87 contigs assembled from Ciona intestinalis genomic DNA sequence. 24 additional Ciona savignyi sequences are included, since these are used against Ciona intestinalis sequences to help assemble the genes. 793 accession numbers sorted by PROTEIN sequence from the JGI Ciona blast server. 79 P450s are assembled from the I-helix to the end of the gene. One seq (seq 91) is a pseudogene that breaks in the middle of an exon, has an extra aa in the heme signature and no upstream P450 sequence. 66 completed genes are 53 intestinalis P450s seq 2, 4, 7, 14, 15, 17, 18, 21, 23, 25, 26, 27, 34, 36, 41, 42, 46, 49, 51, 53, 57, 64, 65, 66, 96, 103, 109, 110, 115, 118, 119, 129, 125, 134, 136, 147, 148, 155, 158, 162, 164, 166, 167, 169, 180, 184, 186, 192, 198, 204, 208, 209, 228 and 13 savignyi orthologs to seq 2 (2 genes), 26, 41 (2 genes) and 110 (2 genes), 115, 134, 166, 167, 192, 204 there are gene clusters Nov. 6, 2002 D. Nelson The email for the Ciona EST blast server is chikako@develop.zool.kyoto-u.ac.jp >sequence 1, 50 The N-term is represented twice and is different from seq 2 or 4 or 27 ILTLICLLLFYTWYRRPSRFPPGPRGFPIVGVLPFLEKYSERTMHKWSKKYGPVMSVRMGNEDWVVMGNYE GCiWno533_e09.b1 - DEV31420.x1 MIELVLPDLSIAPTILTLICLLLFYTWYRRPSRFPPGPRGFPIVGVL PFLEKYSERTMHKWSKKYGPVMSVRMGNEDWVVMGNYEA >GCiWno533_e09.b1 TTCCTGTTGGGTTAAAATCTCTCATAACAAGTCCTTTGCACTCAGTTATTTCATTCGCCAATTTCATGTACGGACGGCCC GAGAATGCACTGCCTGCCTTCACAAAGCTCTAAAAGTGAGATTCAATCATTACAAGACTATATGATGTAAGACTGTAGTG TTTTATAATACTTCTTTATTCTTTAGGTATGCTTGGAGTTTATGAAATTCTTATTGTTGTTGCGTGTTATAAAACGATTG CAGTTTACACATCTAGTGTGGTGGGAGACCCTCTTAGCACATAATATCCAAATATCTTAATTGTGTTTTAAACAATTAGA GTCTTCAGAATACGGTTTTATAATTCTTTGAAATCATTTGTTTACCACCAAGTGCGTCAAGAAAAAAAATAAAACGGTGT CCCATCTCCCCCACCCTACTACATTACCTGATAAACAGCTTCGTAGTTTCCCATGACAACCCAGTCCTCATTTCCCATTC TCACCGACATCACCGGACCATATTTCTTGCTCCATTTGTGCATCGTTCGCTCTGAGTATTTTTCAAGGAACGGCAAAACT CCGACGATTGGGAAACCGCGAGGTCCAGGTGGAAATCGAGAGGGTCTTCGATACCAAGTATAAAACAATAATAAGCAAAT GAGCGTTAGTATTGTCGGNGCAATACTCAAATCGGGTAACACGAGTTCTATCATTCTGACACGTTGAGCACAGCACTAAA ACTGCTGCTTTGTATAGCGAACCTGGAACGTTATGCCCGCTTTAGTTTTTGCTGCGCGAAAACGCTTTCTCTTGCGAAGG AAATTGCGCTGTGCAACCCTACGAGCTATAAATCATGTATGGTCTTAAAACGTTGTGAAGACAATCTG >GCiWno533_e09.b1_4 this = N-term of seq 1 RLSSQRFKTIHDL*LVGLHSAISFARESVFAQQKLKRA*RSRFAIQSSSFSAVLNVSE** NSCYPI*VLXRQY*RSFAYYCFILGIEDPLDFHLDLAVSQSSEFCRSLKNTQSERCTNGA RNMVR*CR*EWEMRTGLSWETTKLFIR*CSRVGEMGHRFIFFLDALGGKQMISKNYKTVF *RL*LFKTQLRYLDIMC*EGLPPH*MCKLQSFYNTQQQ*EFHKLQAYLKNKEVL*NTTVL HHIVL**LNLTFRAL*RQAVHSRAVRT*NWRMK*LSAKDLL*EILTQQE >GCiWno533_e09.b1_5 QIVFTTF*DHT*FIARRVAQRNFLRKRKRFRAAKTKAGITFQVRYTKQQF*CCAQRVR MI ELVLPDLSIAPTILTLICLLLFYTWYRRPSRFPPGPRGFPIVGVLPFLEKYSERTMHKWS KKYGPVMSVRMGNEDWVVMGNYEA VYQVM**GGGDGTPFYFFS*RTWW*TNDFKEL*NRI LKTLIV*NTIKIFGYYVLRGSPTTLDV*TAIVL*HATTIRIS*TPSIPKE*RSIIKHYSL TSYSLVMIESHF*SFVKAGSAFSGRPYMKLANEITECKGLVMRDFNPTGX >GCiWno533_e09.b1_6 DCLHNVLRPYMIYSS*GCTAQFPSQEKAFSRSKN*SGHNVPGSLYKAAVLVLCSTCQNDR TRVTRFEYCXDNTNAHLLIIVLYLVSKTLSISTWTSRFPNRRSFAVP*KILRANDAQMEQ EIWSGDVGENGK*GLGCHGKLRSCLSGNVVGWGRWDTVLFFFLTHLVVNK*FQRIIKPYS EDSNCLKHN*DIWILCAKRVSHHTRCVNCNRFITRNNNKNFINSKHT*RIKKYYKTLQSY II*SCND*ISLLELCEGRQCILGPSVHEIGE*NN*VQRTCYERF*PNRX >GCiWno533_e09.g1_1 this seq = seq 27 NEFSSVPKSCVHV*FVP*LSCYLLLTQKLWVQTITHKVTYMVTRKLARI**CDLRHQF*K ENEKKIFFYKAVNFLQYIQLLNYIRDLFDGGTETTVSTSRWAILCMLHYPETQKKLRNEI MTIIGKRLNFYITNTYLIFLLKGPTRQRVCRISQICLTPVLLYKKYSGSGL*PH*VCPIK *MKMQRLTDTQFQKA*R*EISYIHLIVRLK*KP*ADGLIPKKLNDIFSSTL*CVVFHVYF *LGVTKPVGGAQRSRCVGRNQAVKPERHLDDKENLXSRIT*YLSRWVHVIAWENNLLERK SHLPDXMXXKVGVSSGPX >GCiWno533_e09.g1_2 TNSARYPNRVFTYNLCRSSVVTCF*PRSYGYKQLPTKLHTW*LVSWHEFNNVIFAINFKK KMKKKFFFIKL*TFCSTSSC*TTYVICSMAVPRPL*APVVGQYYVCCITRKLRKNYATK* *LLLVSV*ISI*PTHI*YSC*RAQHASEYVA*VRYALHLCFYTRSTQVPDFSPTECAP*S K*RCNG*RIHNSKRRNGKRFHTFI*SSD*NKNPEQMV*FPKN*TTFLAVHCDVSCFMSIF N*VSPNLWAVHNDPDVWDETKQLNLSVTSMTRKTXSVESRDTFLGGSTSLLGRTTCSNGN LIFLIXWXQRLEFLPDP >GCiWno533_e09.g1_3 RIQLGTQIVCSRIICAVAQLLPASNPEVMGTNNYPQSYIHGNS*AGTNLIM*SSPSILKR K*KKNFFL*SCELFAVHPAAKLHT*SVRWRYRDHCKHQSLGNTMYAALPGNSEKTTQRNN DYYW*AFKFLYNQHIFNIPVKGPNTPASMSHKSDMPYTCAFIQEVLRFRTLAPLSVPHKV NEDATVNGYTIPKGVTVRDFIHSFNRPIEIKTLSRWFNSQKIERHF*QYTVMCRVSCLFL IRCHQTCGRCTTIQMCGTKPSS*T*ASPR*QGKLXQSNHVIPFSVGPRHCLGEQLARTEI SSS*XHGXKGWSFFRT >GCiWno7_b18.b1 CHROMAT_FILE: GCiWno7_b18.b1 PHD_FILE: GCiWno7_b18.b1.phd.1 CHEM: term DYE: big TIME: Sat Sep 1 16:00:22 2001 TEMPLATE: GCiWno7_b18 DIRECTION: fwd Length = 905 Score = 132 bits (329), Expect = 1e-30 Identities = 65/86 (75%), Positives = 66/86 (76%) Frame = -3 Query: 1 MIELVLPDLSIAPTILTLICLLLFYTWYXXXXXXXXXXXXXXIVGVLPFLEKYSERTMHK 60 MIELVLPD SIA ILTL CL LFYTWY IVGV PFLEKYSERTMHK Sbjct: 810 MIELVLPDXSIARQILTLXCLYLFYTWYRRPSRFPPGPRGFPIVGVCPFLEKYSERTMHK 631 Query: 61 WSKKYGPVMSVRMGNEDWVVMGNYEA 86 WSKKYGPVMSVRMGN+DWVVMGNYEA Sbjct: 630 WSKKYGPVMSVRMGNDDWVVMGNYEA 553 PSVGVLPFLEKYSERTMHKWSKKYGPVMSVRMGNDDWVVMGNYE 286 not seq 2 or 4 Two diffs with seq above probably same gene QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIG = seq 2 (1) QDRVPAMNDKAQMPYTCAFMQEVFRYRTLVPLSLMHMTNEDVVLNGYNIPKGTTVSP = seq 4 NLWAVHNDPDVWDEPSKFKPERHLDDKGNFVQSKHVVAFSVGPRHCLGEQLARMEYFIYLVSMVQKFEFF = seq 4 Gap KQIARVV = seq 4 DEV13827.y1 DEV13827.y1 DEV17948.x1 I-HELIX DEV19056.y1 DEV25829.x1 I-HELIX OPPOSITE END OF SEQ 2 DEV26097.x1 I-HELIX DEV31420.x1 N-TERM DEV36161.x1 DEV39712.x1 DEV46240.x1 DEV5183.x01 DEV9515.x1 LGK545.x1 FIRST AND LAST PART = SEQ 1 BUT DIFFERS IN MIDDLE LQW146181.x1 I-HELIX OPPOSITE END OF SEQ 1 LQW146181.y1 LQW183999.x1 I-HELIX OPPOSITE END OF SEQ 1 LQW183999.y1 LQW188756.y1 LQW198468.y1 LQW227602.y1 LQW258179.y1 LQW259311.x1 LQW259311.x2 LQW259311.y1 I-HELIX OPPOSITE END OF SEQ 1 LQW80689.x1 LQW80689.x1 LQW95486.y1 LQW198468.x1 use to compare joint