

64% to CYP2Q4, 54% to CYp2G2P

scaffold_481:40496-49325 (+) strand

MDFSGCGTIFLTIFITLLIFFMIWNKMYRRRKLPPGPTPLPLIGNLLQVR

NGEMAKTLMELGKQYGPVFTFYFGSHPVVVFCGYDAVKEALVDKGEDFVG

RGKQPTVDRVFQGYGLITSEGDRWRQLRRFSLKTLRNFGVGKRTIEERIN

EEASCLVEELRTYKELPVDPAIIISKAVTNVISSVVFGTRFDYSDKRFHR

MLDIFYETFELMSSVWGQIQDMVPMIMNHIPGPHQNIVTLLEELNEFITE

RIKLNQDTLDPNSPRDYIDCFLIKMQEEKDNPASEFNYKNLMLTLNNLFF

AGGETVATTLKHGLLVLLKYPDIQAKLHEEIDRVIGQNRSPNIEDRNKMP

YTEAVIHEIQRFANVIPMNAPHSATRDTNFRGYTIPQGTGVCALLCSVLG

DPKYFVTPNKFNPNHFLDADGHFIKNEAFLPFSTGKRICLGEGLARTELF

LFFTNILQNFQLTSDTHFTESDIAPRMTGFANVPIPYKLSFVPR

 

>CYP2Q8 12ENSXETT00000021306 length=496

100% to DN060997.1 57% to CYP2G1 orangutan, 59% to CYP2Q4

57% TO 2C84 FINCH

scaffold_481:18714-27604 (-) strand

MEILGATAVLLVICAFFLLLNTIQVIRRQGKGKLPPGPTPLPFLGNFLQL

RGEEVFKSLLEFGKKYGPVYTIHLGMEPVVVLCSFDIVKEALNDNGDEFG

ARGHMPLLEKISHGGHGVVASNGERWKQLRRFSLMTLRNFGMGKRSIEER

IQEEAHFLTNEFKYTKGQPVDPTFYFSKAVSNVICSVVFGDRFEYEDTEF

LRLLGLLNQVFRGFSSVWGQLYNIFPKVMGKLPGPHNMIFKSVNSLQEFI

MQRINMHQETLDPSSPRDFIDCFLIKMQQEKDVPQTEFHMQGALNTTFDM

FGAGTETVSTTLRYGLLILLKHPDIEERIQKEIDSVIGRNRAPCIEDRSR

MPYTDAVIHEIQRFVDIIPMGIPHKVTRDIQFQGYFIPKGTTVYPMLSSV

LHDPKQFKYPDIFNPGHFIDENGKFCKNDGFMPFSSGKRICVGEGLARME

LFLFITTILQNYTLRSPVDTEDLDLTPELSGFGNIPRPYKLCFIPR

 

>CYP2Q8 DN060997.1 DR833173.1 DR842090.1 CF374775.1

best hit to CYP2S1 in ESTdb X.tropicalis H.Penmatsa, K. Iyer, G. Vasser

best match in human = 2C18 55%, 47% to 2S1 not a 2S ortholog
56% to CYP2C84_Phalacrocorax, 57% to CYP2C84 finch
MEILGATAVLLVICAF

FLLLNTIQVIRRQGKGKLPPGPTPLPFLGNFLQLRGEEVFKSLLEFGKKYGPVYTIHLGM

EPVVVLCSFDIVKEALNDNGDEFGARGHMPLLEKISHGGHGVVASNGERWKQLRRFSLMT

LRNFGMGKRSIEERIQEEAHFLTNEFKYTKGQPVDP

TFYFSKAVSNVICSVVFGDRFEYEDTEFLRLLGLLNQVFRGFSSVWGQLYNIFPKV

MGKLPGPHNMIFKSVNSLQEFIMQRINMHQET

LDPSSPRDFIDCFLIKMQQEKDVPQTEFHMQGALNTTFDMFGAGTETVSTTLRYGLLILL

KHPDIEERIQKEIDSVIGRNRAPCIEDRSRMPYTDAVIHEIQRFVDIIPMGIPHKVTRDI

QFQGYFIPKGTTVYPMLSSVLHDPKQFKYPDIFNPGHFIDENGKFCKNDGFMPFSSGKRI

CVGEGLARMELFLFITTILQNYTLRSPVDTEDLDLTPELSGFGNIPRPYKLCFIPR*

 

>CYP2Q2
CX972427.1 best hit to CYP2A13 in ESTdb X.tropicalis S.Hill, A.Bolen

NM_001010998.1 89% to CYP2Q1, 55% to 2A6 same as CX972427.1

from refseq database

55% to CYP2G3 anole_ENSACAP00000004548, 54% to CYP2G12 anole_ENSACAP00000000568

MDTSWLWTLLLCLLISAMLIYSTWNKMYRKRNLPPGPTPIPLFG

NVMQIKRGEMVKSLIELGKKYGDIYTLYFGPSPVVILCSYRAIKEALIDQAEEFSGRG

AIPSFDQYFQGYGVVFTNGEEWKNLRRFSLSTLRNFGMGKRGIEERIKEEAQFLVAEI

KSYKEKPFDPTNILVQ

CVSNVICSVVFGNRFEYANKDFQNLLSLFQSVFQETSSSWGQLLNMLPAVMN
HVPGPHKNIIRDMNKLEDFVLQRVKENEKTVDPNSPRDLIDSFLIKMQQENKNPTSPFHM
KNLIATILSIFFAGTETVSTTLRHGFLILLIHPEIEAKLQEEIDRVVGQNRSPTIEDRNK
MPYTDAVIHEIQRLSDVIPMNVPHLVTKDTKFRGYTIPKGTNIYPLLCAVLRDPEQFDTP
SKFNPNHFLDDKGCFKSNDGFMPFSTGKRICLGEGLARMELFLFLT

NILQNFKLHSESGLTEDNIAPKMKGFANYPTSYQLSFIPR

 

>CYP2Q3

NM_001010999.1 54% to 2A6 79% to NM_001010998.1, 78% to 2Q1

from refseq database

56% to CYP2G3 anole_ENSACAP00000004548, 55% to CYP2A13 human

MDTTWLWSLQLFLLIATMLIYSTWNKMYRKRNLPPGPTPIPLFG

NVLQIKRGEMVKSLLELGKKYGPVYTLYFGPSPVIILCDYQSIKEALNDQAEEFSGRG

KIPSWDQFFQGYGESFSNGDEWKQLRRFSLTTLRNFGMGKRGIEERIQEEAQFLVAEI

KSYKGKPFDPTKILVQCVSNVICSVVFGQRYEYSNKDFHKLLYMFQAVFEDTSSTLGQ

LMTLLPNIMNHIPGPHKTVVNKLNKVNDFILQRVKENEKTLDPNSPRHFIDSFLIQMQ

KEKDNPVTKFHWKNLLCTIMNLFFAGTETVSTTLRHGFLMLLIHPEIEEKLHEEIDRV

VGQDRSPTIEDRSKMPYTDAVIHEIQRFSDVLPMSLPHLVMKDTQFRGYTIPKGTDVY

PLICAALRDPKQFATPNKFNPQHFLDDNGLFKSSNAFLPFSTGKRICLGEGLARMELF

LFLTNILQNFKLHSENQFAEDDIAPKMNGFANYPLSYEFSLIPRVQSLLVL

 

>CYP2R1 CX329225.2 DR834894.1 CX379987.2 Yun Peng 74% to human 2R1

79% to CYP2R1v1   finch

MFPPVPLVALVAAALLIGGFLVRQIVKQRKPRGFPPGPPGLPLIGNILA

LASDPHVYMKKQSKIHGQ (0)

IFSLDLGGISTVVLNGYDAV

KECLVRQSDVFADRPSLPLFKKLTNMGGLLNAKYGRCWTEHRKLAVSCFRTFGCSQKSFE

SKISEECLFFLDAIDSYKGKALDPKHLVTIAVSNVSNLILFGERFRYDDNDFLHMIEIFS

ENIELATSAWVFLYNAFPLIGFLPFGKHQQLFRNASEVYDFLLQIIGRFSENRKPQSPRH

FIDAYMDEMERNEAD

PDSTYSMENLIFSVGELIIAGTETTTNVLRWAMLFMALYPNIQGQVQKEIDGVVGLNRMP
TFEEKSRMPYTEAVLHEILRYCNIAPLGIFHATSRDTVVRGYSIPEGTTVITNLYSVHFD
EKYWTDPEIFYPERFLDSAGQFTKKEAFVPFSLGRRHCLGEQLARMEMYLFFTALLQRFH
LHFPQGFVPNLRPKLGMTLQPHPYVICAERR*

 

>CX850388.1 different from 2R1 above 95%, probably same gene with errors

MFPPVPLVALVAAALLIGGFLVRPIVKQRKPRGFPPGSPGLPLIGNILALASDPHVYLKK  184

QSKIHGQIFSLDLGGISTVVLNGYDAVKECLVRQSDVFADRLSLPLFKKLTNMGGLLNAK  364

YGRCWTEHRKLAVSCFRTFCCSQKSFESKISEECLFFLEANDSYE

 

>CYP2U1

CX851239.1 CX439683.1 CX959423.1 DR836116.1

best hit to CYP2U1 in ESTdb X.tropicalis M.Puljic

best match in human = CYP2U1 63%, CYP2U1 ortholog
66% to CYP2U1 finch

MSDLAQDSMSGTLDWKQMGYASWSLLGDCASVSALLLYIALFLGLYLLMGSLWRYYQI

IHSNAPPGPTPWPIVGNFAFMLMPGWLM

QLLNFGIAKGKLRRVPAGATRRGAFLYPHIVLTEMAKMYGKIYGLYIGTRLMVILNDFNS

VKDALVSHSEVFSDRPSVSLVTIITKRKGIVFAPYGPIWRQQRRFSHSTLRYFGLGKLSL

EPKIIEEFKYVKAEMLKFGNKGFSPFEIINNAVSNVICSISFGKRFNYEDKEFKTMLSLM

SRGLEISVNSEAVLICLCSWLYYLPFGPFKELRQIVIDITAFLKRIIAE

HQVTLDPANPRDFIDMYLLHIKEEQKGQAESIFNTEYLFYIIGDLFIAGTDTTTNTLLWS

LLYMCLYPDVQEKVQAEIDTVIGRDRPPSLTDKSQMPFTEATIMEVQRMTVVVPLSVPHM

ASESSVFHGYTIPKGSVVMANLWSVHRDPKVWEKPNDFMPKRFLDENGQILKKEAFIPFG

IGRRVCMGEQLAKMELFLMFVNLLQSFSFSLADDTFKPSLEGRFGLTLAPYPFDIKITKR

*

 

>CYP2AT1 NM_001005711.1 45% to 2C8

49% to CYP2C84 finch

MEPLTIFLCLFIFLLLLFTWKTHKRRVQLPPGPYPLPLLGNVLQ

GITVLYDSYRKLSEQYGPVFTVWLGSTPMVVLCGYEVLKDALINHSQEFGARGAFPVP

ERLTDGYGVISTNGTRWQQLRRFSVTVLRNFGMGKRSMEERIHEETQHLIQAVQHTGG

EAFDPLYLLGRAVNNIINLIVFGRRWDYKDKMMIKLFNIINSILLFLRSPLGVIYSAL

YQIMQHLPGPHQKIFHDSETVKSFIREQINSHKETLDSDSPRDYIDCFLIKANQEKDH

HSSEFSQENLVNTVFDFFVAGTETATNTIQFSLLVIITYPHIQAQVQKEIDKVVGPDR

LPGIADRAQMPYTNAVIHEIHRFLDLVPLSLPHMATQDTVCRGFRIPKGTTVIPLIGS

ALCDPAHWETPEEFNPEHFLNQNGEFYIPPAFMPFSAGKRVCLGEGLARMEIFLFFTA

LLQKFTIRVANQTDTFNLRTLRRAFRKKGLFYQLRAMPRTCTVEK

 

>CYP2AC43 to CYP2AC1_Phalacrocorax, 56% to CYP2AC1 chicken ENSGALP00000026886

65% to CYP2AC1 X. laevis

same as 49364_prot

MDPVSVLLSVVVCIFLFKVFYDGEKESQNFPPGPKPLPLIGNLHIINMEKPYLTFME

LAEKYGSVFSFHLGTEKVVVLCGTDAVRDALINHAEEFSGRPKVAIFDQIFKGH

GIIFADGENWKVMRRFSLSTLRDFGMGKKTIEEKISEESDCL

VETFKSHGGKPFDNTMIMNAAVANIIVALLLSQRFDYQDPTLLKLVKSINKIVRITGSSMVMLYNTF

PSIMQWIPGSHQNVVKNAEKIYTFLIETFTKHRHQLDVNDQRDLIDTFLIKQQEEKSSST

KFFHDENLKVLLLNLFGAGMETTSTTLRWGILLMMKYPEVQKKVQDEIDRVIGSAEPRLE

HQKQMPYTDAVIHEIQRFADLVPNNVPHATTKDVTFRGYFIPK

GTHVIPLLTSVLKDKDYFKKPNEFYPEHFLDSEGHFVKNEAFLPFSA

GRRICAGETLAKMELFLFFTNLLQNFTFQPPPGVEVQLTRGVAITSIPTEHKICALPRS*

 

>CYP2AM1 B1WAQ9 scaffold_481:286338-294191 (-) strand

MAMDSAGTILLSVCVIILLYLVKWRGKSKSKNLPPGPTAYPLLGNFPQIGLREIPSSFV

QLSKTYGPVYTLYLGGHRLIVLIGHDAVKEALIDQSDVFSDRGRLGISQVLFDEHGVIM

SNGERWKTMRRFTLTTLRNFGMGKRSVEERIQEEARSLEEAFRKKKDEPFDPVNLLGPA

VSNIICSIIFGDRFDYEDEKFTTLLKCMRELINLLNSLFGQLVNVFPNLSQHIPGPHQN

IFTYFNKIKQFVKDEAKSHKDTLDANCPRDFIDCFLIRMEEEKMNPNTEFHNDNLFAVI

FDLFFAGTETSSLTLRYAFLIFLKYPEVQEKVYKEIDQVIGQNRYPSFEDKIKMPYTEA

VIHEVQRFADIVPTGLEHKTSKDTTFRGYDIPKGTSVFPVLTSVLKDPKYFKNPDQFDP

GHFLDENGCFKKNDAFMPFSAGKRMCAGEGLARMELFIFLTSILQKFTLKPTVPAETIK

ITPQPKTNASQPWPYKMYAVPRC

 

>CYP2AM1 B4F6Z6 1 aa diff to B1WAQ9

MAMDSAGTILLSVCVIILLYLVKWRGKSESKNLPPGPTAYPLLGNFPQIGLREIPSSFV

QLSKTYGPVYTLYLGGHRLIVLIGHDAVKEALIDQSDVFSDRGRLGISQVLFDEHGVIM

SNGERWKTMRRFTLTTLRNFGMGKRSVEERIQEEARSLEEAFRKKKDEPFDPVNLLGPA

VSNIICSIIFGDRFDYEDEKFTTLLKCMRELINLLNSLFGQLVNVFPNLSQHIPGPHQN

IFTYFNKIKQFVKDEAKSHKDTLDANCPRDFIDCFLIRMEEEKMNPNTEFHNDNLFAVI

FDLFFAGTETSSLTLRYAFLIFLKYPEVQEKVYKEIDQVIGQNRYPSFEDKIKMPYTEA

VIHEVQRFADIVPTGLEHKTSKDTTFRGYDIPKGTSVFPVLTSVLKDPKYFKNPDQFDP

GHFLDENGCFKKNDAFMPFSAGKRMCAGEGLARMELFIFLTSILQKFTLKPTVPAETIK

ITPQPKTNASQPWPYKMYAVPRC

 

>CYP2AM2 14945_prot 55% to DN017333.1, 52% to 2C8

scaffold_1232:575-12890 (+) exon 3 partial

53% to CYP2C103 anole_ENSACAP00000010270, 54% to CYP2C44/CYP2H finch

57% to 52542_prot

scaffold_481:264840-277155 (-) strand

  575 MAMDSAGTVLLAACVIVLFYLVKWRGNNKRKNLPPGPTAFPLLGNFLQVSTTEIPSSCVE 754

 1024 LSKTYGPVFTLYLGGHRSIILIGYDAVKEALIDNSDVFSDRGEGGVSEMIFKNY 1185

 3914 GVILSNGERWKTMRRFTLTTLRNFGMGKRSVEERIQEEARSLEEAFRKKK 4063

 5417 DEPFDPIYLLGLAVSNIICSIIFGERFDYEDEKFMTLLMYIREFVKLLNSFFGM 5578

 5936 LFNFFPNLFCYIPGPHQNIFTYFNKLKQFVKDEAKSHKDTLDANCPRDFIDCFLIRME 6109

 8038 QEKNNPNSEFHYENLFGTILDLFLAGTETTSSTLRYAFLILLKYPEIQ 8181

 9338 ENVYKEIVQVIGQHRYPSVEDRSKMPYTEAVIHEVQRIGDILPLGLEHAASKDTTFRGYDIPK 9526

11964 GTLIFPLLTSVLKDPKYFKNPDQFDPEHFLDENGCFKKNDAFMPFST 12104

12708 GKRVCAGEGLARMELFIFLTTILQKFILKSTVATEEIKITPEPNTNGSRPWPYKMFVVPRC 12890

 

>CYP2AM4 14947_prot scaffold_1232:47102-62978 (+)

55% to 52542_prot

scaffold_481:214755-230628 (-) strand

MAVLGIETLFLVCSFTFLVFLFSRRQRHARLPPGPTPLPLLGNVLQLDFSKQVKEFVKLGSQY

GPVSMVYLGPYPVLVLNGYDVVKEAFVDNGEVFSNRGKNAFIEMIFKGR

GVAFSNGERWRQMRRFSLSTLRDFGMGKRRVEERVQEE

ACALVEEFKKTKGTPFNSTYLMTLAVSNVICSVVFGERFDYQNETFLSVL

ALLKDTFKIITSPWTQLFSFAPGLLKHLPGPHKKAAENLDRLKTFVTEFV

ASHEETLEENFPRDYIDCFLIKMRQEKDNVNTEFDYENLFVTLMNLFFAG

TETTSITLQYGMLILLKYPDIQKKIHEEIDSVIGFNRCPSMEDRPKMPYT

DATIHEIQRFADIVPMGVPRSTNKDTTLRGYDIPKGTTVFPMLTCILKDP

RYFKDPESFNPCHFLDEKGCLKKTDAFIPFSIGKRVCLGEGLARMEIFLF

LTSILQRFELKCHMDPKDIDISPVPSKSAYMPRPYELYITPR

 

>CYP2AN3 CYP2AN.1 A9JTU3 EL664046.1

81% to CYP2AN2

mESLSILTLFFIFLLTLLFLSSLWRQQKRSHVLPPGPTPVPLLGTPNYLYRDGILRYYPE

FHKKYGAMFTLWQMTDPVVVLCGYETVKDALINHTEQFSDRPLYPALDSYTKGFS

FLSSNNHWRLFRRFILMTLRNVGLGKRSLEEKSLKEAELLVEAVSEMGG

KSFNPTQLLSSAVTNAIGTILFG

QRLDYKDQKLLDLISHIRKHSDNIFSAKQQICNMFPVLLKLPYLGQIIMKNSLCLVAYVR

EQLDFHKETLDLFAPPRDFIDHFLLKIKEEKGNKDSKFCDTSLIMFISSILAAGSDSTTA

TLKYCLAIIARFPHIQAKVQREIDDVTGSQRPPGMSDRARMPYTNAVIHELQRHLDLAPA

GFYRSLTQDIAFRGYTLPKGTRILPYLSSVLFDPSQWETPDEFNPGHFLDEKGQFRAKPA

FMVFSAGKRECLGVSLARMEIFLFFSALLQKFSLCPTTGAQMDMKSLRFNKRTIIQSWEI

CAIPRSSHTD*

 

