>CYP18A1 Am2_13.1 (31931-34244), 524 aa, 5 exons
MGGTRIEVLCTFLVFLGVLLVARCLQWLRYVRSLPPGPWGVPVFGYLPFLKGDVHLRYGELAKKYGPMFSARLGTQLVVVLSDHRTIRDTFRREEFTGRPHTEFINILGGYG(1)IINTEGAMWKDQRKFLHDKLRGFGMTYMGGGKKIMESRIM(0)REVKTFLRGLASKRGTPTDVSASLGMSISNVICSIIMGVRFQHGDARFKRFMDLIEEGFKLFGSMAAVNFIPVMRYLPCLQKVRNKLAENRAEMAGFFQETVDQHRATFDEGTMRDLVDAYLLEIEKAKGEGRATTLFQGKNHD(1)RQMQQILGDLFSAGMETVKTTLEWAIILMLHHPDAAIAVQEELDQVVGKSRMPVLEDLPFLPITEATILEVLRRSSVVPLGTTHATTR(2)DVTLHGYTIPAGSQVVPLLHAVHMDPELWEKPEEFRPSRFLSAEGKVQKPEYFMPFGVGRRMCLGDVLARMELFLFFSSLMHTFELRSPQGSSLPSLRGNAGVTVTPDPFDVCLLPRNLDLIEDNDMISTGAILRNIGSH*

>CYP306A1 Am2_13.1 (38911-36903), 499 aa, 7 exons
MILDHYIAIFVLPFLLLLYVVRKNRKARRLPPGPWQLPLLGYLPWIDAEKPHETLTRLSRVYGPVCGFRMGSVYTVLLSDPQLIRQSFAKDSITNRAPLYLTHGIMKGYG(1)IICAEGEQWKDQRKFISNCLRNFGMVKHEGAKRDKMEERISDAVNECVS(0)VLRDRGANGPIDPLDTLHHCLGNLVNSIVFGKTYEEEDRIWKWLRHLQEEGVKQIGVAGPLNFLPFLR(2)FLPQYGRVIRSIVDGKDKTHEIYRQILDEHRARVDSGNGCKIDSFLAAFDEQMRKKDGAESGYFTEPQLYHLLADLFGAGTDTTLTTLRWFLLFMAAHPMEQ(0)EKIQSEMDLCLREGEQPTLNDRIVMPRLEAAIAEVQRIRSVTPLGIPHGTSE(0)DVEIGGYDIPCGAMIVPMQWAIHTDPAYWRDPLEFRPDRFLSEDGTFFKPESFLPFQNG(1)KRVCVGEELARMILFLFAGRILRAFSVRVPAGEIADLEGECGITLVPKPHRLAFVGRDR*

>CYP307B1 Am2_14.4 (871542-875286), 507 aa, 3 exons
MIPLTATTCFLIAITFLALALILLDHLRSKKTTKSVVPGDDDQHALPEPPGPKPWPILGSLHILGRYDVPYKAFADLVRDFDCQVIKLRMGSVPCVVVNGLENIKEVLTVKGHHFDSRPNFARYHLLFGGNKENS(1)LAFCNWSDVQKARREMLRAHTFPRAFSTRFNELNGIIGDEMEFMVNHLDSLSGTSVHAKPLILHCCANIFITYLCSKNFHLEHDGFRNMVENFDKVFFEVNQGYAADFLPFLMPLHHRNMARMAHWSHEIRRFVIKNIIADRVNSWNDVVPEKDYVDCLINHVKSGTEPQMSWNTALFVMEDIIGGHTAIGNLLVKVLGFLATRPEIQRLAQDEIDALGLAGNFVGLENRRSLPYVEAIILETIRIIASPIVPHVANQDSSIAG(1)FRIKKDTFIFLNNYDLNMSTDLWTSPEEFMPDRFVQNGRLLKPEHFLPFGGGRRSCMGYKLVQYVSFAILASILKNFTITPVQKEDYTIPIGNLALPEMTYKFRFERR*

>CYP303A1 Am2_Un.6309 (16690-14856), 375 aa, 8 exons
 (1)LLLVDGNLWNEQRRFVLKHLRDFGFGRQN (1)
LYMNANEYTGNNVTQSQLGTIISMHNIFGITVLNSLWKMLAGKR (2)
YNIDDKELIYFQRILSITLNEIDMLGAPFSHFPLLRFIAPEISGYKSFVKIHEELWKFFK (0)
DEVNNHKNTFNSDSPGNLIDIYLTILNSENYGKTFSD (1)
VSEPQLVAICVDLFMAGSETTSKVLGFCFLYLVLFPHVQKKAHEEIDRVIGRNKLPTAEDKAK (2)
MTYMNAIVLESLRMFAGRSLNLPHRVQRDTKISDYKIPK (0)
NTIIITNFNGILMDESWGDPENFRPERFIDGSGNIVTPSRFLPFSAG (1)
KHRCMGENLAKTNIFIIATTLLQAFTFSEIPGEKPTIEHFIDGTTISPKPYRVNVSLRI*

>CYP305D1? Am2_7.2  (74000-68000) frameshift repaired in 7th exon  (72431-68935), 490 
MNKNFVKIFNLLLYLFIDVFNNLFFIECDG(1)PFSWPFIGNQILLKRLSRKFGGQHKAFMELSKRYNSDIITVNISYEKIIVVSGSKFCDMILQNEEFQGRPWNEFIKVRNMGKKQG(1)ITMNDGTEWKELRNWMMRTMKIFGFGKSEMIEMIQHQLVIFSENLNKNKLHQLKLLFVPAVINVLWNFITGELVAFNQQQK(2)LEHFLDLLDRRSRCFDITGGLLAAFPWIRYIAPEISGYNIMCMLNKELKDFLM(0)KTINDHKEKYIEGKEADLIDMFIQEMRKNEKSSIFTD(1)EQLMMILIDLFLAGFTTTSTTLDFLFLIVTLFPDVQRKVQKEIDSVIPYDRLPNMEDKAK(2)LPYVEAVISETYRLWPVFPIIGPRRVLCDTNIDKYVIPKDTTILFNTYSINKDPTLYPDPDKFMPERFIKNGVFEPDEYSLQFGKG(1)KRRCPGDILAKATIFILFVGIMQKYTLLPVPGKGPHSIKINSGITLTPQPYNVLVEKR*

>CYP15A1 Am2_7.2  (65177-67812), 500 aa, 8 exons
MLYVVISLLLALYCIFCIYDCVKPHNFPP (1)
GPKWLPLIGCFLTFRRLKLKHKYTYVAFQELSKTYGPILGLKLGSQKLVVI
STHDLVKKVLLQDEFNGRPDGFFFRVRAFGKRK (1)
GILFTEGSMWSQCRRFTMRHLRSFGLGQSTMEKYLTVEAENLVNYLRRVST
KGPVPMHTAFDIAVLNSLWCMFAGHRFDYENEKLAEILEIVHDSFR (2)
LMDTMGGIISQMPFLRFIIPELSGYNNLMEILRKLWNFLDEEINNHEKHLSGNQPQDLIEAFLLEISSRNGVQNDSIFDR (1)
ENLLILCLDLFLAGSKTTTDTLSTSILFLSLHSEWIKILQEELDNVVGRSRSPTLEDYSSLPIMESFLAE (0)
IQRFLILAPLGVPHKTTKDVILNGYNIPK 
DTTVLLDFHSAHNDPAYWDHPEEFRPQRFLDANGRFCQNNANIPFGL (1)
GKRRCPGEMLARTSLFLYFAYVIHYFDIEISPEHGKPDLNGHDGFTISPKSYYLKITARSDVTNCSTI* 

>CYP342A1 Am2_8.3 (44357-46424), 505 aa, 7 exons
MISFLFIIFLLLIIYKIYNSVIHVSSNTPPC(1)LPRLPIIGSYWHLLWHDYEYPYNGIIHYVNKLQSKIVTCYFGSHKTIIANDYKSIKEVLTKQEFNGRPINVDIVLQRAFGKSLG(1)IFFTEGTLWHEQRRFALRHMRDFGFGRRHEIFETNVMEEIAILVDMLKEGPINDEEK(0)KFLKNGYACFPDILYPYVANVILNIMFGERFDRSQYHKLIYFCESSMMFQKSLDTSGGAIFQFWFLKYFGNIFGYTNAIKATYQMINFIE(0)EYIDNKKDLDDYDKGLIGRYLKILKEKNNITSTFSQKQLIMTLVDFMFPATSALPSALVHAIKLVMHHPRVVNNIQEEIDRVVGTGRLVTWSDRKN(2)LPYIEATIRESLRYETLTPLSVFHKTLKKTTLCDYDIPKDTLVVTNLVALNTDPDLWGDPENFRPERFLDENNELRKDFTFPFGFG(1)HRVCPGETYSRYNMFEVFAVLMQNFNFSFVEGEPTGLDDKESGLIVTPKKTWIQVKARNMK*