LQW198468.x1.phd.1 LQW198468.y1 13:47:14 2001 TEMPLATE: LQW198468 DIRECTION: fwd Length = 1003 Score = 196 bits (493), Expect = 6e-50 Identities = 98/121 (80%), Positives = 102/121 (83%), Gaps = 14/121 (11%) Frame = +3 Query: 1 QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIG------------- 47 QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIG Sbjct: 186 QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIGENL*TIIDVM*LK 365 Query: 48 -KKIQARHRVPAMNDKAQMPYTCAFMQEVFRYRTLVPLSLMHMTNEDVVLNGYNIPKGTT 106 KK + RVPAMNDKAQMPYTCAFMQEVFRYRTLVPLS++HMTN+DVVLNGY IPKGTT Sbjct: 366 LKKNSGQDRVPAMNDKAQMPYTCAFMQEVFRYRTLVPLSVVHMTNQDVVLNGYTIPKGTT 545 Query: 107 V 107 V Sbjct: 546 V 548 LQW80689.x1 CHEM: term DYE: ET TIME: Fri May 4 11:53:29 2001 TEMPLATE: LQW80689 DIRECTION: fwd Length = 488 Score = 113 bits (281), Expect(2) = 4e-49 Identities = 52/56 (92%), Positives = 55/56 (97%) Frame = +2 Query: 48 KKIQARHRVPAMNDKAQMPYTCAFMQEVFRYRTLVPLSLMHMTNEDVVLNGYNIPK 103 KKIQARHRVPAMNDKAQMPYTCAFMQEVFRYRTLVPLS++HMTN+DVVLNGY IPK Sbjct: 320 KKIQARHRVPAMNDKAQMPYTCAFMQEVFRYRTLVPLSVVHMTNQDVVLNGYTIPK 487 Score = 101 bits (249), Expect(2) = 4e-49 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +1 Query: 1 QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIGKKI 50 QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIG+ + Sbjct: 136 QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIGENL 285 >LQW80689.x1 >lcl|LQW80689.x1 CHROMAT_FILE: LQW80689.x1 PHD_FILE: LQW80689.x1.phd.1 CHEM: term DYE: ET TIME: Fri May 4 11:53:29 2001 TEMPLATE: LQW80689 DIRECTION: fwd TGGTACTTTAAGAACACATTTAAGCATATATCCATATACATTTTTCATTTTTCGTTGGTATGCTCCTTAGAAAACTTCCG ATACTTTGNCGAACTTCTTTTAANACTTACAATACGTCCTTCTATTTAGGACCTACAACTGTTGCAATATGTTCGGGACT TGTTTGTTGCTGGAACCGAAACGACAACCAGCACACTAAGGTGGTCAATACTTTGCATGATTCATAATCCGGAAAAGCAA GAAAAATTAAGAAAAGAAATATGTGATGTCATTGGTGAGAATTTATAAACAATTATTGATGTTATGTAGTTAAAACTTAA AAAAAATTCAGGCCAGGCATAGGGTTCCAGCGATGAATGACAAAGCTCAGATGCCTTACACTTGCGCGTTCATGCAGGAA GTTTTCAGATACCGGACTCTGGTTCCCTTAAGCGTAGTGCATATGACTAATCAAGACGTTGTACTGAACGGTTATACAAT ACCCAAAG >LQW80689.x1_1 WYFKNTFKHISIYIFHFSLVCSLENFRYFXELLLXLTIRPSI*DLQLLQYVRDLFVAGTE TTTSTLRWSILCMIHNPEKQEKLRKEICDVIGENL*TIIDVM*LKLKKNSGQA*GSSDE* frameshift here QSSDALHLRVHAGSFQIPDSGSLKRSAYD*SRRCTERLYNTQX >LQW80689.x1_2 GTLRTHLSIYPYTFFIFRWYAP*KTSDTLXNFF*XLQYVLLFRTYNCCNMFGTCLLLEPK RQPAH*GGQYFA*FIIRKSKKN*EKKYVMSLVRIYKQLLMLCS*NLKKIQARHRVPAMND KAQMPYTCAFMQEVFRYRTLVPLSVVHMTNQDVVLNGYTIPKX >LQW80689.x1_3 VL*EHI*AYIHIHFSFFVGMLLRKLPILXRTSFXTYNTSFYLGPTTVAICSGLVCCWNRN DNQHTKVVNTLHDS*SGKARKIKKRNM*CHW*EFINNY*CYVVKT*KKFRPGIGFQR*MT KLRCLTLARSCRKFSDTGLWFP*A*CI*LIKTLY*TVIQYPK >rciad045g08 seq a Length = 682 Score = 201 bits (505), Expect = 4e-51 Identities = 97/109 (88%), Positives = 102/109 (92%) Frame = -3 Query: 1 QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIGKKIQARHRVPAMN 60 QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIG+ RVPAMN Sbjct: 662 QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIGQD-----RVPAMN 498 Query: 61 DKAQMPYTCAFMQEVFRYRTLVPLSLMHMTNEDVVLNGYNIPKGTTVSP 109 DKAQMPYTCAFMQEVFRYRTLVPLS++HMTN+DVVLNGY IPKGTT+SP Sbjct: 497 DKAQMPYTCAFMQEVFRYRTLVPLSVVHMTNQDVVLNGYTIPKGTTISP 351 >rciad045g08 ACCCCCGATGAATATTTTTATGGTTGAACCGCATCGTTAAATTAAACTATCTTTGCAATTTGCTTGAACCGCAAAGGAAC AAATACAACACCACTCGACCCGTCTTCAACATCTGGAAGATCTGGTTCATTCGGATCCGGAAAAAACTCAAACTTCTGAA CCATTGAAACTAAGTAGATGAAATATTCCATTCGAGCAAGTTGTTCTCCCAAGCAATGACGTGGACCAATCGAGAAAGGT ATCACGTGTTTAGACTGAACAAAGTTTCCTTTGTCATCGAGGTGACGCTCAGGTTTAAACTTGCTTGGTTCGTCCCACAC ATCTGGATTGTTGTGCACCGCCCACAGGTTTGGTGATATTGTTGTTCCTTTGGGTATTGTATAACCGTTCAGTACAACGT CTTGATTAGTCATATGCACTACGCTTAAGGGAACCAGAGTCCGGTATCTGAAAACTTCCTGCATGAACGCGCAAGTGTAA GGCATCTGAGCTTTGTCATTCATCGCTGGAACCCTATCCTGGCCAATGACATCACATATTTCTTTTCTTAATTTTTCTTG CTTTTCCGGATTATGAATCATGCAAAGTATTGACCACCTTAGTGTGCTGGTTGTCGTTTCGGTTCCAGCAACAAACAAGT CCCGAACATATTGCAACAGTTGTAGGTCTGTGTATGACGAGT >rciad045g08_6 identical to seq 2 SSYTDLQLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIGQDRVPAM NDKAQMPYTCAFMQEVFRYRTLVPLSVVHMTNQDVVLNGYTIPKGTTISPNLWAVHNNPD VWDEPSKFKPERHLDDKGNFVQSKHVIPFSIGPRHCLGEQLARMEYFIYLVSMVQKFEFF PDPNEPDLPDVEDGSSGVVFVPLRFKQIAKIV* >cign065e15 seq a Length = 579 Score = 201 bits (505), Expect = 4e-51 Identities = 97/109 (88%), Positives = 102/109 (92%) Frame = +3 Query: 1 QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIGKKIQARHRVPAMN 60 QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIG+ RVPAMN Sbjct: 192 QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIGQD-----RVPAMN 356 Query: 61 DKAQMPYTCAFMQEVFRYRTLVPLSLMHMTNEDVVLNGYNIPKGTTVSP 109 DKAQMPYTCAFMQEVFRYRTLVPLS++HMTN+DVVLNGY IPKGTT+SP Sbjct: 357 DKAQMPYTCAFMQEVFRYRTLVPLSVVHMTNQDVVLNGYTIPKGTTISP 503 >cign065e15 TTCNGCACGAGGCACCGTTTAGCCGTATCAACAATCAACTAATGACGGATGTGAGAGTAATTTTGCAAATGTTAAGAGAA ATACTGTCCGAGCACAAGTCGACATTTAACAAAGATGACGTCCGAGATTTTATCGATGCTTTCATCGCTGAGCAAAATTC AGAAAGCAAACACTCGTCATACACAGACCTACAACTGTTGCAATATGTTCGGGACTTGTTTGTTGCTGGAACCGAAACGA CAACCAGCACACTAAGGTGGTCAATACTTTGCATGATTCATAATCCGGAAAAGCAAGAAAAATTAAGAAAAGAAATATGT GATGTCATTGGCCAGGATAGGGTTCCAGCGATGAATGACAAAGCTCAGATGCCTTACACTTGCGCGTTCATGCAGGAAGT TTTCAGATACCGGACTCTGGTTCCCTTAAGCGTAGTGCATATGACTAATCAAGACGTTGTACTGAACGGTTATACAATAC CCAAAGGAACAACAATATCACCAAACCTGTGGGCGGTGCACAACAATCCAGATGTGTGGGACGAACCAAGCAAGTTTAAA CCTGAGCGTCACCTCGATG XHEAPFSRINNQLMTDVRVILQMLREILSEHKSTFNKDDVRDFIDAFIAEQNSESKHSSY TDLQLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIGQDRVPAMNDK AQMPYTCAFMQEVFRYRTLVPLSVVHMTNQDVVLNGYTIPKGTTISPNLWAVHNNPDVWD EPSKFKPERHLD Combined = seq 2 HEAPFSRINNQLMTDVRVILQMLREILSEHKSTFNKDDVRDFIDAFIAEQNSESKH SSYTDLQLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIGQDRVPAM NDKAQMPYTCAFMQEVFRYRTLVPLSVVHMTNQDVVLNGYTIPKGTTISPNLWAVHNNPD