>CYP2AN2 CYP2AN.2 81% TO CYP2AN A9JTU3

scaffold_1382: 09429-15041 (-) strand exons 3-9

MEILSILTLFFIFLLTLLFLSSLWRQQKRSHVLPPGPTPVPLLGTPNYLTRDGIVRYYP

EFHKKYGKMFTVWQMADPVVVLCGYETVKDALINHAEQFSDRPEYPVIDSYTKGFT

15041 FVSANDHWPQFRRYILTTLRNIGVGKQTLEEKSQKEAEQLVQAMSEMGGKPFNPSHLLGCAV

SNIIGAVLFGQQLDYRDKKLLDLITNIRKHVSNVLSMKHQICNMFPFLLKLPYLGQIIM

KNSLYLVDYVREQLDFHKETLDIAAPPRDFIDHFLLKIKEESRKEGTKFHELSLTMYSS

GLLIAGVDTTTSTLKFCVTVIAHLPHIQAKVQREIDDVTGSQRPPGMSDRAQMPYTNAV

IHELQRHLDLAPAALFHALREDTEFHGYTFPKGTRILPYLSSVLFDPSQWETPDEFNPG

HFLDEKGQFRAKPAFMVFSAGKRECLGVSLARMEIFLFFSALLQKFSLCPTTGAQMDMK

SLRFNKDEIIKSWEIRAIPRSSHAA 09429

 

>CYP2AN1  CYP2AN.3 Q5FVW7 56% TO CYP2AN.2

scaffold_1382:36106-47407 (-) strand

MGVVTILSLALSFILTLLFLVSYWRQQKKSITLPPGPAPLPLLG

NLRYTLHKSHYKFFPELSKRYGPVFTIWQMTDPVVVLCGYEMVRDALMNHAEQFSGRPF

SPVIDLYSKGYSFPSLQGERWRQLRRFTLSSLRNFGMGKKSMEELVLEEAQHLNAAVSE

TGGKPFNPVHLTGCAVANITSRALLGEQFQYQDQKLRDLLLTTRRFISNTHSFLHQLSN

MFPVLLYVPAFRQKIFRESSELLAFVTEYIEQHKQTLDPNSPRDFIDYFLLKIREEKMA

AQSNFCETSLLMTIIALLAAGTETTSSTLAFCLAFISNYPDAQAKIQREMDEVVGPQRP

PETGDRARLPYTNAVIHEMQRLLDLAPIAHFHAVTEDTEFQGFTIPKGTTVIPFISSVL

FDPTQWETPEEFNPGHFLDGDGKFRARPAFMAFSAGKRVCAGESLARMELFLLFCSLLQ

KFTFRRAPGSEPRDCTYLRKNKVQTIMSSIVCAVPRSTM

 

>CYP2AP1 B1H330

MISLILIGVLSALLLIVYSTWRRDSRLPPGPTPWPVIGNIHQIDKLAPYETLMQFGEKY

GPVYTIYFGWNPVVVLYGYDALKEALIGQAEDFSGRAIVPVFERVANRKGLVFSNGAHW

QQQRRFSLATLRSFGMGKRSIEERVREESTNLLEFFQEKKGNPFNPGPHITAAVSNVIC

SIVFGDRFDTEDGTFQTLLRMVNENITFLGKRGFQMYNTFPGILKHLPGEHNKIFQNVS

KLKTFLRGLIDNHTLSRDPNCPRDFVDSFLNKMDEEAGNPDSHFTMESLTYTTFNLFIA

GTETTSSTIRWALRFMLAYPHIQKRVQDEIDSVLGPDKCPSLEDRVNLPYTDAVIHEVL

RYSSVVPNGLPHEALYDIKFKGYTIPKGTQIITFLFSALNDKGYWDDPEQFNPEHFLDE

EGKFVKNEAHLPFGAGKRACIGEALARTEIFIFFVNILQKFSLKSPPGEGGPIELAGGG

TRAPRPFNVCAEWRL

 

>CYP2Q2 4372_prot scaffold_1232:202751-216554 (+) = CYP2Q2

scaffold_481:62341-74973 (-) strand

MDTSWLWTLLLCLLISAMLIYSTWNKMYRKRNLPPGPTPIPLFGNVMQ

IKRGEMVKSLIELGKKYGDIYTLYFGPSPVVILCSYRAIKEALIDQAEEF

SGRGAIPSFDQYFQGYGVVFTNGEEWKNLRRFSLSTLRNFGMGKRGIEER

IKEEAQFLVAEIKSYKEKPFDPTNILVQCVSNVICSVVFGNRFEYANKDF

QNLLSLFQSVFQETSSSWGQLLNMLPAVMNHVPGPHKNIIRDMNKLEDFV

LQRVKENEKTVDPNSPRDLIDSFLIKMQQENKNPTSPFHMKNLIATILSI

FFAGTETVSTTLRHGFLILLIHPEIEAKLQEEIDRVVGQNRSPTIEDRNK

MPYTDAVIHEIQRLSDVIPMNVPHLVTKDTKFRGYTIPKGTNIYPLLCAV

LRDPEQFDTPSKFNPNHFLDDKGCFKSNDGFMPFSTGKRICLGEGLARME

LFLFLTNILQNFKLHSESGLTEDNIAPKMKGFANYPTSYQLSFIPR

 

>CYP2Q3 4371_prot scaffold_1232:170631-190051 (+) = CYP2Q3

scaffold_481:88528-107073 (-) strand

MDTTWLWSLQLFLLIATMLIYSTWNKMYRKRNLPPGPTPIPLFGNVLQIKRGEMVKSLLE

LGKKYGPVYTLYFGPSPVIILCDYQSIKEALNDQAEEFSGRGKIPSWDQFFQGY

GESFSNGDEWKQLRRFSLTTLRNFGMGKRGIEERIQEEAQFLVAEIKSYK

GKPFDPTKILVQCVSNVICSVVFGQRYEYSNKDFHKLLYMFQAVFEDTSSTLGQ

LMTLLPNIMNHIPGPHKTVVNKLNKVNDFILQRVKENEKTLDPNSPRHFIDSFLIQMQK

EKDNPVTKFHWKNLLCTIMNLFFAGTETVSTTLRHGFLMLLIHPEIE

EKLHEEIDRVVGQDRSPTIEDRSKMPYTDAVIHEIQRFSDVLPMSLPHLVMKDTQFRGYTIPK

GTDVYPLICAALRDPKQFATPNKFNPQHFLDDNGLFKSSNAFLPFST

GKRICLGEGLARMELFLFLTNILQNFKLHSENQFAEDDIAPKMNGFANYPLSYEFSLIPRVQSLLVL*

 

>CYP2Q4 52548_prot scaffold_1232:145476-158239 (+) 67% to 2Q2

scaffold_481:119494-132254 (-) strand

MDITGLGTLVLILLISCIVIYSTWNSMYRKRNLPPGPTPLPLIGNLLQIKRGEMVKSLTE

FGKQYGPVYTLYLGPRPVIVLNGYQAVKEALIDQGEEFSGRGKLVVADLIFGGF

GVVFSNGDRWKQLRRFSLMTLRDFGMGKRSIEERIKEEAQCLQVELHKYK (1)

QTPTDPQNILVQAVSNVICSVVFGNRFEYENSEFLKLLRLFNETFQMMSSTWGQ

LQQIIPFIMNYIPGPHQKIDKVVARQLEFVSERVKKNQETIDFNSPRDFIDCFLIKMQQ

ETQNPTSEFNLKNLLMTVLNLFVAGTETVSSTLRNGILLLLKYPHIQ

EKLHKEIDVVIGQNRSPNIDDRSKMPYMDAVIHEIQRFTDILPMNLPHSVIKDTAFQGYTIPK

DTDVYPMLCSVLRDPTQFTTPENFNPEHFLDDSGCFKKSDAFMPFST

GKRICLGEGLARMELFLFLTTILQNFTLTSETQITESDITPRMAGFANVPISYKVSFVPR

 

>CYP2Q5 52547_prot scaffold_1232:122253-139910 (+) poor model revised

missing exons 2,3 found on DT436730.1

58% to 52548_prot scaffold_1232:145476-158239, 55% to 2Q2

scaffold_481:137823-144199 (-) strand last 6 exons

MYVAGLGTILLVLISCVLIFSSWKTLYQKHNLPPGPTPLPLIGNLMNIKRGKLVSSLMK (0)

LWEQYGAVYTLYFGIQPVIVLCGYDAVKEALVDQAEDFGARGKISSLDPVTQGY

GLSFSNGERWRQLRHFTLKALRDFGMGKKSIEEKIQEEALCLVEEFRKSG

EMPTDPEKPIMKAVSNIFFTIVLGNRFEYNDETFSALLAKVEEMFRLMSNTWSQ (0)

IENVLPKLMAYIPGPHKKRDALGKQLILFLHERIKANQETFDPSAPRDFIDEFLIKMEQ (0)

EKKNPNSEFTMKNTLLTFYSIFLGGTETSTTTLKHGLLLLIKYPEIQ

AKLHMEIDNVIGRNRTANMIDRNSMPYMEAVINEIQRFSDIIPLNVPRKVTKDVQFRGYCIPK

DTEIYPLLCTVHHDAKYFSSPYEFNPSHFLDEQGKFKKNNAMMAFSA

GKRICPGESLTRMELFLFFTTILQNFTLTSPTHFTDNDVAPKMTGFINHPIQYKASFISR

 

>CYP2Q6-de1b scaffold_1232:89713-89889 extra exon 1

MDVTGLGTILLVLISCVLIFSSWKTFYQKHNLPPGPTPLPLMGNLMNIKKGKLVSSLMK

 

>CYP2Q6 scaffold_1232

90% to 52547_prot   scaffold_1232:122253-139910, 54% to 2Q2

scaffold_481:157621-183847 (-) strand

 93883 MDVTGLGTILLVLISCVLIFSSWKTFYQKHNLPPGPTPLPLMGNLMNIKKGKLVSSLMK 94059

 96262 LWEQYGAVYTLYFGTQPVIVLCGYDAVKEALVDQAEAFGARGKISSLDPVTQGY 96423

 96988 GIGFSNGERWRQMRHFTLKALRDYGMGKKSIEEKIQEEALCLVEEFRKSG 97137

 98027 EMPINPSTHIMKAVANIFFSIMLGNRFEYNNETFSALLATLEEMYTLMNNTWSQ 98194

 99835 IENVLPKLMAYIPGPHKKRDALAKELILFFHERVKANQETFDPSAPRDFIDEFLIKMEQ 100014

101345 EKKNPNSEFTMRNILMTFFSIFIGGTETSTTTLKHGLLLLIKYPEIQ 101485

116449 AKLHMEIDNVIGRNRTVNLNDRNSMPYMEAVINEIQRFSDIAPLNLPRKVTKDVQFRGYCIPK 116637

119036 DTEIYPLLCTVHRDAKYFSSPYEFNPSHFLDEQGRFKKNDALMAFSA 119176

119933 GKRMCPGESLARMELFLFFTTILQNFTLTSPTHFTEDDVAPKMTGIINHPIQYKASFIA 120109

extra exons 7,8,8

113766 AKLHMEIDNVIGRNRTVNLNDRKFMPYMEAVIN 113864

115357 DTEIYPLLCTVHRDAKYFSSPYEFNPSHFLDEQGRFKKNDALMAFSA 115479

115792 DTEIYPLLCTVHRDAKYFSSPYEFNPSHFLDEQGRFKKNDALMAFSA 115932

 

>CYP2Q7 52545_prot scaffold_1232:71267-83903 (+) short seq

exon 7 gap filled in by DT419848.1, missing exon 2

82% to 52547_prot scaffold_1232:122253-139910

56% to CYP2Q1

scaffold_481:199920-206463 (-) strand first 6 exons

part of exon 2 in a seq gap

scaffold_481:193830-198305 (-) strand  exons 7 (partial) 8 and 9

71267 MDVAGLGTFLLVLITFILTLSSWNTMYKKVNLPPGPTPLPLIGNLMNIKKGKMVNSLMK (0)

LWEQYGAVYTLY

GLSFSNGERWRQMRHFTLKTLKNFGMGKKSIEEKIQEEALCLVEEIRKSG (1)

ETPVDPSKLIMDAVSNVFCSIMFGRRFEYNEEKFANLLTNVNEIFRLMSNTWGQ (0)

LESIFPSVMAYIPGPHKKKNTLSEELISFLHERVKSNQETFDPSAPRDFIDEYLMKIEQ (0)

EKKNPNSEFTMRNTLLTFFSIFLGGTETSTTTIKHGLLLLIKYPEIQ (1)

79425 AKLHMEIDHVIGRNRIVNINDRNAMPYMEAVINEIQRFSDIAPLNAPRKVTKDVQFRGYSIPK (0) 79511

DTEIYPLLCTVHRDPKYFSSPYEFNPSHFLDEQGRFRKSEAMMAFSA (1)

GKRICPGESLARMELFLFFTTILQNFTLTSPTHFTEDDVAPKMAGFMNHPIQYKASFISR* 83903

 

>CYP2AQ1 21828_prot two genes fused scaffold_55:606485-680452

second part has some P450 exons poor model (revised)

upper part is rhesus blood group glycoprotein rhag (next to CYP2AC1P in humans)

DT438894.1 52% to CYP2AC1_Phalacrocorax

scaffold_63: 1032286-1054666 (-) strand without the last exon probably in a seq gap

603844 MDLVYSPSVCLLLATAVFIILYTLIDWARSSARNFPSGPLALPLIGHLHIINLKRPSEALNK 603659

602714 ISKTHGNIFRIQMGTVEMVVLAGYEAVKEALIDNAEAFAGRPFVPILDDIFHGY 602553

593338 GIPFSHGDNWKEMRRFTLSTFRDFGMGKRTIEDKIIEECGFLIKEIEVYK (1) 593189

590829 DEPVELKEFISVAVGNIISSIVLGHRFDNYQHPTLLRVLELVHENFRLLGSPSVI (0) 590665

588598 LYNIFPIMRFFPGDHKKIMKNLEELHCFLRETFLKHLKVLERDDQRGYIDAYLVRQLE (0) 588425

586539 EKGNPKSYFHEQNLLSILATLFAAGTDTTIASIRWAISFMVKNPLIQ (1) 586399

584383 KRVHEEIDRVIGSSQPQFHHRKSMPYTNAVVHETQRVANVVPMNLPHATTRDINFRGYHLPK (0) 584198

581601 GTYIVPLLESVLFDKTQFERAEEFYPEHFLDSDGKFVMRPAFLPFST (1) 581464

       GKRICIGETLAKMELFIFFTSLMQKFSFHPPPGDPNFDVKPAIGLTSPPLPRKLCIVPRS

 

>CYP2AQ2 6348_prot scaffold_55:566754-603844 DT450622.1 83% to 21828_prot

51% to CYP2AC1_Phalacrocorax

scaffold_63: 1017579-1029291 (-) strand

578469 MDLVYSPSMCLLLAAVVFIILYTLIDWARSSARNFPSGPLALPLIGHLHIINLKRPSEALNK 578284

577359 ISKTHGNIFRIQMGTVEMVVLAGYETVKEALIDNAEAFAGRPFVPILDDIFHGY 577198

575649 GIPFSNGENWKEMRRFTISRFRDFGVGKRTMEDKITEESVCLIKEMEVLK 575500

575200 DEPVELTPYISVAVGNIIASIVLGHRFDDYKNPTLLRVLQLTSENLSYLGSPSVL 575036

574075 LYNVFPILRFFPGDRNKLLKNLKELHCFLRETFMKHLKVLERDDQRGYIDAFLVKQLE 573902

572545 EKENSNSYFHEKNLICILVSLFSAGTDTTIASIRWALTFMVKNPHIQ 572408

571008 QRVHEEIDRVIGSSQPQFHHRTSMPYTNAVVHETQRVANVVPMNLPHATTTDVNFRGYHLPK 570823

569487 GTYVVPLLESVLFDKTQFERAEEFYPEHFLDSDGKFVMRPAFLPFST 569347

566936 GKRICIGETLAKMEVFIFFTTLMQKFSFHAPPGEPDIEIKRGIGLTSPPLPQKLCIVRRS 566757

 

>CYP2AC8 NM_001015757.1 47% to 2K6 zebrafish

from refseq database

56% to CYP2AC1 X. laevis

scaffold_63:999631-1009522 (-) strand 2 aa diffs

MDFTFSLATYLVLVVTVLYILSNWKRKALNNFPPGPKGWPLVGNVFSIDLKKPQRTYIE

LSKKYGPVFSVQMGRKKMVILVGYETVKDALVTHAEEFGGRAYIPVTKDLEKGL

GMIFSNGENWKAMRRFTITTLKDFGMGKSTIEETIAHECSYLVQYFASFK

GKPFDNSTILITSVANIIVAILLGHRMEYEDPVFLRLVNLNSEYVKLLGSPMVT

IYNMFPALGFLPGCHKTVKKNLKELYAFLKRTFVEYQKNFDIHDQRSFIDVFLARQKEE

AKHPETYSYFHNENLVRLVRNLFSAGMETTSTALRWALLLMIKYPDIQ

EKVHDEIARVIGSAHPTYSHRTQMPFTNAVIHEMLRFADIVPLSVPHETTRDVHFKGYFIPK

GTYIIPLLTSVLKDKTQFDAPEQFNPNHFLDSEGNFLKKEAFMPFSA

GRRACPGEILARMELFIFFTSLLQKFSFRPPPGVTNINLSSDVGFTSVPLEGMICAIPRA

 

>scaffold_55 exon 7, same as NM_001015757.1

558700 MDFTFSLATYLVLVVTVLYILSNWKRKALNNFPPGPKGWPLVGNVFSIDLKKPQRTYIE 558524

550333 EKVHDEIARVIGSAHPTYSHRTQMPFTNAVIHEMLRFADIVPLSVPHETTRDVHFKGYFIPK 550148

 

>scaffold_2615 : 2-55 (+) exon 9 same as CYP2AC8,9,10,11,12

2 VGFTSVPLEGMICAIPRA 55

 

>21822_prot 2 P450s fused scaffold_55:465695-533227 (-)

99% to DT436641.1

549227 GTYIIPLLTSVLKDKTQFDAPEEFNPNHFLDSEGNFLKKEAFMPFSA 549087

548988 GRRACPGEILARMELFIFFTSLLQKFSFHPPPGVTNINLSSDVGFTSVPLEGMICAIPRA 548809

 

>scaffold 55 partial seq 100% to DT436641.1

scaffold_63:991332-994576 (-) strand part of CYP2AC9

543754 LSKKYGPVFSVQMGRKKMVILVGYETVKDALVTHAEEFGGRASIPVNKNLEK 543599

542568 GMIFSNGENWKAMRRFTITTLKDFGMGKSTIEETIAHECSYLVQYFASFK 542419

542089 GKPFDDSTILITSVANIIVAILLGHRMEYEDPVFLRLVNLNSEYVKLLGSPMVT 541928

541086 IYNMFPALGFLPGCHKTIEKNIKELYAFVRRTFVEHQKHLDIHDQRSFIDAFLARQKEE 540910

540653 AKHPETYSYFHNENLVRLVRNLFSAGMETTSTALRWALLLMIKYPDIQ 540510

 

>scaffold_3433:23829-23954 (+) exon 4

100% to Green = DT436641.1 75% to 21819_prot

23829 FVFSLGKPFDNTMIMNAAVANIIVSIVLGHRFDYQDPKFLRL 23954

 