>3241+6423 Am2_Un.573, R->K (725-7080), 496 aa, 8 exons  combined Am1.2_Un.3241 and 
MWFVILCFVIVLIKILFDYSRPINFPPG(1)PRGLPFIGNILDIIKLINETKYYSDTWCRLAEKYGSVVGLRLGLDQPLIIVSGKSAVTEMLNRSEFDGRPSGFLYKYRCGGMQQGILFTDTDVWHSQRR(2)FALKTLKQFGFGKNSMEHILQHDAIALTNIIIELTKDGTVKNIRSIISAAVLSNLWLLIDGTK(2)FDIGMENSNLKEAINIVQDIVKSSNVSGGIINQFPFLRHLFPNLTGFSAFVERQKRINNFFM(0)EVIAKHKWKKINEEGTNFIDVYLQEIQKKNSSHSFFNE(1)NQLLYIIKDLFSAGVDTTNSTIGFIIAFLVVHQDVQSKVYDEISRVIDKDIYPSLSDKDR(2)LPYLKAVIAEVSRLANIGPTSIPHRAVKDSTFLGFEIKKNYTLLANFKSIHMDKEHWGDPEIFRPERFINEKGDFINDSWLMPFGLG(1)RRKCLGETLAKNTVFLFVACMLQRLHFMLPSNHPPPCLQGIDGFVIAPPMMDIIAVQRF*

>CYP6AQ1 Am2_12.16   (1067523-1070348), 514 aa, 5 exons
MNLLTPYWSLDILIVSSSLMIAVYLYASWKLKYWSRRGIMQITPSPLFGNFKKCILFQKSVSEIIRELYGQNEGLPFMGFY
IFYKPFFLVRDIELVKHILVKDFNTFANKHTSADSKNDRIGYSNLFIIKNPAWKYLRGKLTSVFTSGKLKKMFDLMLIIG (1)
KNLEKHLELLNLDG
NGKEVELKDLCANFTTDLIGTTAFGVNLNSLKDPNSDFRENGRLVFDYNLKRAFEFFSIFFFPNLS
KYVSIKFFGKATDYFRNSFWSVINQRIESNVKRNDLIDCLIELREKHKNDESFEGFR (1)
FDGDDLVSQAAIFFTGGFETSSTTISFTLYELALNKDIQKTVRTEIHEALAQTDGKITYDM (0)
ITNLPYLDMVVSETLRKYPPLGFLDRVALHDYKIPNSDVTIDKDTPVIIPMIAFHYD
PKYFPNPEKYDPLRFSEEVKKTRPSYVYMPFGEGPHICIG (1)
MRLGLLQSKLGIIEILKDYEVSPCEKTKIPMVLDPKGLTTTALGGLYLNIRKITIAAG*

>CYP6AR1 Am2_5.8 (434944-432195), 502 aa, 5 exons
MSWLMIETVGLIATVFFLLYYYSMSKLDYWRKRGVKGPKPLPFLGNFKDVLLAKESTMDCFERAYKEFKDEPMVGMYGSHEPLLILRDLDLIKDVLIKDFNKFAQRTQGAIRE(0)VEPLSEQLFRLDAERWRPLRLKLSSFFSSGKLKEMFHLFVECSDNFEKYLEKMVEKGGLVECRDAAAKFSTDVIGACAFSIHTNALTDENSQFRKMGKQALATNLQQFLNDRLREYPFLFKIFGRFFVDHEVTNFFANSIKDAMDYRIQNNVHLRDVIDILADIRENPTKCGLKE(1)ADNLFLTSQAVLFFLAGFENASLTISNALYELAWKPEIQEKARAEIVNVLQKYDGKITYDGLEEMKYLEACIFE(1)TLRMYPVLQWLSREAMETYTFTGTKVTIPKGQQVFLPIYAIQRDPDIYPNPDNFDPERFTDDKIKTRHSMTHLPFGDGPRHCSG(1)IRLAKKQLKVGLVTVLSKFKVEVCEKTRKIYQKDKKPLFLLQPVDGIHLKISKVSV*

>CYP6AS1 Am2_Un.5363 (3492-1105), 498 aa, 5 exons
MDYFQILCAISIVILTIYYYYSSKYTFWKKRGISGPKPIIFFGNFVDSIIQKRSTSEAVKKWYDDYKHESVFGIFGGTTPLLVINDLDMIKDVLIRDFSLFVDRGFHIFPK(0)IEPLSEHLFLLEAERWRPMRMKLSPIFTSGKLKEMFFLIMESAGNLEKYLDEVIKKDEMVECRELAAKFMTDVIGSCAFGINTNSLLEEDSEFRRMGKKISTPNLKVMLGNICKEFFPPLYEIVGSIFTLKDVNEFFINLVSDTMKYRKDNNIIRSDFINMLMQLKEHPEKMENIE(1)LTNTLLTAQAVVFFVAGFETSSSTMAFSLYELAQNQEIQDKLREEIRNMHEKNKGVLTYTDVKEMKYLDKVFKE(1)TLRKYPILPMLFRQAMENYTFKDTKITIPKGMKLWVPVHGIHHDPNIYPEPEVFDPERFEDDAFASRHPMSYLPFGDGPRNCIG(1)ARFAHYQSKVGLITILRHHKVNVCEKTTIPFKADERSFLLTLKGGVHLKITKI*

>CYP6AS2 Am2_Un.476 (25830-23485), 498 aa, 5 exons
MDYFQILCAISIVILTIYYYYSLKYAFWKDRGISGPKPIIFFGNFGNSIIKKKSLSETVKKWYDDYKHESVFGIFEGTIPVLVINDLDMIKDILIRDFSLFVDRGFHIFPK(0)IEPLTQHLFLLEAERWRPMRMKLSPIFTSGKLKEMFSLIVESAGNLEKYLDEVIKKNEMVECRDLAAKFTTDVIGSCAFGINTNSLLEEDSEFRRMGKKIFSPSLKLMIGNTCKVFFPSLYEVIGNIFTMKDVDEFFINLVSDTMKYRKDNDIVRSDFINMLMQLKEHPEKMDNIE(1)LTDTLLTAQAVVFFIAGFETSSSTIAFGLYELAQNQEIQDKLREEIRKMHEKNKGILTYTDIKEMKYLDKVFKE(1)TLRKYPILSTLSRKAMENYTFKGTKITIPKGTKVWVPVYGIQHDPNIYPKPEVFDPERFEDDAFASRHPMSYLPFGDGPRNCIG(1)ARFAHYQSKVGLITILRNHKVNVCEKTTIPFKADERSFLLALKGGVHLKITKI*

>Am2_Un.4631 new (605-937), 111 aa, 1 exon only one aa diff to 6AS2
MDYFQILCAISIVILTIYYYYSLKYAFWKDRGISGPKPIIFFGNLGNSIIKKKSLSETVKKWYDDYKHESVFGIFEGTIPVLVINDLDMIKDILIRDFSLFVDRGFHIFPK(0)

>BI504529.1 Apis mellifera cDNA clone 95% to 6AS2 last 127aa = 100% match to 6AS2
YYYYSSKYAFWKDRGISGPKPIVFFGNFGNSIVKKRSISETVKKWYDDYKHESVFGIYEG
TIPVLVINDLDMIKDVLIRDFSIFVDRGFHT FPKIEPLTQHLFLLEAERWRPMRMKLSPI
FTSGKLKEMFSLIVESAGNLEKYLDEVIKKNEMVECRDLAAKFTTDVIGSCAFGINTNSL
LEEDSEFRXMGKKIFSPSLKLMIGNTCKVFFPSLYEVI

>CYP6ASf1 Am2_Un.5370 (9442-11518), 497 aa, 5 exons,  completion on C-terminus stop 
MDFFQIFCAICIMLLAIYYYYTSIYNYWKVRGIPGPEPTIIIGNFMEVFLKKISINDKLRFLYNKYKNEPMFGIFEGSSPILVLNDLDLIKDVLIKDFSIFSNRGFRIFPK(0)AEPLGEHLFALETERWRPMRAKLSPIFTSGKLKEMFPLIIECSKNMEPYLDKIAERGKYIECRDLAAKFTTDVIGSCAFGIDMNSISDKDSEFRIIGRKLFTPTFKTIVRDVCRQFLPGLYDVIGHKLQIEEVNEFLTNLIKDTINYRKENKIVRPDFVNTLIELKDHPEKLETIK(1)LTDSMIASQAFVFFVAGFETSSSTISHALYELAQNQEIQDKLREEIREVYEKHGELTYDVIKNMKYLDKVLKE(1)TLRKYPIMAMLTREAQENYTFKGTKVTIEKGIKVWILPYGIQNDPDIFPNPDIFDPERFDEEAVAARHPMSYLPFGDGPRNCIG(1)ARFAQFQSKIGIITIVRNHKIDVCEQTKIPYESDPFQFLLALKGGINLKISKI*