VWDEPSKFKPERHLDDKGNFVQSKHVIPFSIGPRHCLGEQLARMEYFIYLVSMVQKFEFF PDPNEPDLPDVEDGSSGVVFVPLRFKQIAKIV* >rcieg032b06 seq a Length = 764 Score = 201 bits (505), Expect = 4e-51 Identities = 97/109 (88%), Positives = 102/109 (92%) Frame = -2 Query: 1 QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIGKKIQARHRVPAMN 60 QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIG+ RVPAMN Sbjct: 706 QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIGQD-----RVPAMN 542 Query: 61 DKAQMPYTCAFMQEVFRYRTLVPLSLMHMTNEDVVLNGYNIPKGTTVSP 109 DKAQMPYTCAFMQEVFRYRTLVPLS++HMTN+DVVLNGY IPKGTT+SP Sbjct: 541 DKAQMPYTCAFMQEVFRYRTLVPLSVVHMTNQDVVLNGYTIPKGTTISP 395 >ciht001p11 seq a Length = 629 Score = 196 bits (493), Expect = 9e-50 Identities = 95/109 (87%), Positives = 100/109 (91%) Frame = +1 Query: 1 QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIGKKIQARHRVPAMN 60 QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIG+ RVPAMN Sbjct: 292 QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIGQD-----RVPAMN 456 Query: 61 DKAQMPYTCAFMQEVFRYRTLVPLSLMHMTNEDVVLNGYNIPKGTTVSP 109 DKA MPYTCAFMQEVF YRTLVPLS++HMTN+DVVLNGY IPKGTT+SP Sbjct: 457 DKAXMPYTCAFMQEVFXYRTLVPLSVVHMTNQDVVLNGYTIPKGTTISP 603 >cign008n15 seq b Length = 622 Score = 195 bits (490), Expect = 2e-49 Identities = 96/109 (88%), Positives = 98/109 (89%) Frame = +2 Query: 1 QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIGKKIQARHRVPAMN 60 QLL YV DLF AGTETTTSTL WSILCMIHNPEKQEKLRKEIC V+G+ RVPAMN Sbjct: 125 QLLHYVVDLFEAGTETTTSTLMWSILCMIHNPEKQEKLRKEICSVVGQD-----RVPAMN 289 Query: 61 DKAQMPYTCAFMQEVFRYRTLVPLSLMHMTNEDVVLNGYNIPKGTTVSP 109 DKAQMPYTCAFMQEVFRYRTLVPLSLMHMTNEDVVLNGYNIPKGTTVSP Sbjct: 290 DKAQMPYTCAFMQEVFRYRTLVPLSLMHMTNEDVVLNGYNIPKGTTVSP 436 >cign008n15 TCGGCACGAGGGAATTGTTTCTGAACACAACTCGACATTTAACAAAGATGACGCCCGGGATTTTATCGATGCTTTTATTG CTGAGAAAAACTCTCAAAACAAACACTCGTCATTTACTGATTCACAGCTGCTGCACTATGTGGTTGACTTATTCGAGGCT GGAACCGAAACGACAACCAGCACACTAATGTGGTCAATACTTTGCATGATTCATAATCCGGAAAAGCAAGAAAAACTAAG AAAAGAAATCTGTAGTGTTGTAGGCCAGGATAGGGTTCCAGCGATGAATGACAAAGCTCAGATGCCTTACACTTGCGCGT TCATGCAGGAAGTTTTCAGATACCGGACTCTGGTTCCCTTAAGCTTAATGCATATGACCAATGAAGATGTCGTACTTAAC GGTTACAATATTCCGAAGGGAACAACGGTGTCACCTAATCTGTGGGCGGTGCACAACGATCCAGATGTGTGGGACGAACC AAGCAAGTTTAAACCTGAGCGTCACCTCGATGACAAAGGAAACTTTGTTCAGTCTAAACACGTAGTCGCTTTCTCGGTGG GTCCACGTCATTGCTTGGGAGAACAACTTGCTCGAATGGAATATTTCATCTACTTAGTTTCA >cign008n15_2 identical to seq 4 GIVSEHNSTFNKDDARDFIDAFIAEKNSQNKHSSFTDSQLLHYVVDLFEAGTETTTS TLMWSILCMIHNPEKQEKLRKEICSVVGQDRVPAMNDKAQMPYTCAFMQEVFRYRTLVPL SLMHMTNEDVVLNGYNIPKGTTVSPNLWAVHNDPDVWDEPSKFKPERHLDDKGNFVQSKH VVAFSVGPRHCLGEQLARMEYFIYLVS >cign022n24 seq b Length = 675 Score = 195 bits (490), Expect = 2e-49 Identities = 96/109 (88%), Positives = 98/109 (89%) Frame = +2 Query: 1 QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIGKKIQARHRVPAMN 60 QLL YV DLF AGTETTTSTL WSILCMIHNPEKQEKLRKEIC V+G+ RVPAMN Sbjct: 77 QLLHYVVDLFEAGTETTTSTLMWSILCMIHNPEKQEKLRKEICSVVGQD-----RVPAMN 241 Query: 61 DKAQMPYTCAFMQEVFRYRTLVPLSLMHMTNEDVVLNGYNIPKGTTVSP 109 DKAQMPYTCAFMQEVFRYRTLVPLSLMHMTNEDVVLNGYNIPKGTTVSP Sbjct: 242 DKAQMPYTCAFMQEVFRYRTLVPLSLMHMTNEDVVLNGYNIPKGTTVSP 388 >cign022n24 TCGGCACGAGGATTTTATCGATGCTTTTATTGCTGAGAAAAACTCTCAAAACAAACACTCGTCATTTACTGATTCACAGC TGCTGCACTATGTGGTTGACTTATTCGAGGCTGGAACCGAAACGACAACCAGCACACTAATGTGGTCAATACTTTGCATG ATTCATAATCCGGAAAAGCAAGAAAAACTAAGAAAAGAAATCTGTAGTGTTGTAGGCCAGGATAGGGTTCCAGCGATGAA TGACAAAGCTCAGATGCCTTACACTTGCGCGTTCATGCAGGAAGTTTTCAGATACCGGACTCTGGTTCCCTTAAGCTTAA TGCATATGACCAATGAAGATGTCGTACTTAACGGTTACAATATTCCGAAGGGAACAACGGTGTCACCTAATCTGTGGGCG GTGCACAACGATCCAGATGTGTGGGACGAACCAAGCAAGTTTAAACCTGAGCGTCACCTCGATGACAAAGGAAACTTTGT TCAGTCTAAACACGTAGTCGCTTTCTCGGTGGGTCCACGTCATTGCTTGGGAGAACAACTTGCTCGAATGGAATATTTCA TCTACTTAGTTTCAATGGTTCAGAAGTTTGAGTTTCTACCGGATCCGAATGAACCGAACCTTCCAGATATTGAAAAAGGG TCGAATGGAGCTGCATTCGTTCCTCTGCCCTTTAA >cign022n24_2 DFIDAFIAEKNSQNKHSSFTDSQLLHYVVDLFEAGTETTTSTLMWSILCMIHNPEKQ EKLRKEICSVVGQDRVPAMNDKAQMPYTCAFMQEVFRYRTLVPLSLMHMTNEDVVLNGYN IPKGTTVSPNLWAVHNDPDVWDEPSKFKPERHLDDKGNFVQSKHVVAFSVGPRHCLGEQL ARMEYFIYLVSMVQKFEFLPDPNEPNLPDIEKGSNGAAFVPLPF Combined identical to seq 4 GIVSEHNSTFNKDDARDFIDAFIAEKNSQNKHSSFTDSQLLHYVVDLFEAGTETTTS TLMWSILCMIHNPEKQEKLRKEICSVVGQDRVPAMNDKAQMPYTCAFMQEVFRYRTLVPL SLMHMTNEDVVLNGYNIPKGTTVSPNLWAVHNDPDVWDEPSKFKPERHLDDKGNFVQSKH VVAFSVGPRHCLGEQLARMEYFIYLVSMVQKFEFLPDPNEPNLPDIEKGSNGAAFVPLPF >ciad086a13 seq b Length = 549 Score = 195 bits (490), Expect = 2e-49 Identities = 96/109 (88%), Positives = 98/109 (89%) Frame = +2 Query: 1 QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIGKKIQARHRVPAMN 60 QLL YV DLF AGTETTTSTL WSILCMIHNPEKQEKLRKEIC V+G+ RVPAMN Sbjct: 11 QLLHYVVDLFEAGTETTTSTLMWSILCMIHNPEKQEKLRKEICSVVGQD-----RVPAMN 175 Query: 61 DKAQMPYTCAFMQEVFRYRTLVPLSLMHMTNEDVVLNGYNIPKGTTVSP 109 DKAQMPYTCAFMQEVFRYRTLVPLSLMHMTNEDVVLNGYNIPKGTTVSP Sbjct: 176 DKAQMPYTCAFMQEVFRYRTLVPLSLMHMTNEDVVLNGYNIPKGTTVSP 322 >cinc015m09 seq b Length = 658 Score = 195 bits (490), Expect = 2e-49 Identities = 96/109 (88%), Positives = 98/109 (89%) Frame = +2 Query: 1 QLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIGKKIQARHRVPAMN 60 QLL YV DLF AGTETTTSTL WSILCMIHNPEKQEKLRKEIC V+G+ RVPAMN Sbjct: 275 QLLHYVVDLFEAGTETTTSTLMWSILCMIHNPEKQEKLRKEICSVVGQD-----RVPAMN 439 Query: 61 DKAQMPYTCAFMQEVFRYRTLVPLSLMHMTNEDVVLNGYNIPKGTTVSP 109 DKAQMPYTCAFMQEVFRYRTLVPLSLMHMTNEDVVLNGYNIPKGTTVSP Sbjct: 440 DKAQMPYTCAFMQEVFRYRTLVPLSLMHMTNEDVVLNGYNIPKGTTVSP 586 >best matches to CYP11A1 >scf/ciona01/G126/seq_dir/hrs/G126P69032R.T0/G126P69032RA7.T0.seq 722 (07) 722 ABI Length = 722 Plus Strand HSPs: Score = 221 (77.8 bits), Expect = 3.3e-17, P = 3.3e-17 Identities = 51/188 (27%), Positives = 103/188 (54%), Frame = +1 Query: 320 VTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAARHQAQGDMATMLQLVPLLKA 379 +T++ G DT + T+ W L +A+N ++Q+ + AE++ +++ M++ +P +A Sbjct: 112 ITDLFMAGTDTMATTVHWSLVFLAQNPEIQNKMAAEIIKVTGNDVINVS-MMESMPYTRA 288 Query: 380 SIKETLRLHPI-SVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPT 438 + E+ R+ P+ ++L +D+ ++D +IP TLV ++A+ +P ++ +PE+F P Sbjct: 289 VMYESTRMRPVFPLSLGHQATSDVTVKDNVIPKGTLVVANLWAIQNDPKWWKNPESFRPE 468 Query: 439 RWLSKDKNITYFRNL-GFGWGVRQCLGRRIAELEMTIFLINMLENFRV---EIQHLSDVG 494 R ++++ T + F G R CLG ++A IFL N++ F+ E Q D+ Sbjct: 469 RHITENGGFTKNEKIVPFSIGPRFCLGSQMATYHQFIFLANLVRTFKFRFHENQPEPDLT 648 Query: 495 TTFNLILMP 503 +L+P Sbjct: 649 GVMTSVLLP 675 44% to mouse 2j6 112 ITDLFMAGTDTMATTVHWSLVFLAQNPEIQNKMAAEIIKVTGNDVINVSMMESMPYTRA 288 289 VMYESTRMRPVFPLSLGHQATSDVTVKDNVIPKGTLVVANLWAIQNDPKWWKNPESFRPE 468 469 RHITENGGFTKNEKIVPFSIGPRFCLGSQMATYHQFIFLANLVRTFKFRFHENQPEPDLT 648 649 GVMTSVLLP 675 >scf/ciona01/G126/seq_dir/hrs/G126P605845F.T0/G126P605845FG6.T0.seq 701 (27) 0 701 ABI Length = 701 Plus Strand HSPs: Score = 217 (76.4 bits), Expect = 8.9e-17, P = 8.9e-17 Identities = 46/166 (27%), Positives = 95/166 (57%), Frame = +2 Query: 320 VTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAARHQAQGDMATMLQLVPLLKA 379 +T++ G DT + T+ W L +A+N ++Q+ + AE++ +++ M++ +P +A Sbjct: 149 ITDLFMAGTDTMATTVHWSLVFLAQNPEIQNKMAAEIIKVTGNDVINVS-MMESMPYTRA 325 Query: 380 SIKETLRLHPI-SVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPT 438 + E+ R+ P+ ++L +D+ ++D +IP TLV ++A+ +P ++ +PE+F P Sbjct: 326 VMYESTRMRPVFPLSLGHQATSDVTVKDNVIPKGTLVVANLWAIQNDPKWWKNPESFRPE 505 Query: 439 RWLSKDKNITYFRNL-GFGWGVRQCLGRRIAELEMTIFLINMLENFR 484 R ++++ T + F G R CLG ++A IFL N++ F+ Sbjct: 506 RHITENGGFTKNEKIVPFSIGPRFCLGSQMATYHQFIFLANLVRTFK 646 149 ITDLFMAGTDTMATTVHWSLVFLAQNPEIQNKMAAEIIKVTGNDVINVSMMESMPYTRA 325 326 VMYESTRMRPVFPLSLGHQATSDVTVKDNVIPKGTLVVANLWAIQNDPKWWKNPESFRPE 505 506 RHITENGGFTKNEKIVPFSIGPRFCLGSQMATYHQFIFLANLVRTFK 646 >scf/ciona01/G126/seq_dir/hrs/G126P609638F.T0/G126P609638FH3.T0.seq 726 (23) 0 726 ABI Length = 726 Plus Strand HSPs: Score = 195 (68.6 bits), Expect = 9.0e-18, Sum P(2) = 9.0e-18 Identities = 56/199 (28%), Positives = 98/199 (49%), Frame = +1 Query: 311 MSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAARHQAQGDMATM 370 +S DI+ V + G DTT+ + W +Y + R+ +Q + E+ GDM T+ Sbjct: 109 LSLSDIQEEVDTFMFEGHDTTAAAMTWTIYLIGRHPAIQARIHEEL---DDVFGGDMGTI 279 Query: 371 ----LQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREP 426 LQ + LL+ +IKE+LR+ P + R + + + IPA T V + I +L P Sbjct: 280 TNSHLQKLSLLERTIKESLRMFPSVPFIGRVTTEECSVGSHSIPAGTQVAIFIDSLHHNP 459 Query: 427 TFFFDPENFDPTRWLSKDKNITY-FRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRV 485 + + D + FDP R+L ++ + + + F G R C+G++ A +E + L +L + + Sbjct: 460 SVWPDVDRFDPDRFLPENCVGRHPYSFIPFSAGPRNCIGQKFALMEEKVLLTQILRKYSI 639 Query: 486 EIQ-HLSDVGTTFNLILMPEKP 506 D+ +LIL P Sbjct: 640 HSHDEEEDLRKQADLILRSSTP 705 50% to 4V2 human 52% to 4V5 fugu 75% to seq 115 NFLPPQDTRRMAFLDVLLRAESEDGRS 109 LSLSDIQEEVDTFMFEGHDTTAAAMTWTIYLIGRHPAIQARIHEELDDVFGGDMGTI 279 280 TNSHLQKLSLLERTIKESLRMFPSVPFIGRVTTEECSVGSHSIPAGTQVAIFIDSLHHNP 459 460 SVWPDVDRFDPDRFLPENCVGRHPYSFIPFSAGPRNCIGQKFALMEEKVLLTQILRKYSI 639 640 HSHDEEEDLRKQADLILRSSTP 705 Score = 54 (19.0 bits), Expect = 9.0e-18, Sum P(2) = 9.0e-18 Identities = 15/43 (34%), Positives = 20/43 (46%), Frame = +1 Query: 166 NFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFE 208 NFLP D F+ VL R + G DI +++ F FE Sbjct: 28 NFLPPQDTRRMAFLDVLLRAESEDGRSLSLSDIQEEVDTFMFE 156 >best matches to 27A1 >scf/ciona01/G126/seq_dir/hrs/G126P601882R.T0/G126P601882RC8.T0.seq 734 0 734 ABI Length = 734 Minus Strand HSPs: Score = 247 (86.9 bits), Expect = 5.1e-20, P = 5.1e-20 Identities = 57/210 (27%), Positives = 105/210 (50%), Frame = -3 Query: 320 LSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPA--GQVPQH 377 LS + + + G DTT+ +TW +Y + + P IQ +HEE+ V G + + Sbjct: 696 LSLSDIQEEVDTFMFEGHDTTAAAMTWTIYLIGRHPAIQARIHEELDDVFGGDMGTIT-N 520 Query: 378 KDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTA 437 + LL+ +KE+LR++P VP R+ +E V P TQ + +P+ Sbjct: 519 SHLQKLSLLERTIKESLRMFPSVPFIGRVTTEECSVGSHSIPAGTQVAIFIDSLHHNPSV 340 Query: 438 FSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKY 497 + + + F P R+L P +HP+ +PF G R C+G++ A +E ++LL ++++KY Sbjct: 339 WPDVDRFDPDRFL----PENCVGRHPYSFIPFSAGPRNCIGQKFALMEEKVLLTQILRKY 172 Query: 498 KVVLAPETGELKSVARIVLVPNKKVGLQFLQR 529 + E +L+ A ++L + + + R Sbjct: 171 SIHSHDEEEDLRKQADLILRSSTPLNISLTPR 76 75% to seq 115 49% to 4V2 human NFLPPQDTRRMAFLDVLLRAESEDGRS 696 LSLSDIQEEVDTFMFEGHDTTAAAMTWTIYLIGRHPAIQARIHEELDDVFGGDMGTITN 520 519 SHLQKLSLLERTIKESLRMFPSVPFIGRVTTEECSVGSHSIPAGTQVAIFIDSLHHNPSV 340 339 WPDVDRFDPDRFLPENCVGRHPYSFIPFSAGPRNCIGQKFALMEEKVLLTQILRKY 172 171 SIHSHDEEEDLRKQADLILRSSTPLNISLTPR 76 >sequence 38, 65 2 accessions 50% to 2J2 VRDLFMAGTDTTSSTTCWIILFLCRYPEVQRKMQEEVDQVLGSNGVPKMALAEKMPYTRAVIQ EIARMRPTLPLSVPHCTTQDTMMMGYKIPKDTIVLTNIWGIHHDEKLWKNPYDFNPERH 149 LDSNGNFVKSSNIMQFNIGLRSCLGQQLAKMELFLLTTSLCRHFSFSVVGEVDMEGESMVTLRPCSMEVVATKRA* DEV34315.x1 LQW188368.y1 LQW143417.x1 LQW149539.y1 LQW220722.y1 >SEQUENCE 34, 52, 71, 217 74% TO SEQ 29, 60% to seq 65, 39% TO 2C9 MLDILLSCIRAWFSTITLSIIVFYVTWHYWNKRTPGSPPGPRGFPFIGAITSIRKHPEHVMTKWNKEYGPVCMVRLGFKDVLVIGS YEAAHEAYVKSQDFLDRPSPFGLEILGGGYGLFPIAYGSFHQEQRRFGLNTLREHGMGRRVLESTILQYAEELCDRLETKMSAPVL LDQEVYIAVSSTIAHIVFGHNTMQDSPEFRDMILWMLRPNTATVLAGILVFAPYLKHLPFFRGVHNDSRALRLKLESLNLKEVKKH DKTRDPSDPRDFIDSFLNEMDK (1) boundary not consistent with related sequences HFKGKIDPNWETYSSFSDQQLVSM (0) VRDLFLAGTDTTSATTCWIILFLCKYPDVQRRMQKEIDDVIGENGIPKLALAERLPFTRAVIQ (0) EMGRIRPNVPLAVPHCASRDSTLMGFNIPKDTIIMTNIWGIHHDEKTWKDPYKFNPDRHLDAEGNFVKSNHVMQFNIGLRSCLGQQ LARMELFLITVTLFRKFFIELEPGCDIDMEGESLVSLRPYPFKVLLTKRI* DEV10735.x1 exon 1 N-term to