>CYP2AC9 DT436641.1 DT433530.1 DT443285.1 DN045517.1 S.Sarva 95% to NM_001015757

56% to CYP2AC1 X. laevis built from ESTs DNA not complete

MDFTFSLATYLVLVVTVLYILSNWKRKALNNFPPGPKGWPLVGNVFSIDLKKPQRTYIE

LSKKYGPVFSVQMGRKKMVILVGYETVKDALVTHAEEFGGRASIPVNKNLEKGL

GMIFSNGENWKAMRRFTITTLKDFGMGKSTIEETIAHECSYLVQYFASFK

GKPFDDSTILITSVANIIVAILLGHRMEYEDPVFLRLVNLNSEYVKLLGSPMVT

IYNMFPALGFLPGCHKTIEKNIKELYAFVRRTFVEHQKHLDIHDQRSFIDAFLARQKEE
AKHPETYSYFHNENLVRLVRNLFSAGMETTSTALRWALLLMIKYPDIQ
EKVHDEISRVIGSAHPTYSHRTQMPFTNAVIHEILRFSDILPLGVPHETTRDVHFKGYFIPK
GTYIIPLLSSVLKDKTQFDAPEEFNPNHFLDSEGNFLKKEAFMPFSA
GRRACPGEILARMELFIFFTSLLQKFSFHPPPGVTNINLSSDVGFTSVPLEGMICAIPRA*

 

>scaffold 55 (-) 100% to DT436641.1

539574 GMIFSNGENWKAMRRFTITTLKDFGMGKSTIEETIAHECSYLVQYFASFK 539425

539096 GKPFDDSTILITSVANIIVAILLGHRMEYEDPVFLRLVNLNSEYVKLLGSPMVT 538935

538098 IYNMFPALGFLPGCHKTIE 538042

 

>CYP2AC10 scaffold 55 (-) 96% to DT436641.1

54% to CYP2AC1_Phalacrocorax

scaffold_63:969644-983460 (-) strand

532638 MDFTFSLATYLVLVVTVLYILSNWKRKALNNFPPGPKGWPLVGNVFSIDLKKPQRTYIE 532462

530541 LSKKYGPVFSVQMGRKKMVILVGYETVKDALVTHAEEFGGRASIPVNKNLEKGL 530383

527019 GITFSNGENWKAMRRFTITTLKDFGMGKSTIEETIAHECSYLVQYFASFK 526870

525259 GKPFDNSTILSTSVANIIAPILFGHRMEYEDPVFLRLVNLNSEYVKLLGSPMVT 525098

524043 IYNMFPALGFLPGCHKTIEKNLKELYAFVRRTFVEHQKHLDIHDQRSFIDVFLARQKE 523870

521860 EAKHPETNSYFHNENLVRLVRNVFSAGMETTSTALRWALLLMIKYPDIQ 521714

521136 EKVHDEISRVIGSAHPTYSHRTQMPFTNAVIHEILRFADIVPLSVPHETTRDVHFKGYFIPK 520951

519207 XXXXXXXXXXXLKDKTQFDAPEEFNPNHVLDSEGNFLKKEAFMPFSA 519100

519001 GRRACPGEILARMELFIFFTSLLQKFSFHSPPGVTNINLSSDVGFTSVPLEGMICAIPRA 518822

 

>CYP2AC11 scaffold 55 (-) 94% to NM_001015757.1 95% to DT436641.1

56% to CYP2AC1 X. laevis

scaffold_63:946663-957220 (-) strand

506398 MDFTFSLATYLVLVVTVFYILSNWKRKALNNFPPGPKGWPLVGNVFSIDLKKPQRTYIE 506222

504460 LSKKYGPVFSVQMGRKKMVILVGYETVKDALVTHAEEFGGRAYIPVNKDLEKGL 504299

500885 GITFSNGENWKAMRRFTITTLKDFGMGKSTIEEKITHECSYLVQYFAFSK 500736

500410 GKPFDNSTILITSVANIIVAILLGHRMEYEDPVFLRLLNLNSEYVKLLGSPMVT 500252

499245 IYNMFPALGFLPGCHKTIERNMKELYAFVRRTFVEHQKNLDIHDQRSFIDAFLARQKEE 499069

497715 AKHPETKSYFHNENLVRLVRNVFSAGVETTSTALRWALLLMIKYPDIQ 497572

497006 EKVHDEISRVIGSAHPTYSHRTQMPFTNAVIHEILRFADIVPLNVPHETTRDVHFKGYFIPK 496821

496260 GTYIIPLLSSVLKDKTQFDAPEEFNPNHFLDSEGNFLKKEAFMPFSA 496120

496020 GRRACPGEILARMELFIFFTSLLQKFSFRPPPGVTNINLSSDVGFTSVPLEGMICAIPRA 495841

 

>scaffold_21945:198-3026 1 aa diff to CYP2AC11 scaffold 55 (-) 506398-495841

 198 EKVHDEISRVIGSAHPTYSHRTQMPFTNAVIHEILRFADIVPLSVPHETTRDVHFKGYFIPK (0) 1158

2607 GTYIIPLLSSVLKDKTQFDAPEEFNPNHFLDSEGNFLKKEAFMPFSA (1) 2747

2847 GRRACPGEILARMELFIFFTSLLQKFSFRPPPGVTNINLSSDVGFTSVPLEGMICAIPRA 3026

 

>scaffold_3433:6638-6781 (+) exon 6, 95% to DT436641.1

1 aa diff to CYP2AC11

6638 AKHPETYSYFHNENLVRLVRNVFSAGVETTSTALRWALLLMIKYPDIQ 6781

 

>CYP2AC12 Green = DT436641.1 75% to 21819_prot

trace archive for gap

243598069 431692585 (both run into gap)

82% to CYP2AC1 X. laevis

scaffold_63:916520-935762 (-) strand

484940 MFLGDPVTVLLAVALCLIVAITLYRQKRDSSKNFPPGPKPLPIIGNIHNINLKRPYLTYL E 484758

481692 LWKKYGPIFRVQIGSQKMVVLCGYETVKDALVNYAEEFSERPVVPIFLDVVKEY 481531

       seq gap

479226 GKPFDNTMIMNAAVANIIVSIVLGHRFDYQDPKFLRLMSLINENLRLTGSPTVM 479065

477865 LYNVFPSVMRWLPGNHQTVGKNAAENQRFIRETFIKHKEKLDVNDQRNLVDAFLVKQQE 477689

474586 KNGNAVYFHDDNLTMLVSNLFAAGMETTSTSVRWGLLLMMKYPEIQ 474449

470107 KNVQNEIEKVIGQSRPQTEHRKSMPYTDAVIHEIQRFGNIIPMNLPHATAQDVTFRGYFLPK 469922

466117 GTYIIPLLSSVLKDKTQFDAPEEFNPNHFLDSEGNFLKKEAFMPFSA 465977

465877 GRRACPGEILARMELFIFFTSLLQKFSFHPPPGVTNINLSSDVGFTSVPLEGMICAIPRA 465698

 

>CYP2AC13P $$$$2 100% to $$$$3 and 21819_prot

scaffold_63:905210-905392 (-) strand

454570 MFLGDPVTVLLAVALCLIVANTLYRQKRDSYKNFPPGPKPLPIIGNIHNINLKRPYLTYLE 454388

 

>CYP2AC14P $$$$3 100% to $$$$2 and 21819_prot

scaffold_63:900097-900279 (-) strand

449457 MFLGDPVTVLLAVALCLIVANTLYRQKRDSYKNFPPGPKPLPIIGNIHNINLKRPYLTYLE 449275

 

>CYP2AC15 6347_prot scaffold_55:435508-454570 (-)  = first exon of seq below

join with scaffold_55:422403-435585  (-) between 6347 and 21819

84% to 21819_prot

duplicated exons 5 and 6

89% to CYP2AC1 X laevis

scaffold_63:876965-887293 (-) strand missing exon 1

436471 LWKKYGPIFSVQIGSQKMVVLCGYETVKDALVNYAEEFSERPVVPIFLDAVKEY 436310

435614 GIIFSHGENWKVMRRFTLSTLRDFGMGRRTIEDRINEECDFLVEQFKSFK 435465

434353 GEPFENTMIMNAAVANIIVSIVLGHRFDYQDPIFLRLMSLINENIRLMGSPTVM 434192

432802 LYNVFPSVMRWLPGNHQTVGKNAAENRRFLRETFTKHRDKLDINDQRNLVDAFLVKQ Q 432629

432003 EKNGNAVYFHDENLTMLVSNLFAAGMETTSTSVRWGLLLMMKYPEIQ 431863

430611 LYNVFPSVMRWLPGNHQTVGKNAAENRRFIRETFTKHRDKLDVNDQRNLIDAYLVRQQ 430438

429812 EKNGNAVYFHDDNLTVLVSNLFAAGMETTSTSVRWGLLLMMKYPEIQ 429672

428838 ENVQNEIEKVIGQSRPQTEHRKSMPYTDAVIHEIQRFGNIIPMNLPHATAQDVTFRGYFLPK 428653

427205 GTYVIPLLTSVLYDQTRFEKPKEFYPQHFLDSEGNFVKNEAFLPFSA 427065

426319 GKRSCAGENLAKMELFLFFTSLLQNFTFQAPPGEELDLTPAIGITTPPLPHNICALPRT 426143

 

>CYP2AC16 21819_prot parts of two genes long last intron has more exons

scaffold_55:413156-422625 (-) corrected  gene model

81% to scaffold_55:314488-344970

82% to CYP2AC1 X. laevis

scaffold_63:863978-872732 (-) strand exons 2-9 only

422625 MFLGDPVTVLLAVALCLIVANTLYRQKRDSYKNFPPGPKPLPIIGNIHNINLKRPYLTYLE (0)  422443

421910 LWKKYGSIFSVQIGSQKMVVLCGYETVKDALVNHGEEFSERPEIPIFHVIAKGY (1) 421749

420605 GVIFSHGENWKVMRRFTLSTLRDFGMGKKSIEDKINEECDSLVEKLRSY (1) 420456

419591 GKAFENSVTINAAVANIIVSLLLGRRFDYEDPTFLRLMSLMNANFRLMGSPMVM 419430

417270 LYNLYPSIIRWLPGSHKTVGKNAAETQRFIRETFTKRREKLDVNDQRNLIDAFLVRQQ 417097

416953 ETKEDGCSFHDDNLTVLVSNLFAAGMETTSSTLRWGLLLMMKYPEIQ  (1) 416813

415727 KNVQNEIEKVIGQSRPQTEHRKSMPYTDAVIHEIQRFGNIIPMNLPHATAQDVTFRGYFLPK (0) 415542

414638 GTYVIPLLTSVLYDKDHFEKPNEFYPQHFLDSEGNFVRNEAFLPFSA (1) 414498

413332 GKRSCAGENLAKMQLFLFFTSLLQNFTFQAPPGEELDLTPTTGFTTPPLLHNICALPRT  413156

>CYP2AC16-de9d scaffold_63:863654-863758 (-) strand

394115 NFSFQAPPGEELDLTPTTGFTTPSLLHNICALPHT* 394233

>CYP2AC16-de9c scaffold_63:863762-863866 (-) strand

394006 NFTFQAPPGEELDLTSTTGFTTPPLPHNICALPRT* 394114

>CYP2AC16-de9b scaffold_63:863870-863974 (-) strand

393899 NFTFQAPPGEELDLTPTTGFTTPPLPHNICALPRT* 394005

scaffold_63:863870-863974 (-) strand

393791 NFTFQAPPGEELDLTPTTGFTTPPLPHNICALPRT* 393898

 

>CYP2AC17 second exon 4-9 86% to 21818_prot CX463658.2 CR436794.1 CR426826.1

This gene assembled from ESTs, DNA is partial

84% to 21819_prot, N-term from ESTs, 86% to CYP2AC1 X. laevis

exons 1-2 scaffold_63:903874-905392 (-) strand

exons 4-6 scaffold_63:840769-844500

       MFLGDPVTVLLAVALCLIVANTLYRQKRDSYKNFPPGPKPLPIIGNIHNINLKRP

       YLTYLELWKKYGPIFSVQIGSQKMVVLCGYETVKDALVNYAEEFSERPVIPIFLDAVKEY

       GVIFSHGENWKVMRRFTLSTLRDFGMGR

scaffold_63:840769-845242 (-) strand

                                   RTIEDRINEECDFLVEQFKSFK

393678 GKPFDNTMIMNAAVANIIVSIVLGHRFDYQDPIFLRLMSLINENVRLTGSPKAM  393517

391361 LYNVFPSVMRWLPGNHQTVGKNAAEYHRFIRETFTKYRDKLDINDQRNLVDAFLVKQQ 391188

390087 EKNGNAVYFHDDNLTVLVSNLFVAGMETTSTSVRWGLLLMMKFPEIQ  389947

373288 KNVQNEIEKVIGQSRPQTEHRKSMPYTDAVIHEIQRFGNIIPMNLPHATAQDVTFRGYFLPK 373103

       GTFVIPLLTSVLYDQTRFEKPKEFYPQHFLDSEGNFVKNEAFLPFSA

369454 GKRSCAGENLARMELFLFFTSLLQNFTFQAPPGEELDLTPAIGITTPPLPHNICALPRT 369278

 

CR436794

MFLGDPVTVLLAVALCLIVANTLYRQKRDSYKNFPPGPKPLPIIGNIHNINLKRPYLTYLE

LWKKYGSIFSVQIGSQKMVVLCGYETVKDALVNYAEEFSERPVIPIFDAVKEY

GVIFSHGENWKVMRRFTLSTLRDFGMGRRTIEDRINEECDFLVEQFKSFK

GKPFDNTMRMNAAVANIIVSIVLGHRFDYQDPIFLRLMSLINENVRLTGSPKAM

LYNVFPSVMRWLPGXHQTVGKNAA

 

CX463658.2 exon 5 is missing from this EST

RTIEDRINEECDFLVEQFKSFK

GKPFDNTMRMNAAVANIIVSIVLGHRFDYQDPIFLRLMSLINENVRLTGSPKAM

 

EKNGNAVYFHDDNLTMLVSNLFVAGMETTSTSVRWGLLLMMKFPEIQ

KNVQNEIEKVIGQSRPQTEHRKSMPYTDAVIHEIQRFGNIIPMNLPHATAQDVTFRGYFLPK

GTFVIPLLTSVLYDQTRFEKPKEFYPQHFLDSEGNFVKNEAFLPFSA

GKRSCAGENLARMELFLFFTSLLQNFTFQAPPGEELDLTPAIGITTPPLP

 

CR426826

MFLGDPVTVLLAVALCLIVANTLYRQKRDSYKNFPPGPKPLPIIGNIHNI

NLKRPYLTYLELWKKYGPIFSVQIGSQKMVVLCGYETVKDALVNYAEEFSERPVIPIFLD

AVKEYGVIFSHGENWKVMRRFTLSTLRDFGMGRRTIEDRINEECDFLVEQFKSFKGKPFD

NTMIMNAAVANIIVSIVLGHRFDYQDPIFLRLMSLINENIRLMGSPTVMLYNVFPSVMRW

LPGNHQTVGKNAAENRXFIRETFTXHRDKLDVNDQRNLIDAYL

 

>scaffold_2219:41253-41363 (-) exon 2 partial, same as CYP2AC17

41363 LWKKYGSIFSVQIGSQKMVVLCGYETVKDALVNYAEE 41253

 

>scaffold_3861: 233-373 (+) exon 8, this scaffold has large gaps

100% to second exon 4-9 (CYP2AC17), 86% to 21818_prot

233 GTFVIPLLTSVLYDQTRFEKPKEFYPQHFLDSEGNFVKNEAFLPFSA 373

 

>CYP2AC18P scaffold_55 fragment of exon 5 same as 389947 exon 5

scaffold_63:819613-819672

TTSTSVRWGLLLMMKFPEIQ

scaffold_63:820100-824110 (-) strand

ENVQNEIEKVIGQSRPQTEHRKSMPYTDAVIHEIQRFGNIIPMNLPHATAQDVTFRGYFLPK

 

GKRSCAGENLARMELFLFFTSLLQNFTFQAPPGEELDLTPAIGITTPPLPHNICALPRT

 

>CYP2AC19 21818_prot 72% to NM_001004878.1 82% to 21819_prot

scaffold_55:344864-351768 (-) CF344279.1

83% to CYP2AC1 X. laevis

scaffold_63:795689-805747 (-) strand exons 1, 3-9 only

354925 MFLGDPVTILLAVVLCLIVANTLYRGKKDGVGNLLPGPKPLPIIGNIHILNLKKPYLTYLK (0) 354743

       LWKKYGSIFRVQIGSQKMVVLCGYETVKDALINHGEEFSERPRLPIFQVIANGY

351804 GVAFSHGENWKVMRRFTLTALRDFGMGRRTIEDRINEECDFLVEAFKSYK 351655

350789 GKPFENLMILNAAVANIIVSIVFGHRFDYQNPTFLRLMRLINENARLLGSPTAM 350628

348627 LYNVFPSVMRWLPGSHKTLRKNVDEIKIFIRETFTKQRDKLDVNDQRNLIDAFLVKQQ 348454

347806 EKNGNGPYFHDENLTTLVNNLFSAGMETTSSTLRWGLLLMMKYPEIQ 347666

347063 KNVQNEIEKVIGQSRPQIEHRKSMPYTDAVIHEIQRFGNIIPMNLPHATAQDVTFRGYFLPK 346956

346172 GTYVIPLLTSVLYDQSHFEKPNEFYPQHFLDSEGNFVKNEAFLPFSA 346032

345043 GKRSCAGENLANMELFLFFTSLLQNFTFQAPPGEELDLTPGTGLSAPPLPHNICALPRT 344867

 

>scaffold_3861:8120-8284 (+) exon 2 this scaffold has large gaps

100% to 21818_prot

8120 LWKKYGSIFRVQIGSQKMVVLCGYETVKDALINHGEEFSERPRLPIFQVIANGY 8284

 

>CYP2AC20 scaffold_55:314488-344970 81% to 21819_prot

81% to CYP2AC1 X. laevis

scaffold_63:772451-790524 (-) strand

339702 MFLGDPVTLLLAVVLSLIVANTLYRKERVNVQNFPPGPKPLPIIGNIHNINAKRPYLTYLE (0) 339520

337426 LWKKYGSVFSVQIGSQRMVLLCGYETVKDALVNHAEEFSDRPIIPLFHEITKGN 337265

333747 GVVFANGENWKVMRRFTILALRDFGMGRRTIEYRINEECDFLVEKIKSYRG 333595

333068 GEPFENTMIMNAAVANIIVSILLGHRFDYQDPTILRLLSLINQSVKITGSPMVM 332907

331666 LYNMFPSVMRWLPGSHKTLAINVAEIQSFIRETFTKYRDKLEINDQRNLIDAFLVKQQE 331490

330183 NKENGLYFHDDNLTMLVSNLFTAGMETTSSTLRWGLLLMMKYPEIQ 330046

328774 ENVQNEIEKVIGQSRPQTEHRKSMPYTDAVIHEIQRFGNIIPMNLPHATAQDVTFRGYFLPK 328589

327361 GTFVIPLLMSVLYDQSHFENPNEFYPQHFLDSEGNFVKNEAFLPFSA 327221

321805 GKRSCAGENLARMELFLFFTSLLQNFTFQAPPGEELDLTPGTGLSAPPSPYKICALPCS 321629

 

>CYP2AC21 21816_prot 77% to NM_001035117 correct seq 80% to 21810_prot

scaffold_55:303150-314597 (-)

