>CYPa1x1 = CYP4H19, 514aa AAAB01008846.1 no introns
9851526 MLVVVFLVTLLVLAVLREYRDRKRLQHIASHFQGPKPHWLLGYLPLFPVNDIPGIFETMV 9851347
9851346 KLHDRYGQDLFNWGLLNDHMVVVTSAANVEKVVMAKKTQKSQIYEFIEPWLGQGLLISSG 9851167
9851166 EKWFHRRKIITPTFHFKILESFVTVFNREAELLIEKLGQNADAGREFDIYEPISLYALDS 9850987
9850986 ICETSMGVEINAQHNPENQYVRDVKRMSELVLLRIFHVLSAFPRTFWYTMPNAWEQRKLI 9850807
9850806 GRLHAFTDSVIQSRRRQLLAAVEQGTVGNQETHADDLYGAKQRSSFLDLLLNVTVGGKPL 9850627
9850626 SDADIREEVDTFMFEGHDTTTSGIAFTFYQLAKHPEIQEKLHQELQDVLGVDYRHVPLTY 9850447
9850446 NTLQNFPYLDMVVKESLRLLPPVSFIGRRLVEDIQMNGVTIPAGTDFTIPIYVIHRNPAV 9850267
9850266 FPDPERFDPERFSDANQHPPGPYDYIPFSAGSRNCIGQRYALLEMKVTVIKMLAHFRVLP 9850087
9850086 GEQMPQVRFKTDLVLRPDKGIPIKLVRRKFDSIK* 9849982

>CYPa1x2 = CYP4H24,509aa AAAB01008846.1 no introns
9849469 MSFVLFLLVILIVYGLAQVYRKRRRLHRIAAHFDGAKPHWLLGNVMEYPANDIPGIFE 9849296
9849295 TMVALHKRHGKDLFNWGLLNDHMITVSSAANVEKVVMAKRTEKSSVYEFIELWLGQGLLI 9849116
9849115 SKGEKWFHRRKIITPTFHFKILESFVTVFNQEAEILIEKLSQNADTGREFDIYEPISLYA 9848936
9848935 LDSICTTSMGVEINAQRHPENQYVRDVKRMSELILLRIFHVLSSFPRTYWYTMPNAWEQR 9848756
9848755 KLIRRLHAFTDTVIHKRREQLLERSSQVSNEQECLDEEHLYTKRRETFLDLLLNVRVDGN 9848576
9848575 SLSDLDIREEVDTFMFEGHDTTTSGIAFTFYQLAKHPEIQEKLYREIQDVLGGEYRHVPL 9848396
9848395 TYNTLQNFPYLDMVVKESLRLLPPVSFIGRRLADDIEMNGVTIPAGTDFTIPIYVIHRNP 9848216
9848215 VVYPDPERFDPERFSDGNTQRRGPYDYIPFSIGSRNCIGQRYALLEMKVAIVRMVSFYRI 9848036
9848035 LPGDTMHEIRLKTDLVLRPDKSIPIKLVARP* 9847940

>CYPb1x1 = CYP4C26, 480aa AAAB01008846.1
8134549 MENSFASDRIGTVRRGTAALVAVFSPPTLAMLLLLALVLVVFKARRAKMVKLIDQIPGPV 8134370
8134369 CMPLVGNGLQINVGCKD (1) 8134319
8132851 ELFDRIIASRKMFGRRQGISRVWNGPIPYVLISKAAAVE (0) 8132735
8131691 PILSNPKLVEKSNDYEYMKAWLGNGLLTSPGYIWHPRRKSLTPAFHFKILSDFVTIFQN 8131515
8131514 QADVLIDKLAEHTVQGEPFNIVPYVTLCALDIFC (1) 8131413
8131315 ETAMGCPVYAQKNSNSEYVRAHKQ (2) 8131244
8131160 IGKVIRNRLQKIWLHPDFVFKRTKEFQKHQECLKVLHNFSDRVVRERKEELRKRKEQLDQ 8130981
8130980 NNNNGNGESDYSVLEDGIYRKKQLAFLDLLLEGSGLSDLAIREEVDTFIIGGHDTTAAAM 8130801
8130800 AWILYLLGAAPDIQERVIQEIDAVMGTDRDRRPTMAELNEMRYLE 8130658
8130659 CCIKEGLRLYPSIPVIGRRLTEDVRVDNYTIPAGTTAMIVVYELHRDTSVFSNPDKFNPD 8130480
8130479 NFLPENCHGRHPYAYIPFSAGPRNCIGQKFAILEEKSVISAILRKYRIEAVNRREDVQLL 8130300
8130299 CDLVLRPKDGLIVRLHKRE* 8130240

>CYPb1x2 = CYP4C37  548aa AAAB01008846.1
8127689 MAYGDSVLLTSSIGAGSNSWTRQQFIESVPKTSVLLLLSFIFIVCCLAAYLERYRRLVRH 8127510
8127509 INCIPGPATLPIIGNALLINADRE (1) 8127438
8125923 ELFNRIIASRKLYGRRQGITRIWNGMTPYVLISQAQAVE (0) 8125807
8125736 KILSSTKNIEKGRDYEFLQPWLGTGLLTSPASKWQHRRKILTPTFHFRILADFVEVFNK 8125560
8125559 QATVLVEKLAKELDNEAGFDCVRYITLCSLDIIC (1) 8125458
8125373 ETAMGCPVYAQRQSDSEYVRAHEK (2) 8125302
8125230 IGEIMLNRLQKLWLHPDIIFRCTRQYREQQKCLDILHRFSYRMITERRSIIQTGSVVKQ 8125054
8125053 ANTEDGLDANNNNCEGTGRKQLAFLDLLIEASDGGRILSDTDIREEVDTFILGGHDTTAT 8124874
8124873 SISWTLFLLGTDPTVQERVVQEIECVMGDGGERWPTMRELNEMRYLEACIKEGLRLYPSI 8124694
8124693 PIIGRRLTEDVRLADHVLPAGTNAVIVVYQLHRDPAVFPNPDRFNPDHFMVDASSSQEPR 8124514
8124513 HPFAYIPFSAGPRNCIGQKFGALEAKAVLVAVLRQYRVEAVDRRENLTLYGELVLRSKDG 8124334
8124333 LRIRITKRK* 8124304

>CYPb1x3 = CYP4C25, 495 aa AAAB01008846.1
8117931 MESLLGGSLLLSKLSKVFTLFSPVTLLLLTTVSCAIYVYNRRRAHIVRHIDKIPGPAGLP 8117752
8117751 ILGNTLHINVDHD (1) 8117713
8114485 EIFNRIIAIRKLYGRIQGFSRAWNGPLPYVMISKASAVE (0) 8114369
8109600 RILGSQKHIEKSHDYEFLKPWLGTGLLTSAGKKWHPRRKILTPAF 8109466
8109465 HFKILDDFVDIFQEQSAVLKRLEAELGNEQGFNCFPYVTLCALDVVC (1) 8109322
8109232 ETAMGRQVNAQCNSDSDYVKAVYQ (2) 8109161
8109028 IGSIVQNRQQKIWLQPDFIFKLTQDYKNHQKCLAILHEFSNRVIHERKEEIRRQKQQLGDKN 8108843
8108842 NNNSNNNNGGGGAAGTDQDGNNNKDDYLSHEELGRKKRLAFLDLLIEASQDGAVLSHEDI 8108663
8108662 REEVDTFMFEGHDTTSAAISWILLLLGTEPTIQDRIVEEIDQIMGGDRERFPTMQELNEM 8108483
8108482 KYLEACIKEGLRLYPSVPLIARRLTEDVDIDGYVLPAGTTAMIVVYQLHRNPEVFPNPDK 8108303
8108302 FNPDHFLPENCRGRHPYAYIPFSAGPRNCIGQKFAVLEEKSIISAVLRRYRVEAVDRREN 8108123
8108122 LTLLGELILRPKNGLRIRIARRT* 8108051

>CYPs1x1 = CYP315A1, 501 aa AAAB01008846.1 
6194087 MLQRLRGTGSRFRCTGGQQQRAGVAGDSRGAKPFAEMPGPRRIPLLGMLNDVMQLGKPAE (2) 6194266
6194437 LHLRISKYHEQYGDLVRLQIGTQNAVFVRDPSLMRKTFQLEGAYPRHPLPESWTYFNKKH 6194616
6194617 DYQRGLFFM (2) 6194643
6194728 DGKEWLQSRQIFNKPMLKDFHWMEEPIRGTCEATVGHMQQTCDSAAAFEGIEAFLYQWSVE (1) 6194910
6195331 VVLSVMLGSAFTECQQSAEFRRLVQQFSAVVYDIFRCSSELMNIPPAIADRLNVQPWQQF 6195510
6195511 EKVVPETIRL (1) 6195540
6195613 ATAIIEFGIANAQTRDGLLDLMMQKLDKPLMMRIFIDFIIAAGDT (0) 6195747
6195826 TAFATVWALYLLASNANLQQSVRQDVLDSNTLECGAVKGVVRETLRLYPIAPFIGRFVEH 6196005
6196006 ESVFGAYALPKD (0) 6196041
6196104 TLVLLSLYSAGRDERFFAEPEAFNPYRWQRTNAAESSTGRTPS 6196232
6196233 ASLPFAIGARSCIGQKIAQLQMHYLLSM (0) 6196316
6196395 ILTKFELTLAEADQQDAIKPILKMITVPSAPVKLCLKPCSAQPERQAVAQMQD* 6196556

>CYPs1x2 = CYP9K1, 531 aa AAAB01008963.1 also AF487533.1 (mRNA)
198803 MLGTLASLLFSLEGVLLVALLALLYYYVVVRSTRFFADRGVPYLPPVPLLGNGADFITRK 198624
198623 RLLTDVLSDMYHRFASHRFFGYFDFLSPIYVVRDLELVKQICIKDFDHFVNHRIQLDENH 198444
198443 DPLFGRALFAMRDTRWRNMRTILSPAFTGSKMRLMFGLITSYCDGAVRTIRSELGADGTA 198264
198263 ELEMKELFRRFGNDIVATCAFGIEINSFRDRANAFFTLGKELTNLDGVQGLKFLAFSSFP 198084
198083 RVMRALRLRLFSAKMTSFFRHVVMDTITQREQRGIVRHDMINLLMQARKQELRFDENENI 197904
197903 ETNGGGSQKRSV (1) 197868
197510 DWTDDDLTAQCTVFFFGGYDTVSTLSAFMAHELAVNPDVQERLRDEIDRVRSTIGSADKL 197331
197330 NYETLQSMRYLDMVANETLRKWTPAPFLDRTCTKPYMLEDYDGRRVQLQPGDGLWIPAAA 197151
197150 IMRDPQLFPEPDRFWPERFEPESAGAPVDSSAMLAFGLGPRNCIGSRFALMETKAVFFFL 196971
196970 LTHFLLEAGPRTQHPIRLKKSSLGPCAEKGSWIRFRLRK* 196851

>CYPs1x3 = CYP4G17, 562 aawi AAAB01008963.1
1577119 MGIETIPERMAMDETVPGSWVLSVTVATVLLLVAGTLFHLWMQTRRYVQLGNLIPGPVAY 1576940
1576939 PLIGNANMLLGKTHNQIMEKAMELSYIYGTVARGWLGYHLVVFLTEPADVEIILNSYVHL 1576760
1576759 EKSSEYRFFKPWLGDGLLISSGDKWKSHRKLIAPAFHQNVLKTFIDVFNDNSLAVVKRMS 1576580
1576579 KEVGHVFDCHDYMSEVTVDILLETAMGSTRTGENKEGFEYAMAVMK (2) 1576442
1576313 MCDILHKRQLKIHLRLDPLFNLTGVKKEQERLLQIIHGLTRKVVREKKQLYERQMAEGK 1576137
1576136 MPSPSLTEIIGKEEKPGEGQLGGSPAFISQGSMLRDDLDDNDENDIGEKRRLAFLDLMIE 1575957
1575956 TANNGANISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDS 1575777
1575776 KRKATFGDTLEMKYLERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTY 1575597
1575596 KIHRREDLYPHPETFNPDNFLPERTQNRHYYSYIPFSAGPRSCV (1) 1575465
1575390 GRKYAMLKLKVLLSTVLRHYRVVSNLTEKDFKLQADIILKRTDGFQIQLEPRA* 1575229

>CYPs1x4 = CYP307A1 , 533 aa AAAB01008811.1 
2725328 MAYTGLILAVLTIILSVVCYFKILYEWHRKVRIQTVRPSRLQKLATAATTLPQQSTTELM 2725507
2725508 TFPQAPGPVPWPILGSLAFLGQYDVPFEGFTALAKKYGDLYSITLGSTRCLVVNNLDLIR 2725687
2725688 EVLNQNGRYFGGRPDFLRFHKLFGGDRNN (1) 2725774
2731446 SLALCDWSTLQQKRRNLARKHCSPSDASSYYQKMSDVGVMEMHRFMDQLDEVVCPGKDFK 2731625
2731626 VKPLIMQACANMFSEYMCSVRFDYNDQGFMSIVRNFDEIFWEINQGYAVDFLPWLAPFYH 2731805
2731806 KHMSKLTRWSAEIRDFILERIVNEREQTLGDDDTERDFADALLKSLRLDPSVTRDTIMYM 2731985
2731986 LEDFLGGHSAIGNLVMLALGYIAKHPEVGHRIQREIDRITERGKRNVTLYDTESMPYTVA 2732165
2732166 TIFEVLRYSSSPIVPHVATEDTCIAGYGVTKGTVVFINNYELNTSERYWSEPKRFNPSR (2) 2732342
2732448 ENERTLQIERVRKNIPHFLPFSIGKRTCIGQNLVRGFSFIIIANILQKYDVHSNDLSL 2732621
2732622 IKMYPACVAVPPDTYPLAFTQRSTVAA* 2732705

>CYPs1x5 = CYP4G16, 565 aawi AAAB01008885.1
14439 MSATIAHTDGLNSSANIISPINMFYFLLTPALLLWFFYWRLSRRHMLELAERIPGPKGLP 14260
14259 LIGNALDLVGSSH (1) 14221 
13116 SVFRTIIEKGKEYNEVIKIWIGPKLIVFLVDPRDIELLLSSHVYIDKSPEYRFFKPW 12946
12945 LGNGLLIST (1) 12919
12339 GHKWRQHRKLIAPTFHLNVLKSFIDLFNENSRLVVKKMQKENGKVFDCHDYMSECTVEILL (1) 12157
 6930 ETAMGVSKKTQDQSGYDYAMAVMKMCDILHLRHRKMWLYPDLFFNLTQY 6784
 6783 AKKQVKLLNTIHSLTKKVIRNKKAAFDTGTRGSLATTSINTVNIEKSKSDSTKTNTVEGL 6604
 6603 SFGQSSNLKDDLDVEENDVGEKKRLAFLDLLLESAENGALISDEEIKNQVDTIMFEGHDT 6424
 6423 TAAGSSFFLSMMGVHQQIQDKVIQELDEIFGESDRPATFQDTLEMKYLERCLMETLRMYP 6244
 6243 PVPIIARSLKQDLKLASSDIVVPAGATITVATFKLHRLESIYPNPDVFNPDNFLPEKQAN 6064
 6063 RHYYAFVPFSAGPRSCV (1) 6013
 5902 GRKYAMLKLKIILSTILRNFRVYSDLKEEEFKLQADIILKREEGFQIRLEPRQRKSKTL* 5723

>CYPs2r1 = CYP325J1  477 aa AAAB01008987.1 shortened N-term to match other CYP325s
added 18aa including a stop codon.  This sequence is short in the region between 
KATENSH and LIEQ, but there is no intron there.  This may be a pseudogene.
11162359 MFHTFVQCALFCVTVYCCRWWQMRERWKLLSRLPGPRCFPLIGAM 11162493
11162494 YVIPGRDTSRYLETIIGLTGAYGSPYCIWLGS 11162589
         VPVVIVSSADHA*TILTS
11162644 PATVEKASFYRFTPLQGIFSLPADKWRAHRKLIQPSFNQSILRGFIPLFVQKTDAMM 11162814
11162815 RGLGEMAEKGQPFDVYRFTARCTLDMIF (1) 11162898
         ATTLGTDMHIQDKPVCSYLEVLEE (2) 11163028
11163092 LFEIVTIRAVNLFLHPQWLYRWTSVYRKETKALEEFCRPS 11163211
11163212 KMILARKATENSHRFSLIEQLQNSAMLDSAAMEQELNTIIFAGNETSAMTVANTILLLAM 11163391
11163392 HPHVQEKLVDEIRLQCGAEGEQSIGYETLNRLTYMELVLKESLRLLPIAAVVGRRTTAEV 11163571
11163572 DLGQYRLPADIDIVIDIFDIHRNPAYWGSDADRFRPERFEGLRHDPFALLPFSAGSRNCV 11163751
11163752 GLRYAWISMKIMLLKVLRSYRVDTDLKLEDLTMKIALTMKISNGHMVRLKRRQ* 11163913

>CYPc2r1 = CYP4H14 , 485aa AAAB01008987.1 
4711765 MILQALLIAGVVYLLISHLIERKKLQKINKHFPGPKPLPVVGNLLQFAWLDIP (1) 4711923
4712650 GVFEKVVELHQTHGQDYMMWSLFNWTILMMTSRKNVEKVL 4712769
4712770 LAKQTEKALLYQFIEPWLGTGLLIASGEKWFQRRKIITPTFHFKILEQFVRVFNTETDTM 4712949
4712950 VQLLRKHVGGKEFDIYDYVTLMALDSICETSMGTTVDAQHNPDNQYVQNVKR (2) 4713105
4713189 MAVLVLLRTISIVGPYPTLYNLFHPNAWEQRRVIKQLHAFTDNVIRSRREQLAKEKAQN 4713365
4713366 VAFDLNEENLYSKRKLTFLDLLLNVTVEGKPLSNLDIREEVDTFMFEGHDTTTSGISFTI 4713545
4713546 YELARNPDVQERVYEEIVSILGKDHKTAELTYQNLQEFKYLDLVVKEGLRMYPPVGIIGR 4713725
4713726 ALVEDLEL (1) 4713749
4713826 NGTTVPAGQNVLVPIYVIHRNPEIYPNPNQFDPSRFAEDAESKRGPFDYLPFSIGARNCI 4714005
4714006 GQRYALMEMKVTLIKLIANYRILPGESLGKLRVKTDLVLRPDIGIPVKIVLRE* 4714167

>CYPc2r2  = CYP4H15, 500aa AAAB01008987.1 EYVMAVKEIS added to original seq
4608411 MFLVLLTTLLGIAVTCMVVTIIRNRATVAKLKKQLHNFTVIPAIPVLGSAYLFKDPTPEG 4608232
4608231 IFQTFTGFHRQFGRNLITQSLFNFPSMQVCDPKVIEQIMQARTIEKTIIYDFMVPWLGTG 4608052
4608051 LVVSTGTKWAQRRKIITPTFHFKILEDFLVIMNHQTDVLIEKLKQNANSTDFDIYEHVTY 4607872
4607871 CALDIISESAMGVKLNTQQQPNSEYVMAVKE (2) 4607779
4607710 ISDIILKRLFSFLREYKWAFQFTKSHRRQEELVKIVHDFAHNVISERKKQLQ 4607555
4607554 DEREQQLTQEKLEEEDVYGKRRMTLLDLLLNVTIDGKPLSDSDIREEVDTFMFAGHDTT 4607378
4607377 TSCISFAAYYLSRDATVQQRVYDEILAIVGPDAKTQELTYGTLQELKYLEMVIKETLRMN 4607198
4607197 PSVPIIGRRSAGDMLIDGVTIPKGMDFGILIYALHNDPELYPEPARFDPERFSEEASEKR 4607018
4607017 QPYSYIPFSVGARNCIGQRYAMLEVKTMLVKLVANYRFLPCEESNKLRIKTDMTLKPVNG 4606838
4606837 TFVKIVPR* 4606811

>CYPc2r3  = CYP4H25,503aa AAAB01008987.1 YVMAVKE ADDED TO ORIGINAL SEQ AT INTRON
4605447 MFLVLLTTFFGIAITWLAVTIMRNRATVSKLKKQLPHFTVIPAIPVLGSAYHFKDPTPEG 4605268
4605267 IFNTFTGFHKQYGRNLIAQGLFNVPSMQITDPKVIEQIMQARTIEKTIIYDFMIPWLGTG 4605088
4605087 LAISTGAKWAQRRKIITPTFHFKILEDFLVIMNHQTDVLIEKLKQNANSTDFDIYEHVTY 4604908
4604907 CALDIISESAMGVKLNTQQQPNSEYVMAVKE (2) 4604815
4604748 VSDIILKRLFSFLREYKWAFQFTKAHRRQEELVKIIHSFAYQVISERKKQLEDERERKRTQEKLEE 4604551
4604550 EDVYGKRRMTLLDLLLNVTIDGKPLSDSDIREEVDTFMFAGHDTTTSCISFAAYYLSRDA 4604371
4604370 TVQQRVYDEILAIVGPDAKTQELTYGTLQELKYLDMVIKETLRINPSVPIIGRRSAGDML 4604191
4604190 IDGVTIPKGMDFGILIYALHNDPELYPEPARFDPERFSEEASEKRQPYSYIPFSVGARNC 4604011
4604010 IGQRYAMLEIKTMLVKLVANYQLLPCDERNKLRIKTDMTLKPVDGAFIKIVPR* 4603849

