>CYP51 Rv0764c Z80226
MSAVALPRVSGGHDEHGHLEEFRTDPIGLMQRVRDECGDVGTFQ
LAGKQVVLLSGSHANEFFFRAGDDDLDQAKAYPFMTPIFGEGVVFDASPERRKEMLHN
AALRGEQMKGHAATIEDQVRRMIADWGEAGEIDLLDFFAELTIYTSSACLIGKKFRDQ
LDGRFAKLYHELERGTDPLAYVDPYLPIESFRRRDEARNGLVALVADIMNGRIANPPT
DKSDRDMLDVLIAVKAETGTPRFSADEITGMFISMMFAGHHTSSGTASWTLIELMRHR
DAYAAVIDELDELYGDGRSVSFHALRQIPQLENVLKETLRLHPPLIILMRVAKGEFEV
QGHRIHEGDLVAASPAISNRIPEDFPDPHDFVPARYEQPRQEDLLNRWTWIPFGAGRH
RCVGAAFAIMQIKAIFSVLLREYEFEMAQPPESYRNDHSKMVVQLAQPACVRYRRRTG
V

>CYP101 M12546
MTTETIQSNANLAPLPPHVPEHLVFDFDMYNPSNLSAGVQEAWA
VLQESNVPDLVWTRCNGGHWIATRGQLIREAYEDYRHFSSECPFIPREAGEAYDFIPT
SMDPPEQRQFRALANQVVGMPVVDKLENRIQELACSLIESLRPQGQCNFTEDYAEPFP
IRIFMLLAGLPEEDIPHLKYLTDQMTRPDGSMTFAEAKEALYDYLIPIIEQRRQKPGT
DAISIVANGQVNGRPITSDEAKRMCGLLLVGGLDTVVNFLSFSMEFLAKSPEHRQELI
ERPERIPAACEELLRRFSLVADGRILTSDYEFHGVQLKKGDQILLPQMLSGLDERENA
CPMHVDFSRQKVSHTTFGHGSHLCLGQHLARREIIVTLKEWLTRIPDFSIAPGAQIQH
KSGIVSGVQALPLVWDPATTKAV

>CYP102A1 J04832
MTIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFE
APGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRDFAGDGLFTSWTHEKNWKKAHN
ILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFN
YRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVD
KIIADRKASGEQSDDLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSF
ALYFLVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSL
YAKEDTVLGGEYPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFK
PFGNGQRACIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLTLKPEGFVVKAK
SKKIPLGGIP

>CYP102A2 P450 part (N-terminal half)
MKETSPIPQPKTFGPLGNLPLIDKDKPTLSLIKLAEEQGPIFQI
HTPAGTTIVVSGHELVKEVCDEERFDKSIEGALEKVRAFSGDGLFTSWTHEPNWRKAH
NILMPTFSQRAMKDYHEKMVDIAVQLIQKWARLNPNEAVDVPGDMTRLTLDTIGLCGF
NYRFNSYYRETPHPFINSMVRALDEAMHQMQRLDVQDKLMVRTKRQFRYDIQTMFSLV
DSIIAERRANGDQDEKDLLARMLNVEDPETGEKLDDENIRFQIITFLIAGHETTSGLL
SFATYFLLKHPDKLKKAYEEVDRVLTDAAPTYKQVLELTYIRMILNESLRLWPTAPAF
SLYPKEDTVIGGKFPITTNDRISVLIPQLHRDRDAWGKDAEEFRPERFEHQDQVPHHA
YKPFGNGQRACIGMQFALHEATLVLGMILKYFTLIDHENYELDIKQTLTLKPGDFHIS
VQSRHQEAIHADVQAAEKAAPDEQKEKTE

>CYP102A3 U93874
MKQASAIPQPKTYGPLKNLPHLEKEQLSQSLWRIADELGPIFRF
DFPGVSSVFVSGHNLVAEVCDEKRFDKNLGKGLQKVREFGGDGLFTSWTHEPNWQKAH
RILLPSFSQKAMKGYHSMMLDIATQLIQKWSRLNPNEEIDVADDMTRLTLDTIGLCGF
NYRFNSFYRDSQHPFITSMLRALKEAMNQSKRLGLQDKMMVKTKLQFQKDIEVMNSLV
DRMIAERKANPDENIKDLLSLMLYAKDPVTGETLDDENIRYQIITFLIAGHETTSGLL
SFAIYCLLTHPEKLKKAQEEADRVLTDDTPEYKQIQQLKYIRMVLNETLRLYPTAPAF
SLYAKEDTVLGGEYPISKGQPVTVLIPKLHRDQNAWGPDAEDFRPERFEDPSSIPHHA
YKPFGNGQRACIGMQFALQEATMVLGLVLKHFELINHTGYELKIKEALTIKPDDFKIT
VKPRKTAAINV

>CYP102B1  Streptomyces coelicolor cosmid F43.
           GenEMBL AL136502 CDS 10570..12153 gene="SCF43.12"
           Highly similar to the N-terminal P450 domain of Bacillus
           megaterium 41.9% identity in 497 aa overlap. 
           45% to 102A1 over 433 amino acids
                     MAQTAREPARDGLPKGFRSAELGWPELHRIPHPPYRLPLLGDVV
                     GASRRTPMQDSLRYARRLGPIFRRRAFGKEFVFVWGAALAADLADEARFAKHVGLGVA
                     NLRPVAGDGLFTAYNHEPNWQLAHDVLAPGFSREAMAGYHVMMLDVAARLTGHWDLAE
                     ASGRAVDVPGDMTKLTLETIARTGFGHDFGSFERSRLHPFVTAMVGTLGYAQRLNTVP
                     APLAPWLLRDASRRNAADIAHLNRTVDDLVRERRANGGTGGGTGSGSGSGDLLDRMLE
                     TAHPRTGERLSPQNVRRQVITFLVAGHETTSGALSFALHYLAQHPDVAARARAEVDRV
                     WGDTEAPGYEQVAKLRYVRRVLDESLRLWPTAPGFAREAREDTVLGGTHPMRRGAWAL
                     VLTGMLHRDPEVWGADAERFDPDRFDAKAVRSRAPHTFKPFGTGARACIGRQFALHEA
                     TLVLGLLLRRYELRPEPGYRLRVTERLTLMPEGLRLHLVRRTAAAPAPGRRTAAPGAA
                     DDAGDTVSAPGCPVHRAGD

>CYP102C1 Rhodococcus sp. X309 AF059700.1 partial gene 48% to 102B1 
AAAGGKIDATADANKLALDVIGLAGFGYDFASFDGDEHPFVGAM
SRVLEHVNRTSNDIPFLRKLRGNGADLQYEKDIAFVRTVVDDVITERQAKPGEHQDDL
LDLMLNNIDDETGEKLDPVNIRNQVLTFLVAGNETTAGAIAFALYFLSRHPEIADAAR
AEVADITGGETPAFEDVARMRYLRRVVDETLRLWPSAPGYFRKVRTDTTLGGRYAMPK
GSWVFVLLPQLHRDPVWGENPDSFDPDRFKPENVKKRPAHAYRPFGTGPRSCIGRQFA
LHEAVLSLATILQRYSFQSDPEYKLDVREALTLKPVGLELSLQRL

>CYP103A1 M19352, AF242881 CDS 141158.142426 gene="virH1"
MIANSSTDVSVADQKFLNVAKSNQIDPDAVPISRLDSEGHSIFA
EWRPKRPFLRREDGIFLVLRADHIFLLGTDPRTRQIETELMLNRGVKAGAVFDFIDHS
MLFSNGETHGKRRSGLSKAFSFRMVEALRPEIAKITECLWDDLQKVDDFNFTEMYASQ
LPALTIASVLGLPSEDTPFFTRLVYKVSRCLSPSWRDEEFEEIEASAIELQDYVRSVI
ADSGRRMRDDFLSRYLKAVREAGTLSPIEEIMQLMLIILAGSDTTRTAMVMVTALALQ
NPALWSSLRGNQSYVAAAVEEGLRFEPPVGSFPRLALKDIDLDGYVLPKGSLLALSVM
SGLRDEKHYEHPQLFDVGRQQMRWHLGFGAGVHRCLGETLARIELQEGLRTLLRRAPN
LAVVGDWPRMMGHGGIRRATDMMVKLSFDL

>CYP103A2 AF034769 Agrobacterium tumefaciens plasmid pTiC58
gene="virH1" 77% identical to pinF1
MITSSISGTDQQFQNATQPKELDPDAVPVSRLDSEGHEIFAEWR
PKRPFLRREDGVFLVLRADDIFLLGTDPRTRQIETELMLNRGVTRGAVFDLIRYSMLF
SNGEVHVKRRSAFAKTFAFRMIDALRPEITKLTEHLWDDVPRVDDFDFAEMYASKLPA
LTIASVLGLPFGDAPFFTRLVYNVSRCLSPSWGEDDFPEIEASAVELQDYVRAVVADR
SRRISDDFLSCYLKAVREEGTLSPIEEIMQLVFLILAGSDATRNAMVMLPTLLLQNPV
VWSSLCHDQSGVAAAVEEGLRFEPSVGSFPRLALEDIDLDGYVLPKGSFLALSIMSGL
RDERHYEHPQLFDIKRKQMRRHLGFGAGVHRCLGEALARIELQEGLRTLLRRAPSLRV
TGDWPRMIGHGGARRATGMTVNLGVDR"

>CYP104A1 M19352, AF242881 Agrobacterium tumefaciens CDS 142447..143670 gene="virH2"
MEERRVSISSITWRFPMLFAPVDDVTTIDDLTLDPYPIYRRMRV
QNPVVHVASVRRTFLTKAFDTKMVKDDPSRFSSDDPSTPMKPAFQAHTLMRKDGTEHA
RERMAMARAFAPKAIADHWAPIYRDIVNEYLDRLPRGDTVDLFAEICGPVAARILAHI
LGICEASDVEIIRWSQRLIDGAGNFGWRSELFERSDEANAEMNCLFNDLVKKHRSAPN
PSAFATMLNAPDPIPLSQIYANIKIAIGGGVNEPRDALGTILYGLLTNPEQLEEVKRQ
QCWGQAFEEGLRWVAPIQASSRLVREDTEIRGFIVPKGDIVMTIQASANRDEDVFEDG
ESFNVFRPKSAHQSFGSGPHHCPGAQISRQTVGAIMLPILFDRFPDMILPHPELVQWR
GFGFRGPINLPVTLR

>CYP104A2 AB016260 Agrobacterium tumefaciens plasmid 
103A2 124584..125759 and 104A2  CDS 125919..127094 83% to 104A1
MQLAPVDRVTTIDDLTLDPYPIYRRMRAQTPVVRVASVMRTFLT
KASDTKMVKDQPRRFSSDDPNTPMKPAFQAHTLMRKDGAEHARERMAMAKAFAPKTTA
EHWAAIYRDIVNEYLDRLSRGSTVDLFAEICGPVAARILAHVLGISEASDAEMIRWSQ
RLIEGAGNFGWRPEPFERANEANAEMNRLFDNLVEKHRAEPNPSAFAIMVTASDPIPM
SQIYANIKIAVGGGINEPRDALGTIIYGLLTNPEQFEEVKRQQCWGQVFEEGVRWVAP
IQASSRLVLEDTEIRGFLVPKGDTVMTIQASANRDEDVFDDGERFNVFRQNNAHQSFG
SGPHHCAGAQISRQTVGAIMLPTLFERFPNMTLTNPDAVQWRGFGFRGPISLPVTLI

>CYP105A1 suaC M32238, Y18556 CDS 2447..3703
MTDTATTPQTTDAPAFPSNRSCPYQLPDGYAQLRDTPGPLHRVT
LYDGRQAWVVTKHEAARKLLGDPRLSSNRTDDNFPATSPRFEAVRESPQAFIGLDPPE
HGTRRRMTISEFTVKRIKGMRPEVEEVVHGFLDEMLAAGPTADLVSQFALPVPSMVIC
RLLGVPYADHEFFQDASKRLVQSTDAQSALTARNDLAGYLDGLITQFQTEPGAGLVGA
LVADQLANGEIDREELISTAMLLLIAGHETTASMTSLSVITLLDHPEQYAALRADRSL
VPGAVEELLRYLAIADIAGGRVATADIEVEGHLIRAGEGVIVVNSIANRDGTVYEDPD
ALDIHRSARHHLAFGFGVHQCLGQNLARLELEVILNALMDRVPTLRLAVPVEQLVLRP
GTTIQGVNELPVTW

>CYP105A2 D26543
MTTDATDPRTTDAAPFPSNRSAPYRFSDGYAQLRDPPGPLRLGT
RYDGRQAWVVVIHEAARKLLASRFESADAHRTGFPFLTAGGRDMIGTNPTLFRMDDPE
HARLRRMTISHYTVKRIKTISEFVEEVVLVFLRRMTISGPTADLVSQFLIGAGHMVIC
RLLGVPYEDHAFFQERSRVLLTLRSTPEEVRAAQDELLQYLARLARTKRERPDDAIIS
RLVARGEILREEDISDAMLLLIAGHATDANLTSMSLYALADRSEQYAALRADRSLVPG
AVEDPLRYVAIADIATEDVPIRGRTIAAGNTQIAMGSSANLDHEYYEDPDALTARVED
LVHLAFGFGRHQCLGQNLARADQLREDLMTARNDPTLRLAVPVQSSARLEGTTIQGVN
ELPVTW

>CYP105A3 D30815 sca-2 
MTEMTEKATTFLTSQEAPAFPADRTCPYQLPTAYSRLRDEPDAL
RPVTLYDGRRAWVVTKHEAARRLLADPRLSSDRLHADFPATSPRFKAFRQGSPAFIGM
DPPEHGTRRRMTISEFTVKRIKGMRPDVERIVHGFIDDMLAAGPTADLVSQFALPVPS
MVICHMLGVPYADHEFFQDASKRLVQAVDADSAVAARDDFERYLDGLITKLESEPGTG
LLGKLVTHQLADGEIDRAELISTALLLLVAGHETTASMTSLSVITLLEHPDQHAALRA
DPSLVPGAVEELLRVLAIADIAGGRIATADIEIDGQLIRAGEGVIVTNSIANRDSSVF
ENPDRLDVHRSARHHLSFGYGVHQCLGQNLARLELEVILTVLFDRIPTLRLAVPVEQL
TLRPGTTIQGVNELPVTW

>CYP105B1 subC SU-2 M32239
MTTAERTAPPDALTVPASRAPGCPFDPAPDVTEAARTEPVTRAT
LWDGSSCWLVTRHQDVRAVLGDPRFSADAHRTGFPFLTAGGREIIGTNPTFLRMDDPE
HARLRRMLTADFIVKKVEAMRPEVQRLADDLVDRMTTGRTSADLVTEFALPLPSLVIC
LLLGVPYEDHAFFQERSRVLLTLRSTPEEVRAAQDELLEYLARLARTKRERPDDAIIS
RLVARGELDDTQIATMGRLLLVAGHETTANMTALSTLVLLRNPDQLARLRAEPALVKG
AVEELLRYLTIVHNGVPRIATEDVLIGGRTIAAGEGVLCMISSANRDAEVFPGGDDLD
VARDARRHVAFGFGVHQCLGQPLARVELQIAIETLLRRLPDLRLAVPHEEIPFRGDMA
IYGVHSLPIAW

>CYP105C1 choP M31939
MTQAAPVTFSTVRENYFGPPAEMQALRHKAPVTRTAFADGRPGW
LVTGYSAARAVLSDSRFTARGEREHPAVPRAATLEDERCRRLIAGQFTARRMRQLTGR
TERIVREHLDAMEHMGSPADLVEHFALPVPSLVIAELLGVPPPDREHFQHDTLRWGGF
GRSTEEVTEAFVSLGGQLQRLVRLKRTEPGDDLLSGLIAADPALTDEELASIAFLLLV
AGHGTTAHQIALGAFLLLEHPDQLAALRADPALTESAVEELLRHLSVVHHGPTRAALQ
DADIEGTPVKAGEVVVVSLGAANRDPARFERPDAVDVTREDTGHLAFGHGMHQCLGRQ
LARIELRVALTALLERFPHLRLACPAAEIPLRHDMQVYGADRLPVAW

>CYP105D1 P450soy X63601
MTESTTDPARQNLDPTSPAPATSFPQDRGCPYHPPAGYAPLREG
RPLSRVTLFDGRPVWAVTGHALARRLLADPRLSTDRSHPDFPVPAERFAGAQRRRVAL
LGVDDPEHNTQRRMLIPTFSVKRIGALRPRIQETVDRLLDAMERQGPPAELVSAFALP
VPSMVICALLGVPYADHAFFEERSQRLLRGPGADDVNRARDELEEYLGALIDRKRAEP
GDGLLDELIHRDHPDGPVDREQLVAFAVILLIAGHETTANMISLGTFTLLSHPEQLAA
LRAGGTSTAVVVEELLRFLSIAEGLQRLATEDMEVDGATIRKGEGVVFSTSLINRDAD
VFPRAETLDWDRPARHHLAFGFGVHQCLGQNLARAELDIAMRTLFERLPGLRLAVPAH
EIRHKPGDTIQGLLDLPVAW

>CYP105D2 AF071145
LLIAGHETTANMISLGTFTLLNHPEQLEALRSGRTTTAAVVEEL
LRFLSIAEGLQRLATEDIEVAGTTIREGEGVFFSTSLINRDTEVYENPETLDWDRPSR
HHLAFGFGVHQCLGQNL

>CYP105D3 AF071149
LLIAGHETTANMISLGTYTLLRHPDRLAELRADPGLAPAAVEEL
LRMLSIADGMLRVATEDIEAGGTVIRAGDGVIFGTSVINRDETVYTDPDALDWHRPAR
HHVAFGFGIHQCLGQNL

>CYP105D4 AF072709.1|AF072709  Streptomyces lividans CDS complement(1593..2813)
69% to 105D1 67% to 105D2 82% to 105D3 57% to 105A1 
                     MTDTDTTTNTHPAAPVAFPQDRTCPYHPPAAYDPLRTARPLARI
                     TLFDGRPAWLVTGHAAARRLLADQRLSTDRTRDGFPATSARLAAVRERRTALLGVDDP
                     EHRAQRRMVLPEFTLKRAGALRPSIRRIVGERLDAMIAQGPPADLVTAFALPVPSMVI
                     CALLGVPYADHEFFEEQSRRLLRGPLPADTRDARDRLEAYLGELIDRKRRAPGEGLLD
                     DLVRRQASEGATDREQLIAFAVILLVAGHETTANMISLGTYTLLTNPGRLAELRADPA
                     LLPGAVEELMRVLSIADGLLRMATEDIDVDGQTIRAGDGVVFSTSVINRDESVYPEPD
                     ALDWHRPARHHVAFGFGIHQCLGQNLARAELEIALESLFDRLPTLRLAAPADEIPFKP
                     GDTIQGMLELPVAW

>CYP105D5 3StF60 [Full Sequence] Sanger cosmid S. coelicolor 
CDS comp(2106-3344) 98% identical to CYP105D4
MTDTDTTTNTDTTTNTHPAAPVAFPQDRTCPYHPPAAYDPLRAARPLARITLFDGRPAWL
VTGHAAARRLLADQRLSTDRTRDGFPATSARLAAVRERRTALLGVDDPEHRAQRRMVLPE
FTLKRAGALRPSIRRIVGERLDAMIAQGPPADLVTAFALPVPSMVICALLGVPYADHEFF
EEQSRRLLRGPLPADTRDARDRLEAYLGELIDRKRRAPGEGLLDDLVRRQASEGATDREQ
LIAFAVILLVAGHETTANMISLGTYTLLTNPGRLAELRADPALLPGAVEELMRVLSIADG
LLRMATEDIDVDGQTIRAGDGVVFSTSVINRDESVYPEPDALDWHRPARHHVAFGFGIHQ
CLGQNLARAELEIALESLFDRLPTLRLAAPADEIPFKPGDTIQGMLELPVAW*