>CYP6ASf2 Am2_Un.5353 (3026-2045), 209 aa, 3 exons,  4 aa change at C-end of last exon 
(1)LTDILLTAQAVVFFVAGFETSSSTMAFSLYELAQNQEIQDKLREEIRKVHEKNKGVLTYTDIKEMKYLDKVFKE(1)TLRKYPILSTLSRKVMENYTFKGTKITIPKGTKIWVHGIQHDPNIYPEPEVFDPERFEDDAFASRHPMSYLPFGDGPRNCIG(1)LVLPHYQSKVGLITILRNHKXVNVCEKTTIPFKADERSFLLVPKGGIHLKIIKI*

>CYP6AS3 Am2_Un.476 (20769-18418), 499 aa, 5 exons
MDYFQLLCVIGALLFAIYYYLTLTFDTWKNRGIPGPKPTIFFGNFQEVILKKISLAEKTKQLYQEYKNELVFGIFQGRTPILVINDLEMIKDVLIRDFSVFPDRGIHVNPK(0)VEPIFQTLFSLKSKTWRPLRMKLSPVFTSGKLKDMFPLILDCAKNLEEFVEKVRNSGEPVDCRDMAAKFTTDVIGSCAFGVCMNSLSPEGSEFRRMGEQLGKFSFKKLARDFTRLYMPFLFDIIGGYLQSHEVNNFFINLIRDSIKYRQENNVYRPDFVNTLKELKEHPEKLENIE(1)LTDALLTSQALVFFLAGFETSSTTISNALYELAQNPEMQDKLRKEIKEVYENNGGALSYTDVKEMKYLDKVFKE(1)TLRKYPVLAALSRQATENYTFKDTKIKISKGTRIWIPVYGIQHDPNIYPEPEVFDPERFEDDAFASRHPMTYLPFGDGPRNCIG(1)ARFAHYQSKVGLITILRNNKVEVCAKTLIPYKSEPRNILMIPKGGKVELRITKV*

>CYP6AS4 Am2_Un.476 (1718-4379), 501 aa, 5 exons
MLHHFHILTAFVAIFLALYYYLTSKFDFWKNRGVSGPRPVPFFGNAKDVLLRKIGIGSFIAELYKRYDNEAMFGIFIGRSPNLVLRDLDLIKDVLIKDFSIFDNRGLNIPER(0)AEPFSVNLFSVDATRWRPLRMRLSPVFTSGKLKEMFPLILECAEHLEQCLEDAVKRGGPVDCFEIPARYTTDVIGSCAFGINMNALSDERSEFRKMGRNMFDQNMIKFTRNLLRDFFPRFYNLLGFVLPYTESTVFMTKLIKGTIKYREENDVVRPDFVNLLMELKKHPEKLKNIE(1)ITDTLLAAQASVFFAAGFETSSTTMAHALYEMALNPDIQDKLRNEMKEFHAKNNGNLKYEDIKEMKYLDKVFRE(1)TLRKYPPGMLLRRKCNSNYTFHGTKVSIPAGTSVIIPLYAIQIDPKFYENPDVFDPERFNEDAVAARHPMTYLPFGDGPRNCVG(1)ARFAVYQTKVGLIKILQNFRVDVCEKTMIPYVKKINSITLAPRDGIFLKIEKITD*

>CYP6AS5 Am2_Un.4238 (9913-6869), 498 aa, 5 exons,  pseudogene?, stop codon is back in 
MASSFEILCGIAVLFLALYYYLTSTFDFWKSRGVVGPKPVPFFGTTKDLILVKKSTAHFVKDIYEKYKNEPMVGLYATRSPFLLLNDPELIKDILIRDFSKFANRGLGVFER(0)TEPLSPHLLNLEVERWRPLRSRLSPIFTSGKLKEMFYLIIECSLNLEMYLDKLIEKNEPIECRELTARFTTDVIGSCAFGIDMSSMTNENSEFRRMGREVFAVNFMNVMRMKLKQFMPRLYDLLGYVMPDRTFAPFFTRVVTDTIKYRNDNNIVRPDFINMLMELQKNPQKLENIK(1)LTDSLIAAQAFVFFLAGFETSSTTMSNALYELALNQDVQKKLREEINTFCPKNNKELKYDDIKEMEYLDKVFKE(1)TLRMYPPASILMRKAISDYTFNDTKITIPKEMKIWIPAFAIHRDSAIYPNPDSFDPERFDKDAMASRHPMHYLPFGDG*RNCIG(1)ARFAVYQTKVGLITILRNHKVEVCEKTVIPYEFDPGAFLLSPKDGIYLKITKI*

>CYP6AS6 Am2_13.15 (124021-121751), 497 aa, 5 exons
MFDYFQILIAFVASFLALYYYLTSNFDFWKNRNVVAPKPIPFFGNTKDVVLKKIEISNFIAELYKKYENEAMFGIFFGGSPNLILRDLDLIKDVLIKDFSTFDERGFKISER(0)ADPLNANLFNMDVTRWRPLRIKLSPVFTSGKLKEMFPLILKCAERLEQCLEDAVKRGGPVDCFEISARYTTDVIGSCAFGINMNALSDERSEFRRIGKRIFDLDKNILRSFLRQFFPRFYNLLGFVIPYSETSKFVTKFISEMIKYREENNVVKADFVNLLMELKKHPEKLQNIK(1)ITDNLLAAQAFVFFAAGFETSSTTMAHALYEMALNPNIQDKLRKEIKEFYANNNFTYEEVKKMKYLDKVFKE(1)TLRKYPPGVFLKRKCNSNYTFKGTKVSIPAGTSVIIPVYSIQTDPKFYENPDVFDPERFNEDAVAARHPMTYLPFGDGPRKCIG(1)IRFGVYQTKVGLIKMLKNFKVNVCEKTMIPYIKKINSFTLAPKDGIFLKIEKNN*

>6AS7 Am2_13.15 (119129-116557), 505 aa, 5 exons,  completed on N-terminus
MPSLEIIFGIILLFPAIYYYFTSTFDFWKVRGVPGPKPIPIFGNIKNVMLLKTSMCHYLKKLCEEYKHEPMIGIFTRKTPILIIQDPDLIKDVLIRDFSKFANRGIPIHEK(0)AEPLSPHLFNLEVERWRPLRTRLSPVFTSGKLKEMFPLILDCAKHLEQYLDKLVLREEFIECRELTAKYTTDVIGSCAFGIEMNALSDEESEFRRIGRKVFSNSFGQILRFRFRQIFPRIYNLLGFVLPPMEVTKFLTNIIVSTMKYRQENNIVRPDFVNMLIELKKHPDKLENIK(1)LTDTLLTAQAFVFFIAGFETSSSAISNALYELALNPEVQNKLRQEIKEYFNKHNELKYEYIKNMIYLDLVFRE(1)TLRKYPPGPLILRKSITNYTFNNTKVSIPEESFVWIPLYAIHHDPKIYPNPDAFIPERFNDDAIATRHPMHYLPFGDGPRNCIG(1)ARFAVYQSKIGLITILWNYKVEVCDKTMIPYEINPAAFLLTPKGGIYLKFTKIKNNEEILN*

>CYP6AS8 Am2_13.16 (153493-156158), 500 aa, 5 exons
MYISLEIFCGIVVALIALYYYLTVNNNFWKNRGIAGPEPVLGFGNMKKVLLGKESMSQFLTKIYHEYKNEPIIGIFTTRTPQLIIKDPDLIKTILIKDFSKIMNRGLLPMVS(0)GEPISQHLFNIEAERWRPLRIHLTPVFTANKLRGMFSLILECSMHFVSYVDSLVKKGEPVNVREVAARFTTDVVGSCGFGVEMNSLSEKESEFRRVGKSVFATNYARIIKHRIREFMPRLYNYILYLWPTDEMAEKIIKLTRETLEYREKNNLFRPDFMNILLDLKKHPEKIGLD(1)VTNEFLAAQAFIFFVAGFETSSSTISNALYELALNPDVQDKLRKEIKEFAAKNDGEWRYETIKEMEYLGKVFQE(1)TLRKYPSLPFLTRELIEDYTFESNKVTIPKGLKIWIPTYAIHNDPDIYPDPDKFDPERFSDDKIKQRHPMHFLPFGHGPRNCIG(1)ARFAIYQTKIGLINILRNFKLDVCDKTLIPYKHHPRGLLLMPLTDLYLKITRLTN*