>CYPc2r4 = CYP4H26, 507aa AAAB01008987.1
4603407 MAVSVLLLFLLATVLLLSALYIALKVVRNRNRAVALLKQLPNFRALPSVPLLGSAHLFLDTTPDG 4603213
4603212 TLRTIVDCHQRYGRNLLLQELGNEFKLLTCDPRVIEQVLQAKTIVKSNFYRFLLPWIGLS 4603033
4603032 SVVVSGHRWHNRRKVINPGFNYRMLQGFLPTMDAQAAVLVAKLAPHAGGPAIDVDEPLRC 4602853
4602852 MAMDIICETAMGVRLGCQSNPAVPFFKDCEE (2) 4602760
4602679 LLDLIYKRIFNPLLTYDLVYACTRAGRRANATIRALHQFTRSVIRERVKQMQAVLPNSQQ 4602500
4602499 PAPEESQEQQHRSTFLDLLLQTRLAGDKLLSDDDIRGEVNTFMFAGHETVTSCLSFT 4602329
4602328 LYYLSRYPDVQQRLYEEIATMAKAPVLTYGTLMELKYTELVIRETLRLNPSVPMIG 4602161
4602160 RMAAGDMEIDGVTIPTGTEVMLNIYVMQNDPQYYPDADQFRPERFLQEPPPYSYLP 4601993
4601992 FSTGVRSCIGQRFAMLEMKTVLVRLLSRFRFVPCGEENALQVKANLTLKPYHGAFVKLVDRH* 4601804

>CYPs2r2 = CYP325H1 503 aa AAAB01008799.1
2611459 MIVLVFIGVFALVYYVNFRRTRKRLYELAERIPGPFDYPLIGSMLLTIGKSPLELVTHLM 2611280
2611279 ELMHHLPSPMRAWLGPFLLVVVDRPEMVQDVLSSPDCVQKPFMYDFFRLSKGLFGAPADQ 2611100
2611099 WKRHRKLLNASFSPAALKSFVPTLNAKADQFTRELAGKVSGECFDVHKLLARYTLVTISS 2610920
2610919 TTLGADLSVEKREVLEEYTSNAIQ (2) 2610848
2610758 MFTNCFERIYKAWLHPDCVYRMTAAFREEEVRFKSFKQMSRK (0) 2610633
2610567 IITMRQALLSETKQTKTEYQQDSDPEENQELPKAKIFIERLEEIAHDPANGIDEDGF 2610397
2610396 QQHIDTMMFGGNDTSAQALSNTLLTLGMYPDWQEKVYQEIMDVVPHGPVSYEDLTKLTLL 2610217
2610216 EMFLKETMRLLPITGLIARTPMKEVQAQDVTLPVGCFVLIPFLKMHRDKTIWGPDAETFN 2610037
2610036 PDNFLPERCAQRHPYAFIPFSQGPRNCIGMKYGWLSMKILLCHVVRQYRISTDIKLRDIK 2609857
2609856 LSLSLVMKLNTKHLIRLEQR* 2609794

>CYPd2r1 = CYP325F2 507 aa AAAB01008799.1 added N-term
1525219 MALQLVLLYISAALALATLVCVRWKRRKLYAAAATMDGPPCLPLLGHVYLIFGKRCG (1) 1525389
1526699 EDILQVLDRYAPRYKSPIGIWMGPQLIVGIKDNPDYFQTVMNSPHMLNKMDQYNFF 1526866
1526867 RIVNGLFAAP (1) 1526896 
1526968 DHTWKNERKLLNRSFSPTMLSSFVDIFNDKDFIMVENLRKFVGNGEVDLHLYIAKCTIDSIF (1) 1527153
1527218 GTAFGKDLNTQGNDGADEYLHCLDTFFSLVFKRILHLERYSESIYRLTKDYEHETNCVNI 1527397
1527398 IRNMSLDLMKELKENYKNSKATVKEDAYERKPALNFAENLFELAENNPSLPEDHIKDHID 1527577
1527578 TMIVAGHDTTATTMSNLLLMLAMHPEVQEMVYQEVMSVCPDKSKPVTMEDVNNLVYTEMV 1527757
1527758 CKETMRLFPVGPLIGRKCVADVKLD (1) 1527832
1527902 DKHTIPAGCCVALGIYQIHRDPTIWGPEPGKFNPDHFLPERVAERHPYAYLPFSGG 1528069
1528070 PRNCIGIRYAWLSMKILIAHLVRNYRFKTTLKMEDLEIKFAIILRIMNGCLVSIEDRSCSPV* 1528258

>CYPd2r2 = CYP325G1 509 aa AAAB01008799.1
1523203 MIDASVVFVLSIAISALCWTAWRLHKWKHYKLSADLPGPRDFPLIGSAHLFFGKNTGEQF 1523024
1523023 RCILDITKAHRSPCRVWLGPKLFVFIDNADDLQTVLNAGQCLEKADVYRFFQCETGLFSA 1522844
1522843 PAPVWKVHRKHLSPCFNAKILASFVAIFNAKSTILVEQLMGYVKRGALFNVYEYIAKCTLDMVC (1) 1522652
1522581 ATTLGTNMQLQNEQGDEYIAAIER (2) 1522510
1522427 ASELLNHRLYKVWLHPEWIYRLTSGYKVQQQCYATAYKMSRRVLALKGAELAEIRNRST 1522251
1522250 VPVAKVEAPATTDEYRKPQIYIDQLFRLAKETGVFDERAIRDEIDTIILGGNETSALTLS 1522071
1522070 HVVLMLAIHQDVQRRVYEEMVTVVGSSFGEVENDHLAQLTYMEMVMKETMRLFPVGPIIA 1521891
1521890 RQCTDDLKI (1) 1521864
1521793 STTTIPSGVTVVLGIYNVQRSEQHWGLAANAFDPDNFLPERTAHRHPYCFLPFSAGPRNC 1521614
1521613 IGYRYGLMSMKVMLCHLLAAYRFSTDLTMDQLALKLDITLKIANKHMVRIVPR* 1521452

>CYPd2r3 = CYP325F1  509 aa AAAB01008799.1
1516320 MTVQLVLVYVVLSLALAILLCLRWKRRKLYAAAATMDGPPCVPFLGHAYLLFGKQTG (1) 1516490
1516729 EHIIEVFDKYAPRYNSPIGIWMGPKLIVAIKDNPEYFQKVMNSPHLLSKMDQYNFFRAENGLLTAP (1) 1516926
1517007 EHVWKTERKLLNRSFSPMMLSSFVDIFNKKDLVLVENLRKFVGAGVFNSQLYISKCTIDALF (1) 1517192
1517261 ENAFGRDIGTQAHDGHDEYLQCLDTFLSLVFKRVLHVERYIECIYRLTKDYATESSC 1517431
1517432 VNIIRNMSLDLMKEVKENAHQAQQQPVEEAYGGKPALNFAHSLSSLAKHNPSLTEDHIKD 1517611
1517612 HIDTMIMAGHDTTATTIANLLLMLAMHPEVQEMVYQEVMSVCPDKSKPVTMEDANNLAYT 1517791
1517792 EMVCKETMRLFPVAPVIGRKCAADVKLD (1) 1517875
1517949 DKHTIPAGCCVALGIYQIHRDPMIWGPEPGKFNPDHFLPERVAERHPYAYLPFSGGPR 1518122
1518123 NCIGIRYAWLSMKIMIAHLVRNYRFKTPLVMEDLVLKFAIVLRITNGCLVSIEDRPSS* 1518299

>CYPd2r5 = CYP325E1  509 aa AAAB01008799.1 seq corrected 
1440731 MITLLLLGFGALSLYLYCKIKFKFAEKIPCVEPLHPIFGNGLEFAQKNSYEIFKSLTRAYKDNKRIFKLC 1440522
1440521 FGPIPVICPTHPDLIQKIMTEQASMDKPFVYDFMRVDHGLLTAQ (1) 1440390
1437354 YDEWRVHRKALNPTFNTRILNSFIPIFTDCVAKMIANMEKHAGDEKPINVLEFTSP 1437187
1437186 CTLEMICRTSLGGKVLEREGKQEFIEGLEI (2) 1437097
1436434 ILHNVGLRMFNANLYPDIVYRNTRFYKAEMDARKICYAFTDK (0) 1436309
1436213 VIREKRAKFEEKLRNAVDCNNNS 1436145
1436144 TTADENGNVVFADEEDDMLSYKKPQIFVDQLLTIPNDGKPFTHEEITDHIYTMIAA (0) 1435977
1435888 GNETSATQAAHACLLLAMHPEIQDRAAAEICELLADDVEYTHETLKQMEY 1435739
1435738 LERVIKESQRLCPVAAVYGRKTIGTIQLDEYVIPKGFILLLNVFALHRQKEFWGPNADKF 1435559
1435558 DPDHFLPERVKARHPYAYLPFSGGPRGCIGSRYAMMSLKIILSQILKNYRLTTDIPYEKM 1435379
1435378 DFKFKVSMHLSFEHLVRLERRV* 1435310

>CYPd2r7 = CYP325C2 489 aa AAAB01008799.1
1426346 MWWLWLVALVLAALGLWQWWIVQRHRFASHLPVMQPYYPIIGNAQLFIGKSGVDLFNQLL 1426525
1426526 QPFRQYDGWFKIWLGPKLVLATSHPDIMNAVLSHPDCLEKPFFYDFVKLEHGIFAGH (1) 1426696
1426790 YHPWKTQRKALNPTFNTRILNSFIPVFVQCARQMVQHMEQSVGDVGRSISI 1426942
1426943 FPFISKCTLEMVCGTTIGCDVMEQPGKETFIENVDR (2) 1427050
1428758 CFELVAKRMLNIHHYIELVYRFSRDCIEESELRTSCYRFFET (0) 1428883 diff frame
1428961 VIEKAKARINSTTIEHECEDYKKPLIFADQLLAAQHNGNPFTDIEVTHNIYSMIAA (0) 1429128
1429199 GNDTTALQVTHTCLFLAMHPAIQERVYREVMDVFPDPDQDIEVEDLKKLTYMERVIKESL 1429378
1429379 RLAPSGPNIARQTMKDIEIAGVHIPRDSLIVMSIFSMHRRKDIWGPDADLFDPDRFLPER 1429558
1429559 SEGRSTNVFIPFSAGSRNCIGGRYAMLSMKVMLSSILRRLRLRSDLQMNDLQFRFDLTLK 1429738
1429739 LESEYFVQVEKRM* 1429780

>CYPd2r6  = CYP325D2 473  aa AAAB01008799.1  seq corrected, stop codon in exon 1
1430532 MFAIVLFLITACVCYYYTCVVRARFAQDVPCAQPCYPLIENGLSFLEKSPVKLFQNVVQP 1430711
1430712 FNQFDRWFKVWLGPQLMLCTSHPVLAESVLSHPKCLDKPFFYSFVQLE*GILTRK (1) 1430876 
1430948 YQNWKRYRKVMSPAFSTSKVTNALPLFVMCAENLMSKLEAMVANDST
        VSLAPVLSECLLNVIFSTTLGANVVEEREAKHILNNLDI (2) 1431202
1431257 LFQMISARAINALHHIDWVYKHTNNCKIESASRAACYSVVDK (0) 1431382
1431454 VLASRRSALENEFYEANDSPAMLDRLLSVNEDGPLSDTEIVQNIYSIVGA (0) 1431603 
1431670 GNDTTAHSLGHTCLFLAMHPAV 1431735
1431736 QRKLYQELRDVFYSADEPITEEKLKQLSYMECVIKESLRLAPPGATVAREAQEDLTVEG 1431912
1431913 QLIPRGTTVVVSLFALHRRKDFWGADAERFDPDRFLSERCKNRMGCAFMPFNTGSRNCIG 1432092
1432093 SRYAMQIMKIILCKIVRRYELHAELTMEQMQFRFDIALKQEQGYLIRFERRVESD* 1432260

>CYPd2r9 = CYP325D1  476 aa AAAB01008799.1 seq corrected not sure about N-term
1418271 MFAIVLFLIA (?) 1418300
1419296 ACAFLYYYTCVVRARYAQ 1419349
1419350 DVPCAQPCYPLIGNGLSFLEKSPVKLFQNVVQPFNQFNRWFKVWLGPQLMLCT 1419508
1419509 SHPVLAESVLSHPKCLDKPFFYSFVQLEQGILTRK (1) 1419613
1419682 YQNWKRYRKVMSPAFSTSKVTNALPLFVMCAENMMSKLEAMVANDSTVSLAPVLSE 1419849
1419850 CLLNVIFSTTLGANVVEEREAKHILNNLDI (2) 1419939
1419996 LFQMISARAINALHHIDWVYKHTNNCKIESASRAACYSVVDK (0) 1420142 
1420193 VLASRRSALENEFYEANDSPAMLDRLLSVNEDGPLSDTEIVQNIYSIVGA (0) 1420342
1420409 GNDTTAHSLGHTCLFLAMHPAV 1420474
1420475 QRRLYQELRDVFYTADEPITEEKLKQLSYMECVIKESLRLAPPGATVAREAQEDLTVEG 1420651
1420652 QLIPRGTTVVVSLFALHRRKDFWGADAERFDPDRFLPERCKNRMGCAFMPFNTGSRNCIG 1420831
1420832 SRYAMQIMKIILCKIVRRYELHTELTMEQMQFRFDIALKQEQGYLIRFERRVESD* 1420999

>CYPd2r10 = CYP325C1 495 aa AAAB01008799.1
1415746 MWWLWLVALVLAALGLWQWWIVQRHRFASHLPVMQPYYPIIGNAQLFIGKSGVDLFNQLL 1415925
1415926 QPFRQYDGWFKAWLGPKLVLATSHPDIMNAVLSHPDCLEKPFFYDFVKLEHGIFAGH (1) 1416096
1416190 YHPWKTQRKALNPTFNTRILNSFIPVFVQCARQMVQHMEQSVGDLGRSISIFPCISKCTLE 1416372
1416373 MVCGTTIGCDVMEQPGKETFIENVDR (2) 1416450
1416682 WFELIAKRMVSIHHYIELLYRFSRDFIEESETRTSCFRFFET (0) 1416807
1416885 VIEKAKARINSTAFEDECEDYKKPLIFADQLLAAQHNGNPFTDIEVKHNIYSMIAA (0) 1417052
1417123 GNDTTALQVTHTCLFLAMHPAIQERVYREVMDVFPDPDQDIEMEDLKQLTYMERVIKESL 1417302
1417303 RLAPSGPYIARQTMKDIEIAGLHTPRDSLIVMSIFSMHRREDIWGPDADVFDPDRFLPER 1417482
1417483 SEGRSANVFIPFSAGSRNCIGGRYAMLSMKVMLSSILRRLRLRSDLQMNALQFRFGLTLK 1417662
1417663 LDSEYFVQVEKRM* 1417704

>CYPd2r11 = CYP325A3  505 aa AAAB01008799.1
1412735 MFFIPALILLLGLVLYWSKLSRKTSAQLFGKDIPGPRSYPLIGSAHLFLGSDERTFSVIN 1412556
1412555 ELFRKYGSFFKLSLGPKTFLCLSDPDLIQQALTSSACQDKAFFYRFMELDYGLISSR (1) 1412385
1412286 YTDWKLYRKSLNPAFNQRILISFISIFNRCSEVMVARMAKEADRRQPFDVLHYTAQCALEM 1412104
1412103 VFASSLKSDITDDAQLHEACEAIQNMCTIMSSRMFNVLLYSDLLFTLTHKYHELQKMKVKVERVVNP (0) 1411903
1411836 ILYGRREKLSKQRLENAHSEDEEHYRKPMVFLDQLLHMQRGGRDLEIQEIENHLNNIIAA (0) 1411657
1411575 GSDTTASQVAFILLMLAMHPKVQDRVHEEIVSIYGSAAPDFSYETISAQTYLDQVI 1411408
1411407 KETMRMYPVGPIIGRQTIETVKLGDVIVPPGVTLLINILTVHRNKELWGDRAHVFDPDRF 1411228
1411227 DPAQYDAKKQHPFSYIPFGGGPRNCIGYRYGMLAMKIMVTQVLRKYQLSTPLTPSDSLRP 1411048
1411047 FFAITLKIGTGHSICVKRRTNVLL* 1410973

>CYPd2r12 = CYP325A2  505 aa AAAB01008799.1
1408315 MFFIPALILLLGLVLYWSKLSRKTSAQLFGKDIPGPRSYPLIGSAHLFLGSDERTFSVIN 1408136
1408135 ELFRKYGSFFKLSLGPKTFLCLSDPYLIQQALTSSACQDKAFFYRFMELDYGLVSSR (1) 1407965
1407874 YTDWKLYRKSLNPAFNQRILISFISIFNRCSEVMVARMAKEADRRQPFDALHYTAQCTFEM 1407692
1407691 VCASSLKSDITHDPQAREACGAIEKMCAIMSSRLFNVLLYSDLLFTLTQRYREMQKVRATLGRVVNP (0) 1407491
1407423 ILYDRREKISKQRLENAHSEDEEHYRKPMVFLDQLLHTQRGGRDLEIQEIENHLNTIIGA (0) 1407244
1407157 GSETTANQVAFILLMLAMHPEVQERVYEEIVSIYGSAASDLSYETISAQTYLEQV 1406993
1406992 IKETMRVYPVAPLIGRETIETVKLGDVIVPSGVTLLINILTLHRNKELWGERAHVFDPDR 1406813
1406812 FDPAQYDAKKQHPFSYIPFGGGPRNCIGYRYGMFAMKIMVTQVLRKYQLSTPLTPTDSLR 1406633
1406632 LSFAVTLKVGTGHSICVKRRAGVVL* 1406555

>CYPd2r13 = CYP325B1  498 aa AAAB01008799.1 I helix added
1403976 MQLFLLTLVVIFGAVLYRKHQKMF 1404047
1404048 KFAEKIEMLHSYVPVFGHSLLLLGKLPEKVFQIFKSAYLQHDRLFQLRLGLMLFVCSSHP 1404227
1404228 DIMHAVLDNPKSMNKPMLYDFFKLDQGLFATPY (1) 1404326
1404419 GLWKHQRKTLNTSFNKRILDSFLPLFDKCARKMVNAIKQEADLSRVDVMKHCSRCTLDMVCGS 1404610
1404611 TFGSNILDDPEANKFVPMIDK (2) 1404673
1404742 AFEIIARRVVTVSKYPEFIYKLTSDYKEEMYLRSTFYEYVYS (0) 1404867 
1404938 IINRKRASLTDENTDKRNEADDDIEYRKPQIFVEHLVKGKRAGEPFPDLEILHHAVTIIVG (0) 1405120 
1405195 GNDTSALALCNHLTLLAMHPKVQEKAREEIMAVFPTGVELETTPEAL 1405335
1405336 SQLPYLERCILEALRLCPSGPLLGRVCSEDIEVDGNVIPRGTNFLFSIFALHRRTDVWGP 1405515
1405516 DAEGFDPDRFLPERSQGRHPHAYAPFSMGSRDCIGKRYAIQGMKLVLVHLLRSFRFYTDL 1405695
1405696 EYEQVEYKFDITLKLSQGYKFKIQSIDV* 1405782

>CYPd2r14  = CYP325A1  505 aa AAAB01008799.1
1403155 MFFIPALILLLGLVLYWSKLSRKTSAQLFAKDIPGPRSYPLIGSAHLFLGSDERTFSVIN 1402976
1402975 ELFRKYGSFFKLSLGPKTFLCLSDPDLIQQALTSSACQDKAFFYRFLELDYGLISSR (1) 1402805
1402714 YTDWKLYRKSLNPAFNQRILISFISIFNRCSEVMVSRMAKEADRRQPFDALHYTAQCTLEM 1402532
1402531 VCASSLKSDITDDPQAREACGAIEKMCAIMSSRLFNVLLYSDLLFTLTQRYREMQKVRVNLEHVVNP (0) 1402331
1402258 ILYGKRERLSKQRLDNAHSEDEEHYRKPMVFLDQLLHTQRGGRDLEMQEIENHLYTIIGA (0) 1402079
1401992 GSETTANQVAFILLMIAMHPEVQDRVHEEIVSIYGRAAPDFSYETISAQTYL 1401837
1401836 EQVIKETMRVYPVAPLIGRETIETVKLGDVIVPSGVTLLINILTLHRNKELWGERAHVFD 1401657
1401656 PDRFDPALYDAKKQHPFSYIPFGGGPRNCIGYRYGMFAMKIMVTQVLRKYQLSTPLTPTD 1401477
1401476 SLRLSFAVTLKVGTGHSICVKRRANVVQ* 1401390