>CYP105E1 Z29635
MAGTADLPLEMRRNGLNPTEELAQVRDRDGVIPVGELYGAPAFL
VCRYEDVRRIFADSNRFSNAHTPMFAIPSGGDVIEDELAAMRAGNLIGLDPPDHTRLR
HILAAEFSVHRLSRLQPRIAEIVDSALDGLEQAGQPADLMDRYALPVSLLVLCELLGV
PYADRDELRDRTARLLDLSASAEQRAVAQREDRRYMATLVTRAQEQPGDDLLGILARK
IGDNLSTDELISIISLIMLGGHETTASMIGLSVLALLHHPEQAAMMIEDPNCVNSGIE
ELLRWLSVAHSQPPRMAVTEVQIAGVTIPAGSFVIPSLLAANRDSNLTDRPDDLDITR
GVAGHLAFGHGVHFCLGHSLARMTLRTAVPAVLRRFPDLALSPSHDVRLRSASIVLGL
EELQLTW

>CYP105F1 AF127374.1|AF127374  Streptomyces lavendulae LinA homolog. CDS 2006..3229
48% to 105C1 42% to 105B1 40% to 105D1 new subfamily in 105
                     MSDTEQHAPTLPRQRTCPFSPPPELEELRRTDPISRMRFADDSP
                     GWLLTRHADVRAALADPGVSSHPGKAPQPWRNLAPEMRAEHYLPGFLIFMDPPDHTRY
                     RRLLTKWFTMRAIRKLEPRIEQIVTETLDAMEAQGGTVDLVQSFALPIPLLVICELMG
                     IRYEEREEFMDMVLRLQALDATPEELGALGARMNEFMMKLAAAKRANPGDDLLSHLAH
                     DPDADPALTDLEIAGIGVLMLIAGHETSANMLGVGTYTLLENADQWALLRDDISLIDR
                     AVEELLRHQTIVQQGLPRGVTRDMEIAGHQVKTGESLLASLPAANRDPAVFPDPDRLD
                     ITREHNPHLAFGHGIHLCLGMELARVEMRQAWRGLVTRFPGLRMAAAPEDIRWRDDQI
                     VYGVYNLPVTWDEAK"
>CYP105G1 AF040571.1|AF040571  Amycolatopsis mediterranei thioester CDS complement(5011..6066)
49% to 105C1, 105B1 new subfamily in 105 looks like an insertion in seq from 80-120
                     MTTKVTENAPSTESLRSPLPPEFVRREDPFHVPPALVAVSERGP
                     VARATLAAGDPFWLVSGYEEARAVLSDPRFSSDRFQYHPRFKELSPEFAFPAPSLMIC
                     ELLGVRYEDRAEFQQRASALLQMNAPVAEAVKNADALRAFMQALVTDKRANPAGDIIS
                     GLIHHAGADPALTDDELINIANLLLIAGYDTTASMLGLGIFVLLQRPAQLATLRDDPS
                     RIADAVEGLLRYLSVVNPGIFRFAKEDLEFAGEHIPAGSTVVVSVVATNRDARHWPDP
                     DLDLTRPRGPHLAFGHGVHQCLGQQLARMEMQAGYAELLRRLPNVRLAVPPEEVPLRN
                     DMLTYGVHSLPIAWDAP
>CYP105H1 AF263912.1|AF263912  Streptomyces noursei ATCC 11455 nyst CDS comp (58637..59833) gene="nysN" 47% to 105B1 46% to 105A1 46% to 105D1 = new subfamily in 105
                     /function="presumably involved in modification of the
                     nystatin macrolactone ring"
                     MSTEADARTAAPQCPVAFPLRRPGRPFPPPEYATYRGGAGLVRS
                     ELPSGPVWLVTRHEDVRAVLTDPRISADPSKPGFPKAGRTGGAPSQYEVPGWFVAMDP
                     PEHGRFRKTLIPEFTVRKVRELRPVIQQIVDERIDAMLAAGTSADLVESFALPVPSLV
                     ISSLLGVPKVDRDFFEDRTRVLVRLSSTDEERDKATQALLRYLGRLIQIKQRRPGDDL
                     ISRLIAAGTLSRQELSGVAMLLLIAGHETTANNIGLGVVQLLTNPRWIGDDRIVEELL
                     RYYSVADLVAFRVAVEDVEIGGQLIRAGEGIVPLIAAANHDATAFAAPSEFDPERSAR
                     SHVAFGYGVHQCLGQNLVREEMDIAYRTLFARIPSLTLAVPVEELPLKYDGVLFGLHE
                     LPVTWK
>CYP105J1 AF040570.1|AF040570  Amycolatopsis mediterranei rifamycin CDS comp (67462..68673)
52% to AF072709 105D4 50% to 105D1 new subfamily in 105
                     MTETVAFPQDRTCPYQPAPGYEPLADRRPIAEVTLYDGRKAWAV
                     TGHELARKLLCDPRISSDRTNPAWPMVSAAAAVEFTDVQQKVIKLLTALVGVDGPAHR
                     ARRKLVQAGFTVKRIDSLRPKIQALVDRQIDEMIAEGAPVDLLKKFASPVPLIALCDL
                     LGIPHEDQDYFEKKAHQILFGPDAGGAYDELMAYLTKLIDKAEQNPGEEGFLQALLAE
                     RDPSSDVDHEEILQMFLIVLVTGHDTTSSSIGLGAFTLLQHPERLAELRADPSLMPAA
                     VDELTRFVVVPDGLQRVAADDIEVDADTTIRKGDGVFFLFSLINRDEEAYEDGDRLDW
                     HRPTFRDHLTYGFGTHQCAGMNHARAIMEIAFRRLIDRLPGLRLAVPADEVRVKPGDA
                     FQGLAELPVTW"
>CYP105K1 Y18574.1|STE18574  Streptomyces tendae strain Tue901 CDS 6325..7557 gene="nikF"
45% to 105A3 46% to 105D1 43% to 105B1 new subfamily in 105
                     MTETFGHDIPSFPMARECPMHPPAEYRKLRVQEPVSRVRMPDGQ
                     VAWLVLKHDLARKLLADPRVSADRLHPAFPGRLTAEQRTATERVRRLSTRRSMIHLDG
                     DEHGAHRKILTGEFSLRRIAALRPRVQEIVDRSIDEMLAAPQPADLVEHVSQAVPSLV
                     ICELLGVPHEQRRDFHEWAGMLVSRSVSIRERAAASDALNDFLEDLVTEKERGEPTDD
                     LIGRLIARNRRTPVMTHDEIVGTAVMLLIAGHQTTANMISLGVVALLENPEHKARIAA
                     DPSLLPPAIEEMLRYFSVVENAPARVATEDIEIGGVTIRKDEGIVVSGLAADWDDEVF
                     EHPDRLDFERGARHHVAFGYGVHQCLGQNLARVELEIVFETLLRRVPGLSLAVPAEEL
                     PYKDDAGIYGIYRVPVNC
>CYP105L1 AF147703.1|AF147703  Streptomyces fradiae demethylmacroci.CDS complement(2565..3875)
gene=tylHI function=hydroxylation of polyketide ring at C-23 during tylosin production
                     MAWAPDTVFSLRPQRVVSSSGDARPSQKGILLPAARANDTDEAA
                     GRRSIAWPVARTCPFSPPEQYAALRAEEPIARAELWDGAPVWLISRQDHVRALLADPR
                     VSIHPAKLPRLSPSDGEAEASRSLLTLDPPDHGALRGHFIPEFGLRRVRELRPSVEQI
                     VTGLLDDLTARGDEADLLADFALPMATQVICRLLDIPYEDRDYFQERTEQATRPAAGE
                     EALEALLELRDYLDRLISGKTGRESGDGMLGSMVAQARGGGLSHADVLDNAVLLLAAG
                     HETTASMVTMSVLVLLQHPTAWRELTVNPGLLPGAVDELLRYLSIADGLRRSATADIE
                     IDGHTIRAGDGLVFLLAAANRDEAVFSEPEAFDIHRSARRHVAFGYGPHQCLGQNLAR
                     MELEVALGAVLERLPALRPTTDVAGLRLKSDSAVFGVYELPVAW
>CYP105L1 AF055922.1|AF055922  Streptomyces fradiae dipeptidil carb.
CDS comp (6507..7769)
gene="tylH1" same as AF147703 shorter N-term
46% to 105A1 42% to 105D1 43% to 105B1 new subfamily in 105
                     MSSSGDARPSQKGILLPAARANDTDEAAGRRSIAWPVARTCPFS
                     PPEQYAALRAEEPIARAELWDGAPVWLISRQDHVRALLADPRVSIHPAKLPRLSPSDG
                     EAEASRSLLTLDPPDHGALRGHFIPEFGLRRVRDVRPSVEQIVTGLLDDLTARGDEAD
                     LLADFALPMATQVICRLLDIPYEDRDYFQERTEQATRPAAGEEALEALLELRDYLDRL
                     ISGKTGRESGDGMLGSMVAQARGGGLSHADVLDNAVLLLAAGHETTASMVTMSVLVLL
                     QHPTAWRELTVNPGLLPGAVDELLRYLSIADGLRRSATADIEIDGHTIRAGDGLVFLL
                     AAANRDEAVFSEPEAFDIHRSARRHVAFGYGPHQCLGQNLARMELEVALGAVLERLPA
                     LRPTTDVAGLRLKSDSAVFGVYELPVAW
>CYP105M1 AF200819.1|AF200819  Streptomyces clavuligerus clavulanic CDS 136..1359
function="involved in clavulanic acid biosynthesis"
48% to 105B1 42% to 105A1 41% to 105D1 new subfamily in 105
                     MNEAAPQSDQVAPAYPMHRVCPVDPPPQLAGLRSQKAASRVTLW
                     DGSQVWLVTSHAGARAVLGDRRFTAVTSAPGFPMLTRTSQLVRANPESASFIRMDDPQ
                     HSRLRSMLTRDFLARRAEALRPAVRELLDEILGGLVKGERPVDLVAGLTIPVPSRVIT
                     LLFGAGDDRREFIEDRSAVLIDRGYTPEQVAKARDELDGYLRELVEERIENPGTDLIS
                     RLVIDQVRPGHLRVEEMVPMCRLLLVAGHGTTTSQASLSLLSLLTDPELAGRLTEDPA
                     LLPKAVEELLRFHSIVQNGLARAAVEDVQLDDVLIRAGEGVVLSLSAGNRDETVFPDP
                     DRVDVDRDARRHLAFGHGMHQCLGQWLARVELEEILAAVLRWMPGARLAVPFEELDFR
                     HEVSSYGLGALPVTW
>CYP105M1 U87786.2|SCU87786  Streptomyces clavuligerus CDS 13810..15036 same gene as AF200819

>CYP105N1 St4C2 [Full Sequence] Sanger cosmid S. coelicolor 
CDS 29986-31221 45% to 105A1 new subfamily in 105
MTPPESPTASHTPGATPPRDFPIQRGCPFAAPAEYAALRTDDPVARVTLPTRREAWVVTR
YDDVRELLSDPRVSADIRRPGFPALGEGEQEAGARFRPFIRTDAPEHTRYRRMLLPAFTV
RRVRAMRPAVQARVDEILDGMLAAGGPVDLVSAYANAVSTSVICELLGIPRHDLEFFRDV
TRISGSRNSTAEQVSEALGGLFGLLGGLVAERREEPRDDLISKLVTDHLVPGNVTTEQLL
STLGITINAGRETTTSMIALSTLLLLDRPELPAELRKDPDLMPAAVDELLRVLSVADSIP
LRVAAEDIELSGRTVPADDGVIALLAGANHDPEQFDDPERVDFHRTDNHHVAFGYGVHQC
VGQHLARLELEVALETLLRRVPTLRLAGERDQVVVKHDSATFGLEELMVTW*

>CYP106A1 X16610 BM-1
MNKEVIPVTEIPKFQSRAEEFFPIQWYKEMLNNSPVYFHEETNT
WNVFQYEHVKQVLSNYDFFSSDGQRTTIFVGDNSKKKSTSPITNLTNLDPPDHRKARS
LLAAAFTPRSLKNWEPRIKQIAADLVEAIQKNSTINIVDDLSSPFPSLVIADLFGVPV
KDRYQFKKWVDILFQPYDQERLEEIEQEKQRAGAEYFQYLYPIVIEKRSNLSDDIISD
LIQAEVDGETFTDEEIVHATMLLLGAGVETTSHAIANMFYSFLYDDKSLYSELRNNRE
LAPKAVEEMLRYRFHISRRDRTVKQDNELLGVKLKKGDVVIAWMSACNMDETMFENPF
SVDIHRPTNKKHLTFGNGPHFCLGAPLARLEMKIILEAFLEAFSHIEPFEDFELEPHL
TASATGQSLTYLPMTVYR

>CYP106A2 Z21972 P450meg
MKEVIAVKEITRFKTRTEEFSPYAWCKRMLENDPVSYHEGTDTW
NVFKYEDVKRVLSDYKHFSSVRKRTTISVGTDSEEGSVPEKIQITESDPPDHRKRRSL
LAAAFTPRSLQNWEPRIQEIADELIGQMDGGTEIDIVASLASPLPIIVMADLMGVPSK
DRLLFKKWVDTLFLPFDREKQEEVDKLKQVAAKEYYQYLYPIVVQKRLNPADDIISDL
LKSEVDGEMFTDDEVVRTTMLILGAGVETTSHLLANSFYSLLYDDKEVYQELHENLDL
VPQAVEEMLRFRFNLIKLDRTVKEDNDLLGVELKEGDSVVVWMSAANMDEEMFEDPFT
LNIHRPNNKKHLTFGNGPHFCLGAPLARLEAKIALTAFLKKFKHIEAVPSFQLEENLT
DSATGQTLTSLPLKASRM

>CYP107A1 X60379
MTTVPDLESDSFHVDWYRTYAELRETAPVTPVRFLGQDAWLVTG
YDEAKAALSDLRLSSDPKKKYPGVEVEFPAYLGFPEDVRNYFATNMGTSDPPTHTRLR
KLVSQEFTVRRVEAMRPRVEQITAELLDEVGDSGVVDIVDRFAHPLPIKVICELLGVD
EKYRGEFGRWSSEILVMDPERAEQRGQAAREVVNFILDLVERRRTEPGDDLLSALIRV
QDDDDGRLSADELTSIALVLLLAGFEASVSLIGIGTYLLLTHPDQDQLALVRRDPSAL
PNAVEEILRYIAPPETTTRFAAEEVEIRGVAIPQYSTVLVANGAANRDPKQFPDPHRF
DVTRDTRGHLSFGQGIHFCMGRPLAKLEGEVALRALFGRFPALSLGIDADDVVWRRSL
LLRGIDHLPVRLDG

>CYP107B1 M83110
MTTGEVPDLLAFDDAFAQDRHNRYARMREEPVQRIRTVNGLDAW
LITRYEDVKQALLDPRIAKDFGRTQQIIEKRLADAERRPGFSPDLGPHMLNTDPPDHT
RLRKLVVKAFTARRVEGLRPRIEQITDDLLDRLAGRSEVDLIDEFAFPLPITVISELM
GVEDSRRDDFRSWTNVLVDGSQPEAQAQASVAMVEYLTELIAKKRTEPGDDLLTALLE
AVEDGDRLSEGELIAMVFLLLVAGHETTVNLIGNCVLSLLGNPDQLAALRNDPSLLPG
AIEETLRYESPVANGTFRHTAEAVRFGDVVIPEGELVWVALGAANRDGERFEDPDRFD
ITRETTGHVAFGHGIHFCVGAALARLEAQIAVGRLLERFPDLRMAASPDDLRWRFSVL
MRGLEKLPVRPGA

>CYP107C1 D30759
MTALNLMDPEVLRDPFGAYAEIRAQAPLVRASYPWGAVQWLATR
YSDVKAVLTDPRLVNNPANVPEMHLPHPYEQALGDGGIPDEYVRYLAGSILSQDGPGH
LRLRRLSSRAFTVRRVNALRPRVTELAHRLLASLPDRAQDGVIDVLEDFSYPLSIDVI
CEIVGIPEEAREQWHTWGSAFYTMDPAVIGPAVRGMADHLHLLIEQRRATPTGDLLTG
LVQAEDEQGEPLTDEEIATLVLTFVTAGNETTAHLIGNGVAALLTHSDQLALLRSDRR
LLSQAVDELMRWCTPVQVTQPRYATEDLDVGGVTVRKGEQVVAVIGAAGHDPDRFPDP
ERFDITRNHRAPHEAHVGFGFGPHYCLGAALAHQETAIALDTLFDRFPSLALAVPPSA
LERQPFPGAWRLKSLPVRL

>CYP107D1 L37200
MTDTHTGPTPADAVPAYPFSLPHALDLDPHYAELRRDEPVSRVR
LPYGEGTAWLVTRMSDARIVLGDSRFSTAAATDPATPRMFPTPPEPDGVLAQDPPDHT
RLRRLVGKAFTARRVEEMRPRVRSLVDSLLDDMVAHGSPADLVEFLAVPFPVAVICEL
LGVPLEDRDLFRTFSDAMLSSTRLTAAEIQRVQQDFMVYMDGLVAQRRDAPTEDLLGA
LALATDNDDHLTKGEIVNMGVSLLIAGHETSVNQITNLVHLLLTERKRYESLVADPAL
VPAAVEEMLRYTPLVSAGSFVRVATEDVELSTVTVRAGEPCVVHFASANRDEEVFDHA
DELDFHRERNPHIAFGHGAHHCIGAQLGRLELQEALSALVRRFPTLDLAEPVAGLKWK
QGMLIRGLERQIVSW

>CYP107E1 D16098
MTSAEPRAYPFNDVHGLTLAGRYGELQETEPVSRVRPPYGEEAW
LVTRYEDVRAVLGDGRFVRGPSMTRDEPRTRPEMVKGGLLSMDPPEHSRLRRLVVKAF
TARRAESLRPRAREIAHELVDQMAATGQPADLVAMFARQLPVRVICELLGVPSADHDR
FTRWSGAFLSTAEVTAEEMQEAAEQAYAYMGDLIDRRRKEPTDDLVSALVQARDQQDS
LSEQELLDLAIGLLVAGYESTTTQIADFVYLLMTRPELRRQLLDRPELIPSAVEELTR
WVPLGVGTAFPRYAVEDVTLRGVTIRAGEPVLASTGAANRDQAQFPDADRIDVDRTPN
QHLGFGHGVHHCLGAPLARVELQVALEVLLQRLPGIRLGIPETQLRWSEGMLLRGPLE
LPVVW

>CYP107F1 AB018074.1|AB018074  Streptomyces griseus CDS 341..1561
                     MENTSVQNKETVRNCPFDYAHELEFDPQLRQLLTEEPVSRIRMA
                     YGEGEAWLVTRYEDVRTVTTDRRFSRSAVLGRDFPRMTPEPIVQAESINLMDPPASSR
                     LRGLVAKSFTPRRVEQMRGGTQRVVDRLLDEMEEEGSPGDFVARVSAPLPLITICEAL
                     DIPEADRPWLRAHAMTMMNVGAAGKQDAVRAKAELRGYFQELTADRRRSPGEDLISTL
                     ATARDGDELLDDDELAVMAMVLLITGQDTTTYQLGNIAYTLLTRPDLLRSLRAEPQRL
                     PRTLEELLRHIPFRKGVGIPRIALEDVELSGVLIKAGDVVHVSYLTANRDSAKFDRPD
                     ELDPDRPTIPHMTFGWGAHHCLGAPLATMELEVAFSTLLTRFPALRLDVPPEDVSWNT
                     TSIWRYPLALPVTW