71% to CYP2AC1 X. laevis

scaffold_63:753975-765419 (-) strand

314597 MDPISILLSIAVCVFLLNLFYGGKGDSKMFPPGPKPLPLIGNLLIMNMKKPHLTFME (0) 314427

314228 LAEKYGSVFSVQLGTEKVVVLCGTDAVKEALINHADEFSERPKIPIFEDVSKGY 314067

312244 GLIFSHGENWKVMRRFTLTTLRDFGMGKKTIEERICEESDCLVEAFKSYK 312095

310744 GKPFENTLIMNAAVANIIVSILLGHRFDYQDTALLKLIKIINENVRLMGSPMVM 310583

308441 LYNTYPSVMQWLPGKHKTVAENTLKLFKFLEETFTKHRDQLDVNDQRDLVDTFLVKQQE 308265

307774 EKPSSSKFFHDQNLTLLVSNLFGAGMETTSTTLRWGLLLMMKYPDIQ 307634

306167 KKVQDEIDKVIGSAEPQTEHRKLMPYTDAVIHEIQRFANIAPSNLPHATTTDVTFRGYFIPK 305985

304474 GTQVIPLLTSVLQDKNYFKKPEEFYPEHFLDSEGHFMKNEAFLPFSA 304334

303329 GRRSCAGETLAKMELFLFFTKLLQNFTFQPPPGVEVQLTSGEGFTSSPLQHNICALPRT 303153

 

>CYP2AC22 scaffold_55:287553-290430 exons 1-3 (+) 89% to 21811_prot

21815_prot exons 4-8 missing exon 9 scaffold_55:291301-297995 (+)

67% to CYP2AC1 X. laevis

scaffold_63:738383-748890 (+) strand

287561 MDPVSVLLSVVVCIFLYKVFYGGEKESQNFPPGPKPLPLIGNLHIMNMRKPHLTFME (0) 287731

289748 LAKTYGSVFSVQLGLRKTVVLCGADTVRDALINHAEEFSERARIPVFEDITKGHG 289912

290242 GIVFAHGENWKVMRRFTLSTLRDFGMGKKTIEDKICEESDSLVEIFKSYN 290391

291900 GKPFDNTLILNSAVANIIVTILLGDRFDYKDPTLLKLVKVVNQNIRIGGGFMAR 292061

292702 LYNIYPSVMRWIPGDHKTVFKNIAKVYKFLNKTFTEHRKVLDVNDQRDLIDAFLVKQQE 292878

294169 EKLSSKKFFHNQNLTVLVANLFAAGMETTSTTLRWGLLLMMKYPEIQ 294309

295416 KKIQEEIDRVIGSAEPRLEHRKLMPYTDAVIHEIQRFANIAPNNVPHETTQDVTFRGYFIPK 295601

296551 GTQVIPMLTSVLRDKAYFKKPEEFYPEHFLDSEGKFVKNEAFLPFSA  296691

297892 GRRSCAGETLAKMELFLFFTKLLQNFTFQPPPGVEVQLTCGVAMTSIPLYHNIC ALSRS* 298071

 

>CYP2AC23 21813_prot scaffold_55:257853-278655 (+) 90% to 21811_prot

part of exon 2 in seq gap, trace archive for exon 2 586458683

67% to CYP2AC1 X. laevis

scaffold_63:720143-729474 (+) strand exons 3-9 only

262853 MDPVSVLLSVVVCIFLYKVFYGGKERPENFPPGPKPLPLIGNLHIMNMRKPHLTFME (0) 263023

265029 LAKTYGSVFSFQLGLEKIVVLCGTDTVKDALINHAEEFSERAKIPVFEDIAKGH

269321 GIVFAHGENWKVMRRFTLSALRDFGMGKKTIEDKICEESDCLVETFKSYN 269470

270333 GKPFDNTFILNSAAANIIVTILLGDRFDYKDPKMLNLIKVVNQNMRIGGGFMVR 270494

273263 LYNTYPTIMRWIPGSHQTVSKNVATIFKFLNETFTEHRKVLDVNDQRDLIDAFLVKQQE 273439

274172 EELSSKKFFYNQNLTVLVTNLFAAGMETTSTTLRWGLLLMMKYPEIQ 274312

276404 KKIQKEIDQVIGSAQPRLEHRKQMPYTDAVIHEIQRFANIAPINIPHETTQDVTFRGYFIPK 276589

277716 GTQVIPLLASVLRDKAYFKKPEEFYPEHFLDSEGNFVKNEAFLPFSA  277856

278476 GKRSCAGETLAKMELFLFFTKLLQNFTFQPPPGVEVQLTCGVALTSIPLDHKICALPRS 278652

 

>CYP2AC24 21812_prot scaffold_55:242882-252687 (-) 90% to 21809_prot

DN029946.1 fills seq gap

67% to CYP2AC1 X. laevis

scaffold_63:693707-703509 (-) strand

252687 MFSFEPITLFMAIVICLLIYLVYGGKGTPPNFPPGPKPLPLIGNLHIMNLKKPYMTLME (0) 252511

250984 LGKKYGSVFSVQLGTEKVVVLCGYDAVKDALINHAEEFSDRPIIEAFHRRSNGH 250823

250732 GITFSHGENWKVMRRFTLATLRDFGMGKRTIEDKINEECISLVETFQSYK 250583

       GEPFENSLILNAAVANIIVSILLGHRFEYQDPTLLKLIRLINEIARILGTPIVM

       LYNAYPSVMRWLPGSHHNVEKNTQKSHTFI

247704 KETFAEHKAQLDINDQRDFIDAFLIKQSE 247618

245612 EKSATGRFFHNENLVSLVDSLFSAGMETTSTTLRWSLMLMMKYPEIQ 245472

245315 KKVQEEIDKVIGSAQPQMEHRKQMPYTDAVIHEIQRFADIVPTNLPHSTTKDVTFRGYLIPK 245130

243475 GTQVIPLLTSVLRDKAYFERPYEFYPQHFLDSEGNFVKNEAFIPFSA 243335

243067 GKRSCAGETLAKMELFLFFTKLLQNFTFQSPPGQDLHLTPLVGFTSAPMVHKICALSRTLD* 242882

 

>CYP2AC25 21811_prot scaffold_55:216779-238524 (+) 90% to 21813_prot

78% to NM_00103511

67% to CYP2AC1 X. laevis

scaffold_63:674066-689343 (+) strand

223244 MDPVSVLLSVVICIFLYKVFYGGKETSKNFPPGPKPLPLIGNLHIMNMKKPHLTFME (0) 223414

225164 LAEKYGSVFSFEFGLRKTVVLCGTDTVRDALINHAEEFSERARIPVFEDITKGH (1) 225325

225574 GIVFAHGENWKVMRRFTLSTLRDFGMGKKTIEDKICEESDCLVEIFKSYN (1) 225723

227389 GKPFDNTLIMNSAVANIIVTILLGDRFDYKDPTMLKLVKVVNQNIRITGGLMAR (0)227550

230255 LYNIYPSIMRWIPGSHQTVSKNMAKVFKFLNETFTEHRKQLDVNDQRDLIDAFLVKQRE (0) 230431

232470 EKLSAKTFFHNDNLTVLVTNLFGAGMETTSTTLRWGLLLMMKYPVIQ (1) 232610

234765 KKVQKEIDQVIGSAQPRLEHRKQMPYTDAVIHEIQRFANIAPINIPHETTQDVTFRGYFIPK (0) 234947

236825 GTQVIPVLTSVLQDKAYFKKPEEFYPEHFLDSEGKFVKNEAFLPFSA (1) 236965

238345 GKRSCAGETLAKMELFLFFTKLLQNFTFQPPPGVEVQLTCGVALTSIPADHKICALPLS 238521

 

>CYP2AC26 21810_prot scaffold_55:188843-209598 (-) 80% to 21816_prot

67% to CYP2AC1 X. laevis

scaffold_63:639668-660420 (-) strand

209598 MDPVSVLLSVVVCIFLFKVFYGGKRTLENFPPGPKPLPLIGNLHMMNMKKPHLTFME (0) 209428

207937 LAEKYGSVFSVHLGTEKVVVLCGTDTVRDALINHAEEFSERAKMPIFEDFSKGL (1) 207776

206533 GVVFGHGENWKVMRRFTLSTLRDFGMGKKTIEERISEESDCLVETIKSYE (1) 206384

205040 GKPFDNTLIMNAAVANIIVHILLNHRFDYQDPTLLKL LINIVIDNIKIGGSPIVM   204879

200634 LYNTYPSVVRWIPGSHKTLGENTAQLYKFLEETFTQHREQLDVNDQRDLIDAFLVKQQE  200458

198405 EKPSSAKFFHNENLVALLANLFVAGMETSSTTLRWGLLLMMKYPDIQ 198265

192757 KKVQDEIDKVIGSAEPRLEHRKLMPYTDAVIHEIQRFANIAPISLPHATTTDVTFRGYFIPK (0) 192572

191365 DTQVMIVLTSVLQDKDYFKKPEEFYPEHFLNSKGNFVKNEAFLPFSA (1) 191222

189019 GRRICAGETLAKMELFLFFTKLLQNFTFQPPPGVEVDLTCADAMTSKPQEHQICALPRG* 188843

 

>CYP2AC27 21809_prot bad model green parts OK 90% to 21812_prot

77% to NM_001035117 (lower case)

scaffold_55:163837-187896 (-)

68% to CYP2AC1 X. laevis

scaffold_63:614662-635363 (-) strand first intron is large and there is a gap

therefore the first exon here might belong to a different gene but the EST

DT408405.1 supports this seq.

184541 MVSFEPITLFLAIVICLFLIYLVYGGKGTPPNFPPGPKPLPLIGNLHIINLKKPYMTFME (0) 184362

173558 LGKKYGSVFRVQLGTEKVVVLCGYDAVKDALINHAEEFSDRPIIETFHRRSNGH

173308 GITFSHGENWKVMRRFTIATLRDFGMGKRTIEDRINEECHSLVETFQSYK 173159

171488 GEPFETNLIMNAAVANIIVSILLGHRFEYQDPTLLKLIGLSNEMVRILGSPIVL 171339

169346 LYNAYPSVMKWLPGSHHNVIKNTQKSHTFIKETFTEHKAQLDINDQRDFIDAFLAKQSE 169170

167042 KKPNPGLFFHNENLVSLVDGLFVAGMETTSTTLRWGLLLMMKYPEIQ 166899

166538 KVQDEINKVIGSAQPQTEHRKQMPYTDAVIHEIQRFADIIPANLPHATTKDVTFRGYFIPK 166356

164553 GTQVIPMLTSVLRDKDYFERPYEFYPQHFLDSEGNFVKNEAFLPFSA 164413

164016 GKRSCAGETLAKMELFLFFTNLLQNFTFQPPPGQDLNLTTTGGFTSIPMVHKICALSRN 163840

 

>CYP2AC28P 21808_prot New exons 3-5 scaffold_55:152750-158460 (+) no ESTs 83% to 21810_prot

exon 7 decaying, probable pseudogene

61% to CYP2AC1      Xenopus laevis

scaffold_63:604894-609969 (+) strand

154072 MDPVSVLLSVVICIFLYKIFYGGKETPENSPPGPKPLPLIGNLHMINMKKPHLTFME (0) 154242

       seq gap

155983 GIVFAHGENWKVMRRFTLSTLRDFGMGKKTIEDRISEESDCLVGVFKSYE (1)156132

156898 GKPFDNTMIMNAAVANIIVHILLNHRFEYQDPTLLKLIKIVSENIRIGGSPIVM  (0) 157059

157308 LYNTYPSIMRWIPGRHKTVGANTAKLYDFLKETFTRHREHLDVNDQRDLIDVFLVKQQE  (0)157484

158540 KKLSSTKFFHDENLTVLLGNLFGAGMETTSTTLRWGLLLMMKYPEVQ 158680

159012 LYNAFPSVMGWLPGRQQRLFENSQTFHESI KHKSQLDISDQRDLL 159147

 

>CYP2AC29P scaffold_55: 150542-150360 (-) 100% to NM_001004878.1

scaffold_63:601182-601364 (-) strand

150542 MLAADPMTILLSAFICLLLGFVLFGRKRNVCQNFPPGPRPLPVIGNLLLMDRKQPYKALLK (0) 150360

 

>CYP2AC30 NM_001004878.1    66% to NM_001035117, 51% to 2K17 zebrafish

21807_prot (extra N-term piece) P=Q in browser

scaffold_55:119438-130135 (-)

66% to CYP2AC1      Xenopus laevis

scaffold_63:570263-580957 (-) strand

130135 MLAADPMTILLSAFICLLLGFVLFGRKRNVCQNFPPGPRPLPVIGNLLLMDRKQPYKALLK (0) 129953

126756 VSKKYGPVCSFQIGPLKTVVLCGYDTVKDALLNDEFADRPAMPMLDDVAKGH 126601

124037 GILSSNGENWRVMRRFALSTLRDFGMGKKTIESKINEECDHLVQKFSSY 123891

123551 GKPFDTTMIMNAAVANIIASILLSHRFHYENPTLLRLLKLVNENTKFMASRIAM 123390

123231 LYNTFPSIMRWIPGCHKSIYKNAQELLEFIRETFSKQKVELDINDQRNLIDAFLSRQQE (0) 123055

122583 PNSGKYFHDDNLTILVFDLFVAGMETTSTTLRWALLLMMKYPEIQ 122449

121271 KKVQDEIEKVIGSAEPRAEHRKEMPYTDAVIHEIQRFANIFPMNGPHATTKDVTFRGFLIPK 121089

119957 GTFVIPLLASVLKDENYFKKPNEFYPEHFLDSEGHFVKNDAFLPFSA 119817

119617 GRRSCAGENLARMELFLFFTSLLQNFTFQAPPGEELDLTPDVGIATPPMPHTVCALPRA 119441

 

>CYP2AC30 NM_001004878.1 66% to NM_001035117, 51% to 2K17 zebrafish

61% to CYP2AC4 anole_ENSACAP00000012346

87% to NM_001004777.1 68% to CYP2AC1 X. laevis

MDRKQPYKALLKVSKKYGPVCSFQIGPLKTVVLCGYDTVKDALLNDEFADRPAMPMLD

DVAKGHGILSSNGENWRVMRRFALSTLRDFGMGKKTIESKINEE

CDHLVQKFSSYGGKPFDTTMIMNAAVANIIASILLSHRFHYENPTLLRLLKLVNENTK

FMASRIAMLYNTFPSIMRWIPGCHKSIYKNAQELLEFIRETFSKQKVELDINDQRNLI

DAFLSRQQEPNSGKYFHDDNLTILVFDLFVAGMETTSTTLRWALLLMMKYPEIQKKVQ

DEIEKVIGSAEPRAEHRKEMPYTDAVIHEIQRFANIFPMNGPHATTKDVTFRGFLIPK

GTFVIPLLASVLKDENYFKKPNEFYPEHFLDSEGHFVKNDAFLPFSAGRRSCAGENLA

RMELFLFFTSLLQNFTFQAPPGEELDLTPDVGIATPPMQHTVCALPRA

 

>CYP2AC31P exon 1 with frameshift at end same as 21811_prot

scaffold_63:566430-566596 (+) strand

115608 MDPVSVLLSVVICIFLYKVFYGGKETSKNFPPGPKPLPLIGNLHIMNMKKPHLTX 115769

115769 ME (0)115774

 

>CYP2AC32P $$$$$ 93% to NM_001004777

scaffold_63:563632-563814 (-) strand exon 1

112992 MLAADPMTILLSAFICLLLGFVLFGRKRNVCQNFPPGPRALQVIGNLLLMDRRQPYETLIE (0) 112810

 

 

>CYP2AC33P CYP2AC 90% to NM_001004777.1

scaffold_63:553089-558958 (-) strand exons 5-9 only

       LYNSYPSIMRWVPGCHKTIYNNIQELLEFIRETFSKHKVELDINDQRNLIDAFLSRQQE

       EKPHSAKYFHDDNLTVLVADLFVAGMDTTSTTLRWALLLMMKYPEIQ (1)

       KKVQDEIEKVIGSAEPRAEHRKDMPYTDAVLHEIQRFANIFPMNAPHATTKDLTFRGFLLPK

       GTFVTPLLASVLKDENYFEKPNEFYPKHFLNSEGHFVKNEAFLPFSA

       GRRSCAGENLAKMELFLFFTSLLQNFTFQAPPGEEPDLTPAISGTRTPKPHTVCALPRA*

 

>CYP2AC34P

scaffold_63:544579-544746 (-) strand part of exon 1 and exon 2

       MDRKQPYKTLME

       VSKKYGSVFSVRVGPLKMVVLCGYDTVKDALLNYPDEFADRPALPLFDELVKGH

 

>CYP2AC35 CYP2AC NM_001004777.1 (gap missing C-helix, 22 aa) CX454308.2 69% to NM_001035117

61% to CYP2AC4 anole_ENSACAP00000012346, 69% to CYP2AC1 X. laevis

MDRKQPYKTLMEVSKKYGSVFSVRVGPLKMVVLCGYDTVKDALLNYPDEFADRPALPLFD

ELVKGHGIIFSNGENWKVMRRFSLSTLRDFGMGKKTIESKIIEECDHLVQKFNSYGGKPFDNTM

IMNAAAANIIASILLSHRFHYENPTLLRLLKLVNENMRLMASPIALLYNTYPSIMRWV

PGCHKTIYNNAQELMEFIRETFSKHKVELDINDQRNLIDAFLSRQQEEKPHSAKYFHD

DNLTILVIDLFAAGMETTSTTLRWALLLMMKYPEIQKKVQDEIEKVIGSVEPRAEHRK

EMPYTDAVLHEIQRFANITPMNGPHATTKDVTFRGFFLPKGTYVIPLLASVLKDENYF

EKPNEFYPEHFLDSEGHFMKNEAFLPFSAGRRSCAGENLARMELFLFFTSLLQNFTFQ

APPGEELDLTPDVGGTVPPRPHTVCALPRS

 

>CYP2AC35 NM_001004777.1 (gap missing C-helix, 22 aa) CX454308.2 69% to NM_001035117

scaffold_55:85652-94653 (-)

67% to CYP2AC1 X. laevis

scaffold_63:536474-542809 (-) strand exons 4-9 only

94653 MLAADPMTILLSAFICLLLGFVLFGRKRNVCQNFPPGPRALPVIGNLLLMDRKQPYKTLME (0) 94471

93921 VSKKYGSVFSVRVGPLKMVVLCGYDTVKDALLNYPDEFADRPALPLFDELVKGH 93760

      GIIFSNGENWKVMRRFSLSTLRDFGMGKKTIESKIIEECDHLVQKFNSYG

91987 GKPFDTTMIMNAAAANIIASILLSHRFHYENPTLLRLLKLVNENMRLMASPIAL 91826

89951 LYNTYPSIMRWVPGCHKTIYNNAQELMEFIRETFSKHKVELDINDQRNLIDAFLSRQQE 89775

88013 EKPHSAKYFHDDNLTILVIDLFAAGMETTSTTLRWALLLMMKYPEIQ 87873

87405 KKVQDEIEKVIGSVEPRAEHRKEMPYTDAVLHEIQRFANITPMNGPHATTKDVTFRGFFLPK 87220

86157 GTYVIPLLASVLKDENYFEKPNEFYPEHFLDSEGHFMKNEAFLPFSA 86017

85828 GRRSCAGETLARMELFLFFTSLLQNFTFQAPPGEELDLTPDVGGTVPPRPHTVCALPRS 85652

 

>CYP2AC35-de9b scaffold_55

scaffold_63:533261-533437 (-) strand exon 9

82615 GRRSCAGKTLAKMKLFLFFTSILQNFTFQAPPGVEPDLTPAISGTRTHKPHTVCALPRA 82439

 