>CYPe2r1 = CYP4K2  509 aa AAAB01008859.1
10485945 MFYWAVVLGVIATLLAALDWKYKSYEHLPGPRRWPFIGNVVSFLGAGPV (1) 10485799
10485710 EIFDQLIAFASTYGKVYKLDFFYDYTIIYSSPEAAE (0) 10485603
10485525 AILTSPAFTAKSQDYDKVSEWIGNGLLISRDQKWFTHRKVITPGFHFKILENFVPVFNR 10485349
10485348 QAEAFCAKLETLTGRSADAVNVFPELKLLTLGIICETAMGVGMDGEGQSTQQAYYTQIVE 10485169
10485168 ELSSILYWRMFNVFVNIDAVFRLTRTSRRFDELVKKSWQFTLGMIERRRKMNELEAPVEV 10484989
10484988 RKEEETFGKQKRALLDTLLEARIDGRPLTDEEIREEVDTFTFA (0) 10484860
10484786 GHDTTASAMTFILYNVAKHPEIQERVYQEIVNEIGADFCELSLR (2) 10484655 ?????
10484609 AICLHTLSALNNLHYMELVIKESLRLFPPVPVIARIATEDTELLAERITRGTSVAIDIYTM 10484427
10484426 HHSDDYFPDAERFDPDRFEGARDAQTFNPYTYIPFSAGSRNCIGQKFAQYELKSTLVKLL 10484247
10484246 QRFQIRLADASYVPILKAEIVLKPAEGLPLRFIKRRV* 10484133

>CYPe2r2 = CYP4AR1 494 aa AAAB01008859.1
10481939 MIVYALLIALCVLVLRFVAFRYKVYRTVGHLPGPPVNFLLGNTLELVRYDTQ (1) 10482094
10482172 VFFEKLFEYFQRYGMIVRLDMINKVWIIFSSPHDIE (0) 10482279
10482382 QIISSNEFNRKSMDYDILQEWLGNGILLDYGNTWFSNRRALTGAFHFKILDTYV 10482543
10482544 PVFEEQADVLVRKLLDAGGATVDIFALVKLYTLDVILETSMGVRCRAQLEDSDYVRAVSD (2) 10482723
10482794 LTHITFWRMYNAMGFSDWTFRLTKHYQTYRKSLQINREFTTSVIKQRRAELLAAGTSDTT 10482973
10482974 RPEKGRLSLLDILLRSDITGRTFSDEEVYSQVNNFMFA (0) 10483087
10483169 GHDTTSSAITFILYACAKHPEVQQRVYEEIVAELPDGEPVTQQRVNNL 10483312
10483313 KYLEQVIKESLRMFPPVPYYSRHIDHDTTQGGVRLEKGSTIVFGTYMLHHNPEYFPEPDQ 10483492
10483493 FRPERFADGETKRNPFAYIPFSAGSRNCI (1) 10483579
10483643 GQKFALNELKTALVKILRQCKVELPDPDFVPKMKMELVLKPVNGMQLRFLERKTIQL* 10483816

>CYPe2r3 = CYP4D15 , 522aa AAAB01008859.1
10478867 MWPIIVSGTALLLSIAIWWTVANFGSALRYAGKLGGPVAYPLVGNGFLFINKTPA (1) 10478703
10478614 EFLQLLGRLIAQYGKCLRVWLGTQLIVLITDPKDIE (0) 10478507
10477839 ILLSSPKYIEKSSEYDFV 10477786
10477785 RPWLGEGLLISSGRKWQTHRKIITPTFHFKILEEFMDIFDQQGNTFVDILHLFAKSGETF 10477606
10477605 DVFPLVTLCALDVIC (1?) 10477561
10477488 ESAMGTKVNAQMNSESEYVKAVKE (2) 10477417
10477330 ITNLIQLRIYDFVIRYEFFFRLSANRRRQRKALAILHGYTDSVIRTRRQELN 10477175
10477174 ERGAGHNDVPEEDVLGRKKRMAFLDMLLQSTVDGRPLTDLEIREEVDTFMFEGHDTTTSA 10476995
10476994 ISFMLHSLAQNPDVQEKAFNEVRNIVGDDRKQPVTMAMLNDMHYLDLVIKETLRLYPSVP 10476815
10476814 LFGRKMLQNTEIN (1) 10476776
10476706 GKIFPAGSNVIVLPFFMGRDPDCFANPEKFDPE 10476608
10476607 RFNVERSAEKTNPYQYIPFSAGPRNCIGQKFAVTELKSLVSKVLRNYELLPPEQVREETF 10476428
10476427 IAELILRPEHGIPIRVKQRVY* 10476362

>CYPe2r4 = CYP4D17, 508 aa AAAB01008859.1
10475254 MVYSTLAVLLALGSLAAVYLYRRFGEMLKHTGKLGGPPAYPILGNGLMFLNKSPA (1) 10475090
10475008 DFLRIIGELLQRYGDCFRVWLGTQLVIVMGDPKDIE (0) 10474901
10474283 VLLSSPKYIDKSTEYDFIRPWLGEGLLTSRGRKWHTHRKVITPTFHFKILEQFVEIFDR 10474107
10474106 QSSTFIKVLEPFAASGKSFDIFPQVTLCALDVIC (1) 10474005
10473912 ESAMGTKVNAQINSTSDYVLAVKE (2) 10473841
10473768 ITNLIQLRFYDFLIRYDIFFRLSANARKQRKVLQVLHSYTDSVIKGRRQQLASIQQSGEQ 10473589
10473588 EEASDQDLGIKKRMAFLDMLLQSTIDGRPLTDLEIREEVDTFMFEGHDTTTSAISFLLHS 10473409
10473408 LAQNPTIQEKVFDEVRNVVGDDRTRPVTMAMLNDMHYLDLVIKETLRLYPSVPMIGRKMQQTAEI (1) 10473214  
10473149 NGKIIPAGANLIIMPFFLGREARYFPEPEKFDPERFNVERSAEKTNPYQYIPFSAGPRNC 10472970
10472969 IGQKFAVAELKSLVSKVLRHYEILPPTGKQDESFIAELILRPEHGVFVRLKPRAY* 10472802

>CYPe2r5 = CYP4D16, 510 aa AAAB01008859.1
10471979 MFVATLTLLALIASVAFYVYVERFSKILKHSGKLGGPRAYPLIGNGLLFAGKTPA (1) 10471815
10471609 EFLQTVGRLIQQYGKCFRIWLGTQMLIVITEPKDVE (0) 10471502
10471427 AILSSNKYIDKSIEYDFIRPWLGEGLLTSTGRKWHTHRKVITPTFHFKILEQFVEIFD 10471254
10471253 QQSSTFVQVLAAHAKSGDTFDIFRPVTLCALDVIC (1) 10471149
10471046 ETAMGTKVNAQLNTESEYVQAVKD (2) 10470977
10470907 ITNLVQIRLFNFLIRYEIFYRFSANRRKQLEALKVLHGYTDSVIKIRREELNRAAGSG 10470734
10470733 KNTVVDENENELGIKKKMAFLDMLLQSKIDGRPLTDLEIREEVDTFMFEGHDTTTSAISF 10470554
10470553 LLQNLAKHPAIQQKVFDEVRNVVGDDRTRPVTIAMLNDMHYLDLVIKETLRLYPSVPMFG 10470374
10470373 RKMMEDAEI (1) 10470347 
10470283 NGKVFPAGSNTIILPFFLGRNPEFFPNPEKFDPERFNVETSAEKTNPYQYVPFSAGPRNC 10470104
10470103 IGQKFAVAEIKSLVSKLLRNYEILPPVGRYDETFIAELILRPEKGIYVRLQPRVY* 10469936

>CYPe2r6 = CYP4D22, 505aa AAAB01008859.1
10468178 MVVVVQIGLALLVVILTINYLLVRQNIKYGRHIPGPVPLPIVGCFYLYINLKPE (1) 10468017
10467565 DIIDFVSDLRKRYGNLFRVWIGNRLALFCTNVKYNETVLSSQKLIRKSELY 10467413
10467412 KFLIPWLGDGLLLSTGQKWFGKRKILTPAFHFKILDQFIEVFHKQSSILADRLRPEANGQ 10467233
10467232 LVNIYPFVTLAALDIICETAMGTSINAQTDADSAYVKAITELSLVLTGRFVKVWQRVDFL 10467053
10467052 FNLSPDKRRQDRIIKVLHDFTTKIIQSRRRELMEQGGGGGGTVEDDDMADLGTKRRMAFL 10466873
10466872 DVLLQATIDGRPLTDREIQEEVDTFMFEGHDTTTIAISFTLLLLARHPEVQERVYREVVA 10466693
10466692 IVGNDPATPATHRNLQDMKYLELVIKESLRLYPPVPIIARRFTENVEL (1) 10466549
10466470 GGKIVPEGSNFNIGIMHMHRDPTLFPDPERFDPERFAPDRTMEQSSPYAYVPFSAGPRNCI (1) 10466288
10466201 GQKFAMLELKSTVSKVIRHFKLTAAGPEPKLTMQLTLK 10466088
10466087 PRDGLYIGFVPRR* 10466046

>CYPs2r3 = CYP314A1 , 558aapli AAAB01008859.1
10304849 MSVTIVLFYTFVTLFMFLSYNPKPKKIVESIRSFLLHLLQHNGDAGAGSGGLQAATACNA 10305028
10305029 AQTSPVSPPAPSPPPNDAGVPTVRSIWDIPGPRRLPLIGTKWRYFFGRHRYAKVHETFME 10305208
10305209 MHRRYGPIMLDVDTVPIVNLFDRADMEKVLRYPSRYPFRPPTEIVEVYRSSRPDRFGVTNLINA (2) 10305400
10305504 QGAKWHELRAKLTTGITSRRVLQAFIPSVNEICDDFVDLVRRQRADDGTIRNFQDIANSVGLE (1) 10305692
10305765 IICCLVLGRRMGYLTTNRQNAKFMRLAEAVKESFVYIGESYFGLKLWKYVPTRLYSNF 10305938
10305939 VRCEEIIYE (2) 10305965
10306043 TIAEIVYEALEEEQLNCPDNDVKHIFISILQTEGLDTKEKISGIIDLITSAIET (0) 10306204
10306286 LSNTLSFLLHNLSQTVEYQREIAHEFAHCVQHITNEDLVSARFTKACIQE 10306435
10306436 SYRISPTTPCLARILEEDFQLSGYHLQAG (0) 10306522
10306624 TLVLCHTRVACLSEDNFQQADRFLPDRWLEQRDENDNVVNKRAEPGASVVLPFGIGRRMC 10306803
10306804 PGQKVIDIELTLLVAK (0) 10306851
10306952 IFQNFEIEYRSPLDTQFQFLLAPRTPIEIRFRDRT* 10307059

>CYPs2r3 = CYP314A1 , 547aa AAAB01008859.1 alternative N-term prediction NO ATG
This N-term resembles the Drosophila Cyp314a1 N-term, but it is 26500bp upstream
No annotated genes are noted in the genomic sequence in this 26000bp region
10277320 VIGLRGLGLVIGCHCSNFHNWLPFCFVLQLVPSWRMLWLSFYHSEWMSL (1) 10277466
10305029 AQTSPVSPPAPSPPPNDAGVPTVRSIWDIPGPRRLPLIGTKWRYFFGRHRYAKVHETFME 10305208
10305209 MHRRYGPIMLDVDTVPIVNLFDRADMEKVLRYPSRYPFRPPTEIVEVYRSSRPDRFGVTNLINA 10305400
10305504 QGAKWHELRAKLTTGITSRRVLQAFIPSVNEICDDFVDLVRRQRADDGTIRNFQDIANSVGLE 10305692
10305765 IICCLVLGRRMGYLTTNRQNAKFMRLAEAVKESFVYIGESYFGLKLWKYVPTRLYSNF 10305938
10305939 VRCEEIIYE  10305965
10306043 TIAEIVYEALEEEQLNCPDNDVKHIFISILQTEGLDTKEKISGIIDLITSAIET 10306204
10306286 LSNTLSFLLHNLSQTVEYQREIAHEFAHCVQHITNEDLVSARFTKACIQE 10306435
10306436 SYRISPTTPCLARILEEDFQLSGYHLQAG  10306522
10306624 TLVLCHTRVACLSEDNFQQADRFLPDRWLEQRDENDNVVNKRAEPGASVVLPFGIGRRMC 10306803
10306804 PGQKVIDIELTLLVAK 10306851
10306952 IFQNFEIEYRSPLDTQFQFLLAPRTPIEIRFRDRT* 10307059

>CYPs2r4 = CYP325K1 504aa AAAB01008859.1
8748006 MLPGLFVLAACLCAVTLSWYWKQRLRWADDIPRARPTHRWLGNVGDFLGKSPGEVFLVLD 8747827
8747826 RHFRQHDRLFTLRFGSQLAIGLTHPELVQKVLTHPDCQAKPDLYKVVRLPNGLLAAK (1) 8747656
8747572 YDVWKVHRKTLNSTFNARILESFVPIFNDCTQRLVGRLDRYARSG 8747441
8747440 DRCNILEYISACTLEMISRTSLGGKVLEREGAEQFIANLEV (2) 8747318
8746879 ALKTIGVRIFNIFLHIDFIYQFTALYRKEMRAINICQQFTSK (0) 8746754
8746675 IIQAKREEIGRLCDENSNQKLEPEQEHHYRKPQIFIDQLMKMPLTDPSARHFSDEEI 8746505
8746504 SDHIYTMIVA (0) 8746475
8746408 GNETSATQLAHTCLLLAMHPHIQTKAYEEVAGLVFSPDQEITIELMKDLHYLECVLKEAM 8746229
8746228 RLMPVAPIVGRQSRAEIVLDGHRIPQGSVFLFHFYALHRRKDVWGPTADEFEPGRFLADG 8746049
8746048 GRHPYAHLPFSGGPRGCIGYRYAMMSLKTLLAQLLRNYELMTDLRYEDIRYQYQISLNLA 8745869
8745868 FPHAVRLRRRAV* 8745830

>CYPf2r1 = CYP6AA1 505aa AAAB01008859.1 also AY095933.1 (mRNA)
3051026 MGYVSVVLFLVVPALTLLYLYLKQHYRHWANRNLPQLEASFPLGNMKGVGSEIHFNDVLN 3051205
3051206 EAYAKGKAQSAPLVGLYFMLKPILIVTELDMVKRILVKDFSSFHDRGLYVNERDDPLSGH 3051385
3051386 LFALDGERWRYLRNKLSPTFTSGKIKLMFSTICEIGDEFLATVNRFVERDEPLDVKLLSQ 3051565
3051566 CFTCDVVGSCAFGLQCNSLKNGGSKLLEIGDKVFKPPAWRNMLAFALISFKKLAKRLRLP 3051745
3051746 VLPGEVTSFFMPLVTETVADRERNSIERPDFLNLLIQLKNKGTVEDETTEGLQKLTLDEV 3051925
3051926 AAQAFVFFFAGFETSSTTLSFALFELANNPDIQERVRAEMLEKLQLHDGKITYDALKEMT 3052105
3052106 YLDQVIN (1) 3052126 
3052230 ETLRMYPPVPQLIRVTTQPYKVEGANVSLEPDTMLMIPIYAIHHDASIYPDPERFDP 3052400
3052401 DRFALAATHARHTHAFLPFGDGPRNCIGMRFGLLEVKFGIVQMVSKLRFTVSERMQMPLR 3052580
3052581 MSKTASILEAEGGIWLNATKL* 3052646

>CYPf2r2 = CYP6AA2 501 aa AAAB01008859.1
3048722 MTVWLLLVVVVATLLYYYVWRRYRYWRDRGIAELDPSFPLGDMKGVGTTRGFNDMLDEAY 3048901
3048902 GRVRGKSAAVGVYFLISPILIVADLDLAKQILVKDFHLFHDRGMYVNERDDPLSGHLFSI 3049081
3049082 GGERWRYLRNKLSPTFTSGKIKSMFFTIREIGDELLACFDKYIDCGDPIDIKLLCQCFTC 3049261
3049262 DVVGSCAFGLQCNSLKNGGSKLLEIGDKVFRASPMRMVYSMAIGIFPRLSRALRLPALPG 3049441
3049442 DVSAFFRPLVQSTVEHRERNAVERPDFLNLLIQLKNKGTVEDEATEELQKLTLDEVAAQA 3049621
3049622 FVFFFAGFETSSTTLSFALFELANNPNIQERVRAEVLEKLQLHDGRITYDALKEMTYLDQ 3049801
3049802 VIN (1) 3049810
3049873 ETLRLYTPVPQLFRVTNESYHLPSLNVTLEKGTMVLIPVHSYHHDPALFPEPYRFDPD 3050046
3050047 RFTADAMKARHSHAFLPFGDGPRNCIGMRFGLLEVKFGLVQVLNKLRLTVNERTALPLRM 3050226
3050227 SKRSGFPEAEGGIWLNASRL* 3050289

>CYPf2r4 = CYP6P3  509 aa AAAB01008859.1
3040449 MELINAVLAAFIFAVSIVYLFIRNKHNYWKDNGFPYAPNPHFLFGHAKGQAQTRHGADIH 3040628
3040629 QELYRYFKQRGERYGGISQFIVPSVLVIDPELAKTILVKDFNVFHDHGVFTNAKDDPLTG 3040808
3040809 HLFALEGQPWRLMRQKLTPTFTSGRMKQMFGTIWDVGIELEKCMEQSYNQPEVEMKDILG 3040988
3040989 RFTTDVIGTCAFGIECNTLKTTDSEFRKYGNKAFELNTMIMMKTFLASSYPTLVRNLHMK 3041168
3041169 ITYNDVERFFLDIVKETVDYREANNVKRNDFMNLMLQIKNKGKLDDSDDGSLGKGEVGMT 3041348
3041349 QNELAAQAFVFFLAGFETSSTTQSFCLYELAKNPDIQERLREEINRAIAENGGEVTYDVV 3041528
3041529 MNIKYLDNVID (1) 3041561
3041641 ETLRKYPPVESLTRVPSVDYLIPGTKHVIPKRTLVQIPAYAIQRDPDHYPDPERFNPD 3041814
3041815 RFLPEEVKKRHPFTFIPFGEGPRICIGLRFGLMQTKVGLITLLRKFRFSPSARTPERVEY 3041994
3041995 DPKMITIAPKAGNYLKVEKL* 3042057

>CYPf2r5 = CYP6P5 509aa AAAB01008859.1
3037945 MEPVTIVLTAFIFVVSIVYLFVRSKHRFWKDQGVPHAPKPHLFYGHVKGQSRTRHGADIN 3038124
3038125 QELYRYFKQRGVPYGGISLFIMPSLIVVDPELVKTILVKDFNVFHDRGVYSNPRDDPFTG 3038304
3038305 NLFGLEGTPWRLLRQKLTPTFTSGRMKQMFGTIWAVALELEKYMEENYNQPEVEMKDVLG 3038484
3038485 RFTTDVIGTCAFGIECNTLKTPDSDFRKYGNKAFELDPITLTKFFFATSYPQLARKLHVR 3038664
3038665 TTQQDVEDFFMKIVRETVDYRETNNVQRNDFMNLLLQIKNKGKLDDHGTVVGKGEVGLTH 3038844
3038845 NELAAQVLIFFLAGFETSSTTQSFCLYELAKNPDIQDRLREEINRAIEENGGEVTYDVAM 3039024
3039025 NIQYLDNVIN (1) 3039054
3039154 ETLRKYPPVETLTRKPSSDYVIPGTRHIVPKDTVVQIPIYAIQRDPDHYPDPE 3039312
3039313 RFDPDRFLPEEVKKRHPYVFLPFGEGPRICIGLRFGMMQTKVGLINLLRRFRFSPSARTP 3039492
3039493 ERVVYDPKMFTLSPIGGNYLKVDKIA* 3039573