>CYP107G1 rapN X86780
MSTTDQGETGKACPYPFAEMERLEIHPEYNRLRDAGELGRVLML
DGREAWLAASWEDVAKVFVDPRFSRSATLGKDVPRVLPAIQDQPVIMLMDPPEHTRLR
RVATKALTSRRMEALRPRTQEVADDLIDKMLAKGAPADLMEDFALPLPIIMICELLGV
PIEDQTKFRTWSDQMLSNGAYSQEVVMAAGQSLYLYLSELIAERRKQDTNDLLGSLVR
ARDKDDRLSETELVGFAVTLLIAGYETTANAIGNSVYTLLTHPEKLAELRKDLSLIPK
AVDELLRIIPIAKQASWVRMAVEDVELSGTIVKAGEAVAIQTHSANTDPKVYDHPEEI
DFHRTSNPHMSLGHGAHHCMGAQLVRVEMQTALGSLISRIPALRFAVPEPRIKFLRGR
LVPSLEALPLTW

>CYP107H1 BioI U51868
MTIASSTASSEFLKNPYSFYDTLRAVHPIYKGSFLKYPGWYVTG
YEETAAILKDARFKVRTPLPESSTKYQDLSHVQNQMMLFQNQPDHRRLRTLASGAFTP
RTTESYQPYIIETVHHLLDQVQGKKKMEVISDFAFPLASFVIANIIGVPEEDREQLKE
WAASLIQTIDFTRSRKALTEGNIMAVQAMAYFKELIQKRKRHPQQDMISMLLKGREKD
KLTEEEAASTCILLAIAGHETTVNLISNSVLCLLQHPEQLLKLRENPDLIGTAVEECL
RYESPTQMTARVASEDIDICGVTIRQGEQVYLLLGAANRDPSIFTNPDVFDITRSPNP
HLSFGHGHHVCLGSSLARLEAQIAINTLLQRMPSLNLADFEWRYRPLFGFRALEELPV
TFE

>CYP107J1 cypA Y11043
MSSKEKKSVTILTESQLSSRAFKDEAYEFYKELRKSQALYPLSL
GALGKGWLISRYDDAIHLLKNEKLKKNYENVFTAKEKRPALLKNEETLTKHMLNSDPP
DHNRLRTLVQKAFTHRMILQLEDKIQHIADSLLDKVQPNKFMNLVDDYAFPLPIIVIS
EMLGIPLEDRQKFRVWSQAIIDFSDAPERLQENDHLLGEFVEYLESLVRKKRREPAGD
LISALIQAESEGTQLSTEELYSMIMLLIVAGHETTVNLITNMTYALMCHHDQLEKLRQ
QPDLMNSAIEEALRFHSPVELTTIRWTAEPFILHGQEIKRKDVIIISLASANRDEKIF
PNADIFDIERKNNRHIAFGHGNHFCLGAQLARLEAKIAISTLLRRCPNIQLKGEKKQM
KWKGNFLMRALEELPISF

>CYP107K1 Z99113.1|BSUB0010  Bacillus subtilis complete genome CDS complement(76702..77832)
gene="pksS" 43% to 107J1
                     MQMEKLMFHPHGKEFHHNPFSVLGRFREEEPIHRFELKRFGATY
                     PAWLITRYDDCMAFLKDNRITRDVKNVMNQEQIKMLNVSEDIDFVSDHMLAKDTPDHT
                     RLRSLVHQAFTPRTIENLRGSIEQIAEQLLDEMEKENKADIMKSFASPLPFIVISELM
                     GIPKEDRSQFQIWTNAMVDTSEGNRELTNQALREFKDYIAKLIHDRRIKPKDDLISKL
                     VHAEENGSKLSEKELYSMLFLLVVAGLETTVNLLGSGTLALLQHKKECEKLKQQPEMI
                     ATAVEELLRYTSPVVMMANRWAIEDFTYKGHSIKRGDMIFIGIGSANRDPNFFENPEI
                     LNINRSPNRHISFGFGIHFCLGAPLARLEGHIAFKAAFEEIS

>CYP107L1 AF087022.1|AF087022  Streptomyces venezuelae cytochrome P. = pikC gene AF079139
>CYP107L1 AF079139.1|AF079139  Streptomyces venezuelae pikCD operon.same gene CDS 122..1372
                     /gene="pikC"
                     /function="catalyzes the hydroxylation of YC-17 into
                     methymycin and neomethymycin and narbomycin into
                     pikromycin"
51% to 107B1 47% to 107A1 44% to AF254925 42% to 107J1 41% to AL049754
new CYP107 subfamily
                     MRRTQQGTTASPPVLDLGALGQDFAADPYPTYARLRAEGPAHRV
                     RTPEGDEVWLVVGYDRARAVLADPRFSKDWRNSTTPLTEAEAALNHNMLESDPPRHTR
                     LRKLVAREFTMRRVELLRPRVQEIVDGLVDAMLAAPDGRADLMESLAWPLPITVISEL
                     LGVPEPDRAAFRVWTDAFVFPDDPAQAQTAMAEMSGYLSRLIDSKRGQDGEDLLSALV
                     RTSDEDGSRLTSEELLGMAHILLVAGHETTVNLIANGMYALLSHPDQLAALRADMTLL
                     DGAVEEMLRYEGPVESATYRFPVEPVDLDGTVIPAGDTVLVVLADAHRTPERFPDPHR
                     FDIRRDTAGHLAFGHGIHFCIGAPLARLEARIAVRALLERCPDLALDVSPGELVWYPN
                     PMIRGLKALPIRWRRGREAGRRTG
>CYP107M1 D87924.1|D87924  Actinomadura hibisca polyketide synthas CDS complement(6299..7534)
45% to AF127374 CDS 3226..4458 44% to AF254925 45% to 107D1 44% to 107G1, 107E1
new subfamily in 107
                     MPSSKDAPTVDPRPDVTPAFPFRPDDPFQPPCEHARLRASDPVA
                     KVVLPTGDHAWVVTRYADVRFVTSDRRFSKEAVTRPGAPRLIPMQRGSKSLVIMDPPE
                     HTRMRKIVSRAFTARRVEGMRAHVRDLTSGFVDEMVEHGPPADLIAHLALPLPVTVIC
                     EMLGVPPEDRPRFQDWTDRMLTIGAPALAQADEIKAAVGRLRGYLAELIDAKTAAPAD
                     DLLSLLSRAHADDGLSEEELLTFGMTLLAAGYHTTTAAITHSVYHLLREPSRYARLRE
                     DPSGIPAAVEELLRYGQIGGGAGAIRIAVEDVEVGGTLVRAGEAVIPLFNAANRDPEV
                     FADPEELDLGRTDNPHIALGHGIHYCLGAPLARLELQVVLETLVERTPALRLAIDDAD
                     ITWRPGLAFARPDALPIAW"
>CYP107N1 AF127374.1|AF127374  Streptomyces lavendulae LinA homolog.CDS 3226..4458
50% to 107D1 52% to AF254925 47% to 107E1 new subfamily in 107
                     MTGPEAAVRGCPFGAGEAPAYPFHAPDRLEPDPYWEPLRRERPL
                     QRVTLPYGGEAWLATRYQDVRAVFADRRFSRQLAVAPGAPRFLPHQPPPDAVLSVEGP
                     DHARLRRLVGKVFTPRRVEDMRPLIQRTADGLLDAMEEMGPPADLVEDFSLPFAVSMI
                     CELLGVPPEDRKRFCVWSDALLTTTAHTPAQVRDYMMQMHDYLGGLVAQRRVRPTADL
                     IGSLVTARDEEDKLTEGELVRLAEAILIAGYETSASQIPNFLYVLFRHPQLLERIRND
                     HDLIPDAVEELLRFVPIGTVDGFPRTATEDVELGGVLVRAGETVVPSMGAANRDPELF
                     TDPDELDLARRPNPHLGFGAGPHHCLGAQLARVELQITLTTLFRRYPRLRLAVPEESL
                     SWKEGLMVRGMHTMPVTW"
>CYP107P1 AL049754.1|SCH10  Streptomyces coelicolor cosmid H10 CDS complement(10413..11648)
41% to AF087022 40% to 107B1 40% tp 107G1 40% to 107D1 new subfamily in 107
                     MTAATDGPHVSGPAFDPWDPAFVADPYPAFAELRARGRVLYYEP
                     SDQWLVPHHADVSALLRDRRLGRTYQHRFTHEDFGRTPPPPEQEPFHTLNDHGMLDLE
                     PPDHTRIRRLVSKAFTPRTVERLKPYVHGLADDLVARLVAAGGGDLLTDVAEPLPVAV
                     IAEMLGIPESDRAPLRPWSAEICGMYELNPSEETAAKAVRASLDFSDYLRALIAARRK
                     EPGDDLISGLIAAHDEDDRLTEQEMISTCVLLLNAGHEATVNATTNGWLALFRHPDQL
                     AALRADHSLVPSAVEELMRYDTPLQLFERWVLDEIEIDGTTLPRGAEVAMLFGSANHD
                     PAVFTDPERLDLTRRDNPHISFSAGIHYCIGAPLARIELAASMTSLLKRAPGLRLAAE
                     PERRPNFVMRGLTELRVEL
>CYP107Q1 AF040571.1|AF040571  Amycolatopsis mediterranei thioester CDS complement(781..>2316)
66% to AF040570 comp(68704..69969) 43% to 107C1 41% to 107B1 40% to 107A1
new subfamily in 107
                     PVPLSIVSRDRVSIQRLACKVFGETRSGPPGRASFVLIAPRRPQ
                     TVHKGHNSEHCQVGGCSTGRPLPTVRNRACRTRAGRPRRHQEGMAMTATAKPSAKPVD
                     LFSPEVVADPFGWYARLREEPLPHTGTLNLGTMMGGPDMWLATRYEDVLTVLTDPRFL
                     TNPPADSPLADIRDGVFKAMNFPEDLIPWMANKLNTADGEDHTRLRKLVSYALTARRV
                     NALRPRVEKITEDLFDRMAEQGKDGSPVDIVEEFCFPLPVTVICELVGIDEPDRAAWH
                     AWGNAMATMDGPKIPPALRECIALSRELMARRRVEPKDDLVTALVQAQADDPGRVSDD
                     EIVGILFSLVTAGHQTTTYLIGNSVLFLLEQPEQLARLKAEPALWAQAVRELQRLGPL
                     QFTQARFPSEDVELGGVTIPRGTPVAPLLLAANTDPRKFPEPDKLVVDRLSVANEMHL
                     SFGKGIHRCLGQHLAYQEAEVALHGLFTRFPDLALAVPRDEIPWILRPAFTRTKTLPL
                     KLA
>CYP107Q2 AF040570.1|AF040570  Amycolatopsis mediterranei rifamycin CDS comp (68704..69969)
66% to AF040571 complement(781..>2316) new subfamily in 107
                     MTTTAETSAEPVDLFSPEVVADPWGAHAAVREAPTLQIGGFMGG
                     PPMYLAARYEDVRQVLMDQRFQCNPLADSPAEDIRNGVFRHLDMPEELIPWLKNLINA
                     SDGEEHARLRKLVSYALTAHRVGKFRPRVEELTAELLDKLEAAGGDGTPIDLVESFCY
                     PLPVTVICELVGVDHEDRPQWRAWSDAMATLDGKRLPEEVRKTLAAARGMIERRRAEP
                     KDDMVTALVEAQAKNPGIATDDELVGVLFSLVTAGHQTTTYLIGNSVLALHEHPDQLA
                     RLKADPSLWPQAVRELQRLGPIQFGQPRFATEDIEVGGTVIPRGMPVVPLIMAANSDP
                     RKFPEPEKLQIDRLAVGSESHLGFGKGIHRCLGQHVAYLEAEVALRGLYTRFPDMTLA
                     VPREEIPWILRPGFTRTKDLPVRLARPAS"
>CYP107R1 AF254925.1|AF254925  Streptomyces maritimus enterocin CDS comp (18384..19589) gene="encR" 53% to AF127374 CDS 3226..4458 49% to 107E1 new subfamily in 107
                     MTTHTQQLRDFPFAPPAELHMEPAFAQLREEEPISRVRLPYGGE
                     AWLVTRYQDIKTVLGDPRFSRAATQHAQAPRIQPDPAGEGVLMSLDPPDHTRLRKTVA
                     GVFTKRRVEDLRPATQRIAEELLEAMEASGAPADLVASYALPLPVTVICDLLGVPGDD
                     REQLRGWSDALLSTTACTPAESAAAAQAMADHFAALVSQRRRQPTDDLLGALVQTWDR
                     EEGLLRDEELVLLTRDLLIAGHETTASQIANCTYLLLQRPHDMDRLRTDPSAMASAVE
                     ELLRFIPLGSGSFRARVATEPVELCGVRIQPGDTVFAPTVAANWDPDVFAEPGRLDID
                     RSPNPHVAFGHGVHHCLGAQLARLELQVALGVLLRRLPRLRLAVDEAEIVWKTGMQVR
                     GPKTLPVKW
>CYP107S1 Pseudomonas aeruginosa ORF_4339 3740961-3742214 47% to 107B1
from the Pseudomonas genome project new subfamily in 107
VPDRKLRLGEELISPLHALYDGLQVDGAPRPAHRAAEHPVWVVTRYRDAR
KVLNHPGVRRDARQAAELYAKRTGSPRAGIGEGLSHHMLNLDPPDHTRL
RSLVGRAFTPRQVERLQPHIERITEALLDAMAGREQADLMADFAIPLTI
AVIFELLGIPEAEREHARQSWERQAELLSPEEAQALADAQVDYLRVLLE
AKRRQPADDVYSGLVQAADESGQLSEAELVSMAHLLMMSGFETTMNMIG
NALVTLLVNPEQLALLRAQPELLPNAMEELVRHDSPVRASMLRFTVEDV
ELDGVTIPAGEYILVSNLTANHDAERFDDPDRLDLTRNTDGHLGYGFGV
HYCVGASLARLEGRIAIQRLLARFPDLQLAVPHAELQWLPITFLRALIS
VPVRTGCSAPANTASHANPIERIAQ*

>CYP107T1 StH63 [Full Sequence] Sanger cosmid S. coelicolor similar to 107N1
51% to CYP107L1 CDS 16028-17233

MLSSAEEMGSAPRLIVSLTGGPMTAPTYEELAALRAVGAVHRVFVPGSGESRLVVTRDAA
RAALTDPRLRNDIRHSASWDSDGGHAIGHNMLQSDPPQHTRLRRLVAGHFTPGRTAALRP
RVERIAHDLLDALPPAGTADLVARYALPLPVTVICELLGVPESDRGTFHTWSNELVMPTS
PEAAGSAATALTGYLTELTDAKRRTPDGTLLGDLVAAADSGELTPGELLGMAFLILVAGH
ETTVNLISATVHGLLTHPGQLARLRAEPELTEAAVEESLRYHSPVHASAFRFAAEPLELA
GTAIAAGDPVLVSLAAASRDPAHFPDPDRFDIGRRPRGHLGFGHGPHHCLGAPLARVEAA
VAVRLLLDRHPALALAAGPATLTWRTSTLLRGLVELPVRLG* 

>CYP107U1 StE41 [Full Sequence] Sanger cosmid S. coelicolor
comp(7438-8739) 44% to CYP107B1 

MTGSSSAPVPELFSWEFASDPYPAYAWLREHAPVHRTRLPSGVEAWLVTRYADAKQALAD
PRLSKNPAHHDEPAHAKGKTGIPGERKAELMTHLLNIDPPDHTRLRRLVSKAFTPRRVAEFAPRV
QELADGLIDRFADTGSADLIHDFAFPLPIYAICDLLGVPREDQDDFRDWAGMMIRHQGGPRGGVA
RSVKKMRGYLADLIHRKRAALPPEPAPGEDLISGLIRASDHGEHLTENEAAAMAFILLFAGFETT
VNLVGNGTYALLTHPEQRERLQTSLAAGERGLLETGVEELLRYDGPVELATWRFATRPLTIGGQD
VAAGDPVLVVLAAADRDPERFTDPDTLDLARRDSQHLGYGHGIHYCLGAPLARLEGQTALATLLT
RLPDLRLAADPAELRWRGGLIMRGLRTLPVSFTPPASSAGNGPSPTQK*

>CYP108 P450terp M91440
MDARATIPEHIARTVILPQGYADDEVIYPAFKWLRDEQPLAMAH
IEGYDPMWIATKHADVMQIGKQPGLFSNAEGSEILYDQNNEAFMRSISGGCPHVIDSL
TSMDPPTHTAYRGLTLNWFQPASIRKLEENIRRIAQASVQRLLDFDGECDFMTDCALY
YPLHVVMTALGVPEDDEPLMLKLTQDFFGVHEPDEQAVAAPRQSADEAARRFHETIAT
FYDYFNGFTVDRRSCPKDDVMSLLANSKLDGNYIDDKYINAYYVAIATAGHDTTSSSS
GGAIIGLSRNPEQLALAKSDPALIPRLVDEAVRWTAPVKSFMRTALADTEVRGQNIKR
GDRIMLSYPSANRDEEVFSNPDEFDITRFPNRHLGFGWGAHMCLGQHLAKLEMKIFFE
ELLPKLKSVELSGPPRLVATNFVGGPKNVPIRFTKA

>CYP109A1 M24523
MTNQTARSSKKERYANLIPMEELHSEKDRLFPFPIYDKLRRESP
VRYDPLRDCWDVFKYDDVQFVLKNPKLFSSKRGIQTESILTMDPPKHTKLRALVSRAF
TPKAVKQLETRIKDVTAFLLQEARQKSTIDIIEDFAGPLPVIIIAEMLGAPIEDRHLI
KTYSDVLVAGAKDSSDKAVADMVHNRRDGHAFLSDYFRDILSKRRAEPKEDLMTMLLQ
AEIDGEYLTEEQLIGFCILLLVAGNETTTNLIANAVRYLTEDSVVQQQVRQNTDNVAN
VIEETLRYYSPVQAIGRVATEDTELGGVFIKKGSSVISWIASANRDEDKFCKPDCFKI
DRPSYPHLSFGFGIHFCLGAPLARLEANIALSSLLSMSACIEKAAHDEKLEAIPSPFV
FGVKRLPVRITFK

>CYP109B1 YjiB Z99110
MNVLNRRQALQRALLNGKNKQDAYHPFPWYESMRKDAPVSFDEE
NQVWSVFLYDDVKKVVGDKELFSSCMPQQTSSIGNSIINMDPPKHTKIRSVVNKAFTP
RVMKQWEPRIQEITDELIQKFQGRSEFDLVHDFSYPLPVIVISELLGVPSAHMEQFKA
WSDLLVSTPKDKSEEAEKAFLEERDKCEEELAAFFAGIIEEKRNKPEQDIISILVEAE
ETGEKLSGEELIPFCTLLLVAGNETTTNLISNAMYSILETPGVYEELRSHPELMPQAV
EEALRFRAPAPVLRRIAKRDTEIGGHLIKEGDMVLAFVASANRDEAKFDRPHMFDIRR
HPNPHIAFGHGIHFCLGAPLARLEANIALTSLISAFPHMECVSITPIENSVIYGLKSF
RVKM