>CYP2AC36 $$$$$4 95% to NM_001004777.1 pseudogene

68% to CYP2AC1 X. laevis

scaffold_63: 517719-529773 (-) strand exons 8 and 9 are out of sequence

they come before exons 6 and 7

78951 MLAADPMTILLSAFICLLLGFVLFGRKRNVCQNFPPGPRALPVIGNLLLMDRKQPYKTLME (0) 78769

78170 VSKKYGPIFSVRAGPQKMVVLCGYDTVKDALLNYPDEFADRPALPLFDEVVKGH 78009

76552 GIFFSNGENWKVMRRFGLSALRDFGMGKKTIESKINEECDHLVQKFNSYG 76403

75689 GKPFDTTMIMNAAAANIIASILLSHRFQYENPTLLRLLKLVNENIRLMASPIAL 75528

74153 LYNTYPSIMRWVPGCHKTIYKNAQELMEFIRVTFSKHKAELDINDQRNLIDAFLSRQQE 73977

67696 EKPHSAKYFHDDNLTILVFDLFAAGMETTSTTLRWALLLMMKYPEIQ 67556

67082 KKVQDEIEKVIGSVEPRAEHRKEMPYTDAVLHEIQRFGNITPMNGPHATTKDVTFRGFFLPK 66897 517719

69093 GTYVIPLLASVLKDENYFEKPNEFYPEHFLDSEGHFVKNEAFLPFSA 68953

68767 GRRSCAGETLARMELFLFFTSLLQNFTFQAPPGEELDLTPDVGGTVPPRPHTVCALARS 68591

 

>CYP2AC37P $$$$$5

Note frameshifts = & in exon 1 and exon 3, pseudogene

63% to CYP2AC1 X. laevis

scaffold_63:499161-505991 (-) strand

55169 MDPVSVLLSVVVCIFLYKVFYGGKEASQ & 55086

55084 NFPPGPKPLPLIGNLHMMNMKKPHLTFME 54998

53620 FSKKYGPVFSIQLGLNKAIVLCGADAVKDALINHGDEFSGRPKIPVFDQISKGY 53459

52239 GVVFADGENWKVMRRFALSTLRDFGMGRKTIEDTIVEE & SGCLVETFKSHE

51713 AKPFDNTLILNAAVANIIVHILLNHRFEYQDPTLIKLIKSVSENVKIAGSPIVM 51552

50894 LYNTYPSIMGWIPGSHKTVFENFQKLSNFLKETFTKRRDQLDVNDQRDLIDAFLVKQQE 50718

50601 LALQFQEKSSSKKFFHDENLKVLLGDLFAAGMETTSTTLRWGILMMMKYPDIQ 50443

49280 KKVQDEIDRVIGSAEPRLEHRKQIPYTDAVIHEIQRFANLVPIVLPHSITEDVTFRGYFLPK 49095

48788 GTQVIPLLISVMQDKDYFQKPEEFYPEHFLDSKGNFVKNEAFLPFSV 48648

48515 GKRSCVGETLAKMELFLFFTKLLQNFTFQPPHGVEVQLTCGDALTSIPLDHKICALPRS 48339

 

>CYP2AC38 $$$$$$6 nearly identical to $5

scaffold_63:484668-488536 (-) strand, first 2 exons in a seq gap

CX981929.1

MDPVSVLLSVVVCIFLYKVFYGGKGASQNFPPGPKPLPLIGNLHMMNMKKPHLTFME

FSKKYGPVFSIQLGLNKAIVLCGADAVKDALINHGDEFSGRPKIPVFDQISKGY

37714 GVVFADGENWKVMRRFALSTLRDFGMGRKTIEDTIVEESGCLVETFKSHE 37565

37222 GKPFDNTLILNAAVANIIVHILLNHRFDYQDPTLIKLIKSVSENVKIAGSPIVM 37061

36400 LYNTYPSIMGWIPGSHKTVFENFQKLSNFLKETFTKRRDQLDVNDQRDLIDAFLVKQQE 36224

36089 EKSSSKKFFHDENLKVLLGDLFAAGMETTSTTLRWGILLMMKYPDIQ 35949

34787 KKVQDEIDRVIGSAEPRLEHRKQIPYTDAVIHEIQRFANLVPIVLPHSITEDVTFRGYFLPK 34608

34295 GTQVIPLLISVMQDKDYFQKPEEFYPEHFLDSKGNFVKNEAFLPFSV 34155

34022 GKRSCVGETLAKMELFLFFTKLLQNFTFQPPHGVEVQLTCGDALTSIPLDHKICALPRS 33846

 

>CYP2AC39P $$$$$$7 duplicate exons to $8 pseudogene or assembly error

scaffold_63:478676-480625 (-) strand

29803 LAKKYGPVFSVQLGTKKTVVLCGTDAVKDALINYADEFSGRPKTPLSEQASKGN 29642

28967 GIIFANGENWKVMRRFTLSTLRDFGMGKKTIEDRISEESDCLVETFKSHKGR 28812

28033 GKPFDNTLILNAAVANIIVHILLNHRFDYQDPTFLKLIKSVNDNVRNGARPIIVVSKLWP 27854

 

>CYP2AC40P $$$$$$8 no ESTs possible pseudogene

67% to CYP2AC1 X. laevis

scaffold_63:470140-477463 (-) strand missing exons 1,9

26641 LAKKYGPVFSVQLGTKKTVVLCGTDAVKDALINYADEFSGRPKTPLSEQASKGN 26480

25807 GIIFANGENWKVMRRFTLSTLRDFGMGKKTIEDRISEESDCLVETFKSHKGR 25652

      GKPFDNTLILNAAVANIIVHILLNHRFDYQDPTFLKLIKSVNDNVRNGARPIIVVSKLWP

22131 LYNAFPSIIRWIPGTHKRIFASSQNFFNFLKEIFMKRKDQLDVNDQRDLVDAFLVKQQE 21955

21874 EKSSSTKFFHDENLKVLIGNLFGAGMETTSTTLRWGILLMMKYPEIQ 21734

20135 KKVQDEIDRVMGSTEPRPEHRKQMPYTDAVIHEIQRFADLVPNGVPHATTTDVTFRGYFIPK 19950

19461 GTQVFPLLTSVLRDKAYFKKPDEFYPEHFLDSEGNFLKNEAFLPFSAG 19318

 

>scaffold_590 : 150217-150324 exon 8, 83% to CYP2AC40P

150217 LWDKPYFEKPDEFYAQHFLDSEGNFVKNEAFLPFSA 150324

 

>CYP2AC41 21803_prot scaffold_55:62-7002 (-) 84% to seq at 28033

DN017398.1 DT401910.1 DN087618.1 DN099678.1 DN087299.1

Seq completed by ESTs

49361_prot scaffold_996:1053-7259 same seq as 21803_prot scaffold_55:62-7002

66% to CYP2AC1 X. laevis

scaffold_63: 451256-457824 (-) strand first 4 exons and exon7 only

exons 5,6,8,9 in seq gaps

7002 MDPVSVLLSVVVCIFLFKFFYGGEKGSQNFPPGPKPLPLIGNLHMINMKKPYLTFME (0) 6832

6071 LAEKYGPVFSVHLGANKAVVLCGTDAVKDALINYADEFSGRPKTPLFEQTFKGN (1) 5910

4393 GIVFADGENWKVMRRFTISTLRDFGMGKKTIEDRIIEESCCLVETFKSHK (1) 4244

2832 GKPFDNTMILNAAVANIIVHILLKHRFEYQDPTLLKLIKGVNENVRNGARPIVM (0) 2671

     LYNAFPSIIQWIPGTHKRIFANTQNFFNILKEIFIEHRDQLDVNDQRDLIDTFLVKQQE

     EKSSSTKFFHDENLKVLIGNLFAAGMETTSTTLRWGILLMMKYPEIQ

 661 KKVQDEIDRVIGSAEPRLEHRKLMPYTDAVVHEIQRFANLVPNGLPHATTTDVTFRGYFIPK (0) 476

     GTQVIPLLTSVLRDKAYFKKPEEFYPEHFLDSKGNFLKNEAFLPFSA

     GKRTCAGETLAKMELFLFFTKLLQNFTFQPPPGVEVQLTRGVSLTSIPLDHKICALSRS*

 

25 P450 gene cluster on scaffold 55 continues on scaffold 996 upstream of

21803_prot One side of this cluster has genes that are homologous to Chr 6p21

in humans. The other side of the cluster has a methyl malonyl CoA mutase also

on 6p21. IN HUMANS THIS REGION HAS THE CYP2AC1P PSEUDOGENE.

There are no P450 gene clusters in humans on chr6, but CYP21A2 is at

6p21. The CYP21A2 gene is at 32Mb and the MUT gene and rhag are at 49.5Mb, not

in a syntenic region.

 

>CYP2AC42 49362_prot scaffold_996:115436-122968

86% to 21803_prot scaffold_55:62-7002

67% to CYP2AC1 X. laevis

scaffold_63:428532-436061 (-) strand

MDLVSVLLSVVVCIFLYKVFYGGEKESQNFPPGPKPLPLIGNLHIMNMKK

PFLTFMELAEKYGPVFSVQLGTKKVVVLCGTDAVKDALVNHADEFSGRPK

IPMFDQTSKGHGVIFADGENWKVMRRFTLSTLRDFGMGKKTLEDRIGEES

GCLVETFKSHEGKPFDNTLILNAAVANIIVHILLNHRFDYQDPTLLKLIK

SVSENVRIGGRPIVMLYNTYPSIMQWVPGSHKSIYENSQNLLNFLKETFT

EHRHQLDVNDQRDLIDTFLVKQQEEKSSSTKFFHDENLTILLSNLFGAGM

ETTSTTLRWGILLMMKYPDIQKKVQDEIDQVIGSAEPRLEHRKQMPYTDA

VIHEIQRFANLAPNGLPHATTTDVTFRGYFIPKGTQVIPVLTSVLRDKAY

FKKPEEFYPEHFLDSEGKFLKNEAFLPFSAGKRICAGETLAKMELFLFFT

KLLQNFTFQPPPGVEVQLTCGDAITSIPLDHKICALSRS

 

>CYP2AC43 49364_prot scaffold_996:134740-168381 poor model, missing exons 6,7

same seq as:

NM_001035117 BC092552 mRNA

CYP2 family member, 50% to 2K21 zebrafish

from refseq database

83% to 49362_prot scaffold_996:115436-122968

65% to CYP2AC1 X. laevis

scaffold_15025:748-5473 exons 2,3,7,8 with seq gaps for others

scaffold_63: 402657-411393 (+) strand missing exons 7,9

402657 MDPVSVLLSVVVCIFLFKVFYDGEKESQNFPPGPKPLPLIGNLHIINMEKPYLTFME 402827

403626 LAEKYGSVFSFHLGTEKVVVLCGTDAVRDALINHAEEFSGRPKVAIFDQIFKGH 403787

404617 GIIFADGENWKVMRRFSLSTLRDFGMGKKTIEEKISEESDCLVETFKSHx 404763

405134 GKPFDNTMIMNAAVANIIVALLLSQRFDYQDPTLLKLVKSINKIVRITGSSMVM 405295

406867 LYNTFPSIMQWIPGSHQNVVKNAEKIYTFLIETFTKHRHQLDVNDQRDLIDTFLIKQQE 407043

409306 EKSSSTKFFHDENLKVLLLNLFGAGMETTSTTLRWGILLMMKYPEVQ 409446

       KKVQDEIDRVIGSAEPRLEHQKQMPYTDAVIHEIQRFADLVPNNVPHATTKDVTFRGYFIPK

411253 GTHVIPLLTSVLKDKDYFKKPNEFYPEHFLDSEGHFVKNEAFLPFSA 411393

       GRRICAGETLAKMELFLFFTNLLQNFTFQPPPGVEVQLTRGVAITSIPTEHKICALPRS

 

>CYP2AC44 4055_prot scaffold_996:168592-176929

14029_prot scaffold_996:176841-181757 join these two

89% to 49367_prot scaffold_996:195103-207745

66% to CYP2AC1 X. laevis

scaffold_63:369743-379114 (-) strand

172383 MDLVSVLLSVVICIFLYKVFYGGEKESQNFPPGPKPLPIIGNFHMINMKKPHLTFME 172553

172634 LAKKYGSVFSIQLGPEKLVVVCGADAVKDALVNHADEFSARPTIPVFDKTSKGH 172795

174055 GVFFANGENWKVMRRFTLSTLRDFGMGKKTIEDRICEESDFLMETFKSYK 174204

174922 GKPFDNTMIMNAAVANIIVHILLNHRFDYQDPTLLKLINIVSENISIAAKPIVL 175080

176775 LYNAYPSIMEWVPGTHKSVAENMLKLYNFLRETFTQHRDQLDVNDQRDLIDVFLVKQQE 176951

177972 EKPSSTKFFNDQNLTVLLADLFGAGMETTSTTLRWGLLFIMKYPDIQ 178112

179041 KKVQDEIDKVIGSAQPRLEHRKKMPYTDAVIHEIQRLGNLAPNVGHETTTDVTFRGYFIPK 179223

180149 GTQVIILLTSVLQDKDYFKKPEEFYPEHFLDSEGNFVKNEAFLPFSA 180289

181578 GRRICVGETLAKMELFLFFTKLLQNFTFQPPPGVEVDLTCADAITSKPLEHQICALPRS* 181757

 

>CYP2AC45 49367_prot scaffold_996:195103-207745

80% to 49362_prot scaffold_996:115436-122968

66% to CYP2AC1 X. laevis

scaffold_63:343755-356394 (-) strand

MDLVSVLLAVVICFFIFKVFYGGKNAFQNFPPGPKPLPIIGNFHMINMKKPYLTFME

LAEKYGPVFSIQLGTEKVVVLYGADAVKDALINHGDEFSGRPTIPVFDRISKGH

GLFFANGENWKVMRRFTLSTLRDFGMGKKTIEDRICEESDFLMETFKSYK

GKPFDNTMIMNAAVANIIVHILLNHRFDYQDPTLLKLINTISENVRIAGKPMVV

LYNAYPSIMQWFPGIHKSVAESILQFYDFLRETFTQHRDQLDVNDQRDLIDVFLVKQQE

EKSSSTKFFNDHNLTALVADLFGAGMETTSTTLRWGLLFMMKYPDIQ

KKVQDEIDRVIGSAQPRLEHRKTMPYTDAVIHEIQRLGNLAPFIGHETTTDVTFRGYFIPK

GTQAIVLLASVLQDKDYFKKPEEFYPEHFLDSEGNFVKNEAFLPFSA

GRRMCVGETLAKMELFLFFTKLLQNFTFQPPPGVEVDLTCGDAVTSKPLDHQICALPRS

 

>CYP2AC46 49368_prot scaffold_996:213773-226056, 81% to 21809_prot

67% to CYP2AC1 X. laevis

scaffold_63:325444-337724 (-) strand

MFPLEPTTLFVAIVLCLFLIYLLLHNGKGTPPNFPPGPKPLPFIGNLHIM

NLNKPHKTYMELGNKYGSVFSVQLGTEKVVVLCGYDAVKDALINHAEEFS

ERAVSTLSRKRLKGYGIIFSHGENWKVMRRFTLATLRDFGMGKRTTEDTI

NEECNFLMETFKSYKGEPFETNLIMNAAVANIIVSILLGHRFEYQDPTLL

KLIGLVNEIVKLSGRPIIMIYDAFPSVVSWLPGSHQKVLENTRGLRNFIK

ETFTEHKARLDINDQRDLIDVFLVKQREEKPNPGLFFHNENLISLVSNLF

VAGMETTSTTLRWGLLLMMKYPEIQKKVQNEIDKVIGSAQPQMEHRKQMP

YTDAVIHEIQRFADIVPTNLPHATTMDVTFRGYLIPKGTRVIPLLTSVLR

DKAYFEKPYEFYPEHFLDSEGNFVKNEAFIPFSAGKRICAGETLAKMELF

LFFTNLLQNFTFRSPPGQDLPLTTAEGFTSIPMVHKICAVSRA

 

>CYP2AC47 49369_prot scaffold_996:232793-245538 missing exon 4, 78% to $$$$$4

63% to CYP2AC1 X. laevis

scaffold_63:305962-318704 (-) strand

MLVADPMTILLSAFICLLLGFVLVGNKRHIYRKFPPGPRALPFIGNIQMIYVKQPYKTLLE

LSKTYGSIFSIQVGTEKMVVLCGYDTVKDALLNYPDDFADRPALPLIDDLAKRH

GVFFSNGENWRVMRRFALSALKDFGMGKKRMEKTIIEECDHLVQKFNSYG

GKPFDSTMII  Seq gap

LYHTYPSIMRWVPGCHKTVYKNGRELYHFLKETFSKHKADLDINNQRNLIDAFLSKQQK

EKSKPDGFFHDDNLTTLLFDLFTAGMETIANTLRWAILLMMKYPEVQ

KKVQDEIEKVIGSAEPRVEHRKNMPYTDAVIHEIQRFANITPMNCPYATSQDVTFKGYFLPK

GTQVIPLLASVLQDEAYFEKPEEFYPQHFLDSEGHFVKNEASIPFSA

GRRSCAGENLARMELFLFFTSLLQNFTFQAPPGEELDLTPDVGLSTPPMQHTTCALSRACS

 

>scaffold_2899 : 33841-33948 (+)

94% to 49369_prot   scaffold_996:232793-245538, 2 aa diffs to CYP2AC47

33841 GTQVIPLLASVLQDETYFEKPEEFYPQHFLDSEGLF 33948

 

A flanking gene in 996 is MUT methylmalonyl CoA mutase it is on human chr 6p21

Just like the other end of this cluster rhag gene.  There are no P450s at

This location on human chr 6.