>CYPf2r6 = CYP6P4, 506aa AAAB01008859.1
3034916 MDLLSYVLTAFVFVVSIAYLYLRSRHNYWRDRCFPYTRQKPHLLYGHMEQFQSKHASYIN 3035095
3035096 EELYWEFKNRGEPIGGMSMFFLPGLIVADPELVKSILVKDFSVFHDRGVFNDAKADPLSA 3035275
3035276 HLFALEGHEWRVLRQKLTPTFTSGRMKQMFGTIQQVAGEFLKYMNEHCHREIEMKDVLAR 3035455
3035456 FTTDVIGTCAFGIECNTLKNPDSDFRKYGNKVFEQDTLLMLKFMFATTFKGLAKRIGMKL 3035635
3035636 TDEGVERFFLQVVRETVEYREMNNVQRNDFMNLLLQIKNTGSLDGGDVPIKGAAGLTMNE 3035815
3035816 LAAQVFVFFLAGFETSSTTMNFCLYELAKNPDIQDRLREEIERAVEENGGEVTYDMVMNV 3035995
3035996 QYLDNVIN (1) 3036019
3036087 ETLRKYPPIESLSRVPMRDYTVPGTKHVIPKDTFIQIPVYALHRDPEFYPEPDQFNPD 3036260
3036261 RFLPEEVKKRHPYVFLPFGEGPRICIGLRFGVMQAKIGLITLLRNFRFTPSSQTPAKIVF 3036440
3036441 DPKSFILSPSTGNYLKVDKI* 3036503

>CYPf2r7 = CYP6P1, 509aa AAAB01008859.1
3032731 MSLLGVLLLGVVLLLSLAYLFLRSKHNYWRSRGFPCKPSPSLLYGQMQGNGTTRHAAYVT 3032910
3032911 QEIYRYAQDRGERYMGYSFFFMPIVMVCDIELVKTVLVKDFAVFHDRGMYSNPRADPLSG 3033090
3033091 NLFALEGHEWRALRQKLTPTFTSGRMKQMFGTMLQVATELHRHLLEQIDRELEMKAVLAR 3033270
3033271 FTTDVIGTCAFGIECNTLRNPDSDFLKYGRRVFEHRMLAMVKMTFAMLFRAQAVKLGVKV 3033450
3033451 TDDDLEAFFMNLVHDTVEHRERNGVQRNDFLNLLLQIKNKGCLEEQEQEGSASADRTGMT 3033630
3033631 MNELAAQVFIFFVAGFETSSTVMNFCLYELAKNPHIQERLRDELNRSIDANGGELTYDMV 3033810
3033811 MGHEYLGQVVN (1) 3033843
3033923 ETLRKYPPLETTLRVAGQDYTIPGTRHVIPRHVGVQIPVYAIHHDPAHYPEPECFDPDRF 3034102
3034103 SAEACRNRTPYTFLPFGEGPRVCIGMRFGMMQVKVGLVSMVRAFRFLPTAQTPDRIVFDP 3034282
3034283 KSFILSPAGGNYLRIVQV* 3034339

>CYPf2r8 = CYP6P2, 507aa AAAB01008859.1
3030696 MELLTLTLSLLVALATGLYLFVRNRYNYWSNRQFPTLPNQKLLFGHVKGVNTERHASYIS 3030875
3030876 SEIYREFKKRGDAFGGFNMFVIPAVMAIDPEFIKTILVKDFHIFHDRGLFSDPEIDPLSG 3031055
3031056 TLFALQGKAWKILRQKLTPTFTSGKMKQMFATVLEVAERLGQHVATHTGQMEMKDVLARY 3031235
3031236 TTDVIGTCAFGIECNTLRNPDSDFLKYGNKVFEQKVSTMIKIILVLMGRKISSKFTLKIT 3031415
3031416 DADVETFFMNLVRETVEYRERNNVKRNDFLNLLLQIKNTGKLWEGEEDHIGKGEVGMTMN 3031595
3031596 ELAAQVFIFFLAGFETSSTTMNFCLYELAKHPDIQERLRREIERAVEENGGELTYDVVMG 3031775
3031776 TEYLNWVVD (1) 3031802
3031870 ETLRKYPPLETVTRAPEHDYTVPGTAHVIPKGTMIQIPIYALHHDAQYYPDPERFD 3032037
3032038 PERFRPEVANARPAYVYMPFGEGPRICIGLRFGMMQTKVGLITLLRQFRFSPTEQTPDRI 3032217
3032218 RFMPNVFVLSPDSGNYLEVEKL* 3032286

>CYPf2r9 = CYP6AD1  500aa AAAB01008859.1
3027774 MVAFTWVLVLCTIVLTGVAVRMFLRRRQTFWQRHGIPAARHPHPLYGNVGGLVTKHHTAT 3027953
3027954 VLQRLYREFRERKLPAGGFNLYFSPVLLVVDRQLIERVLVNDFAQFQNRGLYASATVNPL 3028133
3028134 SSETLFSVAGERWHRMRQQLRPALGSSSVRTMFATTARIAQTLVVYIGAQSRRRDLEWTD 3028313
3028314 LMARYATDVIGSCAFGIDCRTIRDPGSEFRAMGHRAFRCSLRRMWKLRFGYACRRVADAM 3028493
3028494 RLCVSEPSVEQFFLQLCQSTVLHRESYQVVKRDFLQQLLEMKANGALDMRQVAGQCYSFF 3028673
3028674 IAGFETSASLLSFCLYELAKHGAVQDRLRGSIVAALDETDGQLSYDMVMALGYLDQVVK (1) 3028850
3028917 ETLRMYPPVDFLFRVASNDYPIDGFGTIPQGTLLVVPVHALHRDPAYYPQPDVYNPDRFA 3029096
3029097 ASSKLSGASKNRPPFMPFGLGPRHCIGDTFGLMLVKVGLVAMVRSFRFTLDVDRTPENVT 3029276
3029277 FKPRSLVLAAGSGMYLNVERV* 3029342

>CYPf2r10 = CYP6Z4  498aa AAAB01008859.1 (note: 6Z3 and 6Z4 names have been switched)
2552048 MFVYTLALFAVVLYLALRYVYSYWARQGFPHLRPEIPYGNLRALAEKRESFGVAVNELYT 2551869
2551868 RSTERLLGVYLFFRPAILVRDAHLAKRILVADFQHFHDRGVFCDEHRDPMSANLFALPGA 2551689
2551688 RWKRLRAKLTPTFTSGQLRQMMPTFLDVSEKLLAELEPLAAEGRVVDMRDISSRYVLDVI 2551509
2551508 ATVFFGFETHCLRDPNDPFVEPLRDLNNPNSFVNNIRSAGVFVCPGLLKLTGLSSLPPGM 2551329
2551328 RQFATEVVTHQIEHRERHPQQRRKDFIQLLIDLRREANGQDALTIAQCAANVFLFYVAGA 2551149
2551148 DTSTGVISFTLHELTHNGEAMAKARQEIDHVLERHGGVISYESLQELAYLDLCVKETLRK 2550969
2550968 YPGLPILNRVCTEDYPVPGAADVVIRAGTQVIIPLLGISMDEKYFPEPEVYMPQRFDEQA 2550789
2550788 PNYDPDAYYPFGLGPRNCI (1) 2550732
2550664 GLRQGIMLSKIGLVLMLSRFDFEATVPRKVRFEPANVTLTPDGGLPMKITVRGDRAKVQ* 2550485

>CYPg2r1 = CYP304B1  517 aa AAAB01008879.1
407900 MLATTTLLLWGVAISLLLYALVRPLTARPGKNFPPGPPGRFPFLGDYGLLLLINYRHLHK 407721
407720 AALVLGDYYRTKILGISLRDYPSIVVNDLTVAKEVLNRKVFDGRPDLYLARIRDRDYNRR 407541
407540 GIFFTDGPSWKEQRWFILRYLRDYGFGRRFAQHEAEVNSELLVLIDLLRYGPKHGHERAI 407361
407360 VRDDGYAKCPNVLFSCFANAFLQIVSGERLSREETGVLYD (2) 407241
407070 TGANAMVFQREGDDYGTILSYFPTLRYIFPFSRKFQRIRQASMNVNGFIETIIDKYLRTF 406891
406890 DENHVRCFLDLYFREMVKCTPQEPNFTFQ (1) 406804
406732 HDQLLLGLVDFFFPAISGATTQMALLFERLLHNPPVIERMQREIDEVVGHGRLPTLDD 406559
406558 RTQLAYTEATLREAMRIDTLVPSGIAHRVQEDTTLRGYDLPKDTLVLIGLDAIHNQREYW 406379
406378 GDPERFRPERFLDEHGRLALAKDLSVPFGAGKRLCAGETFARNIMFLTLAALMQNFNIRQ 406199
406198 PPNARLPDLSKRNTGVIIAPEDFWLKFEPR* 406106

>CYPg2r2 = CYP304C1  512aa AAAB01008879.1
410747 MMELMLLVALVVLIVSCAIRYALHRPSERFPPGPPRLPLLGSYPFLLALNYHHLHRAAAR 410568
410567 LSQLYRSKLVGLYLGPLPAVLVNDHETVRQVLQRSEFDGRPDLFLARLRDERYARR (1) 410400
410329 GIFFTDGDSWREQRKFFLKTLHEYGFGRRSDAVEQDLVAGLAELIALLKDGPVHEHERAV 410150
410149 VDASTGSALCPQVFFALFSNVMLRMLTATRLEREDQAVLYD (2) 410027
409921 VGHCSLAFHRQGDDYGLALSYIPWIRHVLPGPSRYRLLREVNQKANGVIRSLVEQCEQTY 409742
409741 SEDDQRCFIDAYIRELRRTGSKATSG (1) 409664
409556 NDQLIIGCADFLVPAFSAIPAKLGLMLERLVAHPAVAEKMYTEIDQSVGQARLPGLDDRT 409377
409376 HLPYCEAVVREALRIDTLVPSGIPHVATADTELAGFQIPKGTLIINGLDYINHQEDVFPE 409197
409196 PHTFRPERFLSDDGQQQQLALEHDRSVPFGAGKRVCAGESFARNALFLTLTTLVQQFTFS 409017
409016 MEGRTPDPEQHLTGVIRTAPDFRIKFTAR* 408927

>CYPh2r1 = CYP6AG1  452aa AAAB01008904.1
937117 MFVTVTLLVTAITFVYVYLAWYSNYWTKRGVPGPAPRLLFGNFPSFILRNRPFVDDFQDIYD (2) 937302
937370 KYRSKGNVIGVFNGRQPAV LVMKPELIKDVLIKNFKQFQDNEFADSVSKDSDPIFGRN 937543
937544 PFMLKGEEWKEKRAEVTPAFTTSR (0) 937615
937714 MKALFPFVEDVSNRMKQYIAQHTTKGPIETRELCAKYTTDVVSSCIFAAD 937863
937864 AQSFTKEKAEIREMGRKLLEPNFQIVMMFLLIGLIPALKKLIKISFVSK 938010
938011 EIEQFFTDLMEKAVAYREQNNVKRVDYLDHLMALRAKKQLSSLDMAAHGVTFFIDGFET 938187
938188 SSLAMCFTLYELARNPDCQETLRSELMAARNEDGSIDYDALLELPYLDQVLY (1) 938343
938418 EALRIWPPAAFLSKVCTVPTELEVTDGHKVLIERGLPVMLPVWAVHRDKEYYEEPERFNP 938597
938598 DRFSPATGGTKVYREKGCFLPFGDGPRQCLGMRFALMQVKRGLFEVITKYEVSVNSKSKQ 938777
938778 PIQLDPKAFIVCPLGGIWLDYKPIEA* 938858

>CYPh2r3 = CYP6AG2 498aa AAAB01008904.1 also BM594498 (mRNA, NO FRAMESHIFT)
this gene has duplicate exons 2 and 3 inside the gene see CYPh2r2
940993 MLLILFGTVVAFVALVYIFLTWEFGFWEKYGVKGPKPKILLGNIPYLLTKKRHTVYNYDQLYN (2) 941181
946085 DFKNEPAVGFFSIRSPQLMVRDPELIKEVLSKGFQNFAENDFSDTVDEKSDPLLARNP 946258
946259 FSLSGERWKTRRAEITPGFTNNR (0) 946327
946394 IKAMAHLMDEVCEHMTDYLRTQAKSSDGVATLDAKE (0) 946501
946566 VMAKYTTDVVASCIFAID
       AQSFVKENPEIRLMGKRIMNFNFVVQLALLVTTFFPSVKKFYKFTFIPK 946766 (FRAMESHIFT)
946766 DTEQFFIRIMQDAIRYRKENKINRTDFLDHLLQLQDRKQITDIDIAGHGVSFFADGFET 946942
946943 SSIVLTYCLYDLAKYPTIQQELRDEIAKAKQVGGGTMSYEQLGEMALLEQIICESMRIHP 947122
947123 LMAVMAKRCTTDTTLVGPKDRKIFVKKGTTVVLPYYSICFDAEHFADPYKYDPKRFAAEN 947302
947303 GGSKAYRERGVYFPFGDGPRMCLGMRFAVTQVRRAIVEVVERFSISVSSKTIEPFEMDPD 947482
947483 QFMLMPKGSIWLDFKPIA* 947539

>CYPh2r2 = CYP6AG2 AAAB01008904.1 duplicate exons 2 and 3
this gene has duplicate exons 2 and 3 inside the gene
943165 NDFKNEPAVGFFSIRSPQLMVRDPELIKEVLSKGFQNFAENDFSDTVDEKSDPLLARNP 943341
943342 FSLSGERWKTRRAEITPGFTNNR 943410
943474 IKAMAHLMDEVCEHMTDYLRTQAKSSDGVATLDAKE 943581

>CYPs2r5 = CYP329A1  507 aa AAAB01008888.1
like the cyp9 family probable cyp9 derived pseudogene heme sign. short
135603 MNQEDLYWFTFILVTLLGFFTYKLLTRHRSYFRLLRVPFERPHFLYGNLDDVLSGKLTTM 135782
135783 EKLEQFYRKFSNHG (2) 135824
135898 LFGFFNYMTPALYVRDPALIRQLLQPNMSHFESHGYFLDEEKDRFLGCQLHLVNGAEKTT 136077
136078 KMASFLSPIFRTPKVPCSMDVTTRRCCAALTDFIASRVELELELKAIFVKHTLNLFAGIA 136257
136258 FGKELNTFEEETDRFCAVASGMAYGTNPVQVIKTMAFYLMPGFMRTVGVQFTDREEMDYL 136437
136438 VKQYHTGASAPNLHSVARYLRQANGKMKPSEQLTDEQLSAQCAMFFTKGFEPTLNLLSFA 136617
136618 VYELAQNPDVQRKLYEEMHHNGLTTGSATGVPPFESIRTLPYLEAIVLETLRKWPSHPLL 136797
136798 VRECTKPFTIPATENGDRAAIPLKVGDKLYVSVWALHRSGDYYPEPERFSPERFVGKDVI 136977
136978 NAAQPSTFIPFGIGRGCLGQEFVKLMVKATLVALLQRFKLQPGERTPEPLQLIESASSLE 137157
137158 ARDGFWIRLEPRL* 137199

>CYPi2r2 = CYP4AA1  512aa AAAB01008888.1 BM641756 revised N-term 6aa
supported by EST 3900bp away
1507739 MTFFQA (0) 1507722
1503821 LEKSSAVELYTYLTLILVCVLLYIFSDYLKICALAFRLPGPKSYPIIGNCLDIARKD (1) 1503651
1503570 LITREMAQAYKNYGPLARVWIFVFPMFVVFDPNDLKMILSSKKHTNKSMFYKLLHNFLGRGLITSS (1) 1503373
1503300 GHKWSSHRKLIQPSFNIAILEKFIDTFTDSASFLIDKLPKEETVLNVTEYVNNCVLDILN (1) 1503121
1503060 EAVLGVPVKSVDKKEMEQSPFRQ (2) 1502992
1502928 GKVVAPYRITHPWLLFNSIYKLTDAATAELNQKKQLDDFSRK (0) 1502803
1502747 MIRRRREILKTLSPSDRRCLLDFMIEISNENPEFTEDDIIDEACTFMLA (0) 1502601
1502528 GQDSVGAAVAFTLFLLARHQDQQAKCYEEIERHIGTDCSKPPSAEGIRELRHLEA 1502364
1502363 CIKESLRLYPSVPLMARKIGEDVRVGKYNLPTGTEIMILPYATHRLEHIYPDPERFDPER 1502184
1502183 FGDGAPHQNPYAFLPFSAGPRNCIGYKFAYIEMKTVIARVLQNFHLSPAPGKEEVQPIFR 1502004
1502003 MTLRARGGLWVKMTPRKVVS* 1501941

>CYPi2r1 CYP4AA1de7_8 AAAB01008888.1 nearly identical to 4AA1
1501451 IEI*NENPEFTEDDIIDEACTFMLA 1501377
1501334 GQDSVGAAVAFTLFLLARHQDQQAKCYEEIERHIGTDCSKPPSAEGIRELRHLEA 1501140
1501139 CIKESLRLYPSVPLMARKIGEDVRVGKYNLPTGTEIMILPYATHRLEHIYP 1500987
1500988 PDPERFDPERFGDGAPH*NPYAFLPFSAGPRNCIGYKFAYIEMKTVIARVLQNFHLSPAP 1500809
1500808 GKEEVQPIFRMTLRARGGLWVKMTPRKVVS* 1500716

>CYPs2r6 = CYP306A1, 505aa AAAB01008977.1
214712 MIMLMCLVILLLFCCIFITLLSRHKKPPGPYGFPFIGCLTLIDPLKPYETFSRLARQYGT 214891
214892 TYGLWMGQVYTVVLTDPTLIRTILSKDEATGRAPLFITHGIMGGH (1) 215026
228242 GIICAQGNLWRDQRRLSIDWLRKLGMVKYGCARLNLERRINSGLIEMLQ (0) 228388
232374 DIDNMVDKAPQGLNPSPIIHHVLGNLLNDLVFGIKYEKNNVTWKYLQHLQEEGVKHIGV 232550
232551 SMAVNFLPFLR (2) 232583 
232678 YLPSTRRTINFLLSGKHQTHAIYDALISHQRSKLRSCDTFIEEQEECILTYFLKEAA 232848
232849 KRQEAGRPDAAFCDDIQLRHLMADLFGAGVDTTFTTIRWALLYIALYPTVQKRLREELRQ 233028
233029 RLVVNEPPSLKDVEALPYLRATIAEVQRIRTVVPLGIPHGTTK (0) 233157
233249 EIKIGDFKIPSNTMIMPVVWAVHMNPILFNAPNTFKPERFLDLEGRFSIPNYFLPFQV 233422
233423 GKRMCLGEELARNILHLYIANIVSHYDWIRISPEDAMLIDLTGNCGLTLTPPDYIIIFSKNNK* 233614

>CYPj2l1 = CYP305A2, 503aa AAAB01008960.1
4400554 MFAILLGLTVALLCAYLINEFRRPANYPP (1) 4400468
4398139 GPPWLPIVGNTPYIRKLARQYGGQHKVFELL 4398050
4398049 GKTYRSDVIGLKLGREYVVVALNYPAVNEVHRNDVFTGRPDNFFIRLRTMGTR (2) 4397891
4397826 LGVTCTDGAFWAEHRNFVTRHLRQVGYGRQPMQVQIQNELNELIDVIRERHQQPIWPGS 4397650
4397649 ILSISVINVLWTFVTGTRIPREDDRLQRLLRLLQDRSKAFDMSGGVLCQLPWLRFIAPEW 4397470
4397469 SGYNLLRRFNLELNEFFAPTIAAHHANFSEDKANDDLIYGYIKEMRDRQDDPQSTFTDLQ 4397290
4397289 LTMIILDIFIAGGQTTSTTLDLALMMMLVRPDIQARVRQEIDTTLRSDELPQQTDRSQLP 4397110
4397109 YTDAFLLEVQRFFHIVPVSGPRRTLADCSLGGYRVPKDTTVLIGLRTVHMDRDYWGDPEV 4396930
4396929 FRPERFLESERDTAGKPHLHTDRLMFFGIGKRRCLGEVLARACLFTFFVGVMQKFELLKP 4396750
4396749 EGGNREMEPSIVLRPGITLSPKPYEVVFRPR* 4396654

>CYPj2l2 = CYP305A3v1 508 aa AAAB01008960.1 N-term section added
4403555 MITLTLAALALILLVAFLVKELWRPANYPP (1) 4403466
4403392 GPRWLPIVGNTPLIRKMASQ 4403333
4403332 HGGLLANVFDKLSESYQSSVIGLKLGRERVVVGLGYAEVKDILCNEAFQGRP 4403177
4403176 DNFFIRLRTLGTR (2) 4403138
4403064 LGITCTDGSFWNEQRSFVTRHLRQVGYGRQAMHEQIQTELTELLDVLDTRAEQPLWPG 4402891
4402890 SILALSVINVLWTIVTGSRVAREDDRLQRLLELLQERSKVFDMAGGTLNQLPWLRFIAPE 4402711
4402710 WSGYNLVRRFNKQLTEFFYPTIEEHKGDFTEDRAVDDLIYAYIKEMRDREGTSNNGSNFT 4402531
4402530 EVQLTMIILDIFIAGGQTTSATLDLALMMMIVHPEVQEKVHREIDSQLEPNAIPHYDDRL 4402351
4402350 KLPYVEAFLLEVQRYFSIVPVNGPRRAVADCTLGGYRVPKDTTVLMGLRNVHMDPKHWGD 4402171
4402170 PEVFRPERFLDEQRQIVNTERLLPFGQGKRRCLGETLARSCLFTFFVGVMKRFCLVGTDE 4401991
4401990 GSEDGTSMAPSLTLKPGITLSAKPYHVVFQPRKRT* 4401883 