>CYP110A1 U38537
MLTQLPNPISVPSWWQLINWIADPIGFQKKYSKKYGNIFSMQLA
GIGSFVILGEPQALQEIFTQDSRFDVGRGNTLAEPLIGRTSLMLMDGDRHRRERKLLM
PPFHGERLQAYAQQICLITNQIASEWQIGQPFVARSAMQKLSLEVIIQIVFGLADGER
YQQIKPLFTDWLNMTDSPLRSSMLFLKSLQKDWGTWTPWGQMKHKQRSIYDLLQAEIE
EKRTKENEQRGDVLSLMMAARDENGQAMTDEELKDELLTILFAGHETTATTIAWAFYQ
ILKNVNVQEKLQQELDRLGANPNPMEIAQLPYLTAVSQETLRMYPVLPTLFPRITKSS
INIAGYQLEPDTTLMASIYLIHYREDLYPNPQQFRPERFIERQYSPSEYIPFGGGSRR
CLGIALALLEIKLVIATVLSNYQLALAEDKPVNVQRRGFTLAPDGGVRVIMTGKKSLK
FEQSSKIFN

>CYP110A2 U38478
MLTQLPNPISVPSWWQLINWIADPIGFQKKYSQKYGDIFSMQLA
GIGSFVILGEPQAIQEIFTQDSRFDIGRGNKLAEPLIGRTSLMLMDGDRHRRERKLLM
PPFHGEKLQAYAQQICLITHQIASQWQIGQPFVARSAMQKLSLEVIIQIVFGLANGER
YQQIKPLFTDWLNMTDSPLRSSMLFLKSLQQDWGNRSPWGQMKYQQRCIYDLLQAEIE
EKRTKENERRGDVLSLMMAARDENGQAMTDEELKDELLTILFAGHETTATTIAWAFYQ
IFRNVNVREKLQQELDSLGENPNPMEIAQLPYLTAVCQETLRMYPVLPTLFPRITKSS
INIAGYQLEPNTTLMASIYLIHYREDLYPHPQQFRPERFIERQYSPSEYIPFGGGSRR
CLGYALALLEIKLVIATVLSNYQLALAEDKPIKVQRRGFTLAPEGGVRMIMTGKKSLR
FEQSNKIFN

>CYP111 P450 lin L23310
MERPDLKNPDLYTQQVPHDIFARLRREEPVYWNPESDGSGFWAV
LRHKDIIEVSRQPLLFSSAYENGGHRIFNENEVGLTNAGEAAVGVPFISLDPPVHTQY
RKVIMPALSPARLGDIEQRIRVRAEALIERIPLGEEVDLVPLLSAPLPLLTLAELLGL
DPDCWYELYNWTNAFVGEDDPEFRKSPEDMAKVLGEFMGFCQELFESRRANPGPDIAT
LLANAEINGQPVALRDFIGNLTLTLVGGNETTRNSISHTIVTLSQQPDQWDILRQRPE
LLKTATAEMVRHASPVLHMRRTAMEDTEIGGQAIAKGDKVVLWYASGNRDESVFSDAD
RFDVTRTGVQHVGFGSGQHVCVGSRLAEMQLRVVFEILSTRVKRFELCSKSRRFRSNF
LNGLKNLNVVLVPK

>CYP112A1 BJ-1 U12678
MSEQQPLPTLPMWRVDHIEPSPEMLALRANGPIHRVRFPSGHEG
WWVTGYDEAKAVLSDAAFRPAGMPPAAFTPDSVILGSPGWLVSHEGREHARLRAIVAP
AFSDRRVKLLVQQVEAIAAHLFETLAAQPQPADLRRHLSFPLPAMVISALMGVLYEDH
AFFAGLSDEVMTHQHESGPRSASRLAWEELRAYIRGKMRDKRQDPDDNLLTDLLAAVD
QGKASEEEAVGLAAGMLVAGHESTVAQIEFGLHAMFRHPQQRERLVGDPSLVDKAVQE
ILRMYPPGAGWDGIMRYPRTDVTIAGEHIPAESKVLVGLPATSFDPHHFDDPEIFDIE
RQEKPHLAFSYGPHACIGVALARLELKVVFGSIFQRLPALRLAVAPEQLKLRKEIITG
GFEQFPVLW

>CYP112A2 AE000083
MPEQPLPTLPMWRVDHIEPSPTMLALRANGPIHNVRFPRGHEGW
WVTGYDEAKAVLSDAAFRPAGMPPAAFTPDCVILGSPGWLVSHEGGEHARLRTIVAPA
FSDRRVKLLAQQVEAIAAQLFETLAAQPQPADLRRHLSFPLPAMVISALMGVLYEDHA
FFAGLSDEVMTHQHESGPRSASRLAWEELRAYIRGKMRDKRQDPGDNLLTDLLAAVDR
GEATEEEAIGLAAGMLVAGHESTVAQIEFGLLAMLRHPQQRERLVGNPSLVDKAVEEI
LRMYPPGAGWDGIMRYPRTDVTIAGVHIPAESKVLVGLPATSFDPRHFEDPEIFDIGR
DAKPHLAFSYGPHYCIGMALARLELKVVFGSIFQRFPALRLAVAPEELKLRKEIITGG
FEEFPVLW

>CYP113A1 U82823 eryK
MTTIDEVPGMADETALLDWLGTMREKQPVWQDRYGVWHVFRHAD
VQTVLRDTATFSSDPTRVIEGASPTPGMIHEIDPPEHRALRKVVSSAFTPRTISDLEP
RIRDVTRSLLADAGESFDLVDVLAFPLPVTIVAELLGLPPMDHEQFGDWSGALVDIQM
DDPTDPALAERIADVLNPLTAYLKARCAERRADPGDDLISRLVLAEVDGRALDDEEAA
NFSTALLLAGHITTTVLLGNIVRTLDEHPAHWDAAAEDPGRIPAIVEEVLRYRPPFPQ
MQRTTTKATEVAGVPIPADVMVNTWVLSANRDSDAHDDPDRFDPSRKSGGAAQFSFGH
GVHFCLGAPLARLENRVALEEIIARFGRLTVDRDDERLRHFEQIVLGTRHLPVLAGSS
PRQSA

>CYP113B1 U08223
MTTQTLEAEKPPEPERTANSVHPLAQPAGAGARGLLEWFARARA
EAPVFWDESRQAWQVFRYDDYLTVSTNPQLFSSDFSPVFPVPEELAILMGPGTFGGID
PPRHGPLRKLVSQAFTPRRIATLEPRIAEITRGLLDGLREKGQIDVVSDLAYPLPVIV
IAELLGIPAEDRDLFREWVDVILNNEGMEYPNLPDDFSETMGPAIKEWGDYLYRRIAL
KRETPTDDLMSGLIEAEVEGRRLTDEEIVNIVALLLTAGHISSATLLGNLFLVLDEHR
EAQAELRADRDLIPGAIEETLRYRSPFNNIFRLLKEDTDILGHPMKAGQMVVAWIASA
NRDSAHFSDPDTFDVRRQPNKHMSFGHGIHHCLGSFLARLEAKVFLELFFDEFSDYRV
EHDEVEFYEEDELTARRLPVTVTRH

>CYP113B2  Streptomyces caelestis cytochrome P-450 hydroxylase homolog (nidi)
           GenEMBL AF016585 CDS complement(<1..396) N-term only, 60% to 113B1
           MVDSVTGPMELSKDANAKELLDWFSHNRTHHPVFWDEGRQAWQV
           FRYDDYLTVSNHPEFFSSDFTEVAPTPPELEMILGPGTIGALDPPAHGPMRKLVSQAF
           TPRRMAGQEQRIRVIAEELLDRVRGQKTIA

>CYP114 BJ-3 U12678
MLSRHADIFWAFKATGDAFRGPAPGELARYFSRAATSPSLNLLA
STLAMKDPPTHTRLRRLISRDFTMGQIDNLRPSIARIVAARLDGITPALERGEAVDLH
REFALALPMLVFAELFGMPQDDMFELAAGIGTILEGLGPHASDPQLAAADAASARVQA
YFGDLIQRKRTDPRRDIVSMLVGAHDDDADTLSDAELISMLWGMLLGGFVTTAASIDH
AVLAMLAYPEQRHWLQADAARVRAFVEEVLRCDAPAMFSSIPRIAQRDIELGGVVIPK
NADVRVLIASGNRDPDAFADPDRFDPARFYGTSPGMSTDGKIMLSFGHGIHFCLGAQL
ARVQLAESLPRIQARFPTLAFAGQPTREPSAFLRTFRTLPVRLHAQGS

>CYP114A2 AE000082.1|AE000082  Rhizobium sp. NGR234 plasmid pNGR234.CDS comp (9861..11264) gene="y4lC" cytochrome P450 BJ-3 homolog" 90% to CYP114A1
                     MDMQETTTACADAFAELASPACIDDPYPFMRWLREHDPVHRAAS
                     GLFLLSRHADICWALKATGDAFRGPAPGELARYFPRAATSLSLNLLASTLAMKEPPTH
                     TRLRRLISRDFTMREIDNLRPSIARFVAARLDGMAPALERGEAVDLHRQFALALPMLV
                     FAELFGMPQDDMFGLAAGIGAILEGLSPHASDPQLAAADAASARMKAYFGDLIQRKCI
                     DPRHDIVATLVGAHDDDADTLSDAELISMLWGMLLGGFATTAATIDHAVLAMLAYPDQ
                     RHWLQGDAAGVEAFVEEVLRCDAPAMFSSIPRIAQSDIELSGVVIPKNADVRVLIAAG
                     NRDPDAFADPDRFDPARFYGTSPGMSTDGKIMLSFGHGIHFCLGAQLARVQLAESLPR
                     IQARFPTLTVAEQPTREPSAFLRTFRALPVRLHAQGDSPRLTSAFLNGQRGVEGGASF
                     EHGDGERRSATDRRAQP

>CYP115P pseudogene U12678 1351-1578

>CYP116 U17130 Rhodococcus erythropolis ORF6' gene CYP116

/gene="thcB"
/standard_name="cytochrome P-450"
/note="first member of the new cytochrome P-450 family
CYP116"
/function="degradation of thiocarbamate herbicides"
/product="ThcB"
MTVDHAPEGVKSPTGCPVSGMAADFDPFRGAYQVDPSSSLRQAR
KDEPVFFSPLLDYWVVTRYEDIKQIFKTPSVFSPSITVDQITPISDEALQILGSYQFA
AGRMLVNEDEPIHTERRRLLMQPFEADNVATLEPKIREVVNTYLDRVIKDGRADLIGD
LLYEVPCIVALIFLGVPDEDIETCRQYGMQQTLFTWGHPTGDEQTRVATGMGKFWEFA
GGLVDKLKADPNAKGWIPHAIEMQRQHPDLFDDNYLQNIMFGGVFAAHETTTNATGNA
FRTLLENRSSWDEICADPTLIPKAIEECLRYSGSVVAWRRKAVVDTTVGEVDIPAGGR
LLIVMASANRDDSMFPEPDDFDIHRGNAQRHLTFGIGSHTCLGATLARLEMKVFLEEV
SRRLPHMSLVAGQEFSYLPNTSFRGPEHVLVEWDPQQNPVPADRP"

>CYP117 BJ-4 U12678
MFGGTLVAQDGIAHRQARDAIQAALLPKGLTLAGIGELFAPVIR
ARVQRWRERGDVTILRETGDLMLKLIFSLMGIPAQDLPGWHRKYRQLLQLIVAPPVDL
PGLPLRRGRAARDWIDARLREFVRAAREHASRTGLINDMVSAFDRSDDALSDDVLVAN
IRLLLLGGHDTTASTMAWMVIELARQPGLWDALVEEAQRVGAVPTRHADLAQCPVAEA
LFRETLRVHPATPLLVRRALRELRIGQQRIPTGTDLCIPLLHFSTSALLHEAPDQFRL
ARWLQRTEPIRPVDMLQFGTGPHFCMGYHLVWLELVQFCIALALTMHEAGVRPRLLSG
VEKGRRYYPTAHPSMTIRIGFS

>CYP117A2 AE000082
MNVLLNPLNRRHRLRYDIPVMPGAFPLVGHLPAIVCDLPRLLRR
AERTLGSHFWLDFGPAGHLMTCVDPHAFALLRHKDVSSALIEEIAPELLGGTLVAQDG
GAHRQARDAIKAAFLPEGLTQAGIGDLFAPVIRARVQAWRDRGDVTILPETGDLMLKL
IFTLMGVPAQDLPGWHRKYRQLLQLIVAPSVDLPGLPLRRGRAARDWIDAQLRQFVRD
ARAHAARTGLINDMVSAFDRSDDALSDDLLVANIRLLLLAGHDTTASTMAWMVIELAR
QPMLWDALVEEAQRVGAVPTRHADLEQCPVAEALFRETLRVHPATTLLPRRALQELQL
GQRRIPAGTHLCIPLLHFSTSALLHEAPDQFRLARWLQRTEPIRPVDMLQFGTGPHVC
IGYHLVWLELVQFSIALALTMHKAGVRPLLLSGVEKGRRYYPTAHPSMTIRIGFS

>CYP118 fragments 

RLGSGIVEQRISVLSIIALADPXXXXXXXDETVWENI
XXXXXXRLLMGDELFTXXXXESNWGKAHN (THIS FRAGMENT MATCHES 12/19 RESIDUES IN CYP102A1 AND 
CYP102A2
SQHDDILDIMLYSADPSTGEQLDTDNV
VNQILTLLVSGSQTLANAIAFALHYLLSIHHDIAAQTRREI
RCLRRVVDATLRLWSXXXXXXRQARRDTTLGNGXXFPKGXXXXXXXXXXXX

THE CYP118 FRAGMENT BELOW IS 50% IDENTICAL TO yetO (CYP102A2) of B. subtilis

RADAWGPDANEFNPDRVLPEICRKLPYTYILFGTGLRTCIGRRFALHEMALELTMIVHQYD

>CYP119 U51337
MYDWFSEMRKKDPVYYDGNIWQVFSYRYTKEVLNNFSKFSSDLT
GYHERLEDLRNGKIRFDIPTRYTMLTSDPPLHDELRSMSADIFSPQKLQTLETFIRET
TRSLLDSIDPREDDIVKKLAVPLPIIVISKILGLPIEDKEKFKEWSDLVAFRLGKPGE
IFELGKKYLELIGYVKDHLNSGTEVVSRVVNSNLSDIEKLGYIILLLIAGNETTTNLI
SNSVIDFTRFNLWQRIREENLYLKAIEEALRYSPPVMRTVRKTKERVKLGDQTIEEGE
YVRVWIASANRDEEVFHDGEKFIPDRNPNPHLSFGSGIHLCLGAPLARLEARIAIEEF
SKRFRHIEILDTEKVPNEVLNGYKRLVVRLKSNE

>CYP120 D64003
MITSPTNLNSLPIPPGDFGLPWLGETLNFLNDGDFGKKRQQQFG
PIFKTRLFGKNVIFISGALANRFLFTKEQETFQATWPLSTRILLGPNALATQMGEIHR
SRRKILYQAFLPRTLDSYLPKMDGIVQGYLEQWGKANEVIWYPQLRRMTFDVAATLFM
GEKVSQNPQLFPWFETYIQGLFSLPIPLPNTLFGKSQRARALLLAELEKIIKARQQQP
PSEEDALGILLAARDDNNQPLSLPELKDQILLLLFAGHETLTSALSSFCLLLGQHSDI
RERVRQEQNKLQLSQELTAETLKKMPYLDQVLQEVLRLIPPVGGGFRELIQDCQFQGF
HFPKGWLVSYQISQTHADPDLYPDPEKFDPERFTPDGSATHNPPFAHVPFGGGLRECL
GKEFARLEMKLFATRLIQQFDWTLLPGQNLELVVTPSPRPKDNLRVKLHSLM

>CYP121 Rv2276 Z77163
MTATVLLEVPFSARGDRIPDAVAELRTREPIRKVRTITGAEAWL
VSSYALCTQVLEDRRFSMKETAAAGAPRLNALTVPPEVVNNMGNIADAGLRKAVMKAI
TPKAPGLEQFLRDTANSLLDNLITEGAPADLRNDFADPLATALHCKVLGIPQEDGPKL
FRSLSIAFMSSADPIPAAKINWDRDIEYMAGILENPNITTGLMGELSRLRKDPAYSHV
SDELFATIGVTFFGAGVISTGSFLTTALISLIQRPQLRNLLHEKPELIPAGVEELLRI
NLSFADGLPRLATADIQVGDVLVRKGELVLVLLEGANFDPEHFPNPGSIELDRPNPTS
HLAFGRGQHFCPGSALGRRHAQIGIEALLKKMPGVDLAVPIDQLVWRTRFQRRIPERL
PVLW

>CYP122A1 U65940
MSTDTPAGTPQAGRCPFAIQDAHRAILDSATVGSFDLFGIKHWL
VAAAEDVKLVTNDPRFSSAAPSEMLPDRRPGWFSGMDVPEHSRYRQKIAGDFTLRAAR
RQEEFVFEAADACLDEIEAAGPGADLVPGYAKRLPSLVINALYGLTPEEGAVLETRMR
GITGSTDLDSVKTLTDDFFAHALELVRAKRDERGDDLLHRLASAEDGEIPLSDDEATG
VFATLLFAGHDSVQQMVGYCLYALLSHPEQEGALRTRPELIDGAVEEMLRFLPVNQMG
VPRVCVADVDLRGVRISVGDNVIPLYSTANRDPEVFPDPDTFDVSRPTEGNFAFGHGV
HKCPGQHVARLLIKVACLRLLERFPDVRLVGDVPMNEGLGLFSPAELRITWGAA

>CYP122A2 rapJ X86780
MSTEAQQESTPTARCPFSIQDGHRTILETGTVGAHELFGVKQWL
VAAAEDVKLVTNDPRFSSAAPSGILGDRRPGWFSGMDSPEHNRYRQKIARDFTLRAAR
KQEEFIVRAADSCLDDIEASGPGTDLVPGYAKRLASLAIHDLYGLNEEGPVLEGQMRA
MEGGTDMESIKRLTDEFGHVLALVRAKRDEAGDRLLHRLAESGEDEILLSDEEATGVF
ATLLFAGHDSMQQMVGYSLYALLSHPEQRAALRENPDLIDGAVEELLRFLPLNQLGVP
RVCVEDVELHGQTISAGDNVIPLYSTANRDPGVFADPDTFDITRKPEHNFAFGYGIHG
CPGQHLARVLIKVATVRLFERFPDVRLAGDVPMNEGLGLFSPAELRVTWGAE

>CYP122A3 AF235504.1|AF235504  Streptomyces hygroscopicus var. CDS 71460..72626 gene="fkbD"
note="C9 hydroxylase" 89% to 122A1 77% to 122A2
                     MSTDTHEGTPPAGRCPFAIQDGHRAILESGTVGSFDLFGVKHWL
                     VAAAEDVKLVTNDPRFSSAAPSEMLPDRRPGWFSGMDSPEHNRYRQKIAGDFTLRAAR
                     KREDFVAEAADACLDDIEAAGPGTDLIPGYAKRLPSLVINALYGLTPEEGAVLEARMR
                     DITGSADLDSVKTLTDDFFGHALRLVRAKRDERGEDLLHRLASADDGEISLSDDEATG
                     VFATLLFAGHDSVQQMVGYCLYALLSHPEQQAALRARPELVDNAVEEMLRFLPVNQMG
                     VPRVCVEDVDVRGVRIRAGDNVIPLYSTANRDPEVFPQPDTFDVTRPLEGNFAFGHGI
                     HKCPGQHIARVLIKVACLRLFERFPDVRLAGDVPMNEGLGLFSPAELRVTWGAA"