>CYP6AS8alt Am2_13.16 (152312-152647), 112 aa, 1 exon this sequence is just upstream 
MYIGFEIIYGIVIVFIAFYYYLTINNNFWKHRGISGPKPVLGFGNMKKIILGEESMSQYLTKLYHKYKNESMIGIFRLRTPALIIKDPDLIKIVLIKDFSKFMNRGLLPIIS(0)

>CYP6AS9 Am2_13.17 (7981-5161), 497 aa, 5 exons,  probably pseudogene, frameshift in 
MFINLETLCGFVIVLIAFYYYLTINNNFWKNRGIPGPKPTIGFGNMWTVMFGKESFSQLLTTIYNKYKDEPMIGIFFRRRPVLLLKDFDLIKDVLIKDFSKFANRGFLKTNP(0)KVPLTNHLFALEVKRWRPLRNHLXSPVFTSGKLKGTFAQILNCSNDLVTHIDTLSKMEDSINMREVAAKFTTDVIGSCVFGIKMNSLSEIENEFRRIGRNIFATNFTNILKIRLLQSTPFLHSLLCKILPDEEMEMFMRITKETMEYREKNNLVRPDFMNILLELKKHPERIADIE(1)LTDDLLAAQAYIFFAAGFETSSTTISNALYELALNHDMQDKLREEIKEFEAKNDGEWRYETIKEMQYLGKIFGG(9)TLRKYPALSFLSRESIIDDYTFRDTKLTISKGTLVWIPVFPIHHDPNIYPDPEKFDPERFTEDKIKERNLMHYFPFGHGPRNCIG(1)ARFAIYQTKIGLIKILRNYKVDVCSKTLIPYKYDPFSFILVPLGGLYLKITRI*

>Am2_79040249 new (34-540), 168 aa, 1 exon highly similar to 6AS9
(0)KVPLTNHLFALEVKRWRPLRNHLSPVFTSGKLKGTFAQILN?APMILXDSYRHFIEDGRLYKHAREVAAKFTTDVIGSCVFGIKMNSLAEREXEFRRIGRNIFATNFTNILKIRLLTSTPLLHSLLCRILPDEEMRXMFFRITKETMEYREKNNPPQAGFYEYTSRLETEV

>Am2_Un.5369 (5212-3283), 300 aa, 4 exons C-terminal end of Am1.2_6AS9, also appears 
EIENEFRRIGRNIFATPFYKYIED*RLLQSTPLLHSLLCKILPDEEMEMFMRITKETMEYREKNNLVRPDFMNILLELKKHPERIADIE(1)ITDDLLAAQAYIFFAAGFETSSTTISNALYELALNHDMQDKLREEIKEFEAKNDGEWRYETIKEMQYLGKIFQE(1)TLRKYPALSFLSRESIIDDYTFRDTKLTISKGTLVWIPVFPIHHDPNIYPEPEKFDPERFTEDKIKERNLMHYFPFGHGPRNC(1)ARFAIYQTKIGLIKILRNYKVDVCSKTLIPYKYDPFSFILVPLGGLYLKITRIQD*

>Am2_48488186  like 2nd exon of Am1.2_6AS9 (826-453), 125 aa, 1 exon
DTLSKMEDSINMREVAAKFTTDVIGXSCVFGIKMNSLSEIENEFRRIGRNIFATNFTNILKIRLLQSTPFLHSLLCKILPDEEMEMFMRITKETMEYREKNNLVRPDFMNILLELKKHPERIADIG(1)

>CYP6AS10 Am2_13.17 (13740-10480), 499 aa, 5 exons
MAAFEILCGFIIFIFAFYYYLIKPQEYWKNRGVPGPKPIPIFGNFFRLTFARISIGDLMTKFYKEYKHEPVFGLYMRNVRVLAINNPDLIKTVLIKDFSKFAHRGLALNEV(0)TEPLSQHLFVLEPKRWRPLRTKLSPIFTSGKLKDMFSLIIECSNTLENYVEHLISKNDRVEVRDLAAKFTTDVIGSCGFGVDMNAMSDVQCKFRDIGREFFGPSFKQILKIRLRENLPRLYTFLGYILPRDETTTFFTNVVLDMIKYRKTNDIYRPDFINALINIQNHPEKLDIE(1)LTEPLLVAQAFLFFVAGFETSSLTIATALYELAQNQDIQDKLRDEITEHHKLNNGEWQYENIKNMPYLDAVFKE(1)TLRKYVPLTVLMRQSLEDYTFESINLTIPKDTRIFIPIYAIHRDPDIYPNPEVFDINRFSKEAEATRHPMHYLPFGDGPRNCIG(1)ARFAIFQTKIGLIKILRTYKVDVCNETQIPFINEPRTFTLAPKHDLTLKITKIEN*

>CYP6AS11P Am2_13.16 (147797-150778), 500 aa, 5 exons,  not a pseudogene after all??? 
MYINLEIFCAIVIAFIAFYYYLTINNNFWKHRGISGPKPVLGFGNMKKIILGEESMSQYLTKLYHKYKNESMIGIFRLRTPALIIKDPDLIKIVLIKDFSKFMNRGLLPIIS(0)TEPISHHLFALEAERWHPLRKHLTSGFTSNKLKGMFCMIHECSKHLVNYLDILVRKEEPVNVREVAARFTTDVVGSCGFGVEMNSLSEQESEFRRLGKSIFNTNVQKIIKDRIRELTPQVYNFLLYILPLDGISPKILKLMKETIKYRKKYDIFRPDFMNIILELKKHPEKINID(1)ITNELLAAQIFIFFAAGFETSSTLISNALYELALNPNIQDKLREEIKKFESQNDEEWKYETIKKMDYLEKVIQE(1)TLRKYPPVPFLNRELIDDYTFESNKVTIPKGLKIWIPTYAIHNDPDIYPDPDKFDPERFSEDNIKQRHPMHFLPFGHGPRNCIG(1)IRFAEYQTKIGLINILRNFKLDVCDKTLIPYKLHPRGLILIPLTDLYLKITRLTN*

>383+1.19 Am2_1.19 (858065-862228), 476 aa, 5 exons, still incomplete on N-term of 4th 
MWNIIRELLEQFLLPGLFLGILYCFLTSTFDFWKNRGVPFRKPTVLFGNFAPMLLFRKSLPEGIKEMYEWFKDERYFGAFRVRSPVLILRDPDLVKNICVKNFTSFSNRGIPVNSQ(0)DPLSAHLFNLEGKKWKSLRSKLTPAFSSGKLKRMFYLLAECGEEFEKLIDISSETDRPYEIRELAAKFTIDVIGTCAFGIQINALTDEESEFHRAAKKLSKPSYKATLWRMLRTAMPRLYKFLGVQVIDPGVTKFFKDVVSQMIKQRGEYGIKRHDFMDLLIELKNKGTLDEFGK(1)LDENSIAAQAFVFFAAGYETSSNTIAFCLHELALNTEIQEKTRRDIQDAIDSRNGNLTYDAVQDMKYLDMVIAG(1)KVELPAGIRVIIPIYGLHHDPDYYPSPAIFNPERFTEENKRTRHPYAYLPFGEGPRNCIG(1)MRFALLQIKVGIISFLRNHRVETCQKTITPIKFSRRSLVTTSEKGFWLRIK*

>13.16 Am2_13.16 (142794-146154), 501 aa, 5 exons,  complete on C-terminus, -->K 
MYIGLEILCGIVITLIAFYCYLTINNNYWKNRGIPGPKPVPGFGNMKNVIFGKESVSQFLTRMYNEYKDEPMIGVFSKRTPVLIVKDVDLIKTILIKEFPKFANRGLFPIFS(0)RDPLTHHLFNLEVERWKPLRTQFTPLFTSSKLKEMFSLILECSNHLESYMDTLIKKGEPIDMREVSARYTTDVVGSCAFGIDMNSLSEKESVFRRLGKLIFATNLRKILSIRIQDMLPWLYNSFLYVLPRDEKTRIIMKLMTETMEYREENNVFRPDFINMLLNLKKHPEKIDIE(1)LTDDLLAAQIFIFFAAGFETSSSTISNALYELALNPDIQEKLRKEIKEFEARNNGEWRYEIMKEMEYLEKVFQE(1)TLRKYPSLPFLNRKLINDYTFESNNVTVSKDLKIWIPVYGIHHDPDIYPDPEKFDPERFSKKEEIMKRHPMHFLPFGHGPRNCIG(1)ARFAVYQTKIGLIKILRNFEVQVCNKTLIPYKVNPYTSLLIPITGLYLNVVKLEN*