 

>CYP3A80

NM_001015786.1 59% to 3A5

from refseq database

MNLIPHLSTGTWILLAALLVLILLYGIWPYGYFKKMGIPGPTPL

PFIGTFLEFRKGMVQFDTECFKKYGKMWGTYDGRQPVLAIMDPAIIKTILVKECYTNF

TNRRNFGLNGPFESAITIAEDEQWKRIRNVLSPTFTSGKLKEMFQIMKDYSDILVKNI

QGYVEKDEPCATKDVIGAYSMDVITSTSFSVNIDSLNKPSDPFVIHMKKLLKTGLLSP

LLILVVIFPFLRPILEGLNLNFVPKDFTEFFMNAVTSFREKRKKGDHSGRVDLLQLMM

DSRTTGGNDLSNKHKALTDAEIMAQSVIFIVAGYETTSTALSYLFYNLATHPDVQQRL

HEEIDSFLPDKASPTYDILMQMEYLDMVIQETLRLFPPAGRLERVSKQNVEINGVSIP

KGIVTLIPAYVLQRDPEYWPEPEEFRPERFSKENRATHTPFTFLPFGDGPRNCIGLRF

ALLSMKVAIVTLLQNFSVRPCAETLIPMEFSTIGFLQPKKPIVLKFLSRAAAHE

 

>CYP3A81

BX779027 CX415432.1 93% to 3A80 N. Abdletawab

CX415433 = mate pair

Trace archive 243619963 419527443 418746304

476067541 (exon 1)

416306382 joint before I-helix

MNLIPHLSTGTWILLAVLLVLILL (2)

YGIWPYGLFKKMGIPGPTPLPFIGTFLEFRKGMIQFDIECFKKYGR

MWGMYDGRQPVLAIMDPAIIKTILVKECYTNFTNRRNFGLNGPLESAITVAEDEQWKRIR

SVLSPTFTSGKLKEMFQIMKDYSDILVKNVQVSVDKDEPCATKDVIGAYSMDVITSTSFS

VNIDSLQNPSNPFVIHIKNLLKTGFLSPVIIFAVIFPFLRPIFEVLNISFFPKDFTQFFM

NAVTSFREKRKKGDHS (0)

GRVDLLQLMVDSGTTEGNDSSNQHKALTDAEIMAQSLIFIFAGYETTSTALSYLF
YNLATHPDVQQKLHEEIDSFLPDKASPTYDILMQMEYLDMVIQETLRLFPPAGRLERVSK
QNVEINGVIIPKGTVAMIPAYVLQRDPEYWPEPEEFRPERFSKENRATQTPFTFLPFGDG
PRNCIGLRFALLSMKVAIATLLQNFSVRPCAETLIPMEFSTIGVLQPKKPIVLKFLSRAAAHE*
 

>CYP3A82 CX982440.1 DT453227 G.Vasser 62% to 3A81, 57% to 3A80 and 3A81

MTFLPDFSMATWTLLVLLLTLLAYYAIWPYKLFKRYGIPGPTPIPFIGTFL

GNRHGLMEFDMECFKKYGKVWGIYEGQKPLLAIVDPVIIKSIMVKECYTNFTNRRDFGLS

GPLKSSVLISKDEQWKRIRTVLSPTFTSGKLKQMFPLMNHYGELLVKNIHKKINNKEPLD

MKHIFGSYSMDIVLSTSFSVNVDSMNNPNDPFVTNARNLFTFSFFNPLFLISILCPFLVP

LLDKMNFCFLSLKILNFFKDAVASIKKKRQKGTH

EDRVDFLQLMVDAQSNEGKSVPEEEKHGYKE

LSDTEILAQSLIFIMAGYETTSTTLMFLAYNIATHPDVQRKLEEEIDALLPNKAPPTYDA

LMKMEYMDMVINESLRMFPPAIRIDRVCKKTMEINGVTIPAGVVIVVPLFALHLNPEIWP

EPEEFQPERFSKENQKNQDPYNFLPFGVGPRNCIGMRFALVNMKVALTILLQNFRLETCK

DTPVPLKICTKGYLKPTKPIILNLIPKVGQTVEE*
 

>CYP4T8

DR860523.1 CX967683.1 DT412234.1 DR834559.1

best match to 4B1 in ESTdb X.tropicalis

A.Bolen, K. Iyer, E. Mahrous, S. Aggarwal

89% to CYP4T4 of Xenopus laevis

best match in human = 4B1 55%, probably a 4B1 ortholog

MWNTLVWQQVA

ALLCLLAVLLKATQLYLSQKRQENIFKQFPGPPRHWLLGNVDQIRRDGKDLDLLVNWTHK

NGGAFPVWFGNFSSFLFLTHPDYAKVIFGREEPKSSISYDFLVPWIGKGLLVLTGPKWFQ

HRRLLTPGFHYDVLKPYVNLISKCTTDMLDNWEKLITKQKTVELFQHLSLMTLDSIMKCA

FSYDSNCQKDSNNAYIKAVFDLS

YVANLRLRCFPYHNDTVFYLSPHGYRFRKACRITHEHTDKVIQQRKESMKLEKELEKIQQ

KRHLDFLDILLFARDEKGHGLSDEDLRAEVDTFMFEGHDTTASGISWILYCMAKYPEHQQ

KCREEIKEVLGDRQIMEWEDLGKIPYTNMCIKESLRMYPPVPGVARQLRNPVTFFDGRSV

PAGTVIGLSIYAIHKNPAVWEDPEVFNPLRFSPENSANRHSHAFLPFAAGPRNCIGQNFA

MNEMKVAVALTLNRFHLAPDLENPPIRIPQLVLKSKNGIHVHLTKVQ*

 

>CYP4T9

NM_001017348.2 55% to 4B1 human, 73% to DR860523.1 C. Blackwell

79% to CYP4T3 of Xenopus laevis

from refseq database

MASTLWKALSSPWLSVNIYQIGQFVALLCVVLLLLKAYALYSRG

RRFAAALVPFPGPPAHWLYGHVNQFRRDGKDLDRLMVWVNKYPNAFPLWIGKFFGTLI

ITDPDYAKVVFGRSDPKTSTGYNFLVPWIGKGLLILSGNTWFQHRRLITPGFHYDVLK

PYVSLISDSTKIMLDELDVYSNKDESVELFQHVSLMTLDSIMKCAFSYHSNCQTDKDN

DYIQAVYDLSWLTQQRIRTFPYHSNLIYFLSPHGFRFRKACRIVHLHTDKVIGQRKKL

LESKEELEKVQKKRHLDFLDILLCSKDENGQGLSHEDLRAEVDTFMFEGHDTTSSGIS

WILYCMATHPEHQQKCREEISEALGERQTMEWDDLNRMPYTTMCIKESLRLYPPVPSV

SRELAKPITFHDGRSLPAGMLVSLQIYAIHRNPNVWKDPEIFDPLRFSPENSSKRHSH

AFVPFAAGPRNCIGQNFAMNEMKVAVALTLKRFELSPDLSKPPLKQPQLVLRSKNGIH

VYLKKAS

 

>CYP4F57v1 CYP4F.a2 AL648475.2, CF786466.1, AL896688.2 S.Hill, N.Liao

NM_001016020.2 62% to 4F22, 1aa different to NM_001015770

90% to NM_001015810, same as DT404766.1

from refseq database

87% to CYP4F42 X. laevis

MLPFLDHFLDSLNMSRTSFRVYIFAAVILMFCLIMCRTIFKMAI

YIYAYIINARRLRCFPEPPRRSWLLGHLGMFMPTEEGLTEISSAICNLRRTLLTWLGP

IPEVSLVHPDTVKPVVAASAAIAPKDELFYGFLRPWLGDGLLLSRGEKWGQHRRLLTP

AFHFDILKNYVKIFNQSTDIMLAKWRRLTAEGPVSLDMFEHVSLMTLDTLLKCTFSYD

SDCQEKPSDYISAIYELSSLVVKREHYLPHHFDFIYNLSSNGRKFRQACKTVHEFTAG

VVQQRKKALQEKGMEEWIKSKQGKTKDFIDILLLSKNEDGSQLSDEDMRAEVDTFMFE

GHDTTASGLSWILYNLACHPEYQEKCRKEITELLEGKDIKHLEWDELSKLPFTTMCIK

ESLRLHPPVVAVIRRCTEDIKLPKGDILPKGNCCIINIFGIHHNPDVWPNPQVYDPYR

FDPENLQERSSYAFVPFSAGPRNCIGQNFAMAEMKIVLALILYNFQVRLDETKTVRRK

PELILRAENGLWLQVEELKR

 

>CYP4F57v2 CYP4F.a3 CX980073.1, CX968437.1, CF589328.1

NM_001015770.1 62% to 4F22

from refseq database

note there are two seqs that differ at only 2 nucleotides

but there are three ESTs that support each sequence so these

are probably alleles.

88% to CYP4F42 X. laevis

scaffold 403 669820-690787 (-) strand

MLPFLDHFLDSLNMSRTSFRVYIFAAVILMFCLIMCRTIFKMAT

YIYAYIINARRLRCFPEPPRRSWLLGHLGMFMPTEEGLTEISSAICNLRRTLLTWLGP

IPEVSLVHPDTVKPVVAASAAIAPKDELFYGFLRPWLGDGLLLSRGEKWGQHRRLLTP

AFHFDILKNYVKIFNQSTDIMLAKWRRLTAEGPVSLDMFEHVSLMTLDTLLKCTFSYD

SDCQEKPSDYISAIYELSSLVVKREHYLPHHFDFIYNLSSNGRKFRQACKTVHEFTAG

VVQQRKKALQEKGMEEWIKSKQGKTKDFIDILLLSKNEDGSQLSDEDMRAEVDTFMFE

GHDTTASGLSWILYNLACHPEYQEKCRKEITELLEGKDIKHLEWDELSKLPFTTMCIK

ESLRLHPPVVAVIRRCTEDIKLPKGDILPKGNCCIINIFGIHHNPDVWPNPQVYDPYR

FDPENLQERSSYAFVPFSAGPRNCIGQNFAMAEMKIVLALILYNFQVRLDETKTVRRK

PELILRAENGLWLQVEELKR

 

>CYP4F58 CYP4F.b1

NM_001015810.1 64% to 4F22

from refseq database

90% to CYP4F42 X. laevis, 90% to CYP4F.a2 and .a3

scaffold 403 641462-661033 (-) strand

MLPSLDHFLDSLNMSRSSFRVYIFAAVILLFCLIMFRTILKMAI

YIYAYIINARRLRCFPEPPRRSWLLGHLGLFMPTEEGLTEVSNTISNFRKSFLTWMGP

ISLVSMVHPDTIKPMVAASAAIAPKDELFYGFLRPWLGDGLLLSRGEKWGRQRRLLTP

AFHFDILKNYVKIFNQSTDIMLAKWRRLAAVGPVSLDMFEHVSLMTLDTLLKCTFSYD

SDCQEKPSDYIAAIYELSSLVVKREHYLPHHFDFIYNLSSNGRKFHQACKTVHEFTAG

VVQQRKKALQEKGIEEWIKSKQGKTKDFIDILLLSKDEDGNQLSDEDMRAEVDTFMFE

GHDTTASGLSWILYNLACHPEYQEKCRKEITELLEGKDTKHLEWDELSQLPFTTMCIK

ESLRLHPPVTAVSRRCTEDIKLPDGKVIPKGNSCLISIYGTHHNPDVWPNPQVYDPYR

FDPEKLQERSSHAFVPFSAGPRNCIGQNFAMAEMKIVLALTLYNFYMRLDETKTVRRK

PELILRAENGLWLQVEELKQ

 

>CYP4F42    Xenopus laevis

           No accession number

           Yoshiaki Fujita and Hiroaki Ohi

           Submitted to nomenclature committee 7/1/2003

           64% to 4F22 in humans (full length)

MLPFLDHFLDSLNLSHSTFRVYIFYAVILFFSLIMFRTILKMVT

YIYAYIINARRLRCFPEPPRRSWLLGHLGLFMPTEEGLTEVSDAISSFRKTFLTWMGP

ISLVSVFHPDTVKPIVAASAAIAPKDDLFYGFLRPWLGDGLLLSHGEKWGRHRRLLTP

AFHFDILKSYVKIFNQSTDIMLAKWRRMTVEGPVSLDMFEHISLMTLDTLLKCTFSYD

SDCQEKPSDYIAAIYELSSLMVKREHYLPHHLDFIYNLSSNGRNFRQACKKVHEFTAG

VVQQRQKALKEKGMEEWIKSKQGKTKDFIDILLLSKVEDGNQLSDEDMRAEVDTFMFE

GHDTTASGLSWILYNLARHPEYQEKCRKEIIELLEGKILKHLEWDELSQLPFTTMCIK

ESLRLHPPVTAVSRRCTEDIKLPDGKVIPKGNTCLISIYGTHHNPEIWPNPQVYDPYR

FDPENVQERSSHAFVPFSAGPRNCIGQNFAMAEMKIVLALILYKFHVRLDETKAVRRK

PELILRAENGLWLQVEELKR

 

>CYP4V4

CX972921.1 AL876066.2 CR409635.1 DT527908.1

best hit to CYP4V2 in ESTdb X.tropicalis Xin Liu

best match in human = 4V2 62%, a 4V ortholog
82% to CYP4V4 X. laevis

MELGGEVHLLVWVAAAVVLLTLLALSILPALQDYVRKRRILKPIPGPGPNYPLIGDALFLKN

NGGDFFLQICEYTESYRLQPLLKVWIGTIPFIVVYHADTVEPVLSSSKHMDKAFLYKFLHPW

LGKGLLTSTGEKWRSRRKMITPTFHFAILSEFLEVMNEQSKILVEKLQTHVDGESFDCFM

DVTLCALDIISETAMGRKIQAQSNRDSEYVQAIYKMSDIIQRRQKMPWLWLDFLYAHLRD

GKEHDKNLKILHSFTDKAILERAEELKKMGEQKKEHCDSDPESDKPKKRSAFLDMLLMAT

DDAGNKMSYMDIREEVDTFMFEGHDTTAAALNWSLFLLGSHPEAQRQVHKELDEVFGKSD

RPVTMDDLKKLRYLEAVIKESLRIYPSVPLFGRTVTEDCSIRGFHVPKGVN

VVIIPYALHRDPEYFPEPEEFRPERFFPENASGRNPYAYIPFSAGLRNCIGQRFALMEEK

VVLSSILRNYWVEASQKREELCLLGELILRPQDGMWIKLKNRETAPTA*

 

>CYP4V4 X. laevis NM_001172180

MELKGDVNVLLWTAVIVVLLTLLVFSALPVLLDYVRKCKVMRLI

PGPGPNYPLVGDALLLKSDAREFFLQMCEFAEDFRSEPLLKLWIGPIPFLIVYHADTL

EPFLSTSKHVDKAYLYKFLHPWLGKGLLTSTGEKWRIRRKMITPTFHFAILSEFLEVM

NEQSNVLVEKLQKHADGESFDCFIDVTLCVLDIISETAMGRKIEAQSNKDSEYVQAIY

KMADFIQNRQTKPWLWSDSLYAYLKEGKEHNKTLNILHTFTDKAILERAEELKKMEVK

KGDSDPESEKPKKRSAFLDMLLMATDDAGNKMSYKDIREEVDTFMFEGHDTTASALNW

TLFLLGSHPEAQRQVHKELDEVFGKSDRPVTMDDLKKLRYLEAVIKESLRIFPPVPMF

GRTVTEDCTVRGFKVPKGVNIIVITYSLHRDPEYFPEPEEFRPERFFPENASGRNPYA

YIPFSAGLRNCIGQRFALMEEKVVLSSILRKYWVEATQKRDECLLVGELILRPQDGMW

IKLKNRETASSA

 

>CYP5A1 CX843268.1 CX920105.1 CX846214.1 54% to CYP5A1 human, Ramy Naguib Attia

missing last exon in seq gap, not in ESTdb or UCSC genome browser

Trace archive 414884422 418775930

scaffold_1778:46661-92162

MGESWLWGLDGCTVTLTLVAGFLGLLYWYSVSAFWQLEKAGIKHPKPLPFIGNI

MLFQKGFWEGDRHLLKTYGPICGYYMGRRPMIVIAEPDAIKQVLQKDFVNFTNRMRLNLV

TKPMSDSLLCLRDDKWKRVRSVLTPSFSAARMKEMCPLINQCCDVLVENLMEYASSGEAC

NVQRCYACFTMDVVASVAFGTQVDSQRDSDHPLVQNCKRFLELFTPFKPVVLLCLAFPSI

MIPIARRLPNKHRDRINSFFLKVIRDIIAFRENQPPNERRRDFLQLMLDAR

DSAGHVSVDHFDIVNQADLSVPQNQDRGQDPPRKSTQKTLNEEEILGQAFIFLIAGYETT

CSLLSFASYLLATHPDCQEKLLKEVDEFSQEHEEADYNTVHDLPYMEMVINETLRMYPPA

YRFAREAARDCTVMGLGIPAGAVVEIPIGCLQNDPRFWHEPEKFNPER (2)

FTAEEKQKRHPFLFLPFGAGPRSCIGMRLALLEAKITLYRVLRKFRFQTCDLTQ (0)

(MISSING last exon)

 

>BC060001.1 Xenopus laevis CYP5A1 for comparison, 92% to X. tropicalis

MEEPTLWGLDGCTVTFALVAGFLGLLYWYSVSAFSQLDKVGIKH

PKPLPFIGNVMLFKKGFWEGDRHLIKTYGPICGYYMGRRPMIVIAEPDAIKQVLQKDF

VNFTNRMKLNLVTKPMSDSLLCLRDDKWKRVRSVMTPSFSAIRMKEMCPLINQCCDVL

VDNLLEYASSGEACNVQRCYACYTMDVVASVAFGTQVDSQRDPDHPLVQNCKRFLELF

TPFKPLILLCLAFPSIMIPIARRLPNKQRDRINSFFLKVIRDIIAFRENQPPNERRRD

FLQLMLDAQDSVSHVTVDHFDIVNQADLSVPQNSPSEKQDRGQDPPRKSSKKLNKEEI

LGQAFIFLIAGYETTCSLLSFTSYLLATHPDCQEKLLKEVDEFSQEHKEADYNTVHDL

PYMDMVINETLRMYPPAYRFAREAARDCTVMGQNIPAGAVVEIPIGCLQNDPRFWHEP

EKFNPERFTAEEKQKRHPFLFLPFGAGPRSCIGMRLALLEAKITLYRVLQKFRFQTCD

LTQ IPLQLSAMSTLRPKDGVYVTVVAR*

 

>CYP7A1

5102_prot 64% to human 7A1 scaffold_8:3335708-3339166 UCSC browser

MLTVSLIWGLVVALCCFFWLIVGIRRRQPGEPPLENGLIPYLGCALQFGA

NPLEFLRVRQNKFGNVFTCKIAGQFVHFVTDPFSFNSVMRHGRHFDWQKF

HFATSAKAFGHSNIDSSDSEVTQNVHDSFLKTLQGDALDPLISNMMENLQ

HTMLQNSSYKVNSKDWVTEGLYAFCYRVMFEAGYLTLFGKEFNSPEDKNL

ARQEAQRALILNAIENFKEFDKIFPALVAGLPIHVFKSAYSARENLAKDL

LHENLRKRNNISELISLRMFLNESMTSLNDMEKAKTHLALLWASQANTLP

ATFWSVFYLLRCPHAMKASTEEVQRVLEKASQKVNCDGRYIFLNRHELDD

MPVLDSIIKEAMRLSSASLNIRVAKENFVLHIDDKQAFNIRKDDIVALYP

QMVHLNPDIYEDPNNFKYDRYLGEDGKEKTSFFLNGRKLKYYYMPFGSGK

TKCPGRQFAVHEIKQMLTLIICYFDMELVDKNIRSPPLDQSRAGLGILQP

THDVDFRYKLKAH

 

>CYP7B1

CX908537.1 CX805060.1 CX814354.1 BX713865.1 CN080250.1

52% to 7B1 Y. Peng

MLDTLLYTVTGLVLGGLLLLLLLPRRQ

RREGEPPLENGWIPFIGLAYEFHKNALEFLISRQQKYGDIFTVHVAGKYITFIMDSTQFQ

YVIKHGKQLDFHEFANSLSSRTFDHPRLTEAKFPHLNDKLHRIYKIMQGRALDKLTDSMM

GNLQRVFKWKFSQATDWKAEKMYQFCCCIMFEASFMTLYGRDPIADGHKVISEIREK

FTKFDAKFPYLVINIPIALLGATKKIREELIHFFFPNKMEKRSEISEVVQERKNVLEQYE
LQDYDRAAHHFAFLWASVGNTIPATFWAMYYLVRHPEALAAVRDEIDHLLQSTGQKKGP
EYDIHITREQLDSMVLLGSAIKESFRLCAASMNIRLVQEDFDLELEGNQTIRLRKDDFIA
LYPPALHMDPEIYEDPERYKYDRFVENGKEKILFYKKGKKLKEYLMPFGSGTSKCPGRFF

AMNEIKQFLAVLLIYVEMELVEHKALGHDNRRSGLGILLPNSDIMFRFKPRTLDL*

 

>CYP8A1

DT406915.1 DN063760.1 best hit to CYP8A1 in ESTdb X.tropicalis H.Penmatsa

best match in human = 8A1 55%, an 8A1 ortholog
cannot extend in ESTdb

29605_prot model missing internal exon(s) UCSC browser

MVWAGVFSLLLLILCIGFCYYRFLHRTR (2)

QPNEPPLDRGSIPWLGYALEFGKDAAKFLSDMKEKHGDIFT (0)

IQVAGKFITVLLDPHSYDAVFWAPSNQLDFGKYARMLMDRMFDVRLPPSGGNEEKTLLAS (2)

HFQGSNLTKLTRSMFHNLSTILLKDRRLPNTEWTDQGLFDFIYGVMLR (2)

AGYLTLFGTESEQYTSTYSPMRDLKHSEDVYKEFRKLDWLLMKAARNTLST (1)

GEKEEASLVKNRLQKLISIKSHKGKCCKSSWFEYYQQHLEEIQATEDMQSRALVLQLWATQ (0)

GNAGPATFWLVLYLLKHPEAMAAVQAEFESIFQRNLQEKRHIEEMNQDLLDKMIIL (1)