>CYPj2l2 = CYP305A3v2 508 aa AAAB01006489.1 N-term section added
3137 MITLTLAALALILLVAFLVKELWRPANYPP 3048
2982 GPRWLPIVGNTPLIRRMASQHGGLLVNVFDKLSESYQ 2872
2871 SSVIGLKLGRERVVVGLGYAEVKDILCNEAFQGRPDNFFIRLRTLGTR 2728
2654 LGITCTDGSFWNEQRSFVTRHLRQVGYGRQAMHEQIQTELTELLDVLDTRAEQPLWPG 2481
2480 SILALSVINVLWTIVTGSRVAREDDRLQRLLELLQERSKVFDMAGGTLNQLPWLRFIAPE 2301
2300 WSGYNLVRRFNKQLTEFFYPTIEEHKGDFTEDRAVDDLIYAYIKEMRDREGTSNNGSNFT 2121
2120 EVQLTMIILDIFIAGGQTTSATLDLALMMMIVHPEVQEKVHREIDSQLEPNAIPHYDDRL 1941
1940 KLPYVEAFLLEVQRYFSIVPVNGPRRAVADCTLGGYRVPKDTTVLMGLRNVHMDPKHWGD 1761
1760 PEVFRPERFLDEQRQIVNTERLLPFGQGKRRCLGETLARSCLFTFFVGVMKRFCLVGTDE 1581
1580 GSEDGTSMAPSLTLKPGITLSAKPYHVVFQPRKRT* 1473

>CYPj2l3 = CYP15B1  459 aa AAAB01008960.1
4404637 MWNGALIVIVLLSLLYCCWDARKPKRFPP (1) 4404723
4404782 GPYWLPFIGSGLVMLKLVRSLHYFHLMWSKLCHQYGPIVGVRFGQDRIIVVSGREAIR 4404955
4404956 AMYAKDQFDGRPDGYFFRMRSFGQRLGVALTDGSHWEVQRKFAVRTMKQLGMGRNDFVRV 4405135
4405136 IEREVQELVENFHRRAVKGETFPMSGSMDVALLNVLWVLLAGQRFELENERLGWLADTVH 4405315
4405316 RTFHVIDVSGGTLNRFPWLRYVCPESSGYGPMLRLLKPLWGFLK (0) 4405447
4405545 ETIETIRKNPHCPS
4405587 RRDSLISAFLVEMSRTERHESFTESQLVSLCLDLFQASVETMSSVLGFAFLYMLHHPDVM 4405766
4405767 RKVQQELDTVIGPDRLPTANDRPLLPYTEAVILEVERIATVVPGGLVHRAMEEVELCGYR 4405946
4405947 IPKDAIVMPLLYSLQMDADYWIDPDVFRPERFLSVQGDRVMQHDLFIPFGAGRRRCLGES 4406126
4406127 LAKPAVFLFFSAIMHRFEIECEGKELPSLNAVDGITLSPVPYTLRLAERVCR* 4406285

>CYPj2l4 = CYP305A4  524 aa AAAB01008960.1
4409289 MITLTLAALALILLVAFLVKELWRPANYPP (1) 4409378
4409448 GPRWLPIVGNTPLIRKMASQHGGLLANVFDKLSESYQSSVIGLKLGRERVVVGLG 4409612
4409613 YAEMKDILCNEAFQGRPDNFFIRLRTLGTR (2) 4409702
4409776 LGITCTDGSFWNEQRSFVTRHLRQVGYGRQAMHEQIQTELTELLDVLDTRAEQPLWPGS 4409952
4409953 ILALSVINVLWTIVTGSRVAREDDRLQRLLELLQERSKVFDMAGGTLNQLPWLRFIAPEW 4410132
4410133 SGYNLVRRFNKQLTEFFYPTIEEHKGDFTEDRAVDDLIYAYIKEMRDREGTSNNGSNFTE 4410312
4410313 VQLTMIILDIFIAGGQTTSATLDLALMMMIVHPEVQEKVHREIDSQLEPNAIPHYDDRLK 4410492
4410493 LPYVEAFLLEVQRFFSIVPVNGPRRAVVDCTLGRYRVPKDTTVLMGLRNVHMDPEHWGDP 4410672
4410673 EVFRPERFLNEQRQIVNTERLLPFGQGKRRCLGETLARSCLFTFFVGVMKRFCLVGTDEA 4410852
4410853 SEDGTSMAPSLTLKPGITLSAKPYHVVFQPRRNQKGRLQEEIKERINYAQ* 4411005

>CYPs2l1 = CYP49A1  521aa AAAB01008960.1
6510830 MVGQRIANSLLKRSAFSSALN (0) 6510892
6510971 AVNEQFSHARPYSDVPGPKGLPMIGNSWRFAPII (1) 6511072
6516929 GQYKIEDLDKVMQDLHRQYGRIAKVNGLIGHPDLLFVFDADLIRDTFKREDVLP 6517090
6517091 HRPAMPSLRNYKSKLRKDFFGDNMGLIGV (2) 6517177
6517262 HGEKWDAFRAQVQQVMLQPSTAKKYIAPLDEISSDFMDR (2) 6517378
6518069 IQEMRDENNELPGDFLHELYKWALE (1) 6518143
6518411 SIGRVALDTRLGCVSKDGNDESKRIINSINTFFWTVAEVELRMPIWRIYETTAYKNYIGALDTFRE (2) 6518608
6518732 LCMRHINIAMEKMNSSTEQKSEECISLVERILQKTNNPKIAAVLALDLIMVGVDT (0) 6518896
6518997 TSVAATSTIYQLSQNPDKQEILFNEIKRSMPSPDTKFTISMLETMPYLRACIKETLR (2) 6519167
6519253 MYPVVIGNGRSLQTDAVIGGYHIPKG (0) 6519330
6519403 THVIFPHLVVSNLQQYFPEPDRFVPERWLKRGELKEHSGCPHAGQKIHPYVSLPFGYGRR 6519582
6519583 TCIGRRFAECELQILLSK (0) 6519636
6519755 LFRRYQVEYNYEKLTYKVNPTYIPDKPLKFKLTERTS* 6519868

>CYPs2l2 = CYP302A1  511aa AAAB01008960.1
10627870 MNLPRQITKRLRGFSSVANKPSKR (2) 10627799
10627725 TVKSFDEIPGPRGPLGLGNLYQYIPGI (1) 10627645
10627583 GRYSFDELHRSGEDKYRQYGSIVRETMVPGQDIVWLYDPDDVATVLDDRTPGMYPSRRSH 10627404
10627403 TALEKYRKDRPNVYRTAGLLPT (2) 10627338
10627266 NGAEWWKIRSELQKGLSSPQNVRNFLPATDKITKEFVTRLRAQMEPGKS 10627120
10627119 ILIEDFMPLVSRLNLE (1) 10627072
10626993 LICLLAFDVRLDSFSEEQMDPGSLSSRLMESAETTNSCILPTDQGFQLWRYFETPAYRRL 10626814
10626813 RKAQEFMEKTAVELVSQKLLYFNEDQQRLASGEHGSKSLMEEYLRNPNLELNDIIGMASD 10626634
10626633 LLLAGVHTTSYTTAFALYHLGLHGATAQDRLYREAKKILPDPRENRI (1) 10626493
10626405 AEASYCRAVLKETLRLNPISIGVGRILNRDHVLGGYQVPRGTVIVTQNMISCRQEAYFRD 10626226
10626225 PQLFLPERWMRETKEPVHPHLVLPFGHGMRSCIARRLAEQSMLVLLLR (0) 10626082
10626011 LIRSFEIEWAGTVPMDVKTKLINQPDQPIRLRMKARTS* 10625895

>CYPk2l1 = CYP4J9  506 aa AAAB01008960.1
11689458 MDILTVVLLLVAFLLILYELRVQLSTHYRAGKRFPGPRALPLLGNAHNLLFNDQRRTFQL 11689279
11689278 PRGWAATYGDTYRILVRGILNLNAFQAKDVEPLLSSPKLIEKSMIYSLLHRFLGIGLLNS 11689099
11689098 TGSKWQHRRRILTPAFHFNILPSFLLTFQEECRRLVAQIGQYADKGAPVALQPLATKFTLNTIC (1) 11688907
11688833 ETAMGIKLDSMTMANEYRSKIEAIGTMLLQRLMNPWLFEDFTYKLSGLQGRFEKLLQPVH 11688654
11688653 AFTRSIIQQRRELFHQN (0) 11688603
11688529 WLKKLLNVHIFCRYTNLKQRYAMLDTLLAAEAKEQIDEDGIREEVDTFTFEGHDTTSAAV 11688350
11688349 IFTLLLLAHSPDVQQRLYEELQEVAQSRTDADDEFTQRDYTELRYMDMVLKESLRLYPPV 11688170
11688169 PFISRNISEDTMFGDRLVPKDTLFNVHIFDLHRDPAVFPDPERFDPDRFLPECVAERSPY 11687990
11687989 AYVPFSAGPRNCIGQRFAILELKTVLAAILMHFRILPVTKREELVFVADLILRTKDPIMV 11687810
11687809 RFERR* 11687792

>CYPk2l2 = CYP4J5  532 aa AAAB01008960.1
11691677 MASDWNVVVQSPLVISTLSILLLLLLWFVWDVFDKRGPTYTALRQFAGPPVWPLIGTMYHTRRLDAAKAFDAF 11691459
11691458 RRWTSQYGGSYKLWLNRYLFILNITRCTEAEPFLSGSRNTEKSLLYRFMYPFIGVGLL 11691285
11691284 NSAGAKWLQRRRILTPTFHFNILNGFHRTFCEESEKLAAKIDSKWDGCEGAAVEIELQSA 11691105
11691104 MSQLTLNTIC (1) 11691075
11690984 ETSMGVKLDALDGAKEYRE 11690928
11690927 GIYRVGEMLLNRAVRPWLYVDWIYWLLGYSRQLQRLLKPLHLFTASIIAQRRDLFAQGK 11690751
11690750 LNDLSSSQDEDHSLYSTTPGGKKRYAMLDTLLTAEMQGQIEPDGIREEVDTFTFEGHDT 11690574
11690573 TGSALVFILLTLSWELEIQTRLHQELSQLATQNDLTDGHLSPNDLNSAKFFDRVIKECLR 11690394
11690393 LWPPVAFISRSVTEEIHLPDGRIIPQGCIANLHIFDLHRDPAQFPDPERFDPDRFLPECV 11690214
11690213 SQRSPYAYIPFSAGPRNCIGQKYALLEVKTAVAYLVLRYRILPATKREEIRFIADLVLRS 11690034
11690033 ATPLKVRFERRQNA* 11689989

>CYPk2l3 = CYP4J10  533 aa AAAB01008960.1
11694155 MLLAVLVCVLGSCIAILLVRDYRSKQTDGYRAALRYPGGTIVPVFGSLFELLFKNP (1) 11693988
11693921 VQTFAYARANATRYGASYRQWIDGSVILNVTRVQEAEKILSSTQHTRKSILYRFLHPLM 11693745
11693744 GDGLLCSKGAKWQQRRRILTPAFHFNILPKFLTIFQEESEQLVRRLDRLADGVQDVVLQP 11693565
11693564 IVTSFALHTIC (1) 11693532
11693456 ETAMGVKLDAYREADEYKQKVYEVGEMLVHRTMSPWLYSDRVYRLLGYDGPLAKS 11693292
11693291 LKPIHHFTRSIIRQRKETFQAAQLTADSTTEENM (2) 11693190
11693113 YFGSKQRYAMLDTLLAAEAKQQIDEEGIREEVDTFMFEGHDTTAAAIMFTLILLAIEQDV 11692934
11692933 QERCYGELQEVLDRSSSDPRSVQDYQNLPYLDRVIKESLRLYPPVAFISRTTSGELVV (1) 11692760
11692336 DGTTFPHNTMSHIHIYDLHRDPVQFPDPERFDPDRFLPEVAEKRNPY 11692196
11692195 AYVPFSAGPRNCIGQKFAQLEMKTVLVAVLERFRLKPVTRREEIVFMADLVLRAKTPLKV 11692016
11692015 RLERR* 11691998

>CYPs2l3 = CYP301A1  517 aa AAAB01008960.1
12196516 MVEALNVGTDGAQTTASSSSSARNTIRLEDARPYSEVPGPKPLPILGNTWR (2) 12196364
12194243 VFPIIGQYKISDVAMISFLLHRDYGRIVRLGGLIGRPDLLFVYDCDEIEK (0) 12194094
12194015 VYRNEGPTPFRPSMPSLVKYKSELRKDFFGDLPGVVGV (2) 12193902
12193548 HGEPWREFRSRVQKPVLQLSTVRRYVSPLEQVTEEFIDRCQQLLDDRKELPDDFDNEIHK 12193369
12193368 WSLECIGLVALDTRLGCLEPNLDPKSEPQQIINAAKYALRNVATLELKAPYWRYFPTPVW 12193189
12193188 YKYVSNMDYFVK (2) 12193153
12193081 VCMKYIKNATQRMKLNEGRALDGEPSLLERVIKSENDEKLAVVMALDLILVGIDT (0) 12192917
12192780 ISMAVCSILYQLATRPAEQQKLYEELKRLMPDPKTPLTIQLLDQAHYLKAFIKEVLRVYS 12192601
12192600 TVIGNGRTLQEDTVICGYRIPKG (0) 12192532
12192451 VQCVFPNLVLGTMEEYVSDAQRFKPERWLKPAQGGSGDQLHPFASLPYGYGARMCLGRRF 12192272
12192271 ADLEMQILLAKLLRSFKLEYHHKPLKYEVTFMYAPEGALKFKMTPREE* 12192125

>CYPs2l4 = CYP6AH1  499 aa AAAB01008807.1  N-term added
2518283 MLEFYVAVIVLAVCLYFKWSCSYWTRQGGVAGPKPLPIFGNLFEQLTGQKHFGEIFEE 2518110
2518109 MYRAFPQASWIGYYKISNQPGIVVRDLELVKEVLTSSFSSFNQNDFIIDEKLDPLVAFNP 2517930
2517929 FVQAGERWKERRGQMTSVFTMNRIRATFPLVQQVAQDFVQFIERTRKMDPHFEGKD (0) 2517762
2517694 ICAKYTINVVASVAFGIDAESFTNPNAEFPRMGNALFAPTWLTAIRSQLALFAPGLAKLLRVP (2) 2517506
2517442 FVPGYVDRWFRCMVRETIRQREGAK 2517368
2517367 RQDLFQVMYDSLSENGTVEANENHLVGHSVTFLSEGFETSSSMMSYLLYE (0) 2517218
2517151 LASNPSIQDRVVKELRTVLEESDGQLTEAALHKLVYMEAAMMETLRMHTPVFTLPR 2516984
2516983 ICTQDYELPPQFPTDTKRITLRRGTSVIIPVYAIHYDPDIYPMPYKFDPDRFLEENRKSR 2516804
2516803 PRHAFLGFGEGPRLCL (1) 2516756
2516687 GMKFALHQSKIGIATLLNKYRVKVSSKQELPLEFAKSSFLLNPKSGIWLNFEDRE* 2516520

>CYPl3r1 = CYP12F4  515 aa AAAB01008964.1
8081110 MLKLTTANSLRFRPFGGAVRWRSATAQPAADTSVDPEWENALPFEKIPAPSLLGFLKEFGPF (1) 8080925
8080869 GKYKDGNLYDINKRLRELYGPILRMNGSFGREDLVMTFVPEDFEKVLRSEGPWPRRTGMD 8080690
8080689 SFVYYRKQHRPEYFKGYGGLLAE (2) 8080621
8080562 QGEDWHKMRTIVNPIMMQPKVIRQYVDKVDTVAREFMAI (2) 8080446
8080383 VHGLRDEKQELPADFNEWLNRWAFETMGVLVLDSRLGVLDKDQTPEVTHFID (0) 8080228
8080161 LTKEAVTLFYQLDILPSIWRKLKTPAFYRLMRALDELYH (2) 8080045
8079985 LIATRIDEAVIRMEKNPSADQDTLSILEKLLKVDRNAAFTMSMDSLFAGVDT (0) 8079830
8079768 TSSGSTGILYCLAKNPDKQEKLRAELRKIMPNKDSPLTPDSMKNMPYLRACIKESLRMYP 8079589
8079588 PTSGNGRCTGKDLVLQGYRVPKG (0) 8079520
8079454 ILVGMGQLVLQREEGYFTRPSEFMPERWLSGEAAAGCPSAKEVHPFVYLPFGFGARSCIG 8079275
8079274 RRLAMMEMEILVCRMVRKYDVGWNYGELKYRATLVNIPANDLKFQLKEVSD* 8079119

>CYPl3r2 = CYP12F3  523 aa AAAB01008964.1
8078481 MLMRRCWLMKPIGCTRSGRWRNVQAQAQRNTATAEHVIDPEWASAKPYKSIPGPTLWQLFRGFSKG (1) 8078286
8077888 GCYDGLNLIELHIRLRQEYGDIYRIPAAMGRADVVMSFAPEDFEKVFRTEGQYPVRRSFDT 8077709
8077708 MTYYRQQVRPDIFGELGGLVTS (2) 8077643
8077574 QGESWQKMRRICNPVLLNPKTVKVYVEQMDAVSLEFMEI (2) 8077458
8077386 MANLRDEKNELPADFNEWLSRWALETTGVLALDTRLGVLHSTDSGEGQRLVD (0) 8077231
8077164 VVNEIFCLTYQLDVLPSVWKYISTPKFNRLMKLFDKLTN (2) 8077048
8076986 LILDQIERAIVSFEKNPTTDSNHSALKKLLSINKHVAVIMALDMIFAGIDT (0) 8076834
8076772 TSAGSVAILYCLAKNPDKQAKLRAELCTIMPTKDTRLTASMMSNLPYLRACIKEGMRMFP 8076593
8076592 PAAGNFRATGRDIVLQGYRVPSD (0) 8076524
8076454 TDIAMGAQVLLRDEKYFHRPTEF 8076386
8076385 IPERWLNDRDASIPSAKEVNPFIFLPFGFGSRSCIGKRLAMMEMEVILARWIRQFEFRWN 8076206
8076205 YEDYKFRTTVINMPGCPLKFEIRDLDD* 8076122

>CYPl3r3 = CYP12F2  522aa AAAB01008964.1
8075699 MNVLKSPLWQHWLRSSVLPYGTTSNRLLSAQAAVEHVDPEWSTAKPYESIPTPSFMEMTRMFGNK (1) 8075505
8075435 GRYANLDLVELHSRMWEDYGDIIRFKGMFGRRDIIMTYSPPDIEKVFRNEGQWPIRRGF 8075259
8075258 DSFTYYRTHVRPDIFSETGGLVTE (2) 8075187
8075095 HGEKWQKVRTIVNPVMMQPKTIKLYVDQVDEIAREFMTL (2) 8074979
8074912 VAGMRDEKNEVPKDFDQWLNRWALETMGVLALDTRFGVLKDEQTEEAKKILG (0) 8074757
8074690 LVRNIFELTYKLDVEMSLWKYISTPAYRKMMSVFDDLTA (2) 8074574
8074508 LIMAKIDEAKQRLEKQPSNSANQSVLEKLLKINKHVAVIMSLDMLIAGIDT (0) 8074356
8074294 TSSGSTGVLYCLAKNPEKQAKLREELRTILPKKDSPLTAENMHNLPYLRACIKEGLRMYQ 8074115
8074114 PVAGNMRAAGRDLVLQGYQIPKG (0) 8074046
8073976 TDIAMGTAVLQRSEKYFRRASEYLPERWLSERPADVPSAKDSNPFIFLPFGFGARSCIGK 8073797
8073796 RLAMMELEMITARLVRQFELRWNYDKLHFKQALINIPANPLQFELRDVDH* 8073644