>CYP123 Rv0766c Z80226
MTVRVGDPELVLDPYDYDFHEDPYPYYRRLRDEAPLYRNEERNF
WAVSRHHDVLQGFRDSTALSNAYGVSLDPSSRTSEAYRVMSMLAMDDPAHLRMRTLVS
KGFTPRRIRELEPQVLELARIHLDSALQTESFDFVAEFAGKLPMDVISELIGVPDTDR
ARIRALADAVLHREDGVADVPPPAMAASIELMRYYADLIAEFRRRPANNLTSALLAAE
LDGDRLSDQEIMAFLFLMVIAGNETTTKLLANAVYWAAHHPGQLARVFADHSRIPMWV
EETLRYDTSSQILARTVAHDLTLYDTTIPEGEVLLLLPGSANRDDRVFDDPDDYRIGR
EIGCKLVSFGSGAHFCLGAHLARMEARVALGALLRRIRNYEVDDDNVVRVHSSNVRGF
AHLPISVQAR

>CYP124 Rv2266 Z77163
MGLNTAIATRVNGTPPPEVPIADIELGSLDFWALDDDVRDGAFA
TLRREAPISFWPTIELPGFVAGNGHWALTKYDDVFYASRHPDIFSSYPNITINDQTPE
LAEYFGSMIVLDDPRHQRLRSIVSRAFTPKVVARIEAAVRDRAHRLVSSMIANNPDRQ
ADLVSELAGPLPLQIICDMMGIPKADHQRIFHWTNVILGFGDPDLATDFDEFMQVSAD
IGAYATALAEDRRVNHHDDLTSSLVEAEVDGERLSSREIASFFILLVVAGNETTRNAI
THGVLALSRYPEQRDRWWSDFDGLAPTAVEEIVRWASPVVYMRRTLTQDIELRGTKMA
AGDKVSLWYCSANRDESKFADPWTFDLARNPNPHLGFGGGGAHFCLGANLARREIRVA
FDELRRQMPDVVATEEPARLLSQFIHGIKTLPVTWS

>CYP125 Rv3545c Z82098
MSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYAERLPVAEFA
ELRSAAPIWWNGQDPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSSYENGVIPRFKN
DIAREDIEVQRFVMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKIAAEAAA
AGSGDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEMTGNEDPEYAHIDPKASSA
ELIGYAMKMAEEKAKNPADDIVTQLIQADIDGEKLSDDEFGFFVVMLAVAGNETTRNS
ITQGMMAFAEHPDQWELYKKVRPETAADEIVRWATPVTAFQRTALRDYELSGVQIKKG
QRVVMFYRSANFDEEVFQDPFTFNILRNPNPHVGFGGTGAHYCIGANLARMTINLIFN
AVADHMPDLKPISAPERLRSGWLNGIKHWQVDYTGRCPVAH

>CYP126 Rv0778 Z80226
MTTAAGLSGIDLTDLDNFADGFPHHLFAIHRREAPVYWHRPTEH
TPDGEGFWSVATYAETLEVLRDPVTYSSVTGGQRRFGGTVLQDLPVAGQVLNMMDDPR
HTRIRRLVSSGLTPRMIRRVEDDLRRRARGLLDGVEPGAPFDFVVEIAAELPMQMICI
LLGVPETDRHWLFEAVEPGFDFRGSRRATMPRLNVEDAGSRLYTYALELIAGKRAEPA
DDMLSVVANATIDDPDAPALSDAELYLFFHLLFSAGAETTRNSIAGGLLALAENPDQL
QTLRSDFELLPTAIEEIVRWTSPSPSKRRTASRAVSLGGQPIEAGQKVVVWEGSANRD
PSVFDRADEFDITRKPNPHLGFGQGVHYCLGANLARLELRVLFEELLSRFGSVRVVEP
AEWTRSNRHTGIRHLVVELRGG

>CYP127A1 AE000101 Rhizobium sp. NGR234 plasmid pNGR234a same seq as Z68203
MSDLRRKRVKTNPIPDHVPPALVRHFSLFTSPGMAPTPNGDPHA
AVACVHDDGPPIFYSPSNTRDGRGTWVITRARDQRRVLEDTETFSSHRSIFASALGEH
WPVIPLELDPPAHGVFRALLNPLFSSRRVLALEPTIHARAGALIDCIAKEKTSCDVMK
DFALPFTFSVFLSFLGLSQRRSEVLVGWVSDLLHGNAEKRRAAARSVVAFIDEMAAMR
RKSPAVDFMTFVVQAKIEGRSLTEEEVRGIGVLFLVAGLDTVAAAIGFDMAYLARNPK
HQELLRNEPARLGLAAEELLRAYSTVQIIRVATKDIEFEGVPIREGDYVSCPAMIANR
DPSEFKCPNTIDLARQDNQHTAFGYGPHLCHGAHLARREIVIGLREWLARIPAFRIKE
GTAPITHGGHVFGISNIILTWA

>CYP127A2   Rhizobium sp. BR816 Ellen Luyten confidential 73% to CYP127A1

>CYP128 Rv2268c Z77163
MTATQSPPEPAPDRVRLAGCPLAGTPDVGLTAQDATTALGVPTR
RRASSGGIPVATSMWRDAQTVRTYGPAVAKALALRVAGKARSRLTGRHCRKFMQLTDF
DPFDPAIAADPYPHYRELLAGERVQYNPKRDVYILSRYADVREAARNHDTLSSARGVT
FSRGWLPFLPTSDPPAHTRMRKQLAPGMARGALETWRPMVDQLARELVGGLLTQTPAD
VVSTVAAPMPMRAITSVLGVDGPDEAAFCRLSNQAVRITDVALSASGLISLVQGFAGF
RRLRALFTHRRDNGLLRECTVLGKLATHAEQGRLSDDELFFFAVLLLVAGYESTAHMI
STLFLTLADYPDQLTLLAQQPDLIPSAIEEHLRFISPIQNICRTTRVDYSVGQAVIPA
GSLVLLAWGAANRDPRQYEDPDVFRADRNPVGHLAFGSGIHLCPGTQLARMEGQAILR
EIVANIDRIEVVEPPTWTTNANLRGLTRLRVAVTPRVAP

>CYP129A1 U50973 doxA
MSGEAPRVAVDPFSCPMMTMQRKPEVHDAFREAGPVVEVNAPAG
GPAWVITDDALAREVLADPRFVKDPDLAPTAWRGVDDGLDIPVPELRPFTLIAVDGED
HRRLRRIHAPAFNPRRLAERTDRIAAIADRLLTELADSSDRSGEPAELIGGFAYHFPL
LVICELLGVPVTDPAMAREAVGVLKALGLGGPQSAGGDGTDPAGDVPDTSALESLLLE
AVHAARRKDTRTMTRVLYERAQAEFGSVSDDQLVYMITGLIFAGHDTTGSFLGFLLAE
VLAGRLAADADGDAISRFVEEALRHHPPVPYTLWRFAATEVVIRGVRLPRGAPVLVDI
EGTNTDGRHHDAPHAFHPDRPSRRRLTFGDGPHYCIGEQLAQLESRTMIGVLRSRFPQ
ARLAVPYEELRWCRKGAQTARLTDLPVWLR

>CYP129A2 U77891.1|SPU77891  Streptomyces peucetius daunorubicin CDS comp (83..1330)gene="doxA"
product="daunorubicin C-14 hydroxylase" 94% to 129A1 
                     MAVDPFACPMMTMQRKPEVHDAFREAGPVVEVNAPAGGPAWVIT
                     DDALAREVLADPRFVKDPDLAPAAWRGVDDGLDIPVPELRPFTLIAVDGEAHRRLRRI
                     HAPAFNPRRLAERTDRIAAIAGRLLTELADASGRSGKPAELIGGFAYHFPLLVICELL
                     GVPVTDPAMAREAVSVLKALGLGGPQSGGGDGTDPAGGVPDTSALESLLLEAVHSARR
                     NDTPTMTRVLYERAQAEFGSVSDDQLVYMITGLIFAGHDTTGSFLGFLLAEVLAGRLA
                     ADADEDAVSRFVEEALRYHPPVPYTLWRFAATEVTIGGVRLPRGAPVLVDIEGTNTDG
                     RHHDAPHAFHPDRPSWRRLTFGDGPHYCIGEQLAQLESRTMIGVLRSRFPEARLAVPY
                     DELRWCRKGAQTARLTELPVWLR

>CYP130 Rv1256c Z77137
MTSVMSHEFQLATAETWPNPWPMYRALRDHDPVHHVVPPQRPEY
DYYVLSRHADVWSAARDHQTFSSAQGLTVNYGELEMIGLHDTPPMVMQDPPVHTEFRK
LVSRGFTPRQVETVEPTVRKFVVERLEKLRANGGGDIVTELFKPLPSMVVAHYLGVPE
EDWTQFDGWTQAIVAANAVDGATTGALDAVGSMMAYFTGLIERRRTEPADDAISHLVA
AGVGADGDTAGTLSILAFTFTMVTGGNDTVTGMLGGSMPLLHRRPDQRRLLLDDPEGI
PDAVEELLRLTSPVQGLARTTTRDVTIGDTTIPAGRRVLLLYGSANRDERQYGPDAAE
LDVTRCPRNILTFSHGAHHCLGAAAARMQCRVALTELLARCPDFEVAESRIVWSGGSY
VRRPLSVPFRVTS

>CYP131A1 dnrQ L47164 C-term may be wrong not heme sign.
MPTPTSAPPAAPTDSELGRHLLTVRGFHFVFGALGDPYARRLRG
EADHLSLGELVRDRGPLHGSALGTWVTADGGISARLLDDPLLGPRHPASEGPQEHVLE
NVWETWRTCHVTPLGEDLLTPAAADSDRLAALLGPVLGPRTCTAWQVDAGRAVHRVLD
GLPPHFDVVSDLARPAIAGSLAAVLGLPDEARAELPDLLAACGPVLDSALCPPRLPVA
RAMTQALRRVRELMAAAVANHLTAPADGAVSALLAVDPGGGRDPGDTVTAAVLSTVVG
AETAITTVANAVMALLKHDEQWSLLRADPGRAADAVEETLRWAPPVTLRSLITQGEVQ
IGGETLEADQHVVVLVDAAQRDPALYEDPDRFRLDRPRSPGFTHMALAGRDHLGLVAP
LVRVQCTAVLRALAERLPGLRAEGEPLRRGRSPVVRAPLSLRLAQK

>CYP131A2 L35154 dauQ N-terminal 
MTMPTPTSAPPAAPTNSELGRHLLTVRGFHFVFGALGDPYARRL
RGEADHLSLGELVRDRGPLHRSALGTWVTADGETSAGLLDDPLLGPRHPASEGLQ

>CYP132 Rv1394c Z80108
MATATTQRPLKGPAKRMSTWTMTREAITIGFDAGDGFLGRLRGS
DITRFRCAGRRFVSISHPDYVDHVLHEARLKYVKSDEYGPIRATAGLNLLTDEGDSWA
RHRGALNSTFARRHLRGLVGLMIDPIADVTAARVPGAQFDMHQSMVETTLRVVANALF
SQDFGPLVQSMHDLATRGLRRAEKLERLGLWGLMPRTVYDTLIWCIYSGVHLPPPLRE
MQEITLTLDRAINSVIDRRLAEPTNSADLLNVLLSADGGIWPRQRVRDEALTFMLAGH
ETTANAMSWFWYLMALNPQARDHMLTELDDVLGMRRPTADDLGKLAWTTACLQESQRY
FSSVWIIAREAVDDDIIDGHRIRRGTTVVIPIHHIHHDPRWWPDPDRFDPGRFLRCPT
DRPRCAYLPFGGGRRICIGQSFALMEMVLMAAIMSQHFTFDLAPGYHVELEATLTLRP
KHGVHVIGRRR

>CYP133A1 confidential Erwinia herbicola Randy S. Fischer, Roy A. Jensen

>CYP133B1 AE003889.1|AE003889  Xylella fastidiosa, section 35 of 22. CDS complement(3751..4959)
82% to AE003887 48% to CYP133A1
                     MKLTDLSNPAFLENPYPLYETLRAQAPFVSIGPNALMTGRYSLV
                     DSLLHNRNMGKKYMESMRVRYGDSAADMPLFQAFSRMFITINPPAHTHLRGLVMQAFT
                     GRESESMRPLAIDTAHQLIDNFEQKPSVDLVAEFAFPFPMQIICKMMDVDIGDAVTLG
                     IAVSKIAKVFDPSPMSADELVHASTAYEELAQYFTKLIELRRTHPGTDLISMFLRAEE
                     DGEKLTHDEIVSNVIMLLIAGYETTSNMIGNALIALHRHPEQLALLKSDLSLMPQAVS
                     ECLRYDGSVQFTMRAAMDDIEVEGELVPRGTVVFLMLGAANRDPAQFTHPDQLDITRK
                     QGRLQSFGAGIHHCLGYRLALIELECALTTLFERLPHLRLAHLDALNWNQRSNLRGVN
                     TLIVDLHAKN"
>CYP133B2 AE003887.1|AE003887  Xylella fastidiosa, section 33 of 22 CDS 6723..7925
82% to AE003889 48% to CYP133A1
                     MKLADLSSPAFLENPYPLYETLRRQGSFVSIGPNALMTGRYSIV
                     DGLLHNRNMGKSYMESIRVRYGDDALDMPLFQGFNRMFLMLNPPVHTHLRGLVMQAFT
                     GRESESMRPLATDTAHRLIDDFEQKSSVDLVTEFSFPLPMRIICRMMDVDISDAISLS
                     VAVSNIAKVLDPAPMSPDELVHASAAYEELAHYFTRLIELRRAQPGTDLISMLLRAEE
                     EGQKLTHDEIVSNVILLLLGGYETTSNMIGNALIALHRHPKQLARLKSDLSLMPQAIL
                     ECLRYDGSVQFTMRAAMDDVSIEGDVVPRGTIVFLMLGAANRDPAQFTDPDHLDITRK
                     QGRLQSFGAGVHHCLGYRLALVELECALTVLLERLPHLRLANLDTLSWNQRGNLRGVN
                     ALIADLHS

>CYP134 cypX Z99122 also cypB AF017113
MSQSIKLFSVLSDQFQNNPYAYFSQLREEDPVHYEESIDSYFIS
RYHDVRYILQHPDIFTTKSLVERAEPVMRGPVLAQMHGKEHSAKRRIVVRSFIGDALD
HLSPLIKQNAENLLAPYLERGKSDLVNDFGKTFAVCVTMDMLGLDKRDHEKISEWHSG
VADFITSISQSPEARAHSLWCSEQLSQYLMPVIKERRVNPGSDLISILCTSEYEGMAL
SDKDILALILNVLLAATEPADKTLALMIYHLLNNPEQMNDVLADRSLVPRAIAETLRY
KPPVQLIPRQLSQDTVVGGMEIKKDTIVFCMIGAANRDPEAFEQPDVFNIHREDLGIK
SAFSGAARHLAFGSGIHNCVGAAFAKNEIEIVANIVLDKMRNIRLEEDFCYAESGLYT
RGPVSLLVAFDGA

>CYP135A1 Rv0327c Z96800
MASTLTTGLPPGPRLPRYLQSVLYLRFREWFLPAMHRKYGDVFS
LRVPPYADNLVVYTRPEHIKEIFAADPRSLHAGEGNHILGFVMGEHSVLMTDEAEHAR
MRSLLMPAFTRAALRGYRDMIASVAREHITRWRPHATINSLDHMNALTLDIILRVVFG
VTDPKVKAELTSRLQQIINIHPAILAGVPYPSLKRMNPWKRFFHNQTKIDEILYREIA
SRRIDSDLTARTDVLSRLLQTKDTPTKPLTDAELRDQLITLLLAGHETTAAALSWTLW
ELAHAPEIQSQVVWAAVGGDDGFLEAVLKEGMRRHTVIASTARKVTAPAEIGGWRLPA
GTVVNTSILLAHASEVSHPKPTEFRPSRFLDGSVAPNTWLPFGGGVRRCLGFGFALTE
GAVILQEIFRRFTITAAGPSKGETPLVRNITTVPKHGAHLRLIPQRRLGGLGDSDPP

>CYP135B1 AL021942 Mycobacterium tuberculosis H37Rv complete
40% with Z96800 Mt Y63 Rv0568
MSGTSSMGLPPGPRLSGSVQAVLMLRHGLRFLTACQRRYGSVFT
LHVAGFGHMVYLSDPAAIKTVFAGNPSVFHAGEANSMLAGLLGDSSLLLIDDDVHRDR
RRLMSPPFHRDAVARQAGPIAEIAAANIAGWPMAKAFAVAPKMSEITLEVILRTVIGA
SDPVRLAALRKVMPRLLNVGPWATLALANPSLLNNRLWSRLRRRIEEADALLYAEIAD
RRADPDLAARTDTLAMLVRAADEDGRTMTERELRDQLITLLVAGHDTTATGLSWALER
LTRHPVTLAKAVQAADASAAGDPAGDEYLDAVAKETLRIRPVVYDVGRVLTEAVEVAG
YRLPAGVMVVPAIGLVHASAQLYPDPERFDPDRMVGATLSPTTWLPFGGGNRRCLGAT
FAMVEMRVVLREILRRVELSTTTTSGERPKLKHVIMVPHRGARIRVRATRDVSATSQA
TAQGAGCPAARGGGPSRAVGSQ

>CYP136 Mycobacterium tuberculosis Z83866 Rv3059 coding region 23158-24636
29% with CYP26
MATIHPPAYLLDQAKRRFTPSFNNFPGMSLVEHMLLNTKFPEKK
LAEPPPGSGLKPVVGDAGLPILGHMIEMLRGGPDYLMFLYKTKGPVVFGDSAVLPGVA
ALGPDAAQVIYSNRNKDYSQQGWVPVIGPFFHRGLMLLDFEEHMFHRRIMQEAFVRSR
LAGYLEQMDRVVSRVVADDWVVNDARFLVYPAMKALTLDIASMVFMGHEPGTDHELVT
KVNKAFTITTRAGNAVIRTSVPPFTWWRGLRARELLENYFTARVKERREASGNDLLTV
LCQTEDDDGNRFSDADIVNHMIFLMMAAHDTSTSTATTMAYQLAAHPEWQQRCRDESD
RHGDGPLDIESLEQLESLDLVMNESIRLVTPVQWAMRQTVRDTELLGYYLPKGTNVIA
YPGMNHRLPEIWTDPLTFDPERFTEPRNEHKRHRYAFTPFGGGVHKCIGMVFDQLEIK
TILHRLLRRYRLELSRPDYQPRWDYSAMPIPMDGMPIVLRPR

>CYP137 Rv3685c AL022121
MVLRSLASPAALTDPKRCASVVGVAAFAVRREHAPDALGGPPGL
PAPRGFRAAFAAAYAVAYLAGGERRMLRLIRRYGPIMTMPILSLGDVAIVSDSALAKE
VFTAPTDVLLGGEGVGPAAAIYGSGSMFVQEEPEHLRRRKLLTPPLHGAALDRYVPII
ENSTRAAMHTWPVDRPFAMLTVARSLMLDVIVKVIFGVDDPEEVRRLGRPFERLLNLG
VSEQLTVRYALRRLGALRVWPARARANTEIDDVVMALIAQRRADPRLGERHDVLSLLV
SARGESGEQLSDSEIRDDLITLVLAGHETTATTLAWAFDLLLHHPDALRRVRAEAVGG
GEAFTTAVINETLRVRPPAPLTARVAAQPLTIGGYRVEAGTRIVVHIIAINRSAEVYE
HPHEFRPERFLGTRPQTYAWVPFGGGVKRCLGANFSMRELITVLHVLLREGEFTAVDD
EPERIVRRSIMLVPRRGTRVRFRPAR