DNVLNETLRLTAAPFISREVLTDMTLKLADGHQYQLRRGDRLCLFPFVSPQMDPEVHQQPE (0)

VFQHNRFLNADGTEKTEFYKKGKRLKYYNLPWGAGSNVCVGKKHAVNSIKQ (2)

FVCLLLFYFDFELKTPAEKIPEFNRTRYGFGLLQPEHDILFRYRRKA*

 

>CYP8B1

CX973251.1 best hit to CYP8B1 in ESTdb X.tropicalis M.Puljic

best match in human = 8B1 54%, an 8B1 ortholog
cannot extend in ESTdb
Trace archive 413359888 234313629 248374609 continues on CF343441.1
MALFLPIILALLVSVIGGLYLLGMFRKRRPDEPPLDKGTIPWLGYALDFRKNTSTFLQKMHKK

HGDIFTVQIAGYYFTFVMDPLSFGPIIKESKGNLDFEEFAKDLVLRVFGYQSFTNDHKML

EKSSTKHLMGDGLIVMTQAMMENLQNLMVHNIGSGKGEREWQQDGLFNYSYNIVFRAGYL

ALYGNEPAKNKGSKEKAKEFDRKHSDELFYEFRKYDQLFPRLAYAVLPPKDKIEAERLKR

LFWNMLSVKKTLQKENISGWIGEQHQ

QRAEQGLPEYMQDRFMFLLLWASQGNTGPASFWFLLYLLKHPEALKAVREEVEAVLKETG

QEVKPGGPLINLTRDMLMKTPVMDSAVEETLRLTAAPVLIRAVKQDMKIKMASGKDFSMR

KGDRVALFPYIAVQMDPEIHAEPEKFKYNRFLNEDGTKKTEFFKNGKKVKYYTMPWGAGS

TICPGRFFATNELKQFAFLMLTYFEFELVNPNEEIPSIDPNRWGFGTMQPTRDVQFRYRLRY*

 

>CYP11A1

53% to CYP11A1 human 62% to 11A1 Fugu

CX377330.2 CX940317, Q. Tran, S. Sarva

cannot extend in ESTdb

22200_prot scaffold_62:97483-110117 model short at N-term

prpose a GC boundary at the end exon 1 to preserve length

MLLLRRLPAVPSGLRMISHHSVVGAGPEMGTLSQVD

TPLPYNQMPGNWKRGWLELYRFWRKDGFHNIHYHMMENFQRFGPIYR (2)

EALGIYDSVFIQLPEDAATLFHVEGLH

PERLRVPPWYEYRDYRNRRYGVLLKKGEDWRSHRIALNREVLSMSAMSRF

LPLLDSVGQDFVHRAHIQVERSGRGKWTADLTNELFRFALESVCYVLYGQ

RLGLLQDYIDPESQQFIDSVSLMFNTTAPMLYLPPSLLRKINSSIWKDHV

RAWDAIFTHADRCIQQIYSSLRQQSDSTYSGVLSSLLLQDQMPLEDIKAS

VTELMAGGVDTTSMTLQWAMYELARTPSVQEKLRSEVIAARDASGKDLTA

LLKRIPLVKAALKETLRLHPVAITLQRYTQRDTVIRNYIIPQGTLVQVGL

YAMGRNPDIFALPQRFSPERWLGGGPTHFRGLGFGFGPRQCIGRRIAEIE

MQLFLIHILENFKIEINRMVDVGTTFNLILFPSKPIHLTLRPLK*

 

>CYP11B1 54949_prot X. tropicalis predicted protein from UCSC browser

scaffold_1888:38981-41244

trace archive 483095886 413360250 242989364 mate = 242988788

584719101 584719005 234592190

50% to 11B2 human 49% to 11B1

scaffold_8238:179-3044 UCSC browser

387238891 419638572 mate = 419631756

93% to X. laevis CYP11B1, 76% to CYP11B2 Rana catesbeiana D10984

MMAALVCGGTCSWDTVRGLRTKSTHFSTVQLAQDSQSLTSAKAQS

LPFKSIPCTGRNAWANLARYWKNNSFQQLHLVMEGHFQNLGPIYR (2)

ETLGTHSSVNIIHPQDVARLFQSEGVFPRRMGIEAWAAHRDLRNHKCGVFL (2)

LNGEDWRSDRLILNKEVLSLTGVKKFLPFLDEVANDFVSFLMRRINKNTRGTLTVDLYADLFRFTME (1)

ASGYVLYGQRLGLLEEHPNEDSLRFIRAVETMIKTTLPLVYLPHQLLRLTDSALWTQHMEAWDVIFQQ (1)

ADRCIQNIYQEFCLGQERGYSGIMAELLLQGELPLDSITANVTELMAGGVDT (0)

TAMPLLFTLFELARNPSVQQELRAEIKRAEGQCPKDMNQLLNSMPLLKGAIKETLR (2)

LYPVGITVQRYPMKDIVLQNYHIPAG (0)

TLVQVGLYPMGRSSELFQNPLRYDPTRWMRRDETNFKALAFGFGSRQCIGRRIAETEMMLFLMH (0)

VSIMNTDIKAQTYSGH*

 

>CYP11B1 AF449175.1 Xenopus laevis steroid 11-beta-hydroxylase protein (CYP11B1)

FAFGPIYRENLGTHSSVNIIHPHDVARLFQSEGIFPRRMGIGVWAAHRDLRNHKCGVFL

LNGEEWRSDWLILNKEVLSLAGVKKFLPFLDEVANDFVSFLMRRINKNTRGTLTVDLYADLFRFTME

ASGYVLYGLRLGLLEEHPNEDSLRFIRAVETMIKTTLPLLYLPHQLLRLMDSSLWIQHMEAWDIIFQQ

TDRCIQNIYQEFCLGQERGYSGIMAELLLQGELPLDSIKANVTELMAGGVDT

TAMPLLFTLFELARNPITS

 

>CYP11B2 Rana catesbeiana D10984

MLEKTAARQIGSCLMRCRTLDTTSPLWTGFSRLSTAPLIHEARE

DGSLASQTLPYEAIPTTGRSAWFNLFQFWRKNSFQHMHLAMEENFQNLGPIYREKLGT

HNSVNIMLPQDVARLFQSEGIFPRRMTMEAWSKHRELRNHKQGVFLLNGEAWRSDRII

LNKEVLSLAGVKKFLPFLDEAAADFVTFMKKRMSKNTRGSLTVDLYADLFRFTLEASS

YVLYGQRLGLLEEHPNADTLRFISAVETVLKTTLPLLYYPHQILQLFQTRLWNEHMHA

WDVIFEQADRCIQNIYQEYCLGQERGYSGIMAELLLQAELPLDSIKANITELMAGGVD

TTAMPLLFTLFELARNPSVQRELREEIRKAEAQNPNDLNQLLNSLPLLKGAIKETLRL

YPVGITVQRHLIKDIVLHNYHIPAGTLVQVGLYPMGRSPLLFQDALRYDPARWLKRED

TNFKALAFGFGSRQCIGRRIAETEITLFLMHMLKNFQIDTVSKDDIKTVFGFILMPEK

PPLLTFRPI

 

>CYP17

CX931022 DR883840.1 CX957932.1 50% to CYP17A1 human, Guo Zhu

MISYVAAAVLLAFGLALLSIWKFAGGKPRGAKYPNSLPCLPFIGSLLHLASHLAPHI

LFNKLQEKYGSLYSFKMGSHYIVIVNHHEHAKEVLLKKGKTFGGRPRAVTTDLLTRNAKD

IAFADYSPTWKFHRKLVHAALSMFGEGTVAIEKIISREAASLCQTLITFQGSPLDMAPEL

TRAVTNVVCALCFNARY

KRCDPEFEEMLAYSKGIVDTVAKDSLVDIFPWLQIFPNKDLEILKRSVAIRDKLLQKKLK

EHKEAFCGEEVNDLLDALLKAKLSMENNNSNISQEVGLTDDHLLMTVGDIFGAGVETTTT

VLKWAVAYLLHYPKVQAKIQEELDVKVGFGRHPVLSDRRILPYLDATISEVLRIRPVAPL

LIPHVALHESSIGEYTIPQDARVVINLWSLHHDPNEWXNPEEFIPDRFLDENGNHLYTPS

QSYLPFGAGIRVCLGEALAKMEIFLFLSWILQRFTLEVPAGDSLPDLDGKFGVVLQVKKFRVT

AKLREVWKNIDLTT*

 

>CYP19

CX885719.1 CX885718.2 DN051995.1

best hit to CYP19 in ESTdb X.tropicalis Z.Zhang

best match in human = CYP19 71%, CYP19 ortholog

5697_prot from UCSC browser scaffold_27:1527865-1546466

MEALNPVQYNSTEAVPTLAPATTVSLLLFIFLLIILWNQEETCLIPGPAYCMGLGP

LISYGRFLLTGIGKAANYYNNMYGEFVRVWINGEETLVISKASATFHIMKHSHYISRFGS

KLGLQCIGMNENGIIFNSNPSLWKVIRPFFIKALSGPGLMQTTEICIRSTKRYLDNLGNV

TNELGNVDVLKLMRLIMLDTSNNLFLRIPLD

ENEIVLKIQKYFDAWQALLLKPDIFFKISWLYKKYEKSANDLK

EAIEILIEQKRQKLSSSEKLDENMDFASELIFAQNHGDLTAENVNQCILE

MLIAAPDTMSVSLFFMLVLVAQHPKIEEGIMNEIDNVIGDRDVESNDIPN

LKVLENFIYESMRYQPVVDLVMRKALEDDMIDGYYVKKGTNIILNLGRMH

RIEYFPKPNEFTLENFEKTVPYRYFQPFGSGPRAC

AGKYIAMVMMKVILVTLFKRYKVQTLGGRCLENIQNNNDLSMHPDESQPCLEMIFIPKNTAELKQ*

 

>CYP20

DR851274.1 CX431022.2 CF240500.1 DT417160.1

best hit to CYP20 in ESTdb X.tropicalis Z.Zhang

best match in human = CYP20 72%, CYP20 ortholog
MLDFAIFAIT

FLLILVGAVLYLYPSSRQACGIPGLAPTEEKDGNLQDIVNSGSLHEFLVNLHERFGPVAS

FWFGRRLVVSLGSLDLLKQHINPNKTSDPFQMMLKSLLGYQSGVIGEAAESHVQKKLFEN

GIIKALHSNFSVVIKLSEELLAKWLTYPQSQHVPLCQHMLGFAMKSVTQTAMGSSFDDDQ

EVIHFRRNHDAIWSEIGKGFLDGSIERSPNRKKLYEDALMEMETVLKKAIKERKVKNPGR

HVFVDSLLQGNLSDKQVLEDSMIFSLAGCVITANLCTWAIYFLT

TSEEVQDKLFKEVTRVIGKGPITMDKLEQLSYCRQILCETVR

TASLTPISARLQELEGRVDQHIIPKETLVLYALGVVLQDNTAWPLAYRFDPDRFNDETAK

QSLTLLGFSGSQECPELRFAYMVAMVLLSVLVRKLHLLPVKGQVMETKYELVTSPKEEAW

ITVSKRS*

 

>CYP21 41% to human CYP21A2, 45% to Fugu CYP21, 46% to zebrafish CYP21

50686_prot scaffold_1026:150552-153289

50687_prot

MALLLLLLLFLVLLSLQWAKKYFLGFSNPHVHYPPCPPPLPFLGNLLHLA

HKDLPIHLLHLSRKYGSIYRLSFWGKDFVVLNNSNLIREALLKKWADFAG

RPKSYIGDLISLGGKDLSLGDYTPVWKVQRRLTHTSLQNCVRNDLENVLI

REARLLCQDCLNLNGEPVDISRSFSLRTCRIIAELTFGTTYDLSDPKFQE

IHKCIVNIIKLWESPSVTALDFIPFLQ (0)

KFPNQTLKLLMDTAKQRDSFIKSQVEAHKAHLPSSKCDEDILDGMMRFLL

EKSGDDSSGMSEFSEDHLHMAVVDLFIGGTETTASLLTWTVAYLMHYPEA

QDKIHQEIIGAVGMERYATYTDRNSLPYLNATVSEMLRLRPVVPLAVPHC

TIRDTSIAGYTIPKGTTVIPNIYAAHLDETIWDNPTQFYPENSHSSRALL

PFSVGARLCIGETLARMEVFFFLSHLLRDFRLLPPSPELLPELSGVFGIN

FKCRPFLVCISPRENTPKIQDLNNKT*

 

>CYP24A1

DT404490  67% to CYP24A1 human, Guo Zhu

Cannot extend in ESTdb

26514_prot scaffold_125:1595529-1618234 UCSC browser (errors in model)

MTSRIKRDFLGMLLKSRSISVQHSIPTATAVCDLKEKELPAPSSCPHSLA

ALPGPTKLPILGSLLDILRKGGLKRQHEALASYHKQFGKIFRMKLGSFDS

VHIGAPCLLEALYREESNYPKRLEIKPWKAYRDYRDEAYGLLILEGKDWQ

RVRSAFQQKLMKPTEVGKLDTKINEVLVDFMKRIDSVCDEDGT

IEDLYCELNKWSLESICLVLYEKRFGFLQPNLGEEAQNFITAIKM

MMSTFGLMMVTPVELHKSLNTKIWK

DHTHAWDSIFKTAKCHIDRRLTKLSSKGSEDFLCTIYNDSKLSKKEMYAT

ITEMLIGAVETTANSLLWAIFNISRNPHIQKKLLEEIESVLLPDQVPTAD

DIRNMPYLKACLKESMRITPSIPFTTRTLDKETVLGDYVLPKGTVLTINS

HVLGSNQECFDNWNQFRPERWLQQKNTINPFAHVPFGIGKRMCIGRRLAE

LQLQLTLCW (0)

LIRKYEIVATDNDPVETLHLGTLMPSRELPVAFHRR*

 

>CYP26A1

NM_001016147.2 (seq gap) CX456558.2 CX423895.2 CX424757.1

69% to human CYP26A1, L. Zhu

MDLYTLLTSALCTLALPVLLLLTAAKLWEVYCLSRKDASCRNPL

PPGTMGLPFFGETLQMVLQRRKFLQVKRRKYGRIYKTHLFGSPTVRVTGAENVRQILL

GEHKLVSVHWPASVRTILGAGCLSNLHDSEHKYTKKVIMQAFSREALANYVPLMEEEL

RRSVNLWLQSDSCVLVYPAIKRLMFRIAMRLLLGCDPQRLGREQEETLLEAFEEMTRN

LFSLPIDVPFSGLYRGLRARNIIHAQIEENIKEKLQREPDGQCRDALQLLIDHSRRTG

EPVNLQALKESATELLFGGHGTTASAATSLTTFLALHKDVLEK

VRKELESQGLLSNKPEEKKELSIEVLQQLKYTSCV

IKETLRLSPPVAGGFRVALKTFVLNGYQIPKGWNVIYSIADTHGEAELFPDKDE

FNPDRFLTPLPGDSSRFGFIPFGGGVRCCVGKEFAKILL

KVFIVELCRNCDWELLNGSPAMKTSPIICPVDNLPAKFKPFASSI

 

>CYP26B1

CX905408.1 CX388776.2 CX940676.2 82% to human 26B1 L. Chen

MIFQSFDLVSALATLAACLVSVALLLAVSQQLWQ

LRWAATRDKSCKLPIPKGSMGFPLVGETFHWILQGSDFQSSRREKYGNVFKTHLLGRPLI

RVTGAENVRKILMGEHHLVSTEWPRSTRMLLGPNSLANSIGDIHRHKRKVFSKIFSHEAL

ESYLPKIQLVIQDTLRVWSSNPESINVYCEAQKLTFRMAIRVLLGFR

LSDEELSQLFQVFQQFVENVFSLPVDVPFSGYRRGIRAREMLLKSLEKAIQEKLQNTQGK
DYADALDILIESGKEHGKELTMQELKDGTLELIFAAYATTASASTSLIMQLLKHPSVLEK
LREELRGNSILHNGCVCEGALRVETISSLHYLDCVIKEILRLFSPVSGGYRTVLQTFELD
GFQIPKGWSVLYSIRDTHDTAPVFKDVDVFDPDRFGQDRTEDKDGRFHYLPFGGGVRNCL
GKHLAKLFLKVLAIELASMSRFEL

ATRTFPKIMPVPVVHPADELKVRFFGLDSNQNEIMTETEAMLGATV*

 

>CYP26C1

CX830022.1 CN120927.1 CR567555.1 CX376643.2 CR567556.1

65% to human 26C1 L. Chen

note this seq has in insertion compared to human, but

the insertion is supported by several ESTs and is real

also seen in X. laevis (see below)

MFLLEISYTSFFEAALTSALSLVLLLAASHQLWS

LRWHSTRDRGSSLPLPKGSMGWPFFGETLHWLVQGSSFHSSRREKYGNIFKTHLLGKPVI
RVTGAENIRKILLGEHHLVSTQWPQSTQIILGSNTLSNSIGELHRQKRKMMSKVLSSAAL
ESYLPRIHEAVRWEVRSWCRGVGPVSMLSCAKALTFRIAARILLGLSLTDTQFQELTRTF
EQLVENLFCLPLDIPFSGLRKGMKARDTLHQYMEEAIKEKLSKRDPDACEDALDYLINSA

KEGGKEINMQELKESAIELIFAAFLTTASASTSLVLLLLKHPSAIHKIRQELASHGL

SEHCEQCLPATENPNNNILQDNGHQCLTAGCQLPLVMGTEGQVKTLWEQTKQLLTDRTDK

DPQNSLSSKNLVNGENRIQEAPCSHDKSNCSPVPGKLQNSVFEGT

CQQNISLEKLKSLHYLDC

VVKEVLRLLPPVSGGYRTALQTFELDGYQIPKGWSVMYSIRDTHETAAVYQNAEMFDPER

FSTERDEGKLGRFNYIPFGGGARSCIGKELAQIILKILAMELVTTAKWELATPSFPKM

QTVPVVHPVDGLQLSFSFLGSNDSDKAARNRSLANP*

 

>CYP26C1 BC111476 Xenopus laevis cDNA

MFLLEISYTSFFEATLTSVLSLVLLLAASHQLWSLRWHSTRDRG

STLPLPKGSMGWPFFGETLHWLVQGSSFHSSRREKYGNVFKTHLLGKPVIRVTGAENI

RKILLGEHSLVSTQWPQSTQMILGSNTLSNSIGELHRQKRKVMSKVLSSAALECYFPR

IQEAVRWEVRGWCRGVGPVSMFACAKALTFRIASRILLGLSLTDSQFHELARTFEQLV

ENLFSLPLDIPFSGLRKGIKARDTLHQYMEEAIKEKLTRRDPDACEDALDYLINSAKE

GGKEINMQELKESAIELLFAAFLTTASASTSLVLLLLKHPSAILKMRQELASHGFSKQ

CQCLPDMENPNNNILQDNGHRCLTAGCQLPLLMGTEGHLKTQGEQTEQLLTDKTDPQN

SLSSKNPLKGKNRIQEAPCSHDKSTCTPVPGKLQSPVSEGT SQQNSNLEKIKSLHYLE

CVVKEVLRLLPPVSGGYRTALQTFELDGYQIPKGWSVMYSIRDTHETAAVYQNAEMFD

PERFSSERDEGKLGKFNYIPFGGGVRSCIGKELAKVILKILAMELVTTAKWELATPSF

PKMQTVPVVHPVDGLQLSFSFLSSSDRDRAARNGSLA

 

>CYP27A8    Xenopus tropicalis (frog)