>CYPl3r4 = CYP12F1 522aa AAAB01008964.1
8073186 MAWRTLMQRSRGSTERLCAKRYVNTVAAATKQYIDPEWSNAKPYKAIPSPKLLAFAKEFKEG (1) 8073001
8072938 GRYYELTGADLFAQWREDYGDLIRIKGIFGRPDIVVTFQPEDFAKVFRTEGAWPIRRSSA 8072759
8072758 TLSYYREKVRPEVFGELSGLITT (2) 8072690
8072628 QGETWQQLRTIVNPVMMQPKIIRLYVDQVDAVAREFMTI (2) 8072512
8072445 VAELRDAKCEVPADFNQWLNRWALETMGVLALDTRLGVLRPEQTTGAKAIIS (0) 8072290
8072231 LVQKIFDLMYRLEFEPEYVLWKYFQTPSLKLLMQELDNLTN (2) 8072109
8072038 LVMGKIDEAVRRIEKAPKMEGTQSVLEKLLKTNKQLAVVMAFDMIMAGIDT (0) 8071886
8071819 TSSSTFGILYCLAKNPAKQALLRKELRSILPHHDSPLTPENMRNLPYLRACIKEGLRLYQ 8071640
8071639 PTPANVRNVGHNIVLQGYRIPKG (0) 8071571
8071514 TEVVMGTLALQRDATYFPQPDAFLPERWLPEGQGMGIPSGKEAHPFIFLPFGFGARSCIG 8071335
8071334 KRLSMMEMEIVIARLVRRYEVGWNYGKLKVKMGFVTTATVPLQFELKDVID* 8071179

>CYPm3r1 = CYP6S2  504aa AAAB01008964.1
5496882 MLIVAVFVAFFGIFWIYFHFRQRYLFWLNRDVPYLEPTFPFGNMIDIFNPNIHFAHLIQK 5496703
5496702 LYRQLKDRGDYVGLFFFRDPVLLVLSPEFARTVMVKDFNYFVDRGVYSNEEFDPLSANLF 5496523
5496522 FMEGAKWRKLRSKLTPTFTSGKLKAMFHTIVDVANRLDQHLGERCVRMQRIDIKELLARF 5496343
5496342 MTDVIGSCAFGIECNTLENPNSQFRLMGKRMINLPKLKSLKVFFAMMFRKQAQALGIRYN 5496163
5496162 DKDVADFFMNVVRDTIRYRAENGVRRDDFMQLLIDMMQENGAGAGESLTFEEIAAQAFVF 5495983
5495982 FFGGFETSTTTLTFALHLLAQHPKAQRKARKCVRSTLAKHGNEMTYEAIKDMYYLECVIH (1) 5495803
5495726 ETLRLYPPVASIHRMTSQPYQLPNGEVIPEGVGVIISNLAFQHDPTLF 5495583
5495582 PDPLAFKPERFEDKTFAKTNPSYLAFGDGPRMCIAMRFGKLQTCLGLAMLLKSYTFSLED 5495403
5495402 CDVDRPLLIDPINLMYGPAGPVWLNVERYVEGSKSS* 5495292

>CYPm3r2 = CYP6S1  498aa AAAB01008964.1
5494835 MFVQFLLVVSLGWLWIYLHFKQRYRFWAERQVPFLEPSFPAGNVPDTLKPTIHFAYIIEK 5494656
5494655 LYKRLKSKGDYVGIYFFRDPVLLVLSPEFARTVLVKDFNYFVDRGVYSNEEVDPLSANLF 5494476
5494475 FLEGNRWRKLRSKLAPTFTSGKLKAMFHTIVDVGNRLDQHLAEKCQQVKRIDVRQLMACF 5494296
5494295 LTDVIGSCAFGIDCNSLENPNSQFRVMGKRMINLPKLKALKVFFAMMFRKQARALGIRFN 5494116
5494115 DEDVSDFFMNVVRDTIRYREEHGERRDDFMQLLIDMMKQDGGAEEDPLKFEEVAAQAFVF 5493936
5493935 FFAGFETSATTLTFVLHLLAKHPEVQLEGRECVRDVLAKHDNKLSYDAVMEMEYLGWIVN (1) 5493756
5493688 ETLRLYPPVATLHRITTQPYQLPNGTILPEGVGVILPNLAFHYDPDYFPDPYDFKPE 5493518
5493517 RFAVKNDFKNNFSYLPFGEGPRMCIGMRFGLLQTRLGLAMLLRNYHFTIDPSDAARPLRI 5493338
5493337 DPINLTHGPEGQVWLNVERIA* 5493272

>CYPm3r3 = CYP6R1  499aa AAAB01008964.1
5491615 MLIVAWLLSAVLSLCFVLCVIHIRKKYSFWSERGVPFVPARFPLGNIQHASHLMLDLYRA 5491794
5491795 LKGKHPFGGIFQFTEPVAMITDPEMIRNVLVRDFRHFYNRGGYINRQHDPLSGHMLNSGS 5491974
5491975 ERWSVLRHASSPIFSTGRLRAFLPDMVQMIDQFQAYLDAKLAAEGEMIELKGVLERHNTD 5492154
5492155 IAMRFLLGREGNNLLAPEGGLHEAVMRGGFLLPSVWKLFLMTSYRAVARKLRLKVCSREL 5492334
5492335 RETVERAVEEAINSKLHEHRPEASRRVDLIDQLVKAPGFDGKSSLTLSEIAAQVFLFVAA 5492514
5492515 YETNAITTFYCLYELAQRPELQQRARACVCEALEKHGGITYEAIAQMPYLDQCIN (1) 5492679
5492750 ETLRKHPLAINLIRVVTEDYPVPDSTGIVLPKGLNIIVPVYAIHYDPQHYPEPERFDPDR 5492929
5492930 FTPEACRQRAPYTFLPFGAGPKICIGYRQGKLQLRTMLAVLLSSYEFATCANTTPGALTN 5493109
5493110 AHTVIKPQGDLWLKVKKLNRVVAA* 5493184

>CYPm3r4 = CYP6N2  501aa AAAB01008964.1
5489754 MLLYLLLLAVTAAIWYVRRKYTFWADRGVPYVKPRFPFGNIQGIGRRMHSSQLMTKFYNE 5489933
5489934 MKTSGRPFGGIYFFTNPVALALELDFVKNVLVRDFAHFHDRGVYYNEKDDPISGHLFNIE 5490113
5490114 GTKWTNLRKKLIPTFSSGKMKMMCPTIVSVGGQFRECLERCIAHSDGEVEMKELLARFTT 5490293
5490294 DVIGTCAFGIECNSLNDPNAEFLRMGRKVFEVPRGRILKFFFMATFKDFSRRIHIKGTAE 5490473
5490474 DVSQFFFKVVRETIEYREQNNIVRNDFMNLLMQLKNSGQLDGSGEEVGKLSLNEIVAQAF 5490653
5490654 VFFLGGFETSSTTMSYCLYELALNEAIQQRARECVVEAVKTHGGLSYEALMDMPYIDQCIN (1) 5490836
5490914 ESLRKYPPGANLIRQVSQDYRVPGTDVTFPKGMNVMIPVYAIHHDADNYPDPERYDPDRF 5491093
5491094 APEACESRKPYSFIPFGEGPRICIAARFGMLEARVGLAVLLMHFSFARCSKTNVPLVISS 5491273
5491274 RHAVLTPEGGLWLKVEKLKE* 5491336

>CYPm3r5 = CYP6Y2  519aa AAAB01008964.1
5486917 MELVVTSVISLGVLLATLCLCVYLLVVRKYSFWRSYHVPYVEPELPYGNFKEMGKSIHPA 5487096
5487097 HLSQRFYEQYKAVPGSPGFVGLYIFLNPVLLVTDLKLAKRILIEDFHHFPDRGVYFNEKD 5487276
5487277 DPLSAHLFAIEGQRWKDLRAKITPTFTSGRMKAAFPLVLGIAEQFCGFLREQYTSDDVVE 5487456
5487457 VRDLMARFTTDVIGSYAFGLELNSFRDPQNEFRRIGRKHFDTPRNHPLKVFIMKTFRGLA 5487636
5487637 NRLGLKLLHDDVAAFFQSVIRETIHHREGHGVRRNDFLDLLIRLKNTGSLEGSHEIVGRL 5487816
5487817 SGDEIAAQAFIFFTAGFETSSSAMTYTLYELALNQEAQRKARECVLETLAKHDGVVSYES 5487996
5487997 SKNMLYLDQCIY (1) 5488032
5488098 ETLRKYPPVAILERIVTKPYRIPDTSVTLHPGMKIMIPAYAIHHDPDIYPEPATYDPDRF 5488277
5488278 TPERMARRDPCAYLPFGEGPRICIGLRFGMMQARIGLALLLKHFQVLPCKETDVPLTYSP 5488457
5488458 RAFVLTPVNGVRLRLVKYDAHGAAEGN* 5488541

>CYPm3r6 = CYP6Y1  504aa AAAB01008964.1
5484629 MFLQLVGVVLAIVLSCLAWIHRRYHFWKDRSVAYIKPRFPFGNFATLGKVEHIAPITQRH 5484808
5484809 YDHFKRQNVPYGGVFMLTSPLLYIFDTKLIKQLLVKDFHHFPNRGVYFNERDDPLSAHMF 5484988
5484989 AIEGQKWRTLRAKLSPTFTSGRIKMTLPLITQVCERFCEHLNESLQSSDEIEVHDLLSRY 5485168
5485169 TIDVIGACAFGIECNSFREPDNEFRRYGKIAFDKLRHSPLVVYLMKAFRAHANALGMKQL 5485348
5485349 HDDVSGFFMRVVKDTVEYREREQIVRNDFMDLLLKLKNTGRLEADGEEIGRLTFEEIAAQ 5485528
5485529 AFIFFTAGYDTSSTAMSYTLYELALNPEVQERARECVKQTLQKYDGKLSYEAVSEMSYLEQCIS (1) 5485720
5485797 ETLRKHPPVAILERNADKDYRLPDSGLLLRRG 5485892
5485893 QKIMIPIYAMHHDPAHFPEPEQYRPERFSPDEVARRDPYCYLPFGEGPRVCIGMRFGSIQ 5486072
5486073 AKLGLASLLDRFRFSACDRTQIPVQYSRTNFILGPANGVWLRVEVLDA* 5486219

>CYPm3r7 = CYP6M1  503aa AAAB01008964.1
5484042 MWFPTIEVLVALLALLGGAVYFIVRKQSYWKERGVPHPKPTFFFGSFKDAGTKIHFTEEV 5483863
5483862 ERHYAIYKGKHPFIGVYMLTTPVVLPLDLELIKAIFVKDFQYFHDRGTYYNEKHDPLTAH 5483683
5483682 LFNLEGQKWRNLRNKMTPTFTSGKMKMMFPTVVAAGQQLRDFMEENVQKHGEMELKDVMA 5483503
5483502 RYTTDVIGTCAFGIECNSMRDPDAEFRAMGKLFMERQPSQFVNMMVQFSPKLSRLLGIRF 5483323
5483322 IDKEVSTFFLKVVRDTIDYRVKNGIQRNDFMDLMIRMLQNTENPEEALTFNEVAAQAFVF 5483143
5483142 FFAGFETSSTLLTWTLYELALNPEVQEKGRQCVQEVLAKHNGEMTYDAIHDMKYLDQILK (1) 5482963
5482891 ESLRKYPPVPLHFRMTAQNYRVPDTDSVIEAGTMLFIPIFSIQRD 5482757
5482756 ASLFPEPEKFDPERFSAEEEAKRHPFAWTPFGEGPRVCIGLRFGMMQARIGLAYLLQGFS 5482577
5482576 FAPYEKTSIPMKFITNSFILGPREGLWLKVNKLESKQG* 5482460

>CYPm3r7 = CYP6M1v2  503aa AAAB01008119.1 8 aa diffs with CYP6M1v1
24150 MWFPTIEVLVALLALLGGAVYFIVRKQSYWKERGVPHPKPTFFFGSFKDAGTKIHFTEEV 24329
24330 ERYYAIYKGKHPFMGVYMLTTPVVLPLDLELIKAIFVKDFQYFHDRGTYYNEKHDPLTAH 24509
24510 LFNLEGQKWRNLRNKMTPTFTSGKMKMMFPTVVAAGQQLRDFMEENVQKHGEMELKDVMA 24689
24690 RFTTDVIGTCAFGIECNSMRDPDAEFRAMGKLFMERQPSQFVNMMVQFSPKLSRLLGIRF 24869
24870 IDKEVSAFFLKVVRDTIDYRVKNGIQRNDFMDLMIRMLRDTENPEEALTFNEVAAQAFVF 25049
25050 FFAGFETSSTLLTWTLYELALNPEVQEKGRQCVQEVLAKHNGEMTYDAIHDMKYLDQILK (1) 25229
25306 ESLRKYPPVPMHFRMTAQDYRVPDTDSVIEAGTMLFIPIFSIQRDASLFPEPEKFDPERF 25485
25486 SAEEEAKRHPFAWTPFGEGPRVCIGLRFGMMQARIGLAYLLQGFSFAPYEKTSIPMKFIT 25665
25666 NSFILGPREGLWLKVNKLESKQG* 25737

>CYPm3r8 = CYP6N1v2  501 aa AAAB01008119.1 complete seq allele of CYP6N1v1
30957 MWIHLLVITLLVAVYWVRQRFAYWEKRGVPYVPPTFPQGNLAGVGKKRHMSEILQSCYKQ 30778
30777 LKSSGRPYGGIHFFINPVALLIDPDLIKTVLVKDFPYFHDRNLYHNDRDDPLSRHLVAME 30598
30597 GSKWKNLRAKLTPTFTSGKMKLMFSTVTAVAEEFDRCMSDEVKINPVVEMKDLLARFTTD 30418
30417 VIGSVAFGLECNSLKDPDAKFRVMGRKVFQASPYRALKIFLAAQFPEIARALHVKLTQPD 30238
30237 VSDFFMGVVKDTIDFRRNNNVQRNDFMTLLMKVMKEQIENGEAGGDPKDQLTMDDIAAQA 30058
30057 FVFFLAGFETSSTAMSFCLYELALNQELQDKARQNIAEVLKNYDTISYEAVHEMKYIEMCIN (1) 29872
29808 ESLRKYPPATTLTRRVEKDYRVAGTDQVLEKGIMVAVPVYALHHDPEHFPNPEQFDPERF 29629
29628 TAKQSEKRHPFAFLPFGEGPRICIGLRFGMMQARIGLVYLLKHFRFTLANDRMSVPLKIS 29449
29448 SASPILTIDGGLWLNVERL* 29389

>CYPm3r8 = CYP6N1v1  501 aa AAAB01008964.1 partial seq allele of CYP6N1v2 partial seq
5477549 MWIHLLVITLLAAVYWVRQRFAYWEKRGVPYVPPTFPQGNLAGVGKKRHMSEILQSCYKQ 5477728
5477729 LKSSGRPYGGIHFFINPVALLIDPDLIKTVLVKDFPYFHDRNLYHNDRDDPLSRHLVAME 5477908
5477909 GSKWKNLRAKLTPTVHSGKMK 5477971
5481491 ILTIDGGLWLNVEQL* 5481538

>CYPm3r9 = CYP6M2  499aa AAAB01008964.1
5471079 MFSLLDFTFLVAALAAGLYYYLDRKRSYWQDRGVPGPKGELLFGNFGSIGTKEHITVPFK 5470900
5470899 RIYDDNKGKHPFAGMYQFVKPVALITDLELLKCVFVKDFQYFHDRGTFYNERDDPLSAHL 5470720
5470719 FNLEGQKWRSLRNKLSPTFTSGKMKMMFPTIVTAGKQFKDFMEETVLRENEFELKDLLAR 5470540
5470539 FTTDVIGMCAFGIECNSMRNPDAEFRAMGRKIFEISPGTFKTMMMNGMPELAKMLRMTQT 5470360
5470359 DKDVSDFFMNAVRDTINYRVKNNVQRNDFVDLLIKMMSKDGEKSDDDSLTFNEIAAQAFV 5470180
5470179 FFLAGFETSSTLLTWTLYELALNPEVQEKGRECVREILQKHNGEMSYDAVVEMKYLDQILN (1) 5469997
5469918 ESLRKYPPVPVHFRVASKDYHVPGTKSVLEAGTAVMIPVHAIHHDPEVFPNPEQFDPERF 5469739
5469738 SPEQEAKRHPYAWTPFGEGPRICVGLRFGMMQARIGLAYLLDGFRFAPSSKTVIPMELSK 5469559
5469558 ESFIMAPKGGLWLKVDKI* 5469502

>CYPm3r10 = CYP6M3  500aa AAAB01008964.1
5468001 MEPLDILISVVMLCLAVYFLLDRRFQYWTDRGVPQSKPELVFGNVREVSRTIHLADKFRE 5467822
5467821 IYNELKGKHPLVGVYLFFKPVALITDLELLKCVFVKDFQYFHDRGTYYNEKHDPLTAHLF 5467642
5467641 NIEGQKWKNLRNKLSPTFTSGKMKMMFSTIVAAGKQFKDFMEETVHEQVDFELKDVLARF 5467462
5467461 TTDVIGMCAFGIECNSMRNPDAEFRVMGRKIFSKPRGKVKSLVINSMPRLAKLIGLRTLD 5467282
5467281 PEVSDFFMNAVRDTIKYRVENNVQRNDFMDILIRMRSDKETKSDDGTLTFNEIAAQAFVF 5467102
5467101 FLAGFETSSTLLTFTLYELALNQEVQDKGRRCVKEVLAKHNGELTYDAVMEMNYLDQILK (1) 5466922
5466849 ESLRKYPPVPVHFRETSKEYQVPGTKTVLEAGTSVMVPVHAIHRDPEHFPDPERFDPDRF 5466670
5466669 TAEQEAKRHPYAWTPFGEGPRICIGLRFGMMQARIGLAYLLTGFRFTPSAKTIVPMEFDI 5466490
5466489 KSFILSPAGGLWLKVEKLNS* 5466427

>CYPm3r11 = CYP6M4  501aa AAAB01008964.1
5466042 MEFYDVAVTVGMLCIIIYLLLVRQFRYWTERNVPQLNPHLLFGDVRDVNKTHHIGEKFRQ 5465863
5465862 LYNELKGKHPFGGIYMFTKPVALVTDLELVKNVFVKDFQYFHDRGTYYDEKHDPLSAHLF 5465683
5465682 NLEGYKWKSLRNKITPTFTSGKMKMMFPTVAAAGKQFKDYLEDAIGEQEEFELKELLARY 5465503
5465502 TTDVIGTCAFGIECNSMRNPNAEFRVMGKKIFGRSRSNLQLLLMNAFPSVAKLVGIKLIL 5465323
5465322 PEVSDFFMNAVRDTIKYRVENNVQRNDFMDILIRMRSDKETKSDDGTLTFHEIAAQAFVF 5465143
5465142 FVAGFETSSSLMAFTLYELALDQDMQDKARKCVTDVLERHNGELTYEAAMEMDYLDCVLK (1) 5464963
5464892 ECLRKHPPVSVHFRITAKDYIVPGTNSVLEAGTSVMIPVLGIHHDPEHFPEPERFDPERF 5464713
5464712 TAEQESKRHPYAWTPFGEGPRICVGPRFGLLQARIGLIYLLTSFRFVRCSKTPVPLRYAL 5464533
5464532 KNQILSPEAGMWLKLEKLNEV* 5464467

>CYPm3r12 = CYP6Z3 492 aa AAAB01008964.1 (note: 6Z3 and 6Z4 names have been switched)
5426771 MFVYTLALVATVIFLVLRYIYSHWERHELPHLKPEIPYGNIRTVAEKKESFGIAINNLYH 5426950
5426951 KSSDRLLGIYLFFRPAILIRDPHLAKRIMVNDFQNFHDRGVYCNEEHDPFSANLFALPGQ 5427130
5427131 RWKNLRAKLTPTFTSGQLRNMLPTLLDVGNKLIDRMNKVADEKAIVDMRDIASRFVLDTI 5427310
5427311 ASVFFGFEANCIHNSEDPFLSTLQRLTKSRKFMDNFRTSGVFICPGLLKLTRITSLPPEL 5427490
5427491 ISFVMEIITHQIDHREKNQITRKDFVQLLIDLRREAENGSEKALSIEQCAANVFLFYIAG 5427670
5427671 AETSTATISFTLHELSHNPEAMAKLQQEIDEMMERYNGEITYENIKEMKYLDLCVKETLR 5427850
5427851 KYPGLPILNRECTIDYKVPDSDVVIRKGTQVIIPLLSISMNEKYFPDPELYSPERFDEAT 5428030
5428031 KNYDADAYYPFGAGPRNCI (1) 5428087
5428158 GLRQGVFVSKIGLVLLLSKYNFQATTPAKVKFAVATVVVTPEDGFPMRVEHRC* 5428319