I-helix DEV17022.x1 exon 1 N-term to I-helix LQW166080.x1 exon 1 N-term to I-helix LQW267527.x1 exon 1 N-term to I-helix DEV41989.y1 exon 1 N-term to I-helix DEV39698.x1 exon 1 N-term to I-helix LQW44017.y1 exon 1 N-term to I-helix LQW64492.x1 exon 1 N-term to I-helix LQW33972.x1 exon 1 N-term to I-helix LQW201553.y1 exon 2 I-helix LQW222497.x1 exon 2 I-helix LQW142648.x1 exon 2 I-helix LWG3369.x1 exon 2 I-helix DEV54722.x1 exon 2 I-helix LQW151633.y1 exon 2 I-helix LQW73069.x2 exon 2 I-helix DEV39698.y1 exon 3 EXXR to end LQW68269.y1 exon 3 EXXR to end DEV41989.x1 exon 3 EXXR to end DEV41989.x2 exon 3 EXXR to end LQW73069.x2 exon 3 EXXR to end LQW151633.y1 exon 3 EXXR to end DEV49881.y1 exon 3 EXXR to end >student assembly of seq 34 ortholog needs checking missing C-term (2 different genes) 68% to seq 65 MMEEVSIVQTIRGTFDTILLLAIVFYLTWHIWNRRSPLSPPGPRGIPLLGAITQLGKHPEHA MMKWNQQYGPICMVRLGHKDV LVLGSYEAAHEALVKNTHIADRPTHNIEVFYGGKGILMINSGSFHQEQRRFGLNTLREY GMGRRALEPTILIYVNDLCDRIEKYGSDPFVIDGEVYLTISSTISHIVFGHDVIHDNPKFKEIIFKMIEPN KLNVLAGILAFAPFLKHFPFFSTVHKSSKEFRLKLQSLIGEEVQEHKKTRDPTQSRDFIDSFLQAMEK (1?) VQDGKLDPNWEPYSSFTIDQLTAM (0?) VRDLFMAATDTTSSTICWIILFLCKNTDVQIKMQEEIDEVLGQNGILKYELATKMHYVRAVIQ (0) LFKEIARLRPSVPLSLPHASNRDTSIMGYRIPKDTIVLTNIWGIHHDEKIWKNPYEFNPE RHLDANGNFVKSKKVMQFNIGLRSCLGQQLANMELFLVTVSLFHRFSFSVVNPKIDMGGE SMVSLRPYPYSVVATTRG* G126P617768R.T0/G126P617768RB11.T0.seq 688 (37) G126P65096R.T0/G126P65096RG8.T0.seq 738 (02) G126P617150F.T0/G126P617150FA9.T0.seq 677 (38) >POSSIBLE ORTH OF SEQ 38 and probable end of seq 34 orth. Minus Strand HSPs: 699 LFKEIARLRPSVPLSLPHASNRDTSIMGYRIPKDTIVLTNIWGIHHDEKIWKNPYEFNPE 520 519 RHLDANGNFVKSKKVMQFNIGLRSCLGQQLANMELFLVTVSLFHRFSFSVVNPKIDMGGE 340 339 SMVSLRPYPYSVVATTRG* 283 G126P64775F.T0/G126P64775FF5.T0.seq 724 (01) G126P602025R.T0/G126P602025RH2.T0.seq 720 (12) >scf/ciona01/G126/seq_dir/hrs/G126P610830R.T0/G126P610830RG2.T0.seq 745 >scf/ciona01/G126/seq_dir/hrs/G126P610830R.T0/G126P610830RG2.T0.seq_4 745 0 745 ABI SSPWFTGCKLVKITHNTLXIAPVIRQ*V*GDLATVRV*TPLVFV*TPPTCRM*TLISYTL FHFQYLCCLNKFLYIKEMAGKNTIHIRVTKITI*SCGI*PEFYFTILRCSRN*LLQYVGC L*TRFCLIRKLLG*DQAKEMPIYITLYTPI*PKY*V*QSDQVGSTLFFALFRYALN*LIN FQYGDV*KRFFSI*GNCSLRTKRPSFSSTCFKQRYFDHGL*NSERHHRSYQHLGDSPGGK NEFHHREL >scf/ciona01/G126/seq_dir/hrs/G126P610830R.T0/G126P610830RG2.T0.seq_5 745 0 745 ABI FFXMVYRL*AG*NNT*HTXNSSGNPTVSVRRSGDCPCVNPPGFCINTPDLSYVNTNFLYP IPFPIFVLFKQILVY*GNGW*KHYTHQGDQNHNLILWYLT*VLFYNTQV*PKLITPICRL FINAVLFNKEIARLRPS*GNAYIHNTIHPNITKILSLTV*PSGFHPVFCII*ICFKLIN* LPVWGCLKTLFFYLRKLLVEDQASLFLFHMLQTEILRSWVIEFRKTPSFLPTFGGFTRRK K*IPPQGAX >scf/ciona01/G126/seq_dir/hrs/G126P610830R.T0/G126P610830RG2.T0.seq_6 745 0 745 ABI LXHGLPAVSWLK*HITHXQ*LR*SDSECEAIWRLSVCKPPWFLYKHPRPVVCKH*FPIPY SISNICAV*TNSCILRKWLVKTLYTSG*PKSQSNLVVFNLSFILQYSGVAEINYSNM*AV YKRGFV**GNCSVETKLRKCLYT*HYTPQYNQNIEFNSLTKWVPPCFLHYLDML*IN*LT SSMGMFKNAFFLFKEIAR*GPSVPLSLPHASNRDTSIMGYRIPKDTIVLTNIWGIHQEEK MNSTTGSS >scf/ciona01/G126/seq_dir/hrs/G126P602025R.T0/G126P602025RH2.T0.seq_4 720 0 720 ABI KY*V*QFDQVGSTLFLHYLDML*IN*LTFRYG*CLKTPFFSI*GNCSFETKRPPFSSTCF KQRYFDHGL*GSERYHRSYQHLGDSP*RKNMEESLRIQS*KASRREWQLR*IQESYAVQY RTAELPWTATCKYGVILGHSFVVS*IFLFTCEP*D*HGRGKYGVITPISIRRRGHNTRVK NVDRVFNPIEKYTDLYIKRY*QRAHHGLEFKPQNTRVTNLKETWSSG*EFPPHWSFSVQD >scf/ciona01/G126/seq_dir/hrs/G126P602025R.T0/G126P602025RH2.T0.seq_5 720 0 720 ABI ILSLTV*PSGFHPVFALFRYALN*LINFQVWVMFKNALFFYLRKLLV*DQASPFLFHMLQ TEILRSWVIRFRKIPSFLPTFGGFTMTKKYGRILTNSILKGISTRMATSLNPRKLCSSIS DCGVALDSNLQIWSYSWSQFRCFIDFPFHL*TLRLTWEGKVWCHYAHIHTASWPQHEGKE RRQSV*PDRKIYRFIYKTILATSPSWVGI*APKYQGDKP*RNLVQRLGISTTLEFQRPRX >scf/ciona01/G126/seq_dir/hrs/G126P602025R.T0/G126P602025RH2.T0.seq_6 720 0 720 ABI NIEFNSLTKWVPPCFCII*ICFKLIN*LSGMGDV*KRPFFLFKEIARLRPSVPLSLPHAS NRDTSIMGYKVPKDTIVLTNIWGIHHDEKIWKNPYEFNPERHLDANGNFVKSKKVMQFNI GLRSCLGQQLANMELFLVTVSLFHRFSFSLVNPKIDMGGESMVSLRPYPYGVVATTRG*R TSTECLTRSKNIPIYI*NDISNEPIMGWNLSPKIPG*QTLKKLGPAVRNFHHIGVSASKX VMFKXAFFLFKEIARLRPSVPLSLPHASNRDTSIMGYRIPKDTIVLTNIWGIHHDEKIWK NPYEFNPERHLDANGNFVKSKKVMQFNIGLRSCLGQQLANMELFLVTVSLFHRFSFSVVN PKIDMGGESMVSLRPYPYSVVATTRG*RMSKECLTRSKHIPIYI*NDISNEPVMGSNLSP KIPGWQTFKETLVQRLARPI*KE*YKNYLNDKTRRFRNKTRKKTG*KRIXPQERRIHXRK S >scf/ciona01/G126/seq_dir/hrs/G126P64775F.T0/G126P64775FF5.T0.seq_5 724 0 724 ABI GDV*XRFFSI*GNCSFETKRPSFSSTCFKQRYFDHGL*NSERHHRSYQHLGDSP*RKNME ESLRIQPRKASRREWQLR*IQESYAV*YRTA*LPWTATCKYGAILGHSFVVS*IFLFSCE P*D*HGRGKYGVITPISIQRRGHNTRVKNVERVFNPIETYTDLYIKRY*QRARHGFEFKP QNTRVANL*RNFGPAVSATDLKRII*KLP**QDQAVSKQNS*KNRVKANXTTGAEDSXXQ KX >scf/ciona01/G126/seq_dir/hrs/G126P64775F.T0/G126P64775FF5.T0.seq_6 724 0 724 ABI *CLXTLFFYLRKLLV*DQASLFLFHMLQTEILRSWVIEFRKTPSFLPTFGGFTMTKKYGR ILTNSTPKGISTRMATSLNPRKLCSLISDCVVALDSNLQIWSYSWSQFRCFIDFPFQL*T LRLTWEGKVWCHYAHIHTASWPQHEGKECRKSV*PDRNIYRFIYKTILATSPSWVRI*AP KYQGGKPLKKLWSSG*RDRFKKNNIKTTLMTRPGGFETKLVKKQGKSESHHRSGGFIXAK V >scf/ciona01/G126/seq_dir/hrs/G126P617150F.T0/G126P617150FA9.T0.seq_4 677 0 677 ABI YYVIYHLLDHSFPLQEHGRPD*NARRNRRIVGTKRNPKIRARYQDALREGCDTGSCG*DV TSAWAQYAINRLPTRNRNTEPNT*TIKRMNDCVAEWLIRPIHLFRFQI*KRGHRCWHRFI SPLFLTVMRACKVSKHHIVFFPHGLPCCKLC*NNT*HTAIAPVIRQ*V*GDLATVRV*TP LVFV*TPPTVRM*TLISYTLFHFQYL*SLNKFLYIKGIPPQGEIQ >scf/ciona01/G126/seq_dir/hrs/G126P617150F.T0/G126P617150FA9.T0.seq_5 677 0 677 ABI ILRHLPFVGSFFSFARTRTSRLKCKKK*TNCWDKTES*NTSSLPRCIT*GL*YRFVWVGC DKCVGTIRY*QTSNSKPKHGTKYINNKTHERLCSGMVDSTDSPFPIPNIKTRP*VLASIH ITSVPYRYASV*SKQTSHSFLSPWFTVL*AVLK*HITHCNSSGNPTVSVRRSGDCPCVNP PGFCINTPDCPYVNTNFLYPIPFPIFVKFKQILVY*GNSTTGRDSX >scf/ciona01/G126/seq_dir/hrs/G126P617150F.T0/G126P617150FA9.T0.seq_6 677 0 677 ABI DTTSSTICWIILFLCKNTDVQIKMQEEIDELLGQNGILKYELATKMHYVRAVIQVRVGRM *QVRGHNTLLTDFQLETETRNQIHKQ*NA*TIV*RNG*FDRFTFSDSKYKNEAIGVGIDS YHLCSLPLCERVK*ANIT*FSFPMVYRAVSCVKITHNTLQ*LR*SDSECEAIWRLSVCKP