           DR832386.1 CX969640.1 DR852196.1

           old CYP27A1 Xenopus

           best X.tropicalis hit to CYP27A1 hum in ESTdb

           best match in human = CYP27A1 55%,

           probably a CYP27A1 ortholog

           scaffold_77:1626758-1638467 (-) complete in UCSC browser

           Trace archive 570051728(+), walked to 411568263(+) 494948503(+)

           54% to 27A7 zebrafish, 50% to 27A3 zebrafish, 50% to 27A1 human

           this seq is near BCS1L and ZNF142 like human CYP27A1

           scaffold 77 1626758-1638467 (-) strand UCSC Browser

MPSASKLGFLPLGRCRWLLHTGRGVSVSQGRAVAGAAVGAVGEEKKMKTF

EDLPGPSLLTNIYWVFLRGYILYTHELQAIYKKNYGPMWKST

LGRYKTVNIADVDILETVLRQEGKYPMRSDMEVWKEHRRQRDLSLGPFTEEGHKWHTLRS

VLNKRMLKPAEAMLYTGVVNEVVTDFLVRLEEMRSETPSGDMVNDIPNALYRFAFEGISY

ILFETRIGCLEKQIPVETQRFIDSIGAMLKNSIFVTIFPPWTNNLLPYYKRYMDSWDNIF

AFGNKLINEKMKKIEARLERDEEVQGEYLTYLISSGKLTDKEIYGSVAELLLAGVDTTSN

TLSWALYHLAREPEIQNALYQEVIGVVPGQNIPTSEDISSMPLLRAVIKETLR

LYPVVPTNSRVAVEKAITIGDYYFPKD

TLIALHHYHISRDEKNFPESDKFIPQRWFRESRVKNNPFSSIPFGYGVRACVGRRI AELEMHMCLSR ()

IIKKYEVRPDPSGAEIKSMARIVLTPHKPINLRFLPR

 

>CYP27A9

AL787054.2 DT421274.1 CR427561.1 Quynh Tran

50% to 27A1 human, 42% to 27B1 human and 38% to 27C1 human

Also BC094536.1

scaffold 77 1590575-1596036 (-) strand (not including the first exon)

MRKGCHALLWKTCWANVQTGRE

KATLGVAGAVAEQEKKLKMSTDLPGPSTLNILYWVFLRGYVFESHKLQVIWKKRYGPLW

KTCIGSHRLVNVASPELLETLLRQEGKYPMRTDMFMWKEHRDLQDFSYGPLTEEGHRWHT

LRRVLNQRMLKPKEAVRYTESFNDVVTDLLVVIKEITAQSPNRTTVDGVANLMYKFAFES

ICTVLFETRIGCLKKEIPPETEKFINSIAIMLENQTRMEKLPRWTRGIFPYWRRFVEGWD

NIFIYGKKLIDKKMEEIEGRLKRGEEVEGEYLTYLLSSGKLSMEEICGSVAELLQAGVDTTSNT

LTWALYQLARNPEIQHNLHQEVIGVTPGDTIPDSEAIARMPLLRAVIKETLRLYPVVPEN

GRVVTEKDVILNDYIIPKNSQFVLCHYALSRDETQFPEPDRFLPERWLR

DSGMKHHPFSSIPFGYGVRACAGRRIAELEMHLALSRIIKMFQVVPDPELGEVGTKNRTV

LVSSRPINLQFIER*

 

>CYP27A10

CX393015 DR862140.1 DN030991.1 49% to 27A1 human

scaffold_31:1,728,368-1,736,213 19854_prot UCSC browser

scaffold 77 1580461-1588306 (-) strand

MIAQRLQTGA

QALLQQSCRASVQTVRKKATLGVSGATVVEGKTLKTLDDLPGPSPLKLLYWIFLRGYLFR

THELQVIFRKTYGPMWKMSDRQHAMVTVASPDLLESLLRKEGKYPTRADMFIMREHRDLR

GHSYGPVTEEGHQWHRIRTILNQRMLKPRETVVYAGSMNEVVSDLLLKIKELTAQSSSGT

QVNGVAELMYKFAFESICTVLFETRLGCLNKEILPETQKFIDSIGIMLEHLTMLTRLPQW

TKGILPYWGRYIEAWDTIFDFGKKLIDKKMEDIEGRLKRGEEVEGEYLTYLLSSGKLSME

EVYGSVVELLQAGVDTTSN

TLTWALYQLSRNPEIQNNLYQEVIRVIPGETIPDSEAIARMPLLKAVIKETLRL

FPVVPENARMINEKEVTIKDYVFPVKTQFILGHYAISRDETTFPEADRF

LPERWLRDSGMKHHPFGSIPFGYGVRACVGRRIAELEMHLALSRIIKMFQVIPDPDLGEV

GAKNRAVLVANRPVNLRFIERQPRPE*

 

>CYP27A12 UniProt B1H1B1 66% TO CYP27A8

scaffold 77 1642228-1648152 (-) strand

MGSRGSLLLQAGRV

AVRQTRAAAGGPSRLGCLPQGRGCGLVQAGRGASVSQGRAVTGAAVGATEGRKEMKEFE

DLPGPSLLKNLYYYFLRGYLLHTHELQLIYKKMYGPLWRSEIGKYKMVNIADPEVLQRL

VRQEGKYPMRNKEDVWKAHRDKRKLAYGPFTEEGHQWYQIRSALNKKMLKPSEAASYAG

GINEVVTDFMDRLQDMRKASPSGDMVNDLANALYRFAFEGISNIVFETRIGCLDKQIPP

ETQKFIDSIGYMFKNSVYVTFLPHWTRGILPYWDRYIEGWDNIFDFGKHLIDKKMSEIQ

SRLDKGEEVEGEYLTYLLSSANLTMGEVYGSVCELLLAGVDTTSNTLCWAMYHLARDPE

LQQAVYEEVSSAAPMDRIPVAEDIPNMPLLRGVIKETLRLYPVIPTNARIVSEKEVEIG

EYRFPKNTLFVLSHYAIARDEENFEDPLKFKPQRWLRDGGMKHHPFSSIPFGYGVRACL

GKRIAELEMHLALSRVIRMFELRWDPKGEDIKSIARIVLSPSKPVNLQFLERKTHQE*

 

>CYP27B1

NM_001006906.1 CYP27B1 54% to human

MAQTLKLGSSRSSQLFRGLQELWAETVLKNSEKVIKGHKSLADM

PGPSTVSFISDLFCRRGLARLHELQLEGKAKFGPVWKASFGPILTVHVAEPSLIEQVL

RQEGKHPIRSDLSSWKDYRQCRGHSYGLLTAEGEEWQQFRSILGKHMLKPKEVEAYSD

VLNDVVGDLIKKINYQRSQNQNNVVKDIAKEFYMFGLEGISSVLFESRIGCLEPTVPK

ETEKFIQSINTMFVMTLLTMAMPKFLHKIFRKPWQKFCESWDYMFAFAKGHIDKRMKD

VAQKLAQGEKVEGKYLTYYLAQEKIPMKSIYGNVTELLLAGVDTISSTLSWSLYELAQ

HPDIQSAVYSEVEEILQGKQIPSPSDVARMPLLKAVVKEVLRLYPVIPGNARVVADRD

IQVGDYIIPKKTLITLCHYATSRDENVFSNPNEFQPDRWLKKEDTHHPYASLPFGFGK

RSCIGRRIAELEVYLALARILSHFEVKPEQPGSLVMPMTRTLLVPEKEINLQFLER

 

>CYP27C1

NM_001011341.1 short at N-term (58 aa) CX494774.2 68% to human

from refseq database

MAALGQLLRGSARLEGLARSFHRFPGAQAAGQALEHEQAEGVLGATVKGSPMVKNLKE

MPGPSTMANLVEFFWRDGFGRIQEIQQKHARQYGRIFKSHFGPQ

FVVSIADKDMVAQVLRAERDAPQRANMESWHEYRELRGRSTGLISAEGEKWLNMRSVL

RQKILRPRDVAMYSGGVNEVVEDLVKRIRKLRVQESDGLTVTNVNDLYFKYSMEAIAT

ILYECRLGCLDDQIPQQTKEYIEALELMFSMFKTTMYAGAIPKWLRPLIPKPWREFCR

SWDGLFKFSQIHVDDRLRQIESQLEKGEEVQGGVLTHLLLSKELDLEEIYANMTEMLL

AGVDTTSFTLSWATYLLAKNPGIQEAVYQQIVQNFGKDQVPTAEDVPKMPLVRAVVKE

TLRLFPVLPGNGRVTQDDLVVGGYFIPKGTQLALCHYSTSYDAECFPAAEEFRPERWI

RSGNLERKENFGSIPFGYGIRSCIGRRVAELEMHLLLIQLLQNFEIKPSPQTTTVLPK

THGLLCPGGKINVRFVDRQ

 

>CYP39A1

CX851900.1 CX931743.2 CX956889.1

best hit to CYP39 in ESTdb X.tropicalis N.Liao

best match in human = CYP39 51%, probably a CYP39 ortholog

MDPIASVSSALLSPTAALGLLVALLTAVLVRYLLPNG

SQKPPYPPCIRGWIPWFGAAFDMGKAPLEFIARAREKHGPIFTVLAAGNRLTFLSGKEGI

SAFFSSKEADFQQAVQKPVQHTASINKEDFLKSHSSIHETIKLRLSQNRLHLYFDRIRNEFSTRIE

LLNPEGTEDLFALVKKVMYPAVADTLFGKGLCPTGKGKLEEFAEHFWKFDEGFEYGSQLP

EFLLRDWSQSKQWLLRLFKKIVIEAEMNNPLEETSKTLHQHLLDTLKGNSTYNNSLLLLW

ASQANANPVTFWTLGFIISDPLVYKAAMDEIHSVFGKAGNKELNMNEAELKRLPFIKTCV

LEAIRLRSPGAITRKAVQPLKINNYLVPAGDLLMLSPYWLHRDPTLFPEPEMFR

PERWSKANLEKNVFLEGFVAFGGGKYQCPGRWFALMEMHMLVVMMLYKYEFSLLDPLPKQ

SNLHLVGTQQPDGPCRVRYKLRK*

 

>CYP46A4 6

NM_001032348.1 CYP46 again 53% to human CYP46

from refseq database, note: this frog has two CYP46 genes

zebrafish also has 2 CYP46 genes

scaffold 519 627623-643634 (+) strand

82% to CYP46A1, 79% to CYP46A7

MGLWALFGWASLLLLALTLICFLLFCGYIQYIHMKYDHIPGPPRD

GFIFGHSPTILRLMKNNKVVYDQYLDWVQ

YGPVVRINALHRVIVLITSPEGVK

EFLMSPKYSKNDIYDRVATLYGM

RFMGKGLVTDKDHDHWYKQRRIMDPAFSR

TYLMDLMGPFNEKAEELMERLSEQADGKSDTEMHNLFSRVTLDVIAK

VAFGMELNSLKDDLTPLPQAISLVMNGI

VETRNPMIKYSLAKRGFIRKVQESIRLLR QTGKECIERRQKQIQDGEEIP

MDILTQILKGAALEEDCDPETLLDNFVTFFIAGQETTANQLSFAVMELGRNPEILQKA

QKEIDEVIGSRRFIEHEDLSKLHYLSQVLKETLRLYPTAPGTSRGLKEEIVIEGVRIP

PNVNVMFNSYIMGRMEQNYTDPLTFNPDRFSPGAPKPYYTYFPFSLGPRSCIGQVFSQ

MEAKVVMAKLLQRYDFELAEGQSFSIFDTGSLRPLDGVICRLRPRTSNTATTNKYIF

 

>CYP46A5 7 CX981536.1 CX970619.1 CX970620.1 CX370643.2
S. Aggarwal 87% to 46A1 Xenopus trop. and 84% to 46A4
54% to 46A1 human
old scaffold_588:627624-672691
scaffold 519 646604 672690 (+) strand
MGLWAILGWAALLLLALILICFLLYCGYIHYIHMKYDHIPGPPRDR (2)
SFIFGHSTALLKLVNENLLMYDYFLDW (2)
VHKYGPVMRINGLHKVAVLVASPEGIK (0)
EFLMSPKYLKDEFYDFFGSLFGER (2)
LMGKGLLTDRDYDHWHKQRRIMDPAFSRT (2)
YLMGLMGPFNEKAEELMEKLSENSDRKCEVNMHDMFSKVTLDVIGK (0)

VGFGMELNSLNDDQTPFPRAISLVMKGSVEIRNPMIK (0)

YSLAKRGLIRKVQESIRLLRQTGKECIERRQKQIQDGEEIPVDILTQILRGA (1)

ALEKDCDPETLLDNFVTFFIA (1)
GQETTANQLSFAVMSLGRNPEILKK (2)
AQAEIDEVIGSKRDIEYEDLGKLSYLSQ (0)
VLKETLRLYPTAPGTSRTLENEIVIDEVRIPGNVTLM (0)
LNSYVMGRMEQYYKDPLMFNPDRFSPDAPK (2)
PYFTYFPFSLGPRNCIGQVFSQ (0)
MEAKVVMAKFLQRYEFELAEGQSFKILDTGTLRPLDGVICRLRSRTNNKKANK*

 

>CYP46A8

NM_001032346 CYP46 ortholog 54% to human CYP46, 82% to NM_001032348

from refseq database, note: this frog has two CYP46 genes

scaffold 519 676371-696647 (+) strand

MGLWALIGWAALLLLALILICFLLFSGYIHYIHMKYDHIPGPPR

DSFFLGHSPTMLRLMKNNLLMYDHFLGWVQKYGPVVRINGLHRVIILVVSPEAVKELL

MSPKYSKDKFYDVIANMFGVRFMGKGLVTDRDYDHWHKQRRIMDPAFSRTYLMGLMGP

FNEKAEELMEKLMEKADGKCEIKMHDMLSRLTLDVIGKVAFGMELNSLNDDLTPFPKA

ISLVMKGIVEMRNPMVRYSLAKRGFIRKVQESIRLLRQTGKECIERRQKQIQDGEEIP

VDILTQILKGAAMEEECDPEILLDNFVTFFIAGQETTANQLSFVVMELGRNPEILEKA

QAEIDEVIGSKRDIEYEDLGKLQYLSQVLKETLRLYPTAPGTSRGLTEDMVIDGVKVP

ENVTIMLNSYIMGRMEQYYSDPLTFNPDRFSPDAPKPYYSYFPFSLGPRSCIGQVFSQ

MEAKVVMAKLLQRYEFELAEGQSFKILDTGTLRPLDGVICRLRPRTSKKAATLQ

 

>CYP46A9 scaffold_49:1707219-1730127 (+) strand

First part matches

scaffold_49:1707219-1723435 with 7 aa diffs

Then new seq is found below this up to 1730127

58% to CYP46A8, 56% to CYP46A6, 56% to CYP46A7

MWHSVIVHCLSWVYSGFLLIIIGAVVAFLAYCAYIKYMHLKYDDIPGPPRDS (2)

FLLGHIPTLSKAEENYSVVHDLFLHW (2)

AEIYGPVFKINILHRVMIYSTSPESVK (0)

ECLMSSKYPKDPYTYNQLFNLFGKR (2)

FLGKGLLTDPDHDHWYHQRRIMDPAFSNT (2)

YLKEMIGIFNERAEQMMEKLEEKADSHQEVSMHSIINRVTLDVITK (0)

VAFGMDLGLVEGNKTDFPNAISKVLTGMMRYIQNPYMQ (0)

YFPKHWAFVREVQESADLLRKTGKECISQRKKAMQNGEELPKDILTKILQCA (1)

ELENALDDEIMLDNFITFFIA (1)

GQETTANQLSFTVMELTRQPEIMTK (2)

LRMEVDEVIGFKRDISYDDIQNLNYMTQ (0)

VLKESLRFYPPGPGTSRYLKEDTIFEGIKIPGGVSIT (0)

FNTYVMGRMEKFFQDPCKFDPERFHPAAVK (2)

PYFCYFPFALGPRSCLGQIFSQ (0)

LEAKVILSKLIQRFEFELVPGQSFGIKDTGTLRPRDGVVCTLKSRA*

 

>CYP46A10

Downstream

scaffold_49:1780107-1800536 (+) strand

97% to CYP46A9 scaffold_49:1707219-1730127 (+) strand

MWHSVIVHCLSWVYSGFLLIIIGAVVAFLAYCAYIKYMHLKYDDIPGPPRDS (2)

FLLGHIPTLSKAEENYSVVHDLFLHW (2)

AEIYGPVFKVNILHRVMIFSTSPESVK (0)

ECLMSSKYPKDPYTYNQLFNLFGKR (2)

FLGKGLLTDPDHDHWYHQRRIMDPAFSNT (2)

YLKEMIGIFNERAEQMMEKLEEKADSHQEVSMHSIINRVTLDVITK (0)

VAFGMDLGLVEGNKTNFPNAISKVLTGMMQYIRNPYMQ (0)

(missing exon)

ELEKALDDEIMLDNFITFFIA (1)

GQETTANQLSFTVMELTRQPEIITK (2)

LRMEVDEVIGFKRDISYDDIQNLNYMTQ (0)

VLKESLRFYPPGPGTSRYIKEDTIFEGIKIPGGVPIT (0)

FNTYVMGRMEKFFQDPFKFDPERFHPAAVK ()

PYFCYFPFALGPRSCLGQIFSQ (0)

LEAKVILSKLIQRFEFELVPGQSFQIKDTGTLRPRDGVVCTLKSRA*

 

>CYP46A10 B1H1A6 58% TO CYP46A1

4 aa diffs to 46A10

MWHSVIVHCLSWVYSGFLLIIIGAVVAFLAYCAYIKYMHLKYDDIPGPPRDSFLLGHIP

TLSKAEENYSVVHDLFLHWAEIYGPVFKVNILHRVMIFSTSPESVKECLMSSKYPKDPY

TYNQLFNLFGKRFLGKGLLTDPDHDHWYHQRRIMDPAFSNTYLKEMIGIFNERAEQMME

KLEEKADSHQEVSMHSIINRVTLDVITKVAFGMDLGLVEGNKTNFPSAISKVLTGMMQY

IRNPYMQYFPQHWAFVREVQESADLLRKTGKECISQRKKAMQNGEELPKDILTKILQCA

ELENALDDEIMLDNFITFFIA GQETTANQLSFTVMELTRQPEIITK LRMEVDEVIGFKR

DISYDDIQNLNYMTQVLKESLRFYPPGPGTSRYIKEDTIFEGIKIPGGVPITFNTYVMG

RMEKFFQDPFKFDPERFHPAAVKPYFCYFPFALGPRSCLGQIFSQLEAKVILSKLIQRF

EFELVPGQSFEIKDTGTLRPRDGVVCTLKSRA

 

>CYP51A1

NM_001016194.2 80% to CYP51 human, CYP51 ortholog L.Zhu

MLLSLWEAGGTLLEEAVGGSLASRILIPCTFLLALAYVSKLAFK

HLQAEDPGNVKYPPFISSNIPFLGHAIAFGKSPISFLENAYDKYGPVFSFTMVGKTFT

YLVGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPIFLEQKKMLKTGLN

IAHFKTHVQMIEEETQEYFERWGDSGVRNLFEALSELIILTASRCLHGKEIRSMLNER

VAQLYADLDGGFTHAAWLLPGWLPLPSFRRRDRAHREIKNIFYQVIQKRRNSAEREDD

MLQTLLDATYKDGTPLNDDEIAGMLIGLLLAGQHTSSTTSAWMGFFLAKNKSLQAQCF

AEQKAVCGEDLPPLNYDQLKDLQALDRCIKETLRLRPPIMTMMRMARTPQSVAGYNIP

PGHQVCVSPTVNHRLRDTWDKNTDFNPDRYLHDNPAAGEKFAYVPFGAGRHRCIGENF

AYVQIKTIWSTMLRMYEFELVDGYFPTINYTTMIHTPNNPVIRYKRRKN