>CYPm3r13 = CYP6Z2  488aa AAAB01008964.1
5424528 MFVYTLALVAAVIFLVLRYIYSHWERHGLPHLKPEIPYGNIRTVAEKKESFGTAINNLYH 5424707
5424708 KSSDRLLGIYLFFRPAILIRDPHLAKRIMVNDFQNFHDRGVYCNEEHDPFSANLFALPGQ 5424887
5424888 RWKNLRAKLTPTFTSGQLRNMLPTLLDVGNKLIDRMNKVADEKAIVDMRDIASRFVLDTI 5425067
5425068 ASVFFGFEANCIHNSEDPFLSTLRRANRGRNFIDNFRSSGVFICPGLLKLTRMTSLQPEL 5425247
5425248 IKFVMEIITHQIDHREKNQITRKDFVQLLIDLRREADKGSEEALTIEQCAANVFLFYIAG 5425427
5425428 AETSTATISFTLHELSHNPEAMAKLQQEIDEMMERYNGEITYENIKEMKYLDLCVKETLR 5425607
5425608 KYPGLPILNRECTIDYKVPDSDVVIRKGTQVIIPLLSISMNEKYFPDPELYSPERFDEAT 5425787
5425788 KNYDADAYYPFGAGPRNCI (1) 5425844
5425917 GLRQGVLVSKIGLVFLLSKFKFQATTPAKVKFAAATVGLTPDAGFPMRIDHRK* 5426078

>CYPm3r14 = CYP6Z1  494 aa AAAB01008964.1
5421907 MILYTIGLIVTFVFLALKYVYSYWDRQGLPNLRPEIPYGNLRILAQKKESFNVAINDLYD 5422086
5422087 RSSERLVGVYLFFRPAILVRDAHLAKRIMVNDFQHFHDRGVYCNEHSDPMSANLFALPGQ 5422266
5422267 RWKNLRAKLTPTFTSGQLRHMLPTFLAVGSKLEQYLERLANEKQIVDMRDIVSRYVLDVV 5422446
5422447 ASVFFGFEANCLHDPDDAFRVALRDLNNPDSFINNIRTAGVFLCPGLLKFTGINSLSPPM 5422626
5422627 KKFTTEVISSHLHQRETGQVTRKDFIQMLTDLRRKAGSSGEETLTDAQCAANVFLFYGAG 5422806
5422807 ADTSTGTITFTLHELTHNAEAMAKLQQEVDEMMERHHGEITYDNINGMKYLDLCVKETLR 5422986
5422987 IYPALAVLNRECTIDYKVPDSDTVIRKGTQMIIPLLGISMNEKYFPEPELYSPERFDEAT 5423166
5423167 KNYDADAYYPFGAGPRNCI (1) 5423223
5423282 GLRQGLLLSKIALVMMLSRFNFSATIPRKIKFEPVSITLAPKGGLPMRIENRAKH* 5423449

>CYPn3r1 = CYP4H16  499aa AAAB01008964.1
2537270 MFVLVAVFVVYLSYLLLKYHQKRQERLKLLRYFPGPQPEYILGCSYLFYNKSIT (1) 2537431
2537508 EIFDTIVDSHAQYGKDICLIGAFNMLELEIASAQNIEKVLLAKTTKKSYQYDFLEPWLG 2537684
2537685 TGLLLSFGEKWFQRRKIITPSFHFKILDQFMDVFNQEADTLVSKLERHVDQQEFDIYDHI 2537864
2537865 TLYALDSIC (1) 2537891
2537975 ATSMGVHINAQKDPNNEYTQGVKKVSEYVFRRIFSVLNQFPALFVLYSYAREQGRIIK 2538148
2538149 RLHDFTNTVIDTRRKQLARENKPVQVDDYSKHRDTFLDQLLKVRVNGQPLSTADIREEVD 2538328
2538329 TFMFEGHDTTTSGISFTILQLAKHQDVQQKLYEEIDTVLGESAKTIVLTNALLQELKYLD 2538508
2538509 LVIKESLRLVPPVPFVGRKLLEDMEM (1) 2538586
2538652 NGTVVPAGTTISLNIFCLHRNPEVFPEPEKFIPERFSDANEIPRGPYDYIPFSAGSRNCI 2538831
2538832 GQKYALLEMKVTIVKLLASYRILPGESIDQVRYKADLVIRPSGGIPVKLTRRS* 2538993

>CYPn3r2 = CYP4H18  507 aa AAAB01008964.1
2488293 MFWLVTLLAVYVAYLLLKYHQQRQKLLAIRAKFGGPESSYFLGTFYLFKDKSIP (1?) 2488132
2488066 DIFDLVVGLHKRYGQDVAIIGAFNDLVLDLSSSKNVEKILLAKTTKKSFVYDYLEPWLGT 2487887
2487886 GLLISFGEKWFQRRKIITPAFHFKILDQFIDVFNEEADVLISKLQKHVGKGEFDIYDYVTLYALDSIC (1) 2487683
2487606 ATSMGVRIHAQDDPNNEYAQAVKQMSVFFLRRVFSLLRQFPSLFFLYPFAREQGRVIKKL 2487427
2487426 HHFTNTVIESRRAQLEQEQRLGKQEFDVNEEDLYSKRRNTFLDQLLKVSIDGKPLSTADI 2487247
2487246 REEVDTFMFEGHDTTTSGISFTILHLAKHQDVQQRLYEEIDRMLGEEKTNVPLTNALLQD 2487067
2487066 FKYLDMVIKESLRLVPPVPIIGRKLLEDMEI (1) 2486974
2486793 NGAIIPAGTSISIKIFNIHRNRTVFPEPERFDPERFSEANEIKRGPYDYIPFSAG 2486632
2486631 SRNCIGQRYALLEMKVTIVKLLASYRILPGESAGRIRYKTDLVIRPTEGIPVKLLKRTA* 2486452

>CYPn3r3 = CYP4H17  506aa AAAB01008964.1
2473831 MMLLVAIVVVYLSYVLFKYHQKRQQLLEIAKYFKGPRADYFLGCFYLFRNKSVA (1) 2473670
2473596 EIFDLLNDMHRKYGHDVTMIGAFNDLVLDISSTQNVEKVLLAKTTKKSFPYEFLEPW 2473426
2473425 LGTGLLLSFGEKWFQRRRIITPAFHFKILDQFMDVFNHEADVLVSKLEKRVNQGEFDIYD 2473246
2473245 YITLYALDSIC (1) 2473213
2473121 ATSMGVQINAQENPNNEYARGVKQMSEFIFRRVFSVLRQFPALFFLYPFAREQGR 2472957
2472956 VIKKLHDFTNSVINTRRSQLQAEQAVGKVEFNADEDELYSKRRDTFLDQLLKVTIDGKPL 2472777
2472776 STADIREEVDTFMFEGHDTTTSGISFTILQLAKHQEIQQKLYEEIDGMLGAEAKSTVLTS 2472597
2472596 ALLQDMKYLDLVVKESLRLVPPVPFIGRKLLEDMEM (1) 2472489
2472423 NGTTIPAGTTISLNIFNVHRNPKVFPEPEKFIPERFSDANEIKRGPYDYIPFSAGFRNCI 2472244
2472243 GQKYALLEMKVTLVKLLASYRILPGESIDQVRYKTDLVLRPTGGIPVKLVKRR* 2472082

>CYPs3r1 = CYP4H27v1  511 aa AAAB01008944.1 plus strand
502696 MFLVLLSICLGTAFAWMIVTILRNRVAVLMLQKRLPNFKVVPAIPVFGSTYHFKDLSAEG 502875
502876 LFTTFIGLHKLYGKTLITQSLFNLPSLHVSDAKVIGQIMQARTVEKTIVYDFMTPWLGTG 503055
503056 LIVSTGSKWTQHRKIITPAFHFKILEDFLVIMNHQSDVLIEKLKTSANGTDCNIYNHVTY 503235
503236 CALDIIAESAMSVKLNTQQHPNSEYVLAVKE (2) 503328
503394 MTDIILKRLFSLFREYKWAFQFTKAHRRQRELVKVIHDFAYKVISDRKKQLYSDAQEQQR 503573
503574 AQKQLAEEAVYGKRRMTLLDLLLNVTMDGKPLSDSEIREEVDTFMFTGHDSTTSSISFTA 503753
503754 YHLSRDASIQQRVYDEILAIVGPDAKTVELTYGTLQKLKYLEMVIKETLRINPPVPVIGR 503933
503934 RSVGDMVIDGVTIPKGLDFFIMIYLLHNDPELYPEPTRFDPERFSEEASVKRPPYSYMPF 504113
504114 SAGSRNCIGQRYAMLEVKTVLVKLLANYQLLPCEASNQLRLKTDMTLKPVNGVFVKLVRR* 504296

>CYP4H27v2 95% to to 4H27 AAAB01008530.1 86215-87815 plus strand allele
86215 MFLVLLSICLGTALAWMIVTILRNRATVLMLQKRLPNFKVVPAIPVFGSTYHFKDLSAEG 86394
86395 LFTTFIGLHKLYGKTLITQSLFNFPSLHVCDGKVIGQVMQARTVEKTIVYDFMTPWLGTG 86574
86575 LIVSTGSKWTQRRKIITPSFHFKILEDFIVIMNHQSDVLIEKLKTSANGTDCNIYNHVTY 86754
86755 CALDIIAESAMSVKLNTQQHPNSEYVLAVKE (2) 86847
86913 MTDIILKRLFSLFREYKWAFQFTKAHRRQRELVKVIHDFAHKVISDRKKQLHSDAQEEQR 87092
87093 AQKQLAEEDVYGKRRMTLLDLLLNVTMDGKPLSESEIREEVDTFMFTGHDSTTSSISFAA 87272
87273 YHLSRDASIQQRVYDEILAIVGPDAKTVELTYGTLQKLKYLEMVIKETLRINPPVPVIGR 87452
87453 RSAGDMVIDGVTIPKGLDFFLVIYSLHNDPELYPEPTRFDPKRFSEEASVKRPPYSYMPF 87632
87633 SAGSRNCIGQRYAMLEVKTVLVKLLANYQLLPCEASNQLRLKTDMTLKPVNGVFVKLVRR 87812
87813 * 87815

>CYP4H30v1 4 DIFFS WITH 4HBB AAAB01008944.1 plus strand partial seq.
505963 MFLVLLAMCLGVVFLWQMFFTICRNRATVLMLQKRLPNFKVIPAIPVFGLMYHFKDPSAE 506142
506143 GIFNTFCDFDTQYGKTLITQSLFNFPSIHVCDAKVIGQIMQARTIEKTIIYDFMTPWLGT 506322
506323 GLIVSTGSKWTQHRKIITPAFHFKILEDFLVIMNHQSDVLIEKLKTSANGTDCNIYNHVT 506502
506503 YCALDIIAESAMSV 506544

>CYP4H30v2 90% to 4H27 AAAB01008530.1 89454-91048 plus strand 
89454 MFLVLLAMCLGVVFVWMFFTICRNRATVLMLQKRLPNFKVIPAIPVFGSMYHFKDPSAEG 89633
89634 IFNTFCDFDTQYGKTLITQSLFNFPSIHVCDAKVIGQIMQARTIEKTIIYDFMTPWLGTG 89813
89814 LIVSTGSKWTQRRKIITPAFHFKILEDFLVIMNHQSDVLIEKLKTSANGTDCNIYNHVTY 89993
89994 CALDIIAESAMSVKLNTQQHPNSEYVLAVKE (2) 90086
90152 MTDIILKRLFSLLREYKWAFQFTKAHRRQRELVKVIHDFAHKVISDRKKQSDAQELQR 90325
90326 AQKHLAEEDVYGKRRMTLLDLLLNVTMDGKPLSESEIREEVDTFMFTGHDTTTSCISFAA 90505
90506 YHLSRDASIQQRVYDEILAIVGPDAKTVELTYGTLQKLKYLEMVIKETLRVNPPVPVIGR 90685
90686 RSAGDMVIDGVTIPKGLDFFIMIYLLHHDPELYPEPTRFDPERFGEEASAKRPPFSYMPF 90865
90866 SAGSRNCIGQRYAMLEVKTVLVKLLANYQLLPCEASNQLRLKADMTLKPVNGAFVKLVPR 91045
91046 * 91048

>CYPs3r2 = CYP307B1  538aa AAAB01008944.1 minus strand
2739177 MDRVSVTLLSSSSTAYLMVSCFLLTLLMLLPELKQKVILRSEVLQALRQLIASVGVTFGT 2738998
2738997 HEDEPVGAASHALEKPAPGPKNYPIIGALKELNGYEVPYQAFSDMGQRYGPVTALRLGSV 2738818
2738817 NAVVVNGFESIKEVLINKGQHFDSRPNFRRYQLLFSGNKEN (1) 2738695
2738605 SLAFCDWSEVQKARRDMLVPHTFPRNYSGRFDELNTIVVDEIGQMLGSVQHGTTVAIKP 2738429
2738428 LVLSICANAFSQYFGSHRFEVEDPRFQQLVRNFDQIFYEVNQGYAADFLPFLLPLHRQNL 2738249
2738248 RRMDRLAEEIRTIILDTIIGDRYERWGEGSEPRDYVDSLIEHVKAGRGPALEWETALFAL 2738069
2738068 EDIVGGHSAVGNFLVKAFGYIVQHPEVQQRIQAEADGVLERHGRQVIELTDRAEMQYTEA 2737889
2737888 VIMEALRLIASPIVPHVANQDSQIG (1) 2737814
2737750 GYTVAKDTLIFLNNYDLSMSPALWDEPERFRPERFLQQGRLVKPDFFIPFGAGRRSCMGY 2737571
2737570 RMTQLLSFSIIANLLRAYTIAPIAGQDYRVPVGSLAMPEQSYVFNVTPRSCCC* 2737409

>CYPo3r1 = CYP4C35  509 aa AAAB01008984.1
10415449 MLLVVLVLLLLTPVLQWLIRRVQMSQIYDKIPGPKAYPFVGTLYLLFGKKSH (1) 10415279
10415211 EIFTLIDQRTRQYDGIHRIWVGMTPEVRLSRAEYVEQIIGASKHTEKATLYRFLGDWLGEGLLTSK (1) 10415014
10414910 GERWFQHRKLITPTFHFNILDGFCEVFAENGAVLVERLQRHANTGQPVNIYPYVTKAALDVIC (1) 10414722
10414625 ETAMGVQVHAQTAGEDNAYVNAVYE (2) 10414551
10414485 LSSLFLERLVRPWLHPEWTFRRSALGRRQAQLLAILHGYTRK (0) 10414360
10414270 VIQERRRTLDQQHAGERNQPEAEGDGLGRRKRLAFLDLLLQSATTGTGSPLLTDEDVR 10414097
10414096 EEVDTFMFE (0) 10414070
10413982 GHDTTTAGMSWALFLLALHPEVQERVHQEIDSIFGGSDRPATMQDLTAMRLLERCLKET 10413806
10413805 LRLYPSVAFFGRTTSKDVTLGGYHVPAGTIVGIHAYNVHRDER (2) 10413677
10413596 FFPDAETFDPDRFLPERTAENRHPYAYIPFSAGPRNCIGQKFALLEEKCLVSSILRRFR 10413420
10413419 IRSHRTRAEQLIVNELITRPKDGILLYLEEREW* 10413318

>CYPo3r2 = CYP4C36  512 aa AAAB01008984.1
10433013 MLTGETVLLVQIALVVIALVPLAKWIKKRLNLHDVINKIPGPKAYPIIGTMYTFVGKKSE (1) 10433192
10433256 EIFYIIDKRTRDYPEIHRIWNGFVPEVRINKAEYVEKLLSSSRNIEKSMTYKFTRDWL 10433429
10433430 GQGLLTSK (1) 10433453
10433548 DDRWFQHRRLITPTFHFNILDGFCEVFAEHGALLVEKLATARAATSASQPINVYPFMTKAALDIIC (1) 10433745
10433846 ETAMGVKVNAQTSGMDNPYVAAVYD (2) 10433920
10434001 LSSLIQYRLLRPWLHTDFVWNRTAEGKRYHEVLAIVHGYAHK (0) 10434126
10434239 VIRERREERKQLRTQGKDGMAQDGERKRRLAFLDMLLESNEQNNLLTDNDVREEVDTFMFE (0) 10434421
10434540 GHDTTTAGMCWALFLLALHPDIQHQVHQEIDSIFGGSDRAPTMRDLNEMKLLERCLK 10434710
10434711 ETLRLYPSVSFFGRTLSEDIQFGHYHVPAGTVVGVHAYHVHRDER (2) 10434845
10434942 FFPDAEKFDPDRFLPERTENRHPYAYIPFSAGPRNCIGQKFALLEEKSVVSSILRRFTV 10435118
10435119 RSAKTRKEQLIQHELITRPKDGILLYFEPRS* 10435214

>CYPo3r3 = CYP4C27  515aa AAAB01008984.1
10596931 MSELSTIFHGVLVFVVFAIYLQWLMKRWQLSQIFEKIPGPKAYPIIGTMYSFIGKQRH (1) 10596758
10595180 EIFYLLDERTRRYPEIHRVWTGLTPEVRISKPEYVEQVIGSSKHIEKATMYRFL 10595019
10595018 HDWLGNGLLTSK (1) 10594983
10594836 GERWHQHRKLITPTFHFNILDG 10594771
10594770 FCDVFAENSEEMVEYLRPHADTGKPVNVYPFIAKAALDIIC (1) 10594648
10594361 ETAMGVKVNAQSEGEENDYVKAVCE (2) 10594287
10594164 LSRLFVERMVRPWLHLDFIWLRSRFAARYKNALDTVHNYSRE (0) 10594039
10593976 VIRDRKAALESAKKSAGAETSDGEAFGVRMRMAFLDLLLEGNQAHNIMTDEDVREEVDTFMFE (0) 10593788
10592366 GHDTTTAGISWVLFLLALHPDVQERVCEEIESIFPPGDDRPATMQDLNELKLLERCIKE 10592190
10592189 ALRLYPSVSFFGRTLSEDVQLGGHQVPAQTIVGIHAYHVHRDER (2) 10592058
10591961 FYPDPEKFDPDRFLPENTENRHPYAYIPFSAGPRNCIGQKFALLEEKSIVSSVLRRYRL 10591785
10591784 RSVRTRDEQKIMHELITRPKDGILLYLESRQKKVDA* 10591674

>CYPp3r1 = CYP9M1  528 aa AAAB01008835.1 
629135 MFLLWALPLALYLLYRWSIATYDYFEKRNIPYVKPVPFFGQVWSFFTQEKH 628983
628982 AVDVASEGYHMFPNTRISGVFTLRTPAYLVHDPALFKEMAIKDFDHFTDHVTQLSLEHD 628806
628805 PLLARSLFFTNGARWRHHRSGLSPAFTGSKIRNMFVLLSKSAGDAMKRLVVFARGKPF 628632
628631 AMELRDLYSKLGNDAMTSISFGVDVDSLTDPDNEFFLKGKRLAQIDGLPGLKLLMTTILP 628452
628451 GLFKFLRLGVLYKDVNEFYLEAVSTNIRYRERNLIKRPDFIHLLLQARRNELNSEQTED 628275
628274 DALESAGFSTAETHTVEQRGATGETLQWHDVDITAAAASFFFGGIETTT 628128
628127 TVLCFTSYELAVNPPIQERLRAEIDSARDELIDGATPTYEILQKMKYLDMVVSETLRRWA 627948
627947 PFGLTNRRCTKDYTFTNTDGTRVTIEKGLNVSIPLKSFHLDEKFFPDPLRFDPERFADPN 627768
627767 NINQDAYVPFGTGLRNCIGSRLALMQAKCFLFYMLSNFIIQPGSKLTIPLVLDETSAGLN
       AKHGFWMNLVPR* 627579

>CYPp3r4 = CYP9M2  529aa AAAB01008835.1
683264 MFLLWALPLALYLFYRWSIATYDYFEKRNIPYVKPVPFFGQVLSFFTQGRH 683112
683111 AVDVASEGYHMFRNTRISGVFTLRTPAYLVHDPTLYKQMATKDFDHFTDHVTDFRIETDP 682932
682931 ILARSLFFTNGAHWRQHRSGLSPAFTGSKMRSMFGLLSKSAGD 682803
682802 AMGRLLVFAAGKPFTMELRDLYSRLGNDVMTSISFGVEVDSLTDRDNEFFLKGKRLAQID 682623
682622 GLPGLKFLMATTIPRVFHFFRLSGMYKDVNEFYTDAVARNIQLRETNRITRPDFIHLLLQ 682443
682442 ARKNTLEAEKHEDEALQDAGFSTVKEHTLEQKMGEGKMNWADIDIA 682305
682304 GAAASFFFGGIETTTTLLCFTSYELAVNPDIQERLRAEIDEQRESLADGRTPTYEVLQKM 682125
682124 KYLDMVVSEALRRWTPLGLTNRKCTKNYTFTNTDGSRVTIERGQNISIPLKYFHLDEKFY 681945
681944 PDPLRFDPERFADPNNINQDAYVPFGAGLRNCIGSRLALMQAKCILFYMLSNFIIKP 681774
681773 DTKLTIPIVIDETSAGLNAKHGFWMNLVPRSA* 681675