>Am2_101397060 (79-354), 91 aa, 1 exon very like Am2_13.16, 29aa in a row
(0)TLRKYPSLPFLNRKLINDYTFESNNVTVSQRFKRFWIPVYRNLTPISDIYPDPEKSHL*KISLGGNYGEGAPKAFLPFGQGPQNMSCVWPIK(0)

>218+7762 Am2_Un.210 (2742-6273), 501 aa, 5 exons, combines Am1.2_Un.218 and 
MNISLEILCGIIVALIVFYYYLIINNNFWKNRKISGPKPVIGFGNMLSIILGKESTSQFLTRIYNEYKNEPMIGIFSKNNPALVIKNPDLIKTVLIKDFHKFANRGLFPVNS(0)REPLSQNLFGLEVERWRPLRIHFSPIFTTNKLKGLCSLILECSEQLEKYMDILIRKGEPLDIREIAARFTTDVIGSCAFGIEMNSLSENESEFRRLGKGVFNTTFRRIVKTRIRNLMPWLYNFFLRILPWDEITKKIVKLTTETIEYRNKNNIVRSDFINVLLNLKKHPEKIAEIE(1)LTNDLLSAQTFVFFGAGFETSSTTISNALYELALNHDIQYKLREEIKEFEKKNDGKWTYESIKEMQYLNKIFQE(1)TLRKYPVVPFLNRELISDYTFENSKITIPKGLKIWIPVYGIHHDPDIYPNPEKFDPERFSEDKIKERHSMHYLPFGHGPRNCIG(1)SRFGTYQTKIGLVKIIRKYKVEICDKTLIPYKFNSFANFLMPSTGLYLMITDVEN*

>CYP6AS12P Am2_Un.476 (9611-6794), 499 aa, 5 exons,  no longer a pseudogene???  
MAYIEILCGIIVSMLVFYYYFTSVFNFWKIRGIPGPKPKFLFGNIRDIILSRISTPTFIKNIYDTYTNEPMVGLYMGRNPILLLKDPELIKDVLIRDFSKFADRGFNVHEK(0)VEPLSQHLFNLEPKRWRPLRSKLSPMFTSKKLKEMFGLILECGHHFEKYVDGLAARRQPVDFCEVAAKYTTDVIGSCAFGINMNAMSSEGSEFREAGRKIFEPTWNSIIRLKFKITMPTLYDLLGPLVPEREVTPFFIKVVTDAMKYRKERNVFRPDFIDTLMKLRDDPESLSDIE(1)LTDAFLTAQAYVFFAAGFETGASTISNTLYELAQNQGMQDRLREEIREHCDKYGGELMYENIKEMEYLDKVFKE(1)TLRKYPPGTLIPRRSVSEYTFKNTNVTIPKGTMIWIPAFPIHRDPNIYPNPDDFNPENFTEDAINNRHPMNYLAFSNGPRNCIG(1)ARFANYQVKIGLIMILRNYKVEVCEKTVIPYQFDPNLFLLGPKGGIYLRVTKVE*

>Am2_98681617 new (840-543), 99 aa, 91% to 6AS12P almost identical to Am2_Un.6006
VDVAFYYYFTSALNFWKIRGIPGPHXPKFLFGNIRDIILSRISTPTFIKNVYDTYTNEPMVGLYMARNPILLLKDPELIKDVLIRDFSKFADRGFNVHEK(0)

>Am2_Un.6006 (2537-189), 375 aa, 4 exons, like 6AS12, but with nucleotide deletion at 
YGRIVHGTESDS
LLKDPELIKDVLIRDXFSKFADRGFNVHEK(0)VEPLSQHLFNLEPKRWRPLRSKLSPMFTSKKLKEMFGLILECGRHFEKYVDGLAARRQPVDFCEVAAKYTTDVIGSCAFGINMNAMSSEGSEFREAGRKIFEPTWNSIIRLKFKITMPTLYDLLGPLVPEREVTPFFIKVVTDAMKYKKESNVFRPDFIDTLMKLRDDPESLSDIE(1)LTDAFLTAQAYVFFAAGFETGASTISNTLYELAQNQGMQDRLREEIREHCDKYGGELMYENIKEMEYLDKVFKE(1)TLRKYPPGTLIPRRSVSEYTFKNTNVTIPKGTMIWIPAFPIHRDPDIYPNPDDFNPENFTEDAINNRHPMNYLAFSNGPRNCIG(1)

>1326a Am2_Un.5370 (792-4695), 499 aa, 5 exons, completes 3rd exon for Am1.2_1326a, 
MIANLEIFCGIIVILIAFYYYIRLEQFWKFXGIPGPEPLPGFGNVLMIVLGKEAPFQFLTRVYNEFKNEALIGVFMKTYPALVVKDPDLIKDIMIKDFYKFPNRGFPKSDSVN(1)PLTQHLFLVEEEKWRPLRTQLSPVFSTGKLRGTFTQILDCSNHLVTYMDKLVEIGEPIDVREVTAKFTTDVIGSCVFGIKMNSLSGKESEFRRFGRQIFAMNFLKILRLRIKQFLPMLHYLLVRILPPDEETKIMLKLTRDTFKFREAHNIVRPDFMNILMELKKHPEKVPSLD(1)LTDGLLAAQAFIFFAAGFETSSTTVANTLYELALNPDIQEKLRQEIKEFEANNDGEWKYETIQEMKYLDKTFKE(1)TLRKYPVLPYLSRRSIEDYTFEGTKVSIPKNTLICIPVYPIHHDSSIYPNPEKFDPERFSEDEVKKRHSMHYFPFGHGPRNCIG(1)LRFAIYQSKIALIKILSNYKIEICDKTLIPYKYDPFSFISLPLTGIFLKITKLQN*

>Am2_Un.5351 like Am1.2_Un.1326a (1601-384), 100% to Am1.2_Un.1326a
(1)GLLAAQAFIFFAAGFETSSTTVANTLYELALNPDIQEKLRQEIKEFEANNDGEWKYETIQEMKYLDKTFKE(1)TLRKYPVLPYLSRRSIEDYTFEGTKVSIPKNTLICIPVYPIHHDSSIYPNPEKFDPERFSEDEVKKRHSMHYFPFGHGPRNCIG(1)

>Am2_13.17 (752-9), 143 aa, 2 exons, like Am1.2_Un.1326a, but lacking the frameshift 
MIANLEIFCGIIVIVIAFYYYITARNNFWKIRGIPGPEPLPGFGNVLMIVLGKEAPFQFLTRVYNEFKNEALIGVFMKTYPALVVKDPDLIKDIMIKDFYKFPNRGFPKSDS(0)ADPLTKHLFLVEEEKWRPLRTQCPQCSQPVN

>Un.416 Am2_11.13 (431584-428990), 515 aa, 6 exons, missing aa on C-terminus, changed 
MQNSLFMPIIFSIAFFVIILILYLKYTRTYWLRRGVPTVPGHWLFGNIKKILDLKKPPAYVISDIYQKCSENDDILGIYIFFKPFLLIKDPAIIKQILIKDFNYFPDRNFTIQSFYDEIGNKSLFTLKNPQWKYLR(2)TKLSPIFSSAKVKKLFHLMVEAANSMNKYLDDEFSNDTKTKTIMIKDVTLKYTTNVISSVAFGIQVNSFNPKTIQFYEEA(1)QKGLKTTFSRSMQLCISFFFPKLSPYLNTRMLGSSTNFFRKVFWNSMDNREITKTKREDLIDSLMELKNAKQDKDFK(1)FEGDALLSQSAIFFIAGRETSISIICLTLYELAKHPEIQKRTREEINEKLKEHGMTYEGVQSMKYLHQVVSEILRIYPPTPIIDRVAVADYK(0)IPGTDIVIEKGTSVFIVLTALHNDPKYHPDPLRFNPDRFSDENKENIKPFTYIPFGEGPRICIG(1)ARIGQLQSIIGLITIIKNYEISFISKCKGDLDVRNIFITPINDFSL??????????????????FH*