>CYP138 Rv0136 Z92770
MSEVVTAAPAPPVVRLPPAVRGPKLFQGLAFVVSRRRLLGRFVR
RYGKAFTANILMYGRVVVVADPQLARQVFTSSPEELGNIQPNLSRMFGSGSVFALDGD
DHRRRRRLLAPPFHGKSMKNYETIIEEETLRETANWPQGQAFATLPSMMHITLNAILR
AIFGAGGSELDELRRLIPPWVTLGSRLAALPKPKRDYGRLSPWGRLAEWRRQYDTVID
KLIEAERADPNFADRTDVLALMLRSTYDDGSIMSRKDIGDELLTLLAAGHETTAATLG
WAFERLSRHPDVLAALVEEVDNGGHELRQAAILEVQRARTVIDFAARRVNPPVYQLGE
WVIPRGYSIIINIAQIHGDPDVFPQPDRFDPQRYIGSKPSPFAWIPFGGGTRRCVGAA
FANMEMDVVLRTVLRHFTLETTTAAGERSHGRGVAFTPKDGGRVVMRRR

>CYP139 Rv1666c Z95617
MRYPLGEALLALYRWRGPLINAGVGGHGYTYLLGAEANRFVFAN
ADAFSWSQTFESLVPVDGPTALIVSDGADHRRRRSVVAPGLRHHHVQRYVATMVSNID
TVIDGWQPGQRLDIYQELRSAVRRSTAESLFGQRLAVHSDFLGEQLQPLLDLTRRPPQ
VMRLQQRVNSPGWRRAMAARKRIDDLIDAQIADARTAPRPDDHMLTTLISGCSEEGTT
LSDNEIRDSIVSLITAGYETTSGALAWAIYALLTVPGTWESAASEVARVLGGRVPAAD
DLSALTYLNGVVHETLRLYSPGVISARRVLRDLWFDGHRIRAGRLLIFSAYVTHRLPE
IWPEPTEFRPLRWDPNAADYRKPAPHEFIPFSGGLHRCIGAVMATTEMTVILARLVAR
AMLQLPAQRTHRIRAANFAALRPWPGLTVEIRKSAPAQ"

>CYP140 Z97193 Mycobacterium tuberculosis cosmid Y180 Rv1880c
44% with 107A1
MKDKLHWLAMHGVIRGIAAIGIRRGDLQARLIADPAVATDPVPF
YDEVRSHGALVRNRANYLTVDHRLAHDLLRSDDFRVVSFGENLPPPLRWLERRTRGDQ
LHPLREPSLLAVEPPDHTRYRKTVSAVFTSRAVSALRDLVEQTAINLLDRFAEQPGIV
DVVGRYCSQLPIVVISEILGVPEHDRPRVLEFGELAAPSLDIGIPWRQYLRVQQGIRG
FDCWLEGHLQQLRHAPGDDLMSQLIQIAESGDNETQLDETELRAIAGLVLVAGFETTV
NLLGNGIRMLLDTPEHLATLRQHPELWPNTVEEILRLDSPVQLTARVACRDVEVAGVR
IKRGEVVVIYLAAANRDPAVFPDPHRFDIERPNAGRHLAFSTGRHFCLGAALARAEGE
VGLRTFFDRFPDVRAAGAGSRRDTRVLRGWSTLPVTLGPARSMVSP

>CYP141 Mycobacterium tuberculosis Z95150 Rv3121 cosmid cY164 from Sanger Centre
           coding region 29289-30488
35% with 107D1
MTSTSIPTFPFDRPVPTEPSPMLSELRNSCPVAPIELPSGHTAW
LVTRFDDVKGVLSDKRFSCRAAAHPSSPPFVPFVQLCPSLLSIDGPQHTAARRLLAQG
LNPGFIARMRPVVQQIVDNALDDLAAAEPPVDFQEIVSVPIGEQLMAKLLGVEPKTVH
ELAAHVDAAMSVCEIGDEEVSRRWSALCTMVIDILHRKLAEPGDDLLSTIAQANRQQS
TMTDEQVVGMLLTVVIGGVDTPIAVITNGLASLLHHRDQYERLVEDPGRVARAVEEIV
RFNPATEIEHLRVVTEDVVIAGTALSAGSPAFTSITSANRDSDQFLDPDEFDVERNPN
EHIAFGYGPHACPASAYSRMCLTTFFTSLTQRFPQLQLARPFEDLERRGKGLHSVGIK
ELLVTWPT

>CYP142 AL022022 Mycobacterium tuberculosis Rv3518c
MTEAPDVDLADGNFYASREARAAYRWMRANQPVFRDRNGLAAAS
TYQAVIDAERQPELFSNAGGIRPDQPALPMMIDMDDPAHLLRRKLVNAGFTRKRVKDK
EASIAALCDTLIDAVCERGECDFVRDLAAPLPMAVIGDMLGVRPEQRDMFLRWSDDLV
TFLSSHVSQEDFQITMDAFAAYNDFTRATIAARRADPTDDLVSVLVSSEVDGERLSDD
ELVMETLLILIGGDETTRHTLSGGTEQLLRNRDQWDLLQRDPSLLPGAIEEMLRWTAP
VKNMCRVLTADTEFHGTALCAGEKMMLLFESANFDEAVFCEPEKFDVQRNPNSHLAFG
FGTHFCLGNQLARLELSLMTERVLRRLPDLRLVADDSVLPLRPANFVSGLESMPVVFT
PSPPLG

>CYP143 AL022021 Mycobacterium tuberculosis Rv1785c
34% with 127
MTTPGEDHAGSFYLPRLEYSTLPMAVDRGVGWKTLRDAGPVVFM
NGWYYLTRREDVLAALRNPKVFSSRKALQPPGNPLPVVPLAFDPPEHTRYRRILQPYF
SPAALSKALPSLRRHTVAMIDAIAGRGECEAMADLANLFPFQLFLVLYGLPLEDRDRL
IGWKDAVIAMSDRPHPTEADVAAARELLEYLTAMVAERRRNPGPDVLSQVQIGEDPLS
EIEVLGLSHLLILAGLDTVTAAVGFSLLELARRPQLRAMLRDNPKQIRVFIEEIVRLE
PSAPVAPRVTTEPVTVGGMTLPAGSPVRLCMAAVNRDGSDAMSTDELVMDGKVHRHWG
FGGGPHRCLGSHLARLELTLLVGEWLNQIPDFELAPDYAPEIRFPSKSFALKNLPLRWS

>CYP144 Z97345 Mycobacterium tuberculosis cosmid Y25C11 Rv1777
34% with 107B1
MRRSPKGSPGAVLDLQRRVDQAVSADHAELMTIAKDANTFFGAE
SVQDPYPLYERMRAAGSVHRIANSDFYAVCGWDAVNEAIGRPEDFSSNLTATMTYTAE
GTAKPFEMDPLGGPTHVLATADDPAHAVHRKLVLRHLAAKRIRVMEQFTVQAADRLWV
DGMQDGCIEWMGAMANRLPMMVVAELIGLPDPDIAQLVKWGYAATQLLEGLVENDQLV
AAGVALMELSGYIFEQFDRAAADPRDNLLGELATACASGELDTLTAQVMMVTLFAAGG
ESTAALLGSAVWILATRPDIQQQVRANPELLGAFIEETLRYEPPFRGHYRHVRNATTL
DGTELPADSHLLLLWGAANRDPAQFEAPGEFRLDRAGGKGHISFGKGAHFCVGAALAR
LEARIVLRLLLDRTSVIEAADVGGWLPSILVRRIERLELAVQ

>CYP145 AB000735 Nocardioides sp. 32% with B.s. 109B1
MSSVLAPESDVDLFAGEVLADPYPIYAALRSLGPVVWLPRHGFY
VVVRYAEAREVLNDHERFVSGRGVGFNQQFNDVRSGSIIASDPPRHDILRSVLNERLG
PRALKDTEVMIRSRASDLVAEMAQRRSFDAVKDFAEVFPVQVVGELIGLPEGSRGRLL
QWANGAFNAFGPSGERTAAGLEAIAEQFDYIRTVANREQLMPDSMGAAVYQAADEGII
SEDDCLPLLSAYLTAGMDTTVNALSAMLLLLSTDPDQWQELRSSPSLAPSVVNEVLRI
EAPAQLFSRVTATRVDLAGTRIEAGERVAVIYASANRDEKKYPDPDRFDIRRNPAGHL
AFGSGLHVCAGQFLAKTELRAVLDALIEQIETMTVGEPVRKINNVLRGLSSLPATFVP
VQTSR

>CYP146 AJ223998 Amycolatopsis orientalis cosmid PCZA361 2 genes
gene 2 34% WITH B.S. Z99119 (107H)
MQTTTAVGDLGNPDLYTTLDRHARWRELAARDAMVWSEPGSSPT
GFWSVFSHRACAAVLAPSAPFTSEYGMMIGFDRDHPDKSGGQMMVVSEQEQHRKLRRL
VGPLLSRAAARKLSERVRTEVSGVLDQVLDGGVCDVATAIGPRIPAAVVCEILGVPAE
DEDMLIELTNHAFGGEDELFDGMTPRQAHTEILVYFDELITARRERPADDLVSTLVTD
DELTIDDVLLNCDNVLIGGNETTRHAITGAVHALATVPGLLTGLQDGSADVDTVVEEV
LRWTSPAMHVLRVSTDDVTINGQDLPAGTPVVAWLPAANRDPAEFDDPDTFLPGRKPN
RHITFGHGMHHCLGSALARIELSVVLRVLAERVSRVELVKEPAWLRAIVVQGYAELSA
RFTGR

>CYP147A1 AF111947.1|AF111947  Myxococcus xanthus Partial missing C-term CDS 1939..>2877
42% to AF087022 partial  new family
                     MAQASIFEQILDPANRANPYPLYAELRKTPVAREADGTYIVSTY
                     DEIVALLHDPRVSSDIRNLVRQAGATPSPQEGPPGLPEPFIRRDPPDHDRLRKLAMRP
                     FGRTPPDALMPFVPGWSRPRRACLTRSRARTKSTSSDDVAYPFPVTVICKLLGVPRED
                     EARFHELADAGVETLDPTTGTIEQRKAKRDRTKAELGQYLAALADAHLRQPGGDLLSG
                     FLTDNGPDGRMSREEVLSTAALLLVAGHETTVNLIANGMLTLLRHPGVFERLRREPEL
                     SIPLVEELLRYEPPVQFLPDRVTLADIDIAGTTIPQG

>CYP148A1 AE002083.1|AE002083  Deinococcus radiodurans R1 CDS 1719..2948
38% to AL049754 complement(10413..11648) new family
                     MTASSGSSAPSSGPLLAAVQGLWSGAALADPHPIYEQIRGFANA
                     DGLVRLPEWNTAFAVGHAATSAVLRSPAARSGEWDHGPSDGGKLLQHMMLFRNGIPHA
                     RLRGLVQKAFTPRVVEEQRDLVRSLLDELLSDMARAGGPVDLVAGLSGPLPGRVIMRM
                     LGLRGADEERFLGWSASVAELLGGADRSPALLARIEADAREMRGYFRDLADELRVSPQ
                     PGLLSALAAVEDGGERLSGDELLSNAVLLLAAGHETTSNLIPGGVLALSQQPGAWAAL
                     LNHPRHPGVADELLRHVSPVQLDGRMLTEAQTVGETPLPAGTPVQLLLAAANRDPQVF
                     PDPERLDWDRPNASRHLAFAAGPHYCLGASLARLEIAETFAALAERFPDLRVSAAPHY
                     KANFVLRGPQELWVTLG

>CYP149A1 AB036790.1|AB036790  Microcystis aeruginosa CDS complement(779..2254)gene="mapks"
41% to 107H1 partial seq new family
                     MIKQPIAIVGMGCRFPGANNPSEFWEILQNGVHKITKDPIDRPT
                     QMTGWAGFLDGIDKFDAAFFGIYSEEAIKMDPQHRLLLETSWEALEDAKLVPANLAGT
                     DTGVFIGLSGSEYPNLLIEDSTFNTTIGTLDCMLANRISSYFDFQGLSITINTACSSV
                     LVAIDSACQSLWNEDICLALVGGTHLTFSPVIASRASLNAMRPKIQAIVDDLLDRFAP
                     RGEMEIIADFATPLPAFAITKILGLPIEDYQQLIRWSAKTVFIFDQPVSLEEYKEQNQ
                     ILIEHRAYFAQKVAEYKRQPNDGLISQLANYNDNINALTEDEIISTSILLIATSQESM
                     KGLLSNGLLALLKHPQSLEYVRQNPGNIENIVEELLRYDSPIQYVSRRAIEDVEVSGK
                     IIHRGEYVVIYLGAVNHDPEYFSNPQQLDFSRRKPNLGFGGGLHYCVGMFLARLQVQI
                     ALNAMVQRFPDICLNTDKLDWCDSKISRRLKTLPVKFTPVA

>CYP150A1 Mycobacterium species AF107046 Pascal Poupin gene 1
MSDFDTIDYFTDPALVPDPHPYFDHLRAQCPVVKEPHYGVLAVT
GYDEAATVLKDNETFSSCIAVAGPFPPLPFTPEGDDITDQITAHRPQMPMFEHMVTMD
PPDHTNARSLLNRLLTPSRLKENEDFMWRLADEVLDDFVTDGRCEFLTAFAKPFSLLV
IADMLGVPEEDHDEFRAVLGAPRPGANVGSLDHSDLVGTNPLEWLDEKFIGYLEDRRR
EPRNDVLTALATAKYPDGSTPPVIEVVRSATFLFAAGQETTTKLLSASMRVLGDHPDV
QERLRRDRSRIPVFVEEALRMDAPVKSQFRLAKKNTKVGDMNVPAGTTMMVCPGAVNR
DPNRFEHPHEFDLDRKNVREHIAFGRGVHSCPGGPLARVEGRVSIERILDRMADIQID
EELHGPPGARRYTYEPTFILRGLTDINITFSPVG

>CYP150A2 Mycobacterium smegmatis AF107047 Pascal Poupin gene 2 
MTDSTATDPAATTPDFDTVDYFTDQSLVPDPHPYFDHLRSKCPV
VREPHYGVLAITSFEEATTVLKDTETFSSCIAVGGPFPPLPFTPEGDDITGQIEQHRT
QLPMFEHMVTMDPPEHTNARSLLNRLLTPKRLKENEDFMWRLADECLDDFIDDGSCEF
LKQYAKPFSLLVIADLLGVPEEDHDEFRHVLGAPRPGAIVGSLDGDQLAMNPLAWLDD
KFVRYLEDRRKEPRDDVLTALATAKYPDGSTPEVIDVVRSATFLFAAGQETTTKLLSA
SLRVLGDRPDIQQALREDRSRIPTFVEEALRMDAPVKSQFRLAKKTTQLGGVDVPAGT
TLMVCPGAVNRDPVRFEDPHTFSLDRKNVREHIAFGRGVHSCPGGPLARVEGRVSLER
ILDRMADIRIDEEHHGPADNRRYTYEPTYILRGLTDLHIKFEPVR

>CYP151 Mycobacterium smegmatis AF102510
             Poupin P, Ducrocq V, Hallier-Soulier S, Truffaut N
             Cloning and Characterization of the Genes Encoding a Cytochrome
             P450 (PipA) Involved in Piperidine and Pyrrolidine Utilization and
             Its Regulatory Protein (PipR) in Mycobacterium smegmatis mc2155.
             J Bacteriol 181, 3419-3426 1999
MSSTTLDSVPSFDVTDPAFSITSDEVHEAREKSWYATTPYGLAV
LRYEQVNRLIKHPKLRQGSAAWPAHNGVTEGPFAEWFASWILNKEGEEHHRLRRLMNP
AFSPKLIGSLVPRFQALANELIDNFAEPDRCEFVSEFAEPYAARVIAIMLGLPEEEWK
VISTESATIGLALGVTLREDLPKIEAAVQRLYEYSDELIADRRANPRDDFMTTLVNAS
RPDDGRLSDKELRDAILLLIFGGFDTTRNQLGLAMQTFMKHPDQWRLLGERPDLGGKA
VEEVMRVNPTVRWVTREVVEDFEYEGVTLKAGTTVHLYSESAGTDPRVFEPGFDITAE
RKPHFGFGGGVHHCLGHFVARSDMSEALPLLARRLRDPHELPGATWLPDSGNTGPNTL
PIGFTPAP

>CYP152A1 Bacillus subtilis
            GenEMBL AB006424
            ybdT gene
            this sequence is missing part of the heme signature sequence, but has 
            PERF and EXXR
MNEQIPHDKSLDNSLTLLKEGYLFIKNRTERYNSDLFQARLLGK
NFICMTGAEAAKVFYDTDRFQRQNALPKRVQKSLFGVNAIQGMDGSAHIHRKMLFLSL
MTPPHQKRLAELMTEEWKAAVTRWEKADEVVLFEEAKEILCRVACYWAGVPLKETEVK
ERADDFIDMVDAFGAVGPRHWKGRRARPRAEEWIEVMIEDARAGLLKTTSGTALHEMA
FHTQEDGSQLDSRMAAIELINVLRPIVAISYFLVFSALALHEHPKYKEWLRSGNSRER
EMFVQEVRRYYPFGPFLGALVKKDFVWNNCEFKKGTSVLLDLYGTNHDPRLWDHPDEF
RPERFAEREENLFDMIPQGGGHAEKGHRCPGEGITIEVMKASLDFLVHQIEYDVPEQS
LHYSLARMPSLPESGFVMSGIRRKS

>CYP152B1 Sphingomonas paucimobilis
            GenEMBL AB006957
            Isamu Matsunaga
            this sequence is missing part of the heme signature sequence, but has 
            PERF and EXXR
MPKTPHTKGPDETLSLLADPYRFISRQCQRLGANAFESRFLLKK
TNCLKGAKAAEIFYDTTRFEREGAMPVAIQKTLLGQGGVQGLDGETHRHRKQMFMGLM
TPERVRALAQLFEAEWRRAVPGWTRKGEIVFYDELHEPLTRAVCAWAGVPLPDDEAGN
RAGELRALFDAAGSASPRHLWSRLARRRVDAWAKRIIEGIRAGSIGSGSGTAAYAIAW
HRDRHDDLLSPHVAAVELVNVLRPTVAIAVYITFVAHALQTCSGIRAALVQQPDYAEL
FVQEVRRFYPFFPAVVARASQDFEWEGMAFPEGRQVVLDLYGSNHDAATWADPQEFRP
ERFRAWDEDSFNFIPQGGGDHYLGHRCPGEWIVLAIMKVAAHLLVNAMRYDVPDQDLS
IDFARLPALPKSGFVMRNVHIGG

>CYP153A1 Acinetobacter calcoaceticus confidential
MAIER; T; FOERSTER, H.H.; ASPERGER, O. AND HAHN, U.: 33% to CYP111 

>CYP154A1 AL353832.1|SCE6  Streptomyces coelicolor cosmid E6 CDS 17561..18787 51% to AF145049
42% to AL158061 complement(14764..15987) 38% to 107A1, 107B1 39% to AF087022
David Lamb's seq     MATQQPALVLDPTGADHHTEHRTLREGGPATWVDVLGVQAWSVS
                     DPVLLKQLLTSSDVSKDARAHWPAFGEVVGTWPLALWVAVENMFTAYGPNHRKLRRLV
                     APAFSARRVDAMRPAVEAMVTGLVDRLAELPAGEPVDLRQELAYPLPIAVIGHLMGVP
                     QDRRDGFRALVDGVFDTTLDQAEAQANTARLYEVLDQLIAAKRATPGDDMTSLLIAAR
                     DDEGDGDRLSPEELRDTLLLMISAGYETTVNVIDQAVHTLLTRPDQLALVRKGEVTWA
                     DVVEETLRHEPAVKHLPLRYAVTDIALPDGRTIARGEPILASYAAANRHPDWHEDADT
                     FDATRTVKEHLAFGHGVHFCLGAPLARMEVTLALESLFGRFPDLRLADPAEELPPVPS
                     LISNGHQRLPVLLHAG