>CYPs3r3 = CYP325C3  495 aa AAAB01008980.1
2843698 MWWFWLVALVLAALGLWQVWIVQRHRFASHLPVVQPYYPIIGNAQLFIGKSGVDLFNQIL 2843877
2843878 QQFRQYDGWFKAWLGPKLVLATSHPDIMNAVLSHPDCLKKPFFYDFVKLEHAIFAGH (1) 2844048
2844146 YHLWKTQRKALNPTFNTRILNSFIPVFVQCSRQMVQHMEQSVGDVGRSISIFPFISKCTLE 2844325
2844326 MVCGTTIGCDVMEQPGKETFIENLDR (2) 2844403
2844615 WFELVAKRMVSIHHYIELLYRFSRDFTEESEHRLACFRFFET (0) 2844740
2844818 VIEKAKARINSTAIEDECEDYKKPLIFADQLLAAQHNGNPFTDIEVTHNIYAMIAA (0) 2844985
2845055 GNDTTALQVTHTCLFLAMHPAIQERVYREVMDVFPYPDQDIEVEDLKKLSYMERVIKESL 2845234
2845235 RLAPSGPNIARQTMKDIEIAGVHIPRDSLIVMSIFSMHRRKDVWGPDADVFDPDRFLPER 2845414
2845415 SEGRSANVFIPFSAGARNCIGGRYAMLSMKVTLSSILRRLRLRSDLQMNDLQFRFGLTLK 2845594
2845595 LESEYLVEVEKRM* 2845636

>CYPs3r4 = CYP303A1  500aa AAAB01008980.1
12508996 MWYFVALCVVLLLLWLHLDNLKPLNFPPGPKWYPIVGSALSIMNARNKTGMLCKAVEHIA 12509175
12509176 QDYPDHRGVIGFKIGKDKAVMAINAESLKEMMNNEDFDGRPTGIFYETRTWGLRRGVLLT 12509355
12509356 DEQFWQEQRRFIVRHLKEFGFARKGMTEIIQNEAAHIRKDFEEQIAKGQGKATVQMQGAF 12509535
12509536 SVYVLNTLWLMMAGVRYSKDNDDLRYLQALLHELFTNIDMMGALFSHFPYLRFVAPRLSG 12509715
12509716 YRQFVEIHECMHKFIGAEVERHQKNFNPDDEPRDLMDVYLHTLQNNNAPSDSFSREQLLA 12509895
12509896 VCLDMFIAGSETTTKTLDFSFLYIVRNPKVMRRIQEEIDDVIGRNRLPTLEDRAS (2) 12510060
12510164 MPYSEATTLEGLRLFMSNTFGIPHRALKDTTLCGYHIPK (0) 12510280
12510352 DTMLVGMFRGMMLDENLW 12510405
12510406 ENPTQFNPERFLKDGKIHIPAQYHPFGVGKHRCMGELMAKSNLFLFLTTTLQSFDLLLPD 12510585
12510586 GAPIPSDIPIDGATPSVRKYHVAIRARH* 12510672

>CYPs3l1 = CYP4C28 460 aainc AAAB01008849.1 N-term added
1485146 MSSILWSDLVPNALQLLSPTAWIVMLTVAASTVIFYRQRAEVAKHINRIPGPPALPLLGNSLQWLVDRD (1) 1485352
1496913 EMFSTINGARLLYGRRQGFNRVWAGLKPYILISKATAAE (0) 1497029
1497113 RILSSSKNIEKGRDYDLLKPWIGTGLLTSHAAKWHQRRKMLTPTFHFKILANFVEVMNKQ 1497292
1497293 SYVLVRQLEKQLNNTEGFDCTIYATLTSLDIIC (1) 1497391
1497639 ETAMGYPIHALEKSDSEYVKAHEK (2) 1497710
1497790 ISEIILERLQKFWLRSDFIFRFTKAYTEHEHCLKILHDFAYSMIQKRREMYRQRKQSML 1497966
1497967 SETGSADNAPHSEEAHGQRKQLAFLDLLLELSEDGQLLSDADIREEVDTFILGGHDTTAT 1498146
1498147 ALAWMLYLLGTDQTVQERVFLEIDGIMGGDRERHPTMAELSEMRYLECCIKESLRLFPSI 1498326
1498327 PILSRTLTTGVDIEGHHIPSGTNAVIMLYQLHRDPQYFPNPEKFYPDRFLPENSTNRHPY 1498506
1498507 SYIPFSAGPRNCIGQKFGALEEKAVISAVVRNYKIESVHRREDLILYGDLVMRTKGGLKI 1498686
1498687 RIQRRI* 1498707

>CYPs3l2 = CYP6AK1  516aa AAAB01008823.1
821726 MSLEVVDLLYTVALLLLLYLGWRKQTYWTRAGVPYIPEIPIIGNFATIFLQRHSSFEYIE 821905
821906 HIYHHARTRTSDFFGVNIFTRPALVLRSPELIKRLTCTDAQRFINRQMCTDPFHDAIGYF 822085
822086 NLIMIREPLWKQLRGFLSPSVTSAKLKRMQPLIEQ (0) 822190
822276 VGADMMASLDALPVLRPNVRETEFKELCARFTTDVIASTFFG 822401
822402 MQANCLKDEQSEFRYYGRKIFDYGPGRGLTMASFFFLPELVPYLRLKLFPRDTEAFLKAI 822581
822582 IEQEIARREQTGESRGDFIDSMIALKNNNATLGVNEKI (1) 822695
822765 PLKGDILVAQAATFYMASFETTSSVLSFALYELTKN (0) 822872
822935 PHVQERLREEIRDIIVKYGREIPYEAYANEMPYLGMVISETNRLYPVLAFIERQCTLPEG 823114
823115 STGYKLEPLHDYVIPNGMPIMIPIYAIHRDPK (0) 823210
823281 YFPNPTVFDPERFAKENLDQIQPCTYMPFGVGPRTCLGSHFGTLQIKIALLKLLSQYRIE 823460
823461 RSPSTPEVLTYRKNAFTLNSNEGLYAALVEDAM* 823562

>CYP6AK1 Duplicate exon 1 partial 2 aa diffs AAAB01008823.1
811484 MSLEVVDILYTVALLLLLYLGWRKQTYWTRAGVPYIPEIPIIGNFATIFLQRHSSFEYIE 811663
811664 HIYHHARTRSSDFFGVNIFTR 811726

>CYPs3l3 = CYP6AJ1  522aa AAAB01008823.1
698590 MFVSSLLLGGLFYHHPLVAVPLIALVALFYWLVKHNYKFWEIDGVPYPKPSLLTGNLGPS 698411
698410 LALKKHISELASDWYN (2) 698363
698295 NAYPDKPFVGYFKIFTPAIMVKDPVLVKNILSRDFDCFANNDFLLDVRQDPLLSHDPFLV 698113
698112 TGERWKRSRSLLTPSFTGAKIKQLFPVMESVADAFVTFIGRHVAQELEAKE (0) 697960
697868 IAARFTTQNVVACTFSIDGDCFGEQESEFRRMGRRVFETSP 697746
697745 MATVKTMMAVFLPTVAKYIPVP (2) 697680
697606 FLLKDVDEWIRSLVANLIIQRSASEKTVQEDLLQSFLKNREKSSTYRIDSPFK (1) 697448
697408 NATQTEITAHALTIFLEGFETSSVVLGFALYR (0) 697313
697248 LAKSPEVQQNLYNEVKKRIDANGGQLDFDALQQLEYLDWVMLETLRMHPPAATMHKV 697078
697077 CTKKYIMRKGFRDEQGHDMSIYVREGTPILIPVLAIHM (2) 696964
696884 DPKYYPEPHQFDPERFSPARKVTHEGATFLPFGEGPRMCLGMRFAQAQVKLAMVKLI 696714
696713 LNYRVTVGPNDKPFAIDSRSFVYQARDGLRIVFERR* 696603

>CYPq3l1 =CYP6AF1  500 aa AAAB01008823.1
59957 MALPIALYLCVSVVCLLVLWIRRRRNYWSTRNVPTIPGHFLLGNFEGLRRQSVADVSNEL 60136
60137 YRQVDRRERFCGLSIMLQPTLMITDLDLIKSVLIKDFAHFTDHGVYHNERVDVLSCHLFC 60316
60317 LEGAKWKSIRSKLSPAFTTGRIRAMFPILRQVADNFAHFLRTEVDGKAELDMKDCCARMM 60496
60497 IDNIGGCAFGIECNSFHEPDSAFRRTGELVFDKPRHSQVVSSLLRLYPALGHLLGLKVNH 60676
60677 DEVVEFFTGMMRRTVAMRESSNTATPKRNDLIDMMLQLRAASNGSALSMDELMAQAFGFF 60856
60857 LAGYETSSSNVTFCLYELALNEHCQERARACVREALRKHGGLTYEALGEMEYLDRCIN (1) 61030
61097 ETLRKYPPLPLLPRLTSKAYRIPGSDVILPAKMRIHLPVYAIQRDERYYPDPDRFDPDRF 61276
61277 APERVAERHFSAFLPFGEGPRICIGQRLGVLQSRIGLATVLANFRVRPGPRTPIPLVFAK 61456
61457 DAVTLQSAGEVYLQVEPLQEHE* 61525

>CYPq3l2 = CYP6AF2  500 aa AAAB01008823.1
50296 MALPIALYLCVSVVCLLVLWIRRQRNYWSTRNVPTIPGHFLLGNFEGLRRQSVADVSNEL 50475
50476 YRQVDRRERFCGLSIMLQPTLMITDLDLIKSVLIKDFAHFTDHGVYHNERVDVLSCHLFC 50655
50656 LEGAKWKSIRSKLSPAFTTGRIRAMFPILRQVADNFAHFLRTEVDGKAELDMKDCCARMM 50835
50836 IDNIGGCAFGIECNSFHEPDSAFRRTGELVFDKPRHSQVVSSLLRLYPALGHLLGLKVNH 51015
51016 DEVVEFFTGMMRRTVAMRESSNTATPKRNDLIDMMLQLRAASNGSALSMDELMAQAFGFF 51195
51196 LAGYETSSSNVTFCLYELALNEHCQERARACVREALRKHGGLTYEALGEMEYLDRCIN (1) 51369
51436 ETLRKYPPLPLLPRLTSKAYRIPGSDVILPAKMRIHLPVYAIQRDERYYPDPDRFDPDRF 51615
51616 APERVAERHFSAFLPFGEGPRICIGQRLGVLQSRIGLATVLANFRVRPGPRTPIPLVFAK 51795
51796 DAVTLQSAGEVYLQVEPLQEHE* 51864

>CYPr3l1 = CYP9J3  497 aa AAAB01008986.1 N-term corrected based on mRNA BM603861.1
2151559 MEISVVTLALLVGLCVAVYRYVTKNYFYFADKPIPFMKP
        SFPFGNAGPILMKKVTLFEHFKNLYDAFPNAR (2) 2151347
2151261 IHGTFNMRQPVYIVRDPELVKQITVKDFDYFVDHMTTGMEQ 2151139
2151138 TEDNNSNHLLLGNSLVSLRGQKWRDMRATLSPAFTGSKMRLMFALIADCGKSMVEHFREE 2150959
2150958 DKKARAAGGTGYQLEMKDVMTRFANDVIGTAAFGIKVDSFRDPTNVFISMARSVTNQESL 2150779
2150778 VKVLKMIGYTFAPKLMTRLNIDFLTPEEDQFFRNTILETMRTRQEKGIFRPDMIELLMQA 2150599
2150598 KKGSLKHQQAEEPRTDSETGEGFATVEESHVGRRAHDRVWTDTELIAQAFIFFFAGFETI 2150419
2150418 SWTISFALYELAVNEDIQARLYEEVRDAEQSLEEGKTLTYEQLQSLPYLDMVVSETLRRW 2150239
2150238 PIATVLNRECVRNYQYDDGQGTRFTIEKGTLVFIPVVGIHFDPKYFPEPERFDPERFSAA 2150059
2150058 NRNNIQPGTYLPFGAGPRNCIGSRFALMEAKAALYYLLLNFRLVPCAKTQIPLKLKKSST 2149879
2149878 QFATEQGIWLEFQSRSS* 2149825

>CYPr3l2 = CYP9J4  534aa AAAB01008986.1
2148466 MAAIATILALLYYYVRNRYRYFLDKPYPHLKPTFLLGSSAPMMLRRRNMIQHIEALYYSHPDAK (2) 2148275
2148169 VIGAYDLLTPNVLLRDPDCVKQIGVKDFDYFTDHTPFLPNESDIGQSDNMF 2148017
2148016 LNSLFMLRGQKWRDMRATLSPAFTGSKMRQMFELMSDSCQGMVEHLLKEAREDESKQAHE 2147837
2147836 MKDIFSRFANDVIASIAFGIRVNSFADRENDFYTRGKKLLDFSSFWPTIRFMLFMMVPRV 2147657
2147656 MLKLDIELMDKEMCRHFHAMILDNMKVREEKGIVRNDMINILMQVKRGALSHREDEPDVK 2147477
2147476 DAGFATVHESAVGKKAITREWTEKELVAQCFLFFLAGFDTVSTALGFLMYELMRNREVQE 2147297
2147296 RLYEEIAEIDQRLDGKPLTYDAVQGMRYMDMVVSESLRLWPPAPMVDRYCNRDYTFDDGE 2147117
2147116 GLRFKIEKGVTVMVPVAGLHSDPKYFPDPKRFDPERFSEENRHKINPGAYLPFGVGPRNC 2146937
2146936 IGSRFALMEVKSIIYYLLKSFTFERCEQTQVPLRLKNSPVVLAAEKGIWIRFKPREVAK* 2146757

>CYPr3l3 = CYP9L3  313aainc AAAB01008986.1 deletion of 223 aa after FISF aa 60
2145772 MYLVYVGGIVSLLMVLYAYLTYNNDFFKKYPIPCLPVEPLFGSCRRLVLKQISFISFK 2145599
2145598 GKLRYQPTDRAEVEGFATVRESNEEKIMPENMVKLSESEMVAQCLIFFLAGFDTIATLMS 2145419
2145418 FIVYEITLAPEIQQRLYEEIQQVSESLGGGSLTYDALQGMRYLDMVVSETLRKWPPAPST 2145239
2145238 DRLCNQDFRITDERDNVEIIIPKGVTVNIPIAGLHHDPRFYPDPDRFDPERFNDENKHKM 2145059
2145058 PLGAYLPFGIGPRNCIASRFALMEVKAIVYHLLLHYEFKRTDRTPVPVQLAKGFTPLRSE 2144879
2144878 KGIYLQLSPRRTN* 2144837

>CYPr3l3 = CYP9L3 AAAB01003071.1 intact mid region of allele of CYP9L3
lower part from seq AAAB01008986.1
    183 MYLVYVGGIVSLLMVLYAYLTYNNDFFKKYPIPCLPVEPLFGSCRRLMLKQISFNDFV 356
    357 RSNYDRFQGAK (2) 389
    453 IFGMFEVLTPMFVIRDPELIKQITVKDFDHFINHRPLIKADSSMPNSSVMFTKVLFNLN 629
    630 DQRWRNVRTTLSPTFTGSKMRQMFAMIVECSENMVQALATANGQECEVKDLFVRFTNDII 809
    810 ASCAFGVRINSFRDKENVFFRYGKDLTDFGRLKVFLKMMGYQMFPKLMARLEIDIFDRKH 989
    990 IQFFTELFRQSVREREQHGLVRPDMIHLLTQAGKGKLRYQPTDRAEVEGFATVRESNEEK 1169
   1170 IMPENMVKLSESEMVAQCLIFFLAGFDTIATLMSFIVYEITLAPEIQQRLYEEIQQVSES 1349
   1350 LGGGSVTYDALQGMRYLDMVVSETLRKWPPAPSTDRLCN 1466
2145223 QDFRITDERDNVEIIIPKGVTVNIPIAGLHHDPRFYPDPDRFDPERFNDENKHKM 2145059
2145058 PLGAYLPFGIGPRNCIASRFALMEVKAIVYHLLLHYEFKRTDRTPVPVQLAKGFTPLRSE 2144879
2144878 KGIYLQLSPRRTN* 2144837

>CYPr3l4 = CYP9L2  505aa AAAB01008986.1 N-term corrected
2144518 MEIHLVYVIGIVSLLVALYVYLTRNNNFFKSFPIPCMEVEPLFGSHRKLLLKQISLHDFV 2144339
2144338 RSCYERFPNAK (2) 2144306
2144235 IFGLFEMITPMFVVRDPELIKQ 2144170
2144169 ITVKDFDHFVNHRAILPGDGSSSRNSSIMFTKVLFNLNGQRWRNVRNTLSPAFTGSKMRQ 2143990
2143989 MFTMIVECSENMIKELATFTGQEFEVKNLFIRFTNDVIASCAFGVRINSFRDKENVFYRY 2143810
2143809 GKDITNFGRLKVFLKMMGYQLIPKLMAWLEIDIFDREHVQFFIDLFRQSVQEREQHGIVR 2143630
2143629 PDMIHLLMQANNGKLRYQPTDHEEVEGFATAKESNDEKVVPEDMVKLSENEMVAQCLIFF 2143450
2143449 LAGFDIIASVMTFLLYEVALDPEIQQRLYEEIQQVSESLDGKSITYDALQNMRYLDMVVS 2143270
2143269 ETLRKWPSQPATDRLCNQDYKVTDVTPNVDIIIPKGCIVSIPIAGLHYDPAIYPDPTRFD 2143090
2143089 PERFNDENKHKIPLGAYLPFGLGPRNCIASRFALMEVKAIVYQLLLNYEFKRSERTPVPL 2142910
2142909 KLAKGFASTSAEKGIYLQLSPRQVE* 2142832

>CYPr3l5 = CYP9L1  533aa AAAB01008986.1 no in
2142476 MEINLMYVIGIVSVLVALYVYLTHNNDFFKKYPIPCLPVEPLFGSSRQFLLKKISFSEFV 2142297
2142296 RSNYERFPNAK (2) 2142264
2142196 MYGMFEMFTPMFVIRDPELIKQITVKDFDHFINHRPLMKADNSSNSTAMFSKILFNLTG 2142020
2142019 QRWRNVRTTLSPTFTGSKMRQMFAMILECSDNMVQALAHPTGRECEVKDLFIRFTNDVIA 2141840
2141839 SCAFGVHVNSFRDKDNVFFRYGKDLSNFSRLKVALKIMGYQVFPKLMAQLQMDIFDSTHV 2141660
2141659 QFFTEMFRQSVQEREEHGIVRPDLIHLLIQARKGQLRYQPQESEETDGFATAKESNEQKI 2141480
2141479 LPEDMVKLSENEMIAQCLLFFLAGFDTIATSMTFVLYEVTLAPEIQQRLYEEIQQVSETL 2141300
2141299 DGKALTYDALQGMRYLDMVVSETLRKWSPSPGTDRMCNQDYTIPGDPDIVIPKGATVFIP 2141120
2141119 IAGLHYDPRFYPDPDRFDPERFNDENKHKIPLGAYLPFGIGPRNCIASRFALMEVKAIVY 2140940
2140939 HILLNYELKRSERTSVPVKLAKGFSPLKPENGMYLKFNPRMKN* 2140808

>CYPr3l6 = CYP9J5  545 aa AAAB01008986.1
2126984 MEISLMVLVPLVAILGFIYHYITKGNKYFHDKPIPSLAAEPLFGSTRRLMMKQTSFHDFV 2126805
2126804 ISIYNKYPLVK (2) 2126772
2126352 VFGMIDTMLPMFVVRDPELLKRIAVKDFEYFMNHRPVFGNNDDPHNEALFGKTLI 2126188
2126187 AITDQKWRDMRATLSPAFTGSKMRQMFELIVECSSNMAQHYKEQIRSNGAGSREHEMKDV 2126008
2126007 FTRYANDVIATCAFGIKVDSLKHAENDFFVNGKKMMAFNRPIVMLRMMGFRLLPKLMNFF 2125828
2125827 NLDLFDREQRVFFTEIIKDTVRTRDANGIVRPDMVHLLMQARKGALKHQRDTEEREEVKG 2125648
2125647 FATVEESEVGQTQASKGMQMTELEMIAQCLIFFLAGFDTVSTCLTFLAYELTVNRDVQDK 2125468
2125467 LYEEILQTDKALSGGPLTYDAVQGMQYMDMVVSEGLRMWAPAPATDRLCVRDYVVDDGDR 2125288
2125287 LKFTIDKGTVVFIPIAGLHHDPQYYPNPSKFDPERFSVENRDKINPNTYLPFGIGPRNCI 2125108
2125107 GSRFALMEVKAIIYYMLREFSFERTPNTQVPLRLAKGFAGMRSEKGVFVEFRPRKQAAN* 2124928