PWFLYKHPRLSVCKH*FPIPYSISNICEV*TNSCILREFHHRARFX >scf/ciona01/G126/seq_dir/hrs/G126P617768R.T0/G126P617768RB11.T0.seq_4 688 0 688 ABI RTGRFERPAFAC**MNLYV*RFVIFSWRQLILRHLPFVGSFFSFARTRTSRLKCKKK*MK CWGRTES*NTSSPPRCITLGL*YRFVWIGCDKTSWA*YAINRLPTRNRNTEPKT*TIKRM NDCVAKWLIRPIHFPIPNIKTRPWVLASIHITSVLHRYAIV*SKQTSHSFFPPWFTVL*A VLK*HITHCYSSGNPTVGVRRSGDCPCVNPPGFCIYTPDCQCESTTWSS >scf/ciona01/G126/seq_dir/hrs/G126P617768R.T0/G126P617768RB11.T0.seq_5 688 0 688 ABI PYGAI*ATCFCVLINESLCLKVRDLFMAATDTTSSTICWIILFLCKNTDVQIKMQEEIDE VLGQNGILKYELATKMHYVRAVIQVRVDRM*QNVVGIIRY*QTSNSKPKHGTKDINNKTY ERLCSEMVDTTDSFSDSKYKNEAMGVGIDSYHLRSSPLCDRVK*ANIT*FFSXMVYSAVS CVKITHNTLL*LR*SDSGCEAIWRLSVCKPPWFLYIHPRLSV*IHHMELX >scf/ciona01/G126/seq_dir/hrs/G126P617768R.T0/G126P617768RB11.T0.seq_6 688 0 688 ABI VRGDLSDLLLRVNK*ISMFKGS*SFHGGN*YYVIYHLLDHSFPLQEHGRPD*NARRNR*S VGAERNPKIRARHQDALR*GCDTGSCG*DVTKRRGHNTLLTDFQLETETRNQRHKQ*NV* TIV*RNG*YDRFIFRFQI*KRGHGCWHRFISPPFFTVMRSCKVSKHHIVFFXHGLQCCKL C*NNT*HTAIAPVIRQWV*GDLATVRV*TPLVFVYTPPTVSVNPPHGAX >scf/ciona01/G126/seq_dir/hrs/G126P64855R.T0/G126P64855RH11.T0.seq 689 (01) >scf/ciona01/G126/seq_dir/hrs/G126P64855R.T0/G126P64855RH11.T0.seq_4 689 0 689 ABI GGPGLXGRRK*MKCGAERES*K*RLATKRHYVRAVIQVRGDGSDKTWGA*YAINRLPTRN RNTGPKT*TIKRRTMCSERVDTTDSFSDSKYKNEARVLGIDSYHLRSSPLADRVK*ANIT *FFSPWFTVL*AVLK*HITHCYSSGNPTVGVGRSGDCPCVNPPGFCIYTPDGRV*TLISY TLFHFQYLAGLNKFLYIKEMAE*KHYTHQGTKITI*SWGI*PECNSTTG >scf/ciona01/G126/seq_dir/hrs/G126P64855R.T0/G126P64855RH11.T0.seq_5 689 0 689 ABI GRSRIXRQKEIDEVWGRTGILKIEARHQEALR*GCDTGSWGWE*QNVGGIIRY*QTSNSK PKHGTKDINNKT*NDV*RKG*YDRFIFRFQI*KRGQGVGHRFISPPFFTVSGSCKVSKHH IVFFP MVYSAVSCVKITHNTLL*LR*SDSGCGAIWRLSVCKPPWFLYIHPR RSCVNINFL YTIPFPIFGWFKQILVY*GNGGIKTLYTSGDQNHNLILGYLTGM*FHHRX >scf/ciona01/G126/seq_dir/hrs/G126P64855R.T0/G126P64855RH11.T0.seq_6 689 0 689 ABI REVPDXKAEGNR*SVGQNGNPKNRGSPPRGITLGL*YRFVGMGVTKRGGHNTLLTDFQLE TETRDQRHKQ*NVERCVAKGLIRPIHFPIPNIKTRPGCWASIHITSVLHR*RIV*SKQTS HSFFPHGLQCCKLC*NNT*HTAIAPVIRQWVWGDLATVRV*TPLVFVYTP PTVVCKH*FP IHYSISNIWLV*TNSCILRKWRNKNTIHIRGPKSQSNLGVFNRNVIPPQG LXHGLPAVSWLK*HITHXQ*LR* SDSECEAIWRLSVCKPPWFLYKHPRPVVCKH*FPI PYSISNICAV*TNSCILRKWLVKTLYTSG*PKSQSNLVVFNLSFILQYSGVAEINYSNM*AV >scf/ciona01/G126/seq_dir/hrs/G126P65096R.T0/G126P65096RG8.T0.seq 738 0 738 ABI TTTGACGCTGAAACTCCATGGTGGNAATTCGATACGTATCATTCTAGTGT TGCCAAGAGGTCCAATCTAACGTATGATGAGCGCCAATAGGCAATTAATC GGATAGCCTTAATACTTGCTCGTTTAGCCGTGTGTACTTTGTGTTTGGTG GTGATATTACTAAATGTTTGAGCAAGCGTTACAAAGTTTCTTCTTTTACT GGACTTAGTTTCAAATCCATGATGGGCTTGTTGCTTACACCATTTTCTAT ATTTAAGTCGGTATATGTATTGGTGGCGTTATCCTCCTGCCACACGACCG TACGGGCGATTTGAGCGACCTGCTTTTGCGTGTTAATAAATGAATCTCTA TGTTTAAAGGTTCGTGATCTTTTCATGGCGGCAACTGATACTACGTCATC TACCATTTGTTGGATCATTCTTTTCCTTTGCAAGAACACGGACGTCCAGA TTAAAATGCAAGAAGAAATAGATGAAGTGTTGGGGCAGAACGGAATCCTA AAATACGAGCTCGCCACCAAGATGCATTACGTTAGGGCTGTGATACAGGT TCGTGTGGATAGGATGTGACAAAACGTCGTGGGCATAATACGCTATTAAC AGACTTTCAACTCGAAACCGAAACACGGAACCAAAGACATAACCAATAAA ACGTTTGAACCATTGTGTTTCGAAATGGTTGCAACCACCGATCCATTTCC CGACTCCAAAAATAAAAACAAGCCATGTGTGAAGGCAT >scf/ciona01/G126/seq_dir/hrs/G126P65096R.T0/G126P65096RG8.T0.seq_1 738 0 738 ABI FDAETPWWXFDTYHSSVAKRSNLTYDERQ*AINRIALILARLAVCTLCLVVILLNV*ASV TKFLLLLDLVSNP*WACCLHHFLYLSRYMYWWRYPPATRPYGRFERPAFAC**MNLYV*R FVIFSWRQLILRHLPFVGSFFSFARTRTSRLKCKKK*MKCWGRTES*NTSSPPRCITLGL *YRFVWIGCDKTSWA*YAINRLSTRNRNTEPKT*PIKRLNHCVSKWLQPPIHFPTPKIKT SHV*RH >scf/ciona01/G126/seq_dir/hrs/G126P65096R.T0/G126P65096RG8.T0.seq_2 738 0 738 ABI LTLKLHGGNSIRIILVLPRGPI*RMMSANRQLIG*P*YLLV*PCVLCVWW*YY*MFEQAL QSFFFYWT*FQIHDGLVAYTIFYI*VGICIGGVILLPHDRTGDLSDLLLRVNK*ISMFKG S*SFHGGN*YYVIYHLLDHSFPLQEHGRPD*NARRNR*SVGAERNPKIRARHQDALR*GC DTGSCG*DVTKRRGHNTLLTDFQLETETRNQRHNQ*NV*TIVFRNGCNHRSISRLQK*KQ AMCEG >scf/ciona01/G126/seq_dir/hrs/G126P65096R.T0/G126P65096RG8.T0.seq_3 738 0 738 ABI *R*NSMVXIRYVSF*CCQEVQSNV**APIGN*SDSLNTCSFSRVYFVFGGDITKCLSKRY KVSSFTGLSFKSMMGLLLTPFSIFKSVYVLVALSSCHTTVRAI*ATCFCVLINESLCLKV RDLFMAATDTTSSTICWIILFLCKNTDVQIKMQEEIDEVLGQNGILKYELATKMHYVRAV IQVRVDRM*QNVVGIIRY*QTFNSKPKHGTKDITNKTFEPLCFEMVATTDPFPDSKNKNK PCVKA STLTGFVAIAPFLRHLPVFGMLYRKTMKFKQDIHDVIEKEIKEHEDTRDPKEPRDYVDSFLQAMEK (0) >scf/ciona01/G126/seq_dir/hrs/G126P608952R.T0/G126P608952RB12.T0.seq 763 0 763 ABI Length = 763 Plus Strand HSPs: Score = 157 (55.3 bits), Expect = 3.4e-11, P = 3.4e-11 Identities = 32/52 (61%), Positives = 39/52 (75%), Frame = +2 Query: 1 VRDLFMAATDTTSSTICWIILFLCKNTDVQIXMQEEIDELLGENGIPKLALA 52 VRDLFMAATDTTSSTICWIILFLCK ++ +++ + G+NGI K LA Sbjct: 602 VRDLFMAATDTTSSTICWIILFLCKTRTSRLKCKKKXMKWWGQNGILKYELA 757 G126P64401F.T0/G126P64401FH9.T0.seq 724 >scf/ciona01/G126/seq_dir/hrs/G126P618763R.T0/G126P618763RF3.T0.seq 724 0 724 ABI Length = 724 Plus Strand HSPs: Score = 406 (142.9 bits), Expect = 4.2e-41, Sum P(2) = 4.2e-41 Identities = 82/83 (98%), Positives = 83/83 (100%), Frame = +3 Query: 1 YRTYVILIILQDQNINGIKFRYRLIMHTFILYFYASVTKYKL*KFCVNLIQIG*QILVYT 60 YRTYVILIILQDQNINGIKFRYRLIMHTFILYFYASVTKYKL*KFCVNLIQIG*QILVYT Sbjct: 117 YRTYVILIILQDQNINGIKFRYRLIMHTFILYFYASVTKYKL*KFCVNLIQIG*QILVYT 296 Query: 61 LF*QTSVLGISGYITGPLTQLRV 83 LF*QTSVLGISGYITGPLTQLR+ Sbjct: 297 LF*QTSVLGISGYITGPLTQLRL 365 Score = 49 (17.2 bits), Expect = 4.2e-41, Sum P(2) = 4.2e-41 Identities = 9/15 (60%), Positives = 11/15 (73%), Frame = +2 Query: 76 GPLTQLRVVFILCHI 90 G ++VVFILCHI Sbjct: 341 GTTNTVKVVFILCHI 385 >scf/ciona01/G126/seq_dir/hrs/G126P618763R.T0/G126P618763RF3.T0.seq_1 724 0 724 ABI LRAELHVVEFVIQPNHVTLSTSFFKQWKRQSEVKILCKLIEHMLS*LYYKTKI*TV*SLG IDL*CTHLFSIFMHQ*QNINCKNSA*TLYK*ANKFWSTHCFNKLQF*ELVVTLRDH*HS* GCLYPLPYLTGMVLIN*ITGFNYFTGGNKSKLNQDGFADVQDGKLDPNWEPYSSFTIDQL TAMVIYLNGSGCG*TTNRNLVK*ISCGSLNCIVI*FLLETVMPDKQQL*YKLENGNTKIP VX >scf/ciona01/G126/seq_dir/hrs/G126P618763R.T0/G126P618763RF3.T0.seq_2 724 0 724 ABI