>Un.6686 Am2_Un.1086 (577-5116), 512 aa, 6 exons, complete on N-terminus 
MFLTTWLIPDIIAVASLITVGLYFYYKLYLFKFWHKKGIFYVKPSFPTGNIMPIINGKLSLA(1)EFFRDIYEHNKHHRLVGIYMLYKPYLIVNDPNLIRDILTKEFTNFHDRGIFYNEEVDPLSGHLFQLPGKKWRNLRVKLTPTFTSGKIKQFFPILNEAGNILAKYLEEEARKGSTIDVKDIFAR(2)YSTDIIMSVAFGISCDSFKEPNNEFRYWGKKIFDPKPLWNALILFAPQILNFFSISYTEKSVTKFFTNMFKQTVKYRESNNIERKDFLNLLIQLMKNGYVDADDESLSNNVNAAK(1)NKLTMMEAAAQAYVFFLAGFETSSTTVTFCLYELAKNQDIQNKVREEIQTMIKKNGDLTYNALNDMNYLHKVISE(1)TLRKYPPVVILNRICTNDVKLSTTDFCIPKGTCIAIPVFGLHRDSNIFPNPEKFDPERFSEENIKTRHPYVYLPFGEGPRICIG(1)LRFGLIQTKIAIINALLKNKFKFGPNTPSTLEFEKGSLILIGKGGIHLNIEPI*

>Am2_98611857 new (16-745), 93 aa, 2 exons, 89% to Am1.2_Un.6686, CYP6P like
PRDGSSQEKFDPERFSEENIKXLGHPEVYLPFGEGPRIL(9)IGLRFGLIQTKIAIINALLKNKFKFRPNTPSTSEFEKGSLILIGTGGIHLNIEPL*

>CYP335A1 Am2_14.6   (434001-435548), 515 aa, 1 exon
MEVSHLTTFELLLLTLIFIILAKLVSILYTQFTYWKRNKVPYIRSSPLFGTAWRVFFRLVSFPNYCKYIYNYYPDARYVGVMDFATPTVIVRDPKLIKEIAVKNFNNFPDHRSFVTEEMDPVFGKNVFSLKGDRWREMRNTLSPSFTANKMRFMFDLVSKCSHDFVSCLHDRLESSSSEIEGKNLFTRYSNDVIATVAFGISVNSIEHPDNEFYRRGIDVSTFSGTFRFIKFMLFRLNPRLTRMAGFTFLSRATSKFFWRVISETVTARKRRGIVRPDMIHLLMQATDSKKKSIHQTMTIDDIVAQAFIFFLAGFDTTSTLMCYVVHELALHQDVQRRLREEVDRVLDDGTEISYEDTLGMEYLEMVISETLRMHPPTLLIDRQCAKEFHLPPAGPGYESVTIHPGENIWFPVLAIHRDPAHFPDPDKFDPERFNRENRNGIDPYTYIPFGVGPRKCIGNRFALMETKLLIIRLLRKFVIKPCERTMDPIVYKKGNFTLMPKDGFWVTFEKRNDH*

>CYP335A2 Am2_14.6 (443001-444560), 519 aa, 1 exon
MESPTLLFSFELLAIGLTAIVLAKFVSLLHHQYNYWRKRRVPHVGAVPVLGSSWRIFTRRMSLPNFCSLVYKHRPGSRYLGMMDCFTPVVVVRDPNLIKEIAVKNFDHFPDHHSFINEKIDPIFGKNVFSLKGDRWREMRNTLSPSFTASKMRFMFDLVSNCSEEFVRYLYDHPEFSSSIEAKDAFTRYTNDVIATVAFGISVNSMENRDNEFYTKGADATNFGGIFRLFKFMLFRVNPRLTRMAGLSFLSRGTATFFHRVVRETVRARDERRIVRPDMIHLLMQARDKEDRRPVATVDNRMTIDDITAQAFIFFLAGFDTSSTLMCYVAHELALNPPVQERLREEVDRFMDGGNGAITYEALLKMEYMDMVTSETLRKYPPIVFIDRLCVEKFELPPAEQGYDHLIVHPDNIVWFPVYGLHHDPKYFPEPEKFDPERFNDANKRNIVPYTYMPFGLGPRKCIGNRFALMETKILIAYMLRKFRIKRTEKTRASIEFSKTNFSLTPDHGFWIGLEKRDP*

>Am2_14.6 (440001-441185), 379 aa, 1 exon,  psuedogene like 335A2
DSFRYSAHFANSSS*KNPVGPVLAQSSSKREILLDFTLNPSINQGDSFDRFIDRSSTRNIFSF*GAKGRKR*GILSPSFTMNEIDVRNCSQVCGSFALIYPRWTQRKILSSATT*SFIYQILLESV*IRWKTTSQFPLMRFRVHD**DY*E*FLKSTIFDFVPRVVSNGIEWRTRHR*TGYTAFIARNKEKSSIDKMTIDDIVSRAIRFSTWMALTLALSNFMRFVLYDPAFGWRGKEIDG*NILRILRRVYTGMMMSETLGKYSGLIFVDRVCTRKFALSGAGYDGATLYPGDIVFSPYVGSRS*IFFRSRNEKNEGNIVPYWNLLLEIKIFMIPSRRFSIRLNEKTPEAYRLSEK*SCIHS*RRNLD*IGRKERL*ILWLVKNFVHYFAKRFM

>CYP335B1 Am2_14.6 (530001-531533), 510 aa, 1 exon
MDYLQLGLTLLAILVAVYYLSTRNHKLLKRHGIVHIPPTPLFGNLGPLVRRKCHMEDVIQRVYDLDPDARYVGMYEFTTPLIIIRDPELIKTIGVKEITNFTNHRPFVDVGVDPMLGEVLFAMQGDRWREHRTMLTTLFTSSKIKSMFVLMSDCAKRFADYLSKVEREIELKSVLTRYTNDVIARCVYGVSVDSVNEPENIFYRYGQVASQLSTFKQNLMIFVHRNSPRLARLFNLKILPVHIEKFFHRLVMDTIETRRREGVHGLDMLQQLMDMQSRRKESEEGKRGMTVTDIANHAFSFFFGSVDTMATQISLISHMLAVNPDVQQRLQEEIDEVLSASEDKQVGYDVIQEMKYLDAVMSEAMRYHPILLFVDRVCGETFELPPALPGARPFKLERGMNIWFPVKAIHHDPKYFENPDRFDPDRFLRDGKGIASSGAYMPFGMGPRKCIGSRFALTEMKILLFNILAKCSFKVGSKTMVPLKFKEGVFNPVAKNGFWLKIERRENSCC*

>CYP335B2 Am2_14.6 (589998-588400), 532 aa, 1 exon
MEFLSLALVLAAISIIAYYYCFVRKNFNLFQEHGILHVPPSPLVGNFGPLIRGKENVHDTIQRIYNIHPDAKYVGIFEFLTPVIMIRDLDLIKSITMKNFDQFPDHRPMFCKSVDPMLGEMLFIMDGERWKEHRNMLSPTFTSSKIKTMFVHMSECAKRFAHHLSKLPEKDRETEMKALLTRYTNDVIAACIYGVNVDSIKEPRNVFYMYGRVGATLIGLKKNLKIMVHRNMPWLANLLRLNILERHIAKFFTDLVVETVEERERNGTTNSDLIQLMMDTRNKKESGKKNLTVQNMANHAFSFFFGGFDTVSSQTCVLLHMLVENPEVQQRLQQEIDETLESNNGQLSYDVIQEMRYLDAVINEILRLHPIAVFIDRMCVKSFELPPALPGDVPFTVKPGMNVWIPVKAIHHDPRYYDEPEKFKPERFLDNGKNIIGSGAYFPFGIGPRICIGNRFALIEMKVLVCHILAVCDIKAGARTGIPLEFEKGVFNATAKTGFWLKIEPRKYSYHSGQINGLVNNHVINGACKTGI*

>CYP335B3 Am2_14.6 (574998-573445), 517 aa, 1 exon
MDYLTISLSLITVFVAVYYLATRNNDFFKKHGIPHVPPVPFLGNMGSLVRQKSNLHDVIDRTYNLDPGAKYVGIYEFTTPIIILRDLDLIKTITMKYLDHFPDHRSFAYEGADPVFGSMLFAMKGERWKEHRNMLTPTLTSSKIKGMFKLMTECAVRFADFLSVLPENERETEMKALLSRYANDVIASCVYGVSVDSINDPKNIFYVYGRRGTNVVGLKKSMFVLIHRNMPWLAKLFGLRFLEKHVQKFFYDLVYETIESREKLGTNRSDVLQLLMDIRDKANSSGKMTTMTVENVAIHAFTFFFGGFDSITSVTTLLTQMLAEHPDVQARLQQEIDETLRSNDGVLTYDAVHGMKYMDAVINETMRFCPVLPFLDRMCVESFQLPAPVPGGQPFTLRPGMNVWIPLAAIGRDPEYFEDPDKFDPDRFLNPEAGIKNSGAHFPFGLGQRKCIGERFAMMEMKVLLCYVLAACNVRIGSKTTVPMKLEKGLINANVKGGFWLKIEPRKVTYYNSSRSN*