>CYP154B1 AF145049.1|AF145049  Streptomyces fradiae tylosin-biosynt. CDS 3108..4409
51% to AL353832 CDS 17561..18787 44% to AL158061 complement(14764..15987)
39% to 107C1
                     MAPDPVLVPRVGTYSMRPTERSARMETTSCPYALDPLGRDLAGE
                     AAMLRSQGPATWVELPGGVGAWAVTGHRYVKQVVADPRVSREARHWPAFTEGRITEEW
                     PLYYWVAAQNMMFSYGERHARLRRMVAGAFTVRRTEALRPRIEGLVGELLDGLAASPA
                     GEPVDLRASFAKLLPMRVICALFGVPEADRDTLCAEVDTTFNTAATPEETTASQIKVF
                     RMLAELIALKRAEPEDDLTSALIAIRDSGDRLTEDELIGTLNLMIAAGAESTVHLIGN
                     AVAALLTRNDQRDLVRSGRAGWEDVIAETMRTKNPAAYLPLRYAVEDIDLDGVPIRKG
                     DPILVSFAAPGLDPERHGDDAAEFDLLRAGRDNLGFGHGVHYCLGAPLARLEAGIALE
                     KLFERFPAMSLARPVESLEPLSSLIVNGYAALPVLLGPAAS"

>CYP154C1 AL158061.1|SC6D11  Streptomyces coelicolor cosmid 6D11 CDS complement(14764..15987)
44% to AF145049 42% to AL353832 CDS 17561..18787 39% to 107C1 
                     MTTGTEEARIPLDPFVTDLDGESARLRAAGPLAAVELPGGVPVW
                     AVTHHAEAKALLTDPRLVKDINVWGAWRRGEIPADWPLIGLANPGRSMLTVDGAEHRR
                     LRTLVAQALTVRRVEHMRGRITELTDRLLDELPADGGVVDLKAAFAYPLPMYVVADLM
                     GIEEARLPRLKVLFEKFFSTQTPPEEVVATLTELASIMTDTVAAKRAAPGDDLTSALI
                     QASENGDHLTDAEIVSTLQLMVAAGHETTISLIVNAVVNLSTHPEQRALVLSGEAEWS
                     AVVEETLRFSTPTSHVLIRFAAEDVPVGDRVIPAGDALIVSYGALGRDERAHGPTADR
                     FDLTRTSGNRHISFGHGPHVCPGAALSRMEAGVALPALYARFPHLDLAVPAAELRNKP
                     VVTQNDLFELPVRLA"
>CYP155A1 AL158061.1|SC6D11  Streptomyces coelicolor cosmid 6D11 CDS complement(40542..>41807)
32% to AF127374 new family
                     DPGDHVVEPGGRRGRTAGVGGGHVVQDGRVSARKADRGRAGPAC
                     PVDRAADGTWRVHDFAVARALLRGPGTVQAGLGIETVEKLPPRVRRPVLYRDGPEHRE
                     HRRQTARYFTPRRVDEHYREPMVRIAEEQLAVLRSAGEAPLSDLAFGLAVGVVSEVVG
                     LRYSRPGIRRRLERFFPEEFGEPGLTSVRGLYWLVRQNTNWLRIHLADVRPAVRAHRR
                     REHDDLISHLIAEGCSDVEILGECLTFAAAGMVTTREFVCLAAWHLFSDAELLGHYRS
                     ADETGRLAVLQELLRLEPVIGSLRRRATGPVELSCRDGPVTVRPGEYVEVHLDDANAD
                     PKAVGEEPLLVRPERAGAVGAGLSFGDGPHRCPGAHIALLETDVFLSRLFALDGVRMS
                     GGPRVAFQEAIDGYEIRDLTVALPRAGRG"
>CYP156A1 AL353832.1|SCE6  Streptomyces coelicolor cosmid E6 gene 16317..17549
34% to AL158061 complement(15984..17225)
                     MTLPSTETAPTGEPGRIALYAPEFAADPHAAYRSMRRTHGPLVP
                     VDLAPGVPATLVIGYYQARRILNDPLRFPADPRAWEKLIPATCPVRPMMEWRPNALRS
                     GGAEHTRYRSANTHAIDQVDQHGLRALVEQVASDAIEGFRTAGSADLLTQYSFPIAFR
                     VLSALLGCPDEIGQRIADGMAKIFDTTNADQGNLILAQAVSDLVTLRRTHPGDDITSR
                     LALHPVRLTDEEMSHQLVTLYGAGIEPMTNLISNTILKILTDEEFSADLHAGLSTVRD
                     ALDAVLYTDPPMANYCISYPPYPVDVEGVLLPADQPVVISMAAANNDPALTEGVPAGQ
                     HGGNRAHLAWSTGPHTCPARSHAYLIAETAVTHLLDALPETDLARPAAELVWRPGPFH
                     RALESLPVTFPAAQSAAH
>CYP157A1 AL158061.1|SC6D11  Streptomyces coelicolor cosmid 6D11 CDS complement(15984..17225)
51% to AL132991 complement(7477..8739) 40% to AL132648
                     MSTDAHDVPGAVPLGGPRFQTDPALLYRQMRREHGAVTPVVLDG
                     DVPAWLVLGYRELHQVTGDPVLFSRDSDLWNQWENIPDDWPLLPMIGRRQPSILYTVG
                     ERHRERAAMISDALEAVDPHLLRGHAERFADELVDRLCAKGEADLVGDYAMLLPVRVL
                     ARLYGFPDEQGPALVTALNDMIDGRERALAGQTHLGTSMARLLADRKAAPADDVASRM
                     LADESGFTEEEVAQDLMVMMAAGHQPTADWIGNSLRLMLTDDRFAASLFGGRNSVAEA
                     MNEVLWEDTPTQNVAGRWAARDTQLGGRRIRAGDLVLLGLQGANSDPQVRTDGSALTG
                     GNNAHFSFGHGEHRCPFPAQEVAEVIARTGIEVVLDRLPDIDLAVPAGSLTRRPSPWL
                     RGLTELPVRFTPTTALGGTSA"
>CYP157B1 AL132991.1|SCF55  Streptomyces coelicolor cosmid F55 CDS complement(7477..8739)
51% to AL158061 (15984..17225) new family
                     MTDIDPSPHPVAAPGCPVHPDAVPLAGLEYQQTPSELYRGLRAE
                     HGAVAPVLLDGGIPAWLVLGYPEVSYVTSHDELFARDSRRWNQWGSIPPDWPLLPYVG
                     HQPSVLFTEGEEHRRRAGVITQALAGIDQFELARDCRHLADRLIAAFAGSGRAELMSG
                     YAHPLPMRAAVRMCGMPHTGVETRQLVEDLRISLDAAEGDDPVAAYTRVGERIHQLVR
                     HKRERPGPDVTSRMLTHPAGLTDEEIVQDLISVIAAAQQPTANWIGNTLRLLLTDERF
                     ALNVSGGRLSVGEALNEVLWLDTPTQNFIGRWAVNDTQLGGRHIRAGDCLVLGFAAAN
                     TDPQLWPEAHVGAENSAHLSFSNGEHRCPYPAPLLADVVARTAVETLLERLPDLVLAL
                     EPGELTWRPSIWMRGLTALPALFTPVVA
>CYP157C1 AL132648.1|SCI41  Streptomyces coelicolor cosmid I41 CDS complement(9396..10892)
40% to AL158061 (15984..17225) 39% to AL132991 complement(7477..8739) new family
                     MTPESHSPTGTGEPLLEPPPGCPAHGLGPGGLHRLHEAEDLEEL
                     YEKLREQHGPVAPALLHDDVPMWVVLGHAENLHMVSTPSQFCRDSRIWTPLNEGMVKP
                     DHPLMPHIAWQPICSHAEGDEHKRLRGAVTSAMSDLDYRELRRHIKRYTQRVVNRFCE
                     EGRADLVSQFAEHLPMGVMCHLLGMPEEYNDRLVEAARDTLKGTETAIASHAYVMEAL
                     GRLTATRRADPADDIAGRLVTHPAGLTDDEVREHLRVVLLAAYEATVNLIGNVMRVVL
                     TDPGFRAQLSGGQMTVPQAVEQSLWDEPPFSTVFAYFAKQETELGGQRIRAGDGLLLG
                     IAPGNVDPRIRPDLDASMMGNRAHLAFGGGPHECPGQDIGRAIADAGIDALLMRLPDL
                     QLDCDEDDLRWRSSIASRHLVELPVRFEPRAQQDIMQQPSHAPTPERHAPWHVGLPKP
                     ERRAQPPLPAQPPQPVSVTAAEPQQAPGAGQPRPRGAWQRFLLWWRGY

>CYP158A1 AL353864.1|SC8F11  Streptomyces coelicolor cosmid 8F11 CDS complement(25687..26910)
St5A5.00008, cosmid=St5A5; Contig ID=00008; CDS 11366-12589 Sanger cosmid
40% to AF254925, 107E1, 107F1 34% to 107A1 probably a new family
                     MTQETTTLTGQSPPPVRDWPALDLDGPEFDPVLAELMREGPLTR
                     VRLPHGEGWAWLATRYDDVKAITNDPRFGRAEVTQRQITRLAPHFKPRPGSLAFADQP
                     DHNRLRRAVAGAFTVGATKRLRPRAQEILDGLVDGILAEGPPADLVERVLEPFPIAVV
                     SEVMGVPAADRERVHSWTRQIISTSGGAEAAERAKRGLYGWITETVRARAGSEGGDVY
                     SMLGAAVGRGEVGETEAVGLAGPLQIGGEAVTHNVGQMLYLLLTRRELMARMRERPGA
                     RGTALDELLRWISHRTSVGLARIALEDVEVHGTRIAAGEPVYVSYLAANRDPDVFPDP
                     DRIDLDRDPNPHLAYGNGHHFCTGAVLARMQTELLVDTLLERLPGLRLAVPAEQVAWR
                     RKTMIRGPRTLPCTW

>CYP158A2 2StG58 [Full Sequence] Sanger cosmid S. coelicolor 31% to CYP125
CDS 5270-6484 61% to 158A1

MTEETISQAVPPVRDWPAVDLPGSDFDPVLTELMREGPVTRISLPNGEGWAWLVTRHDDV
RLVTNDPRFGREAVMDRQVTRLAPHFIPARGAVGFLDPPDHTRLRRSVAAAFTARGVERV
RERSRGMLDELVDAMLRAGPPADLTEAVLSPFPIAVICELMGVPATDRHSMHTWTQLILS
SSHGAEVSERAKNEMNAYFSDLIGLRSDSAGEDVTSLLGAAVGRDEITLSEAVGLAVLLQ
IGGEAVTNNSGQMFHLLLSRPELAERLRSEPEIRPRAIDELLRWIPHRNAVGLSRIALED
VEIKGVRIRAGDAVYVSYLAANRDPEVFPDPDRIDFERSPNPHVSFGFGPHYCPGGMLAR
LESELLVDAVLDRVPGLKLAVAPEDVPFKKGALIRGPEALPVTW*

>CYP159A1 AL132991.1|SCF55  Streptomyces coelicolor cosmid F55 CDS 6235..7458
41% to 107K1 41% to 134 new family
                     MSTAQQVPDILSPEFAANPYPAYRTMRDSAPLIRHEATQSWIVS
                     RYEDVERVFKDRAGQFTTENYDWQIEPVHGRTILQLSGREHAVRRALVAPAFRGADLQ
                     ERFLPVIERNSRELIDAFRHTGRADLVADYATRFPVNVIADMLGLDKADHDRFHGWYT
                     SVIAFLGNLSGDQEVAAAGARTRTEFAEYMIPVIRERRENPGDDLLSTLCAAEVDGVR
                     MSDEDIKAFCSLLLAAGGETTDKAIAGIFANLLAHPEQLAAVREDRSLIPRAFAETLR
                     YTPPVHMIMRQTATDVTLSGGTIPAGATVTCLIGAANRDETRYRDPDRFDIMRDDLTT
                     TTAFSAAADHLAFALGRHFCVGALLAKAEVEIGVGQLLDALPGLRTEDGFEVVERGVF
                     TRGPQSLPVRFTPAA
>CYP160A1 AF127374.1|AF127374  Streptomyces lavendulae LinA homolog.CDS complement(43595.44782)
                     gene="mmcN" 39% to D87924 new family
                     MTSAAPPAFPFPPGPGGTVPPEYARLLTDDPVAEVRLADGSRIW
                     LVTRHEDVRTVLTDGRFSRHRAAMLPGSGFGRSQGSGIVDLDPPEHGRLRGPVVAAFG
                     ASRTARFAPRIEAAAEAALDRLPAGSGTVDLVAAYTAPFAGRVTAEFLGLPGDRWQDV
                     TSDVELLLLPRGATEQALKEARGRLGQVLDELLAARRAEPGDSVTDTLLDAEELTDDD
                     RRLLLHGLIISGFITIRDLLARHLFGVLSSPGLAARLREDPSVLPSAVQELLRYYPSS
                     NDGLLRVATEDVVLSGRRVAAGDAVLPLVSAASRDPEVFADPHVLDIERVADRGIAFG
                     AGQHACPATGLAVTELTVGIGRLLAAFPRIALAVPPEEVEHSSELLPLGVRSLPVVPG
                     PRN"
>CYP161A1 AF263912.1|AF263912  Streptomyces noursei ATCC 11455 nyst.CDS 57095.58279 gene="nysL"
                     /function="presumably involved in modification of the
                     nystatin macrolactone ring" 36% to AF127374 = new family
                     MSTPTAPPSLKAEVPPVLRLSPLLRELQSRAPVCKVRTPAGDEG
                     WLVTRHTELKQLLHDDRLARAHADPANAPRYVHNPFLDLLVVDDFDLARTLHAEMRSL
                     FTPQFSARRVMDLTPRVEALAEGVLAHFVAQGPPADLHNDFSLPFSLSVLCALIGVPA
                     EEQGKLIAALTKLGELDDPARVQEGQDELFGLLSGLARRKRITPEDDVISRLCLKVPS
                     DERIGPIASGLLFAGLDSVASHIDLGTVLFIQHPDQLAAALADEKLMRGAVEEILRSA
                     KAGGSVLPRYATADVPIGDVTIRAGDLVLLDFTLVNFDRTVFDEPELFDIRRAPNPHL
                     TFGHGMWHCIGAPLARVNLRTAYTLLFTRLPGLRLVRPVEELRVLSGQLSAGLTELPV
                     TW"
>CYP162A1 AJ250199.1|STE250199  Streptomyces tendae nikkomycin CDS 22..1212 gene="nikQ"
38% to AF170880 new family
                     MRVDLSDPLLYRDSDPEPVWSRLRAEHPVYRNERANGEHFWAVM
                     THGLCTDMLTDPRVFSSQNGMRLDSDPQVLAAAAGKMLNITDPPRHDKIRKVVSSAFT
                     PRMVSRLEATMRETAAKAIDEALAAGECEFTRVAQKLPVSVICDMLGVAPADWDFMVE
                     RTRFAWSSTALDEAEEARKVRAHTEILLHFQDLAAERRREPKDDLMSALVCGEIDGAP
                     LTDQEILYNCDALVSGGNETTRHATVGGLLALIDNPDQWHRLRDEPALMPSAIQEIVR
                     YTSPVMHALRTATEDVEFGGERISAGDHVVAWLPSANRDEKVFDDPDRFDIEREPNRH
                     LGFIQGNHYCIGSSLAKLELTVMFEELLARVEVAELAGQVRRLRSNLLWGFDSLPVKF
                     VPRA"
>CYP163A1 AF170880.1|AF170880  Streptomyces spheroides novobiocin CDS 9688..10911 gene="novI"
38% to AJ250199 new family
                     MSTRPTVSPSELEQIDLASPVLHAEYELDEIFRHLRADEPVYWQ
                     QPRNEQPGFWVISRHADVNEVYKDKEHFTTEHGNALATLLTGGDSASGAMLAVTDGVR
                     HHQVRNVLSRGFSARMLDLIAHTLQETVDGLLLAALERGECDAAQDIAADVPLGAICD
                     LLEIPHADRKYLLGLTSHAWSTDYADEPPEESWVAKNEILLYFSKLLKERRGGVREDM
                     VSLLANCRIDGDPLKAAEQMANCYGLMIGGDETGRHAITGTILALIQNPDQWRALKNG
                     DVDLNTATEEALRWTVPSLHGGRKATGDVVINGRRINAGDVVSVWISSANRDETVFDA
                     PDEFNLARTPNKHFTFAYGSHYCLGHYLGRMEVYAVLDGLRRLVGDLEQIGEERWIYS
                     SILHGMSSLPIRITG"
>CYP164A1 AL007924
.1|MLCB1788  Mycobacterium leprae cosmid B1788 CDS complement(38296..>39228)
40% to AL049754 partial probably a new family
                     TRLRKLVSKAFAPKVVQALEGDIAALVDSLLDKGAAAGQFDVIA
                     DLAFPLAVAVICRLLGVPYEDAPEFGRVSALLVQSVDPFITITGEPPEATEERLRAGV
                     WLRDYLEQLVKCRRGTPGEDLISRLIELDESGDQLTEEEIIATCGLLLVAGHETTVNL
                     IANAVLAMLRNPSQWKALSSNPQRAPLVVEETLRYDPAIHLIGRVAAKDMTIGQTTLT
                     EGDTMVLLLAAANRDPAVYSRPDEFDPDRPSSRHLAFAVGSHFCLGAALARLEATVTL
                     SAISARFPQVQLAGELVYKPNVAMRGMSALPVQV
>CYP165A1 Y16952.1|AMOXYAE  Amycolatopsis mediterranei 9.9kB DNA CDS 224..1399 gene="oxyA"
85% to AJ223999 CDS 31325..32500 42% to Y16952 CDS 1449..2645 
41% to AJ223999 32520..33740
                     MFEESNALRGTEIHRRDRFAPGPELRSLMGEGTMSILQPPDSPG
                     GRTGWLATGHDEVRQVLGSDKFSAKLLYGGTVAGRIWPGFLNQYDPPEHTRLRRMVTS
                     AFTVRRMQDFRPRIEQIVQASLDAIEAAGGPVDFVPRFAWSVATTVTCDFLGIPRDDQ
                     ADLSRALHASRSERSGKRRVAAGNKYWTYMTEIAARARRDPGDDMFGAVVRDHGDAIT
                     DAELLGVAAFVMGAGGDQVARFLAAGAWLMVEHPDQFALLREKPDTVPDWLNEVERYL
                     TSDEKTTPRIAQEDVRIGDQLVKAGDAVTCSLLAANRRKFPAPEDEFDITRERPVHVT
                     FGHGIHHCLGRPLAEMVFRAAIPALAQRFPKLRLAEPDREIKLGPPPFDVEALLLEW"
>CYP165A2 AJ223999.1|AOPCZA363  Amycolatopsis orientalis CDS 31325..32500
85% to Y16952 oxyA new family
                     MFAENNAVRGTEIHRREQFDPGPELRSLMAEGPMSILEADDPAE
                     GRTGWLATGYDEIRQVLGSDKFSAKLLYGGTVAGRIWPGFLNQYDPPEHTRLRRMLTS
                     AFTVRRMQGFRPRIELIVEATLDDIEATGGPVDFVPRFAWPIATTVTCDFIGIPRDDQ
                     ADLSRALLASRSERTGKRRVAAGNKFWTYMSQVAAQARRDPGDNMFGAVVREHGDAIT
                     DAELLGVAAFIIGAAGDQVARFLAAGAWLIAEHPEQFAVLRDKPDTIPDWLNEVARYL
                     TSDEKTTPRIALEDVYIGDQLVKAGDAVTCSLLAANRRNFPAPEDQFDITRERPAHVT
                     FGHGIHHCLGRPLAEMVFRTAITALTRRFPTLRLAEPGREIKLGPPPFDVEVLLLDW"
>CYP165B1 Y16952.1|AMOXYAE  Amycolatopsis mediterranei 9.9kB DNA CDS 1449..2645 gene="oxyB"
87% to AJ223999 32520..33740 47% to Y16952 CDS 2795..4015 47% to AJ223998 gene 1
53% to U84350 partial = new family
                     MNDDDPRPLHIRRQGLDPADELLAAGSLTRVTIGSGADAETHWM
                     ATAHALVRQVMGDHQRFSTRRRWDPRDEIGGTGTFRPRELVGNLMDYDPPEHTRLRQK
                     LTPGFTLRKMQRLQPYIEQIVNERLDEMARAGSPADLVAFVADKVPGAVLCELIGVPR
                     DDRATFMQLCHAHLDASRSQKRRAAAGEAFSRYLLAMIARERKDPGEGLIGAVVAEYG
                     DEATDEELRGFCVQVMLAGDDNISGMIGLGVLALLRHPEQIDALRGGEQPAQRAVDEL
                     IRYLTVPYGPTPRIAKQDVTVGDQVIKAGESVICSLPAANRDPALVPDADRLDVTRDP
                     VPHVAFGHGIHHCLGAALARLELRTVFTALWRRFPDLRLADPAQETKFRLTTPAYGLT
                     ELMVAW"
>CYP165B2 AJ223999.1|AOPCZA363  Amycolatopsis orientalis CDS 32520..33740
87% to Y16952 oxyB new family
                     MVAQELSQSGDDDPRPLHIRRQDLDPADELLAAGALTRVTVGSG
                     ADAETSWMATTHGAVRQVMGDHKSFSTRRRWHQRDEIGGTGIFRPRELVGNLMDYDPP
                     EHTRLRQKLTPGFTLRKMQRMQPYIEQIVADRLDAMEQAGSPADLIEFVADEVPGAVL
                     CELIGVPRDDRAMFMQLCHGHLDASRSQKRRAAAGEAFSRYLLAMIARERKDPGEGLI
                     GAVIAEYGDEATDEELRGFCVQVMLAGDDNISGMIGLGVLALLRHPEQIAAFQGDEQS
                     AQRAVDELIRYLTVPYAPTPRIAMQDVIVASQMIKKGESVICSLPAANRDPALVPDPN
                     RLDVTREPVPHVAFGHGVHHCLGAALSRLELRTVYTALWQRFPTLRLADPAKETNFRL
                     TTPAYGVTSLLVAW
>CYP165C1 Y16952.1|AMOXYAE  Amycolatopsis mediterranei 9.9kB DNA CDS 2795..4015 gene="oxyC"
90% to AJ223998 gene 1 89% to U84350 partial 47% to AJ223999 32520..33740
47% to Y16952 CDS 1449..2645 40% to AJ223999 CDS 31325..32500
                     MGHDIGQLAPLLPEPANFQLRTNCDPHADNFDLRAHGPLVRIAG
                     DSSAQLGREYVWQAHGYDVVRRILGDHENFTTRPQFTQAKSGAHVEAQFVGQISTYDP
                     PEHTRLRKMLTPEFTVRRIRRMEPAIQALVDDRLDRVAAEGPPADLQALFADPVGALA
                     LCELLGIPRDDQREFVRRIRRNTDLSRGLKARAADSAAFNRYLDNLIARQRRDADDGF
                     LGMIVREHGDTVTDEELKGLCTALILGGVETVAGMIGFGVLALLENPGQVPLLFAGPE
                     QADRVVNELLRYLSPVQAPNPSLAVKDVIIDGQLIKAGDYVLCSVLMANRDEALTPNP
                     NVFDANRAAVSDVGFGHGIHYCVGAALARSMLRMAYQALWQRFPGLRLAVPIAEVKYR
                     SAFVDCPDRVPVTW
>CYP165C2 U84350.1|AOU84350  Amycolatopsis orientalis hypothetical CDS  <1..935
92% to AJ223998 gene 1 new family
                     ISTYDPPEHTRLRKMLTPEFTVRRIRRMEPAIQSLVDDRLDMLE
                     AEGSPADLQGLFADPVGAHALCELLGIPRDDQREFVRRIRRNADLSRGLKARAADSAA
                     FNRYLDNLIARQRADPDDGLLGTIVREHGGNVTDEELRGLCTALILGGVETVAGMIGF
                     GVLALLQHPGQIPLLFEGPEKADRVVNELVRYLSPVQAPNPRLAIKDVVVDGQLIKAG
                     DYVLCSVLMANRDEALTPDPNVFDANRTAVSDVGFGHGIHYCVGAALARSMLRTAYQT
                     LWRRFPGLRLAVPVEEVKYRSAFVDCPDQVPVTW
>CYP165C3 AJ223998 Amycolatopsis orientalis cosmid PCZA361 2 genes
gene 1 N-TERM IS FROM END OF AJ223999 gene 1
90% to Y16952 CDS 2795..4015
MAHGIDQHGIDQHGIDQHGIDQHGIDQHGIDQHGIDQHSIDQHG
IDQHGMEQVAPLLQEPANFQMRTGCDPHEENFDLRAHGPLVRLVGDSSTQLGRDYVWQ
AHGYDVVRKILGDHENFTTRPQFTHAKSDAHVEAQFVGQISTYDPPEHTRLRKMLT
PEFTVRRIRRMEPAIQGLIDDRLDMVEAEGPPADLQGLFADPVGALALCELLGIPRDD
QREFVRRIRRNTDLSRGLKARAADSAAFNRYLDNLISRQRKDPDEGFLGMIVREHGDN
VTDEELKGLCTALILGGVETVAGMIGFGVLALLENPDQIQLLFAGPEKADRVVNELVR
YLSPVQAPNPRLAIKDVVIDGQLIKAGDYVLCSVLMANRDEALTPNPNVLDANRAAVS
DVGFGHGIHYCVGAALARSMLRMAYQTLWQRFPGLRLAVPIAEVKYRSAFVDCPDQVP
VTW
>CYP166A1 AF040570.1|AF040570  Amycolatopsis mediterranei rifamycin.CDS 2652..3842
similar to Streptomyces Sp. ChoP" identical to AJ223012
probably a new family 41% to 105C1 but less to other 105s
                     MTDAISFEVPWDRTDKFDPPAVFDSLREERPLAKMVYPDGHVGW
                     IVSSYELVREVLSDLRFSHSCEVGHFPVTHQGQVIPTHPLIPGMFIHMDPPEHTRYRK
                     LLTGEFTVRRASRLIPRAEAVAAEQIEVMRAKGAPADVVMDFAKPLVLRMLGELVGLP
                     YEERDRYVPAVTLLHDAEADPAEAAAAYEVAGKFFDEVIERRRQRPQDDLISSLVTED
                     LTQEELRNIVTLLLFAGYETTEGALATGVFALLHHTDQLAALRAEPEKLDAAIEELLR
                     YLTVNQYHTYRTALEDVKLEGELIKKGDTVTVSLPAANRDPAKFGCPAELDIERDTSG
                     HVAFGFGIHQCLGQNLARIELRAGFTALLRAFPELRLAVPADEVPLRLKGSVFSVKKL
                     PVSW"
>CYP167A1 AF210843 Sorangium cellulosum strain CDS 62369..63628 gene="epoF"
35% to 107B1 new family
                     MTQEQANQSETKPAFDFKPFAPGYAEDPFPAIERLREATPIFYW
                     DEGRSWVLTRYHDVSAVFRDERFAVSREEWESSAEYSSAIPELSDMKKYGLFGLPPED
                     HARVRKLVNPSFTSRAIDLLRAEIQRTVDQLLDARSGQEEFDVVRDYAEGIPMRAISA
                     LLKVPAECDEKFRRFGSATARALGVGLVPQVDEETKTLVASVTEGLALLHDVLDERRR
                     NPLENDVLTMLLQAEADGSRLSTKELVALVGAIIAAGTDTTIYLIAFAVLNLLRSPEA
                     LELVKAEPGLMRNALDEVLRFDNILRIGTVRFARQDLEYCGASIKKGEMVFLLIPSAL
                     RDGTVFSRPDVFDVRRDTGASLAYGRGPHVCPGVSLARLEAEIAVGTIFRRFPEMKLK
                     ETPVFGYHPAFRNIESLNVILKPSKAG
>CYP167A1 AF217189.1|AF217189  Sorangium cellulosum Same gene as AF210843 CDS 56757..58016
gene="epoK"