SELSSMWWNS*SNPIT*LYRHLSSSNGKDRAK*KFYVNL*NICYLNYTTRPKYKRYKV*V *TYNAHIYSLFLCISNKI*TVKILRKPYTNRLTNFGLHIVLTNFSFRN*WLHYGTTNTVK VVFILCHI*LAWS*SIKSLGLIILQVVISQNSTKTDSLTYKMGNWIQTGNRTPHLP*IS* PQW*FI*TGLAVVKRPTVI*LNELVVVV*IV*LFNFY*KR*CQINNNCDTN*KTAIQKFQ L >scf/ciona01/G126/seq_dir/hrs/G126P618763R.T0/G126P618763RF3.T0.seq_3 724 0 724 ABI QS*APCGGIRDPTQSRDFIDIFLQAMEKTERSKNSM*TYRTYVILIILQDQNINGIKFRY RLIMHTFILYFYASVTKYKL*KFCVNLIQIG*QILVYTLF*QTSVLGISGYITGPLTQLR LSLSFAIFNWHGLNQLNHWV*LFYRW**VKTQPRRIR*RTRWEIGSKLGTVLLIYHRSAN RNGNLFKRVWLWLNDQP*FS*MN*LW*FKLYSYLIFIRNGNAR*TTIVIQIRKRQYKNSS >scf/ciona01/G126/seq_dir/hrs/G126P617020F.T0/G126P617020FA11.T0.seq_4 699 0 699 ABI LIYHRSANRNGNLFKRVWLWLNDQP*X*LNELVVVV*IV*LFNFY*KR*CQINNNCDTN* KTAIQKFQLW*LTWEVFKRTV*VYGIPLLLNNWVEWSRL*HLVSFIINIDSEYFAEITS* R*LLLVSFVGICTDITSFHQVIQFGN*EEANTTSVIRIILVLPRRPNLTYDKRQ*AINRI ALLLARLAVCTLCLVVILPNV*VSVTKFFLLLLGLVSNP*WACCGIPPQGENR >scf/ciona01/G126/seq_dir/hrs/G126P617020F.T0/G126P617020FA11.T0.seq_5 699 0 699 ABI HLP*IS*PQW*FI*TGLAVVKRPTVXLVK*ISCGSLNCIVI*FLLETVMPDKQQL*YKLE NGNTKIPVMVVNMGSFQTDSVGVWNTAFVKQLGGMVPFITPSLVYYKHR*RILCGNYKLK IITVGIVCWYLYRYHIISPSYSIWKLRRSQYYFRDTYHSSVAKEAQSNV**APIGN*PDS LITCSFSRVYFVFGGDITKCLSKRYKVFSSFTGLSFKSMMGLLRNSTTGREQX >scf/ciona01/G126/seq_dir/hrs/G126P617020F.T0/G126P617020FA11.T0.seq_6 699 0 699 ABI SFTIDQLTAMVIYLNGSGCG*TTNRNXS*MN*LW*FKLYSYLIFIRNGNAR*TTIVIQIR KRQYKNSSYGS*HGKFSNGQCRCMEYRFC*TIGWNGPVYNT*SRLL*T*IANTLRKLQVK DNYCWYRLLVFVPISHHFTKLFNLETEKKPILLP*YVSF*CCQGGPI*RMISANRQLTG* PYYLLV*PCVLCVWW*YYQMFE*ALQSFFFFYWA*FQIHDGLVAEFHHRARTX >scf/ciona01/G126/seq_dir/hrs/G126P612515F.T0/G126P612515FG9.T0.seq_1 715 (29) DSRPVVEFFQTDSVGVWNTAFVNNWVEWSRL*HLVSFIINIDSEYFAEITS*R*LLLVSF VGICTDITSFHQVIQFGN*EEANTTSVIRIILVLPRRPNLTYDKRQ*AINRIALLLARLA VCTLCLVVILPNV*VSVTKFFLLLLGLVSNP*WACC*NYFLYLSRYMYWWR*PFCHTTHD RFEWTALRVNK*TSMFKGS*SFHGGN*YYVIYHLLDHSFPLQEHGRPDXNARRNRRIVX >scf/ciona01/G126/seq_dir/hrs/G126P612515F.T0/G126P612515FG9.T0.seq_2 715 0 715 ABI ILALWWNSFKRTV*VYGIPLLLTIGWNGPVYNT*SRLL*T*IANTLRKLQVKDNYCWYRL LVFVPISHHFTKLFNLETEKKPILLP*YVSF*CCQGGPI*RMISANRQLTG*PYYLLV*P CVLCVWW*YYQMFE*ALQSFFFFYWA*FQIHDGLVAKTIFYI*VGICIGGVNRSATRPTT DLSGLLCVLINEPLCLKVRDLFMAATDTTSSTICWIILFLCKNTDVQIXMQEEIDELL >scf/ciona01/G126/seq_dir/hrs/G126P612515F.T0/G126P612515FG9.T0.seq_3 715 0 715 ABI FSPCGGILSNGQCRCMEYRFC*QLGGMVPFITPSLVYYKHR*RILCGNYKLKIITVGIVC WYLYRYHIISPSYSIWKLRRSQYYFRDTYHSSVAKEAQSNV**APIGN*PDSLITCSFSR VYFVFGGDITKCLSKRYKVFSSFTGLSFKSMMGLLLKLFSIFKSVYVLVALTVLPHDPRP I*VDCFAC**MNLYV*RFVIFSWRQLILRHLPFVGSFFSFARTRTSRLXCKKK*TNC >SEQUENCE 65, 78 81% TO SEQ 29 35% TO 2A6 may be in a cluster with 29 MEISVQSISSIFDTILLVLIVSYLTWHFWNQRSAWA PPGPRGLPFIGPITSIRIHPEHAMMKWNQQYGPVCMVRFGFKDILLLGSYEAAHEAL exon 1 VKNMDLADRPSNGIAVFKGGKGILMTKFGSYHQEQRRFSLNKLREYGMGRRALEPTI exon 1 LLYSNELCERIEKFGSKPFYIDMEIYKAISSTICHIVFGHNVIEENEDFKEIINTLN exon 1 KKSKLNVLSGILAFAPFLRFLPVFSTIHAKSVNFQQTLHALVRQEISEHEKTRDPKE exon 1 PRDYIDSFLNEMDK (0) exon 1 JOINT PROBLEM gc not gt DFRGQVDPNWKQYSSFTYEQLVAM (0) EST SUPPORT exon 2 from PNW on CRDLFMAGTDTTSSTTSWIILFLCRYPEVQRKMQEEADQVLGSNGEPKMALAEKMPYTRAVIQ (0) exon 3 EIARMRPTLPLSVPHCTTQDTMVMGYKIPKDTIVLTNIWGIHHDEKLWKNPYDFNPERHLDSNGNFV exon 4 KSSNIIQFNIGLRSCLGQQLAKMELFLLTTSLCRHFSFSVVGEVDMEGESMVTLRPCSMEVVATKRA* exon 4 DEV2228.x1 exon 1 supported by EST sequence AL669345.1 exon 1 EST sequence LQW149539.y1 exon 4 heme to end DEV34315.x1 LQW229649.x1 DEV46839.x1 LQW229649.x1 exon 1 LQW149539.x1 exon 1 LQW224871.y1 exon 1 to mid DEV46839.x1 exon 1 LQW18242.y1 exon 2 LQW277754.x1 exon 2 DEV46839.x1 exon 2 LQW224871.y1 exon 2 1 diff >sequence 29 9 accessions 33% to 1A1 in a cluster with 65 MEEYGIINSIKVAVDTVILVGLAIYLTWHFWNKRTPGGAPGPRGLPFIGAITSIRKHPEHAMMKWNQQYG PVCMVRLGFKDILLLGSYEAAHEALVKSPDFANRPPAHSIEVIAGGKGIVMIPFGPFHQEQRRFGLNALREH GMGRRALEPTVHLCAQELCERIEEYGSKPFNLDNEVY QSVSSIISRLVFGHDVVQENLEFRKMIFQMIEPNKLNILAGIL AFAPYLKHLPFFSEIHRKNKEFRLKMESSIRKEIEEHMETRDRKEPRDYIDSFLNEMEK (?) DEPNTKNEEWKQYSSFTQNQLIAM (0) LQW220722.x1 exon 1 LQW220722.y1 C-term of seq 65 gene cluster LQW162545.y1 exon 1 LQW202945.x1 exon 1 DEV48427.x1 exon 1 LQW72018.y1 exon 1 DEV21292.y1 exons 1, 2 GCiWno655_k19.b1 GCiWno749_o22.b1 GCiWno178_l07.b1 GCiWno714_n01.g1 exon 1 GCiWno709_e10.b1 exon 1 GCiWno143_b11.g1 exon 1 GCiWno201_d17.g1 exon 1 GCiWno809_g22.g1 exon 1 >DEV21292.y1_5 RSPPTSNTSRSSAKFTEKTKNLD*KWSRRFVKK*KNIWRHVTERNHVTTSTVS*TKWKNQ IKYQRQKV*TRTQKFQSQ*YVSTCPLSIVFITV*LI*YHHVCVTKNIAIRKNTYLKSKSC QPKKHYVLSIFADFPTDISQLAISAMTPTDEDEPNTKNEEWKQYSSFTQNQLIAMVYFTY IDVVVCLYV**NERTYSLFGVDIKX >GCiWno655_k19.b1_1 LHRQFLKRNGKIKSSTKGRRYKRVHKNFSHNNMSVLAR*V*FLSLFN*YNTIMFL*QRTS RLEKISI*SLKVANRKNITYCQYLPISRRIFHNSLF*Q*RLPTRTNRIQKTKNGNNIHLL PRTNLLLWYTLLI*MLWYVCTCDEMKERIAYLVLT*SHPV*GMAKKCHQTTQNTALYLYN NRLYMFVSASRLI*LYVFLYRVDYYHCR*TISKGGGGKKGXTXNT*YXE*X*XVFL*IKX RVL*KVGRDXGFIN*FGMVFWFKXXMGKKNT*FEEKGGVIFXXKXIYKX >GCiWno655_k19.b1_2 YIDSFLNEMEKSNQVPKAEGINAYTKISVTTICQYLPVKYSFYHFLINIIPSCFCDKEHR D*KKYLFKV*KLPTEKTLRIVNICRFPDGYFTTRYFSNDAYRRGRTEYKKRRMETIFIFY PGPTYCYGILYLYRCCGMFVRVMK*KNV*LIWC*HKATRYKEWLKNATKQHKTPPCIYII TVYICLFQHRV*FNYTYFYTEWIITIVDRLLVKGGGERRGXX*IHNXXNRXDXCFYKLXK GFCERWGGIXVL*IDLEWFFGLKXKWERRILNLRKKVVLFFXKXLYIN >GCiWno655_k19.b1_3 TSTVS*TKWKNQIKYQRQKV*TRTQKFQSQQYVSTCPLSIVFITF*LI*YHHVFVTKNIA IRKNIYLKSKSCQPKKHYVLSIFADFPTDISQLAILAMTPTDEDEPNTKNEEWKQYSSFT QDQLIAMVYFTYIDVVVCLYV**NERTYSLFGVDIKPPGIRNG*KMPPNNTKHRPVSI** PSIYVCFSIAFDLTIRIFIQSGLLPLSIDY**RGGGKEGXXXKYIIXRIGXIXVFIN*XK GFVKGGEGXGFYKLIWNGFLV*KXNGKEEYLI*GKRWCYFXXKXYI* >GCiWno495_k23.b1 CHROMAT_FILE: GCiWno495_k23.b1 PHD_FILE: GCiWno495_k23.b1.phd.1 CHEM: term DYE: big TIME: Tue Oct 16 10:59:14 2001 TEMPLATE: GCiWno495_k23 DIRECTION: fwd Length = 869 Score = 121 bits (300), Expect = 2e-27 Identities = 62/65 (95%), Positives = 62/65 (95%), Gaps = 3/65 (4%) Frame = +2 Query: 