>CYP335C1 Am2_14.6 (581001-582596), 531 aa, 1 exon
MLDSWSITAAIVAVLAIAYYQLIWKYKHFERIGIPCYHSIPLLGSFWEAVIQRNNFAEISRKIYNSYPDTKYMGMYDTTTPVLLIRDTELIKAISVKHFEQFPDHRSFQNEATDPLFAKNLFALRGDRWREIRNLLSPAFTSSKMKSMFILMRDCAKEYGDYFASLTGDESTIELKDAFTRYTNDVIATCAFGVEVNSMKDRKNKFYVYGREGTTFGSWASIKFFVTRVLPVSVCTLLRIRLIRKEISDFFIDLVSTTIKTREEKGIVRPDMIQLMMESKGKLGAGKEMSMIDICAQAFVFFFGGFESTSTLMCFAAYEIAVNEDIQRRLQNEIDQVLEERDGEVTYAAVNEMKFLDAIIYEALRMYPVVVATDRVCMKPFELPPNRPGEKPYLLKEGDNVWFPIYAIQRDPQYYPEPDKFDPDRFLNDTKQMINSGLFLTFGIGPRMCIGNRFAMLETKVLLFHLFARCNLVPCSKTTIPMKLNRKGFSMTAENGFWFKIEPRSAKKEEKIAVPGTTMLIDKIPDRYPDN*

>CYP335D1 Am2_14.6 (577001-578524), 507 aa, 1 exon, 1 aa change
MAIFALLLIVLGILGSYHLLKSQNPFKEHGLPYKSYLPILGSTWESILRRKSFAVVIQEIYNLAPSARYVGFYNRTTPIVMIRDPELIKTIAVKNFDAFRNHRTVNDTQTDDVLLSGNLLLLRDNRWREVRSLNTPAFSTSKIRSMYRSMSEIAINVARYLSTLAPGQNIVEMKDIFTRYANDVFATCAFGISVDSLSDRENKFYELGREALDIHSTPILKLILIFAFPKLARRLGVSLVSKEATNFFTRVVSENIKMREEKGITRPDFIQAMIDKRNGRGRDDELTVEDITAQAFVFFFGGFETTSGLLSFAVHELAANPEIQGKVHAEIDRVLVSNNEITFERVNGLMYLDAVINETLRMYPIIPITDRECSKRFELPPVLPDAKPYVLKEGSHVWFPIYAIQRDPRYFEKPDCFDPDRFLDDNKKRSDAFNGDAYMPFGAGPRNCIGNRFSMVETKVALFHILAKCRLDVCPKTTIPMELRKRGVFLTAKNGFWLRIVPRHPVT*

>CYP336A1 Am2_2.8 (230001-231491), 496 aa, 1 exon,  5aa changed 
MASAFLTLVTGALLLLCFYLYLKYTYWKRNGIPYSKGYYPIIGHFLPLIMKKQSYSEIIEEIYRDSNHSMVGMYKGMKPVLILRDINLIKTVLQSNFSKFHENAVKIDPKLDPLLAKNPFFCYGELWQTGRKRLTYAFSNARLKILFAAVYEVCTKFRNFLDRRLESSKKYEVELKSLFLKFTSEVVANAGLGIEGFCFEDDKVQSMFTNLDNNDFLDTFLIGIIVHFPFLTKLLRIQFLPTKHDKFFRTVVKKNLELRKSDPIPRNDFIQLMIEMEQTGEKIDEEIVAAHAVSFYLDGVETSSVTLNFIGCQLAIHQDVQEKLRKEVRSTLEKHGGVLTFEALKDMTYMNQVISESQRYFSALGFLGKICTDEFELQGSDGLNYRAKPGTELLIPICGLHKDPKYWDNPEIFDPERFSDENKQRIEKMAFIPFGEGPRICVGMRMAMLQMKSCLATLMKDYKLEVSPKMQLPLKLSPTYFLSAPLGGGWVLISKA*

>CYP4G11 Am2_16.8 (1440635-1444519), 545 aa, 7 exons
MAAASATGFSASSVFLSLLIPALILYFIYFRISRRHLLELAEKIPGPPALPLIGNALDLFGT (1)
MFSQVLKKAENFKDVVKIWVGPKLVICLIDPRDVEIILSSNVYIDKSTEYRFFKPWLGDGLLIST (1)
GQKWRNHRKLIAPTFHLNVLKSFIDLFNANARSVVEKMRKENG
KEFDCHNYMSELTVDILLETAMGVSKPTRDHNAFEYAMAVMK (2)
MCDILHLRHTKIWLRPDWLFNLTKYGKNQIKLLEIIHGLTKKVIQLKKEEYKSGKRNIIDNSAQKTESK (0)
TNNIVVEGVSFGQSVGLKDDLDIDDDVGEKKRQAFLDLLIEAGQNGVLLTDKEVKEQVDTIMFE (0)
GHDTTASGSSFFLAVMGCHPDIQEKVIQELDEIFGDSDRPATFQDTLEMKYLERCLLETLRMYPPVPLIAREIKTDLKLA (1)
SGDYTIPAGCTVVIGTFKLHRQPHIYPNPDVFDPDNFLPEKTANRHYYAFV PFSAGPRSCVGRKYAMLKLKIVLSTILRNFRVRSDVKESEFRLQADIILKRADGFKIRLEPRKQVASTA*

>CYP4AV1 Am2_Un.282 (45375-55154), 501 aa, 8 exons, insertion of nucleotide at C-end 
MSSSTIIMGVSWLTMILSICLMTIVVLLLVRRGKFLYALRKVPCPPAFPIIGNAYELCCSPEE(1?)AFKKMIKWGKELGDMYLIWVGMRPFIFLYKAEAIQPLLSSSVHIDKSLEYQYLQPWLGSGLVTSTG(1)EKWHFHRKLLTPTFHSGLLELYLKTTIREAQILISCLRKEIGKPEFDIVPYAKRAALDIICD(1)SSMGCNINAQKNFENEYVQAVNT(2)LASISQRRFLNVWMSFDPIFKLTSWGKRHDHALSVTHGFVNK(0)IIAERKAEWKDRKDTNFNEKSHKRQALLDLLLELSKDGKVLTDDDIRDEVNTFMFAGHDTTATSVSWILYALGRHPQYQ(0)ELIIEEYDETVGTKELTLDILSKLTWLEACIKESWRLYPVTPLIARQIYHPITIL(1)GHEIPIGSTVLVNSFLLHRDSRYFPEPDIYRPERFLPDGPKYPSYAFVPFSAGSRNCIGWKYGTMIVKVLILYILKNFHVESLDTEDQLRFISELVLHNADGLRLKITPRK*

>Un.1527 Am2_Un.5748 (1270-4633), 487 aa, 12 exons, added 7th intron, completed 11th 
MISAILFFIFLLATLHYFLLHHRKFGKMINLIPGPEPLPILGNIPTFHNISPS(1)ELWKFLTQLSKQYYPIYRMWTFLEAYVHICHPDDIE(0)TILGNIKFTKKGFGYKYLKPWFNTGLLTSSG(1)HKWHVRRKILTSAFHFNVLRQFVDIFIEDAERLIKTLESEEGIFVENLLQLTSEHTLNVICE(1)TAMGTSLKNKEKFQYEYRKAVYNMGCIFANR(2)IVKPWFYYDFFFNLSPEGWQQSKLLKILHNFTRK(0)IIQERKEYHDKTNV(1)RRKRLAMLDLLIEAHRNNKIDDEGIREEVDTFMFR(0)GHDTTAISFCFSIMLLAEHKEIQ(0)DRARAEIKAAIEENGGKLNITVLQNLPYLERCIKESLRLFPSVPRISRKLETS(1)NYEIPSNTIINVNIFDTHRDPKFWPNPNKFDPDRFLPENSKKRHPYAYVPFSAGPRNCIG(1)QRFAMLELKTYLGLLLYNYYFEPIDYLKDVTFVSGIVLRLENPVRMKFIPVKKIC*

>Am2_49183273 new (824-692), 45 aa, 1 exon 83% to Un.1527 in 4 clan
(0)DRPPAEIKAAIEENGGKLNITVLQFFSDLERCIKESLRLFPTVAG(1)

>Un.1327 Am2_Un.1509   (17798-16709), 299 aa, 3 exons
 (2)GQIMLLYRMIRPWLLIEWIYRLTKYGREEEKQRKNLFDTCFKMVKEKRDLLQSKDRISNNDIKKNK
NISLLEYMVEINEKNPCFSDEDIVEECCTFMLAGQDSVGTATAMTIFLLANHPEWQNKCIEEIDEIFNG
DTRFPTISDLKEMKCLEMCIKESLRLYPSVPIIGRTLGEDIKI (1)
GKHIIPAGCSVLISPYSTHHLPHHFPDPDTFKPERFNSENSEKRHPYAYIPFSAGPRNCI (1)
GYKFAMLEMKSIISAILRKCRLQSIPGKKEIRPKFRMTIRAQGGLWVKIIERDQILKSIAA*