>CYP168A1 Pseudomonas aeruginosa ORF_3218 2792751-2794082 35% to 107P1
from the Pseudomonas genome project
MDDAFSEEGSAQPRHDAQRPALAPRSDGFDIHTYHPDFVADPYPLLRLIR
SRAPVCRDQASIWWISRYADVSACLRDRRFSADPARLGAAGVRQGGASW
FGHQQLQPLARFYDNFMLFNDAPRHTRLRRLFAPAFGPDAVRRWEARIE
VLVEELLDSLLERREPDLLRDFAEPLTIRVAAELFGFPREDTGQLLPWG
RDLAAGLDLAASHGDAGQINRSAVAFSDYLQRQARGWSDGSSRPPSGAA
PSILDGAAMLEAGLGLEDLVAAYAMVFMAAFETTISMVGNATLALLTHP
DQLDLLRRCPELAANAVEELLRFDGAVRGGVRCTLEEVEIGGQRIPPGE
KVWLSFLAANRDPEMFAAPDRLQLQRANAKQHVAFAHGPHYCLGAYLAR
LELQCALRGLVRRRFALASEPTDLRWRRSSVFRTLERLPIVPEGDAQKT
CE*

>CYP169A1 Pseudomonas aeruginosa ORF_4783 4121066-4122340
from the Pseudomonas genome project
low 30% range for C-term half new family
MQQTIDCPIRRRLAHLPWANDGRAGVRHWLEMQRDPLAWLQKMHVAQPDL
AVARMGPQRLWCLFHPQAVQELMVDRRDDLQRWQPALCMLKQWNGRSFM
MREGAPAQARRKEVRPHLAPPPASEVRRLAAEWGERVEEGREYDLDLEM
AAFSVTLSGHALFDVDLQPSAYRIAKAVRLLSRVALLEMSTGLPLGHWF
PSKLCPRKRWALGQLREAVGEVAERSPRPLADLRDELCTLLMASHQSTG
VTLTWSLLLLAQRPELLARLRAELAGVNWTAIRSVADLRDCALLRAVLQ
ECLRLYPPAYGLAPRQVTADIEVFGQRLKRGDVTMVSSWITQRDPRWFE
APLEFRPERFLEPARWPRGAYFPFGLGDRACPGTAMAMIDLAAALAYWV
EHWDIMHDGDLAPRGWFSLRPQRARVRFRRRA*

>CYP170A1  Streptomyces coelicolor cosmid 7E4 gene="SC7E4.20
           GenEMBL AL359214 CDS 18278..19663
           32% to Streptomyces avermitilis CYP171A1
                     MTVESVNPETRAPAAPGAPELREPPVAGGGVPLLGHGWRLARDP
                     LAFMSQLRDHGDVVRIKLGPKTVYAVTNPELTGALALNPDYHIAGPLWESLEGLLGKE
                     GVATANGPLHRRQRRTIQPAFRLDAIPAYGPIMEEEAHALTERWQPGKTVDATSESFR
                     VAVRVAARCLLRGQYMDERAERLCVALATVFRGMYRRMVVPLGPLYRLPLPANRRFND
                     ALADLHLLVDEIIAERRASGQKPDDLLTALLEAKDDNGDPIGEQEIHDQVVAILTPGS
                     ETIASTIMWLLQALADHPEHADRIRDEVEAVTGGRPVAFEDVRKLRHTGNVIVEAMRL
                     RPAVWVLTRRAVAESELGGYRIPAGADIIYSPYAIQRDPKSYDDNLEFDPDRWLPERA
                     ANVPKYAMKPFSAGKRKCPSDHFSMAQLTLITAALATKYRFEQVAGSNDAVRVGITLR
                     PHDLLVRPVAR

>CYP171A1  Streptomyces avermitilis polyketide synthase gene cluster 
           GenEMBL AB032367 CDS complement(31914..33284)
           gene="aveE"
           note="probably catalyzes furan ring formation at C6 to C8
           32% to CYP170A1
                     MMSQSTSSIPEAPGAWPVVGHVPPLMRQPLEFLRSAADHGDLLK
                     LRLGPKTAYLATHPDLVRTMLVSSGSGDFTRSKGAQGASRFIGPILVAVSGETHRRQR
                     RRMQPGFHRQRLESYVATMAAAAQETADSWSAGQVVDVEQAACDLSLAMITKTLFFSD
                     LGAKAEAALRKTGHDILKVARLSALAPTLYEVLPTAGKRSVGRTSATIREAITAYRAD
                     GRDHGDLLSTMLRATDAEGASMTDQEVHDEVMGIAVAGIGGPAAITAWIFHELGQNAE
                     IESRLHAELDTVLGGRLPTHEDLPRLPYTQNLVKEALRKYPGWVGSRRTVRPVRLGGH
                     DLPADVEVMYSAYAIQRDPRWYPEPERLDPGRWETKGSSRGVPKGAWVPFALGTYKCI
                     GDNFALLETAVTVAVVASHWRLHALPGDEVRPKTKATHVFPNRLRMIAEPRSVVRLEE
                     PAAMGA

>CYP172A1 Campylobacter jejuni AL139078 only 28% to 102A3 
MSECPFFPKPYKNKASTLLTFLLKRRSWLDGLYERSYKMQTGYV
KMPNFDLYVINDTKEVKRMMVDEVREFPKSAFLHELLSPLLGESIFTTNGEVWKKQRE
LLRPSFEMTRINKVFNLMSEAVADMMDRFSKYPNHAVIEVDEAMTFITADVIFRTIMS
SKLDEEKGKKILNAFVTFQEQSVHTAMRRMFRFPKWLSYVLGDCKRAKAGDVIRQVLS
DIIKPRYDMADNAEFEDILGSLLLVVDADTNKRFSFEEILDQVAMLFLAGHETTASSL
TWTLYLLSLYPKEQEKAYEEITQVLQGGVIEISHLRQFKYLTNIFKESLRLYPPVGFF
AREAKKDTQVRDKLIKKGSGVVIAPWLIHRHEEFWTNPHGFNPSRFEGEYKKDAYLPF
GVGERICIGQGFAMQEAILILANILKTYKLELEEGFVPDVVGRLTVRSANGMRIKFSK
RKL

>CYP173A1 Mesorhizobium loti AP003005.1  327049-328782 only 30% to 172A1 
MVRLVQHRQVERGDVGQHRLELPVLTRERIQPLGKNRTGAAGPRAADDDVQLVLQGGLPC
QAVSLCDCHYGRASRRTRRDTQRKGHDRMNGASAFAPRIACLAVTWTPGLPATTLMRAAE
HFMDTQPAPFVPPAPKPRTSPPSTLEMIRIVYRNPLELWGEPTYNEPWISANGVGGHLIV
ANDPGLIRHVLVDNAKNYKMATVRQKILRPILRDGLLTAEGEVWKRSRKAMAPVFTPRHI
FGFAQPMLKRTKEFVTRYEEGGASDIAHDMTLLTYDILAETLFSGEIAGEPGSFANEIDR
LFETMGRVDPLDLLRAPDWLPRLTRIRGRKTMAYFRKIVTDTVKMREEKFRRDPDAVPQD
FLTLLLKAEGPDGLTRSEVEDNIITFIGAGHETTARALGWTLYCLAESPWERNRVEQEID
EVLAREPDPTKWLDAMPLTRAAFDEALRLYPPAPSINREPIEPEMWKDLYIPRHAAVLVM
PWVVHRHRKLWDRPDAFLPERFHPGNREKIDRFQYLPFGAGPRVCIGASFAMQEAIIALA
ILLSRFRFDTTAETKPWPVQKLTTQPQGGLPMQVTPR*

>CYP174A1 Halobacterium sp. NRC-1 AE004998 comp(560-1777) only 33% to 171A1 
MGPMETYVVTEPALVERLLVSDAAEFRKPEFQADAIDDLLGDGL
LLSEGESWREQRGRANPAFSMARVAGFDADIAAHAADRVDDWPVGDTVDVEAAMTHIT
LDVILDVMLGVSLPEARVDAIGDALEPVGARFEPDPVRFAVPEWLPMPDDREYAAAVA
TLDDLVDDIVAAREGTASGGDGDDPMDLLSVLLRARDRGEQSLDRLRDEVMTTLLAGH
DTTALTLTYTWFLLSEHPDVEARLHAELDGALDDGAQPTVAQLQDLDYLEWVLQESMR
LYPPVYNVFRTPIEPVELAGSEVPAGAPIMLPQWAIHRSPDHWDDPEAFDPERWRPER
RADRPRFAYFPFGGGPRHCIGKQLALLEAKLIVATVASDYRLRYEGDTPLSFVPSLTI
HPEQEMRMRVEPR

>L76374 Mycobacterium avium paratuberculosis
39% identical to 107B1
483 LIFTDPPRHRQLRKLINSGFXXRRVSVLEPKIRKIVXXILDGIEXGAVHEFTEQITAPLP 304
303 TRMIAELIGAPPDDWEQFRAWSDAATGTADPEIELDPAVAAGQLYEYFQRLIAARRARPR 124
123 ADLLSVLAEAEIDEHRLTDEDLLNFAFLLLVAGNETTRNLI 1

>AF071144  Streptomyces glaucescens cytochrome P450
57% to AF071148 56% to AF071146 59% to 105D3 54% to 105A3 
LLIAGHETTTSMIALSTLLLLDRPELPAELRNDPDLMPAAVDEL
LRVLSVADSIPLRVAAEDIELSGRTVPADDGVIALLAGANHDPEQFDDPERVDFHRTD
NHHVAFGYGMHQCLGQNL

>AF071146  Micromonospora inyoensis cytochrome P450
99% to AF071148 61% to AJ223999 CDS 32520..33740 60% to 105A3
LLIAGHETTSHMISLGVTALLEHPDQLAALQNDLTLLPEAVEEL
LRYLSIADYVPSRVALEDVVIGGTVIRAGEGVVPLLAAADWDPKVFDNPGTLDIHRGN
RRHVAFGYGVHQCLGQNL

>AF071147 Streptoalloteichus hindustanus cytochrome
61% to 105C1 59% to AF040570 CDS 2652..3842
LLIAGHETTANMLALGAFALLEHPEQLAELRANPDLMPGAVEEL
MRYLSIVHIGPVRTAVADVEIEGQLIRAGESVTVSVPAANWDPAKFPEPERLDLTRRT
SGHLAFGHGVHQCLRQNL

>AF071148  Amycolata autotrophica cytochrome P450
99% to AF071146 61% to AJ223999 CDS 32520..33740
LLIAGHETTSHMISLGVTALLERPDQLAALQNDLTLLPEAVEEL
LRYLSIADYVPSRVALEDVVIGGTVIRAGEGVVPLLAAADWDPKVFDNPGTLDIHRGN
RRHVAFGYGVHQCLGQNL

>CYP?      Streptomyces noursei putative P450 hydroxylase gene, partial cds.
           GenEMBL AF071516 CDS complement(85..>519)
           function="may hydroxylate a macrolide antibiotic polyketide moiety
           C-term only 55% to 107A1
           WTTPTRWSCSAPSLICLPRHGRNTAHRRTSRSHHPGRARRHPDR
           DTLIPARSTVFIAGAAANRDPQKFPNPDTFDITRNTQGHLAFGYGVHHCIGRPLAQME
           GEVAITALLRRFPHLHLTTPSQNLTWRRSFLRGLTALPVTLN