>CYP314A1 Am2_5.28 (288891-286071), 517 aa, 10 exons (first intron is a guess)
MLLSSAWFEVIAAVLLTILIFVTSHRPAWWFWTATSHEASA(1)PAEGKFKTVSKVPGPFSLPIFGTRWIFSCIGYYKLNKIHDAYKD(1)LNQRYGALCKEEALWNFPMISVFSRQDIETIIRRNSRYPLRPPQEVISHYRRTRRDRYTNLGLVNE(2)QGQTWHDLRVALTSELTAASTVLGFFPALNIVADSFIELIRRQRVGYKVTGFEELAYKMGLES(1)TCTLILGRHLGFLKPDSSSELATRLAEAVRIHFTASRDAFYGLPLWKLLPTCAYKQLIESEDAIYN(2)IISEIIETTIQEKRDDAKDESVEAIFQSILRQKNLDIRDKKAAIVDFIAAGIHT(0)LGNTLVFLFDLIGRNPAVQNKLYEETYALAPAGCDLTIDNLRKAKYLRACITESLR(2)LIPTTTCIARILDEPIELSGYRLTAG(0)TVVLLHTWIAGLNEENFKDAKKYLPERWTTPTTPHSPLLVAPFGAGRRICPGKRFVDLALQLILAK(0)IIREFEIIVEEELDLQFEFILAPKGPVSLGFRDRS*

>CYP334A1 Am2_9.4 (736455-733846), 531 aa, 10 exons, second exon is a guess 
MTESQTASVDESLRTDTIPLLDHTATTEVSPTTFEVSTMKVDTQIFDKAPLPFDEIPGPAILKIWEKYWKYVPLLG(1)RLTWNRNITPLKYLFNEYGCIVRINGPLSGDIVMIHR(2)PEHIAEVFKQEGDTPVRSGIDILQHYRLNYRKYRLAGPFSM(2)QGTEWLEIRDKVEDTFNQISSTFFTKIDTCCNELITRICKIRNRQNE(0)VPVSFYEDLIRWAMECFCDLTFNKRLGFLEPIGYNSSSEASKLINALTTAHKYMSRCETGFQVWRFFLTPFARKLFEACDVLDN(2)VIGKYVRQAQCKLRIRKSHSEESSMTERSPVLEKLLLNEGIHPDDICTMLMDMIILGIQA(0)TVNSEAFLLYHLAKNPRTQRKVYDEIISVLSNDNSSFTEKSLKNMPYLKACIQETLR(2)LHPAIPYITRLLPKTISLHGYTIPKG(0)TFVIMANQITSQREENFEDPFKFWPERWLSNSSKEDVHFSYLPFGHGIRSCLGKNMAEAKMMLLTAK(0)LVRQFRIEYDYADIKSRFMMVNVPNKPLRFRFVNRN*

>CYP315A1 Am2_Un.248 (31787-34039), 535 aa, 6 exons
MNLAQNILKSGKSVSLSSNVIALKYNVPGCGYAGASQTSRIDDLSDISKSTDGGNRSKIEITEKLRDRNYGTVAVATSESILQEMPEPRGIPVFGTLFSFILSGGPKKQHEYVDKRHKELGPVYKERIGPTTAVFVNSIHEFRKIFRLEGSTPKHFLPEAWTLYNEIRKCRRGLLFM(2)NGEEWVYFRKILNKVMLLPDPTNLMIAPCQEVAIELKRKWQKQIKTNNIISNLQVQLYQWSIEA(1)MMATLMGSYWYSYKHQLSRDFEILAETLHEIFEYSAKLSIIPVKLAMNLRLPVWKKFVASADTAFEIVRMLVPEMAKLGGNGLLKKMMDEGIRAEDAICIVTDFILAAGDT(0)TATTLQWILLLLCNHPEKQEELFKHLKDLSQEDILRLPLLKGIIKESLRLYPIAPFISRYLPEDSVIGNYFVPKG(0)ELLVLSLYSSGRDAANFPQPNEFRPERWIRTQKGIYQGVVHPHASLPFALGARSCIGRKLAEIQISFALAE(0)LIKSFKIECINKNQVKLILHLISVPSQSIKLKLMERN*

>CYP302A1 Am2_Un.4726 (2916-5374), 228 aa, 4 exons, added to C-terminus 
MCTLLKKCNQSIRKKLFIKFYSNEFTKSKIKINHSQPKAFYDIPGPKSLPIIGTLYKYLPFIG(1)EYSFTNLYESGKKKLKCFGPLVREEIIPNVNVIWIYRPEDIAEIFKAESGLHPERRSHLALLKYRKDRPNIYNTGGLLPT(2)NGSEWWRLRKEFQKVSSKPQDVINYLKETDCVIQEFVELCNNEKFADFLPLLSRLFLEL(1)TCLVVFDIRLNSFSKEERCENSISSKLIKAAFATNSAILKLDNGLQLWRLFETPLYRKLRKAQTYMEM(2)IALELVSRKKNNMKIRYNKSFLDAYLENPVLDIKDIVGMACDMLLAGIDT(0)TSYSTAYILYHLAKNQNIQEKLRIEATQLLKNHNEPISINILRNASYTKAVIKESLRLNPISIGIGRILQTDVVLSGYRVPKG(0)SVVVTQNQIICRLPEYFEEPNLFIPERWLREYSENNNKINYKKTVHPYVLLPFGHGPRSCIARRFAEQNMQILLLR(0)ICRRLKISWHGDDLGMISLLINKPNALLKFNFHDILNNNSV*

>Am2_98065759 new (1073-428), 72 aa, 2 exons 62% to 302A1 
(0)IIALHLWRFLAPPLYRKLRNAQTYMET(9)NWYLVTPNHMKIRSHKSFLHPYLENPALHIKAILGMACVMNYLSL

>CYP49A1 ortholog Am2_Un.86 (102533-109096), 531 aa, 10 exons
MLKIFVIKFLCCRVKMQILNCKFTKLLKNTVKQSNNIIKTLETLTTEVEEQDWSRCRPYSEIPGPKPIPFLGNTWRFIPFIG(1)DFKIQAVDQVSKKLYKEFGDIVKVEGLLGRPDMVFIYDANEIERIFRQEERMPYRPSMPSLNYYKHVLRKEFFKENAGVIAV(2)HGESWYNFRSKVQQVMLQPRTARMYITSMEEASLAFLER(2)IKKIRNKNDEVPDDFLNEIHKWSLES(1)IARVALDVRLGCLDDDANIETQQLIDAVTTFFKNVGILELKIPFWKLFNTPTWLKYVNALDTILS(2)ITSRYTTVALSRTKEAEKSDKEPSLLERVLALENDTKLATILSLDLFLVGIDT(0)TSSTVASTLYQLALHPDEQDRAYNEVCNILPSKDMQLDGKHLDKLKYLKACIKETLR(2)MYPVVIGNGRCMTKDTIIKGYRVPKG(0)VQVVFQHYVISNLDKYFPHSDKFLPERWLQSDGVRHSFASLPFGYGRRMCLGRRFAELEMLVVISK(0)ILQRYKIEYHHEKLEYYINPMYTPKGSLNLKFIDR*

>301A1 Am2_Un.86  (115000-109000) changed to better splice sites for 2nd intron 
MMTGKTRYLFFKIHFLLLYVLI(2)CMVDHDTTTIQQGKPYKDIPGPRPIPILGNTWRLFPMIGQYEISDIAKLSQIFYDEYGKIVRLTGLIGRPDLLFVYDVDEIEKIYRQEGPTPFRPSMPCLVHYKSVVRKDFFGSLPV(1)FTILRRHGEPWREFRTRVQKPILQPQTVRKYITPIEMVTSDFIQR(2)IQEIKGEDGEVPGDFDNEIHKWALEC(1)IGRVALDVRLGCLSSNLTSDSEPQKIIDAAKFALRNVAILELKAPYWRYVPTLLWSRYVRNMNYFIE(2)VCMKYIDATMERLKTKKAVDEYDLSLMERILAKETDPKIAYILALDLILVGIDT(0)ISMAVCSILYQLATRPEEQEKIYQELVEILPDPSVPLNMSHLDKAIYMKAFIREVFR(2)VYSTVIGNGRTLQNDTIICGYKVPKG(0)VQVVFPTVVTGNMEKYVTDAKIFKPMRWLKESTKTLHPFASLPYGHGARMCLGRRFADLEIQVLLAK(0)LIRSYKLEYHHKPLKYKVTFMYAPDGELKFKVLPR*