1 NERTYSLFGVDIKPPGIRNG-KMPPNNTKHRPVSI--PSIYVCFSIAFDLTIRIFIQSGL 57 NERTYSLFGVDIKPPGIRNG KMPPNNTKHRPVSI PSIYVCFSIAFDLTIRIFIQSGL Sbjct: 113 NERTYSLFGVDIKPPGIRNG*KMPPNNTKHRPVSI**PSIYVCFSIAFDLTIRIFIQSGL 292 Query: 58 LPLSI 62 LPLSI Sbjct: 293 LPLSI 307 >GCiWno495_k23.b1_1 RIQKRKMETIFIFYPGPTYCYGILYLYRCCGMFVRVMK*KNV*LIWC*HKATRYKEWLKN ATKQHKTPPCIYIITVYICLFQHRV*FNYTYFYTEWIITIVDSTI**XVGXDGTP*IHNM RID*S*HKQLTTGCERTRGVGSITH*MSMCYYLM*IYSYSTDG*IIIFHTTIAVYMLPV* RLRGYCYNQRILNGLPNVLSFHKSVNTRKK**LSKKNT*KLLDSHEVQNTAVVITTHTSR PCLDIKSLKHGYTLMDATLSPGC*KTTLKTRLTMPLKKMGRLLGSIEYPP >GCiWno495_k23.b1_2 EYKNEKWKQYSSFTQDQLIAMVYFTYIDVVVCLYV**NERTYSLFGVDIKPPGIRNG*KM PPNNTKHRPVSI**PSIYVCFSIAFDLTIRIFIQSGLLPLSIVLYSXGWGXMGHLRYIIC E*TDRDINS*QRAVKELEESVL*PIECPCATI*CEYIHILLMGESLYSTLLLLSICYRSR GSEAIVTTNGFLMVCPMYYPSISLSIHARNNDYPKRIRENS*IPTRCRTPLLL*QPILPG HAWI*KVSNMDIL*WMQHYHLVVERLHLKPVLPCL*KKWGDYWDLLSIPX >GCiWno495_k23.b1_3 NTKTKNGNNIHLLPRTNLLLWYTLLI*MLWYVCTCDEMKERIAYLVLT*SHPV*GMAKKC HQTTQNTALYLYNNRLYMFVSASRLI*LYVFLYRVDYYHCR*YYIVXGGEXWDTLDT*YA NRLIVT*TVNNGL*KNSRSRFYNPLNVHVLLSDVNIFIFY*WVNHYIPHYYCCLYVTGLE AQRLLLQPTDS*WSAQCIILP*VCQYTQEIMTIQKEYVKTLRFPRGAEHRCCYNNPYFPA MLGYKKSQTWIYSDGCNIITWLLKDYT*NPSYHAFEKNGAIIGIY*VSP >GCiWno47_e18.g1_1 XVSLAHW*RIGXSVPMVKIKSSTKGRRYKRVHKNFSHNNMSVLAR*V*FLSLFN*YNTIM FV*QRTSRLEKIPI*SLKVANRKNITYCQYLPISRRIFHNSLFQQ*HLPTRTNGIQKTKN GNNIHLLPRTNLLLWYTLLI*MLWYVCTCDEMKERI*LIWC*HKATRYKEWLKNATKQHK TPPCIYNNRLYMFVSASRLI*LYVFLYRVDYYHCR*YYIVRXXHSPPLYHHLHLSNAPHL PSIISPFLTSPHPLSKPSHTPIHIPAHLLLPPAHPHHRTYSTTLPLPPPPTVTHPSHLVP LTTPLRALPPLPPTPVLSPQ >GCiWno47_e18.g1_2 L*V*HIGNALXXRYPW*KSNQVPKAEGINAYTKISVTIICQYLPVKYSFYHCLINIIPSC LCDKEHRD*KKYLFKV*KLPTEKTLRIVNICRFPDGYFTTRYFSSDTYRRGRTEYKKRRM ETIFIFYPGPTYCYGILYLYRCCGMFVRVMK*KNVYSLFGVDIKPPGIRNG*KMPPNNTK HRPVSIITVYICLFQHRV*FNYTYFYTEWIITIVDSTI*YAPXTPXPSITTYTFQTPPTF PLSSPPFLLPHIHSLSPPTHPSTFPPISYSPLHTRITALTQQHFLSRPPPPSPTHLTSYL LLHHSAHSPLSRLLPSSHL >GCiWno47_e18.g1_3 CKFSTLVTHWXLGTHGKNQIKYQRQKV*TRTQKFQSQ*YVSTCPLSIVFITV*LI*YHHV CVTKNIAIRKNTYLKSKSCQPKKHYVLSIFADFPTDISQLAISAVTPTDEDERNTKNEEW KQYSSFTQDQLIAMVYFTYIDVVVCLYV**NERTYIAYLVLT*SHPV*GMAKKCHQTTQN TALYL**PSIYVCFSIAFDLTIRIFIQSGLLPLSIVLYSTXPPLPXPLSPLTPFKRPPPS LYHLPLSYFPTSTL*ALPHTHPHSRPSPTPPCTPASPHLLNNTSSPAPPHRHPPISPRTS YYTTPRTPPSPAYSRPLTS >sequence 2,3,9,44, 45 COMPLETE 81 accessions 94% to sequence 1 40% to 2U1 MVLQLLSDINVSSLVIFFTAFLALYYWYTRPKNFPPGPRGVPFLGVIPFLGNYPERVMRKWSKKYGPVMSVRMG REDWVVLGDYETIQQ (0) SLVKQGQCFSGRPDVPVLNQITNGHGLITVDYNEDWKTQRRFGITTLRG (2) FGVGKRSMEDRIVEEVAYLNDAIRSHNEKPFDIL (0) SILSNAVSNNICSVVMGRRFDYDDKRFMEIMARLSRS (2) FNDPTANFALNVVMFMPILVKIPPFSRINNQLMTDVRVI (1) LQMLREILSEHKSTFNKDDVRDFIDAFIAEQNSESKHSSYT (0) DLQLLQYVRDLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVI (1) GQDRVPAMNDKAQMPYTCAFMQEVFRYRTLVPLSVVHMTNQDVVLNGYTIPKGTT (0) ISPNLWAVHNNPDVWDEPSKFKPERHLDDKGNFVQSKHVIPFSIGPRHCLGEQLARMEYFIYLVSMV QKFEFFPDPNEPDLPDVEDGSSGVVFVPLRFKQIAKIV* rciad81k12 EST rcieg32b06 EST = AV862083 rciad45g08 EST rciad44e10 EST rciad47d10 EST DEV16203.x1 DEV25023.x01 DEV25023.x1 = SEQ 44 DEV25395.x1 small deletion 8aa DEV36142.x1 DEV36161.y1 DEV36161.x1 = SEQ 1 DEV43341.y1 DEV43341.x1 = SEQ 9 THIS MAY BE N-TERM DEV46240.y1 DEV46240.x1 = SEQ 1 DEV6477.x1 DEV8789.x1 DEV8789.y1 = SEQ 9 DEV9515.y1 DEV9515.x1 = SEQ 1 LQW12658.y1 LQW132813.x1 LQW156838.x1 LQW164355.y1 LQW164355.x1 = SEQ 9 LQW176676.y1 LQW188497.y1 LQW189083.y1 LQW189083.x1 = SEQ 9 LQW193177.y1 LQW198468.x1 LQW198468.y1 = SEQ 1 LQW206936.y1 LQW210436.x1 LQW210436.y1 = SEQ 9 LQW211598.x1 LQW212168.x1 LQW21261.y1 LQW224972.x1 LQW227602.x1 LQW227602.y1 = SEQ 1 LQW228810.x1 LQW229022.y1 LQW231535.y1 LQW232410.y1 LQW234563.x1 LQW249118.y1 LQW249118.x1 = SEQ 9 LQW25924.x1 LQW265547.y1 LQW268100.x1 LQW272015.x1 LQW278692.y1 LQW35104.x1 WXXP TO HEME LQW9894.x1 DEV13827.x01 note: DEV13827.y1 = seq 1 may be opposite end of gene DEV13827.x1 DEV16357.y1 DEV1636.x1 DEV17399.x1 15 aa deletion after TIQQ DEV19053.y1 DEV24912.y1 DEV25110.x01 DEV25110.x9 DEV25829.y1 DEV30184.x1 DEV34783.x1 DELETION OF SHNEKPFDIL DEV35744.x1 DEV36429.x1 DEV39712.y1 DEV43341.x1 DEV48144.y1 DEV50104.y1 DEV8789.y1 LGK545.y1 LQW103513.y1 LQW151967.y1 LQW164355.x1 LQW182856.y1 LQW184127.x1 LQW188756.x2 OPPOSITE END IN SEQ 1 LQW189083.x1 LQW210436.y1 LQW214090.y1 LQW21815.y1 LQW221848.y1 LQW226594.x1 HEME LQW226690.y1 LQW236384.y1 LQW249118.x1 LQW258179.x1 LQW36428.x1 LQW41750.x1 LQW60970.x1 LQW65773.x1 LQW8464.x1 LQW89091.y1 LQW96601.y1 >CIONA SAVIGNYI SEQUENCE 71% TO CIONA INTESTINALIS seq 2 70% TO SEQ 4 This sequence carefully checked for contigiuity between exons This sequence is not hybrid between multiple genes MLQRMLNEINVSTSFIFLTVFLGLYYWYRRPKNFPPGPRGIPFLGVLPFLGNYPERKMRK WSNKYGPVMSVRMGRQDWVVLGDHETIQQ (0) GLVKHGNAFSGRPSIATIDQITEGHGVLFIDYNDHWKRQRRFGLSTLRG (2) FGVGKRSMEDRITEEVAYLNDAIRTHDGKAFDIQ (0) SILSNAVSNNICSIVMGRRFDYDDERFKEIMGRLARG (2) FNDPEASFVLQILIFMPALINFPYFSRINGELMEDVRVI (1) PELLREIVEEHKASYEQDNHRDFIDAFLGEQKAENGAKTFT (0) DTQLLQYVRDLFVAGTETTTSTVRWSLLCLIHNPETQEKLRKEIFEVL (1) GPEKIPAFENKSKMPYTSAFIQEIYRYRTLVPLSVTHMTNEDAHISGYTIPKGTT (0) IAPNLWAVHNDPEEWDEPNKFKPERHLDAGGNFVQLKHVIPFSVGPRHCLGEQLARMEVF IFLVSLVQKFEFLPDPKATVLPDIENGASGAAYVPLPFKIVAKVV* Accession length (datafile) exon # G126P600183F.T0/G126P600183FG2.T0.seq 711 (13) exon 1 G126P69914R.T0/G126P69914RA5.T0.seq 727 (10) exon 1 G126P600628R.T0/G126P600628RB7.T0.seq 710 (08) exon 1 walked to exon 2 G126P616258F.T0/G126P616258FG2.T0.seq 675 (37) exon 2 G126P606888F.T0/G126P606888FD6.T0.seq 758 (25) exon 2 G126P69517R.T0/G126P69517RE7.T0.seq 708 (12) exon 3 G126P64550R.T0/G126P64550RF9.T0.seq 795 (00) exon 4 G126P64980F.T0/G126P64980FE12.T0.seq 726 (03) exon 4, 5 G126P600445F.T0/G126P600445FB7.T0.seq 711 (08) exon 4 G126P601719R.T0/G126P601719RH9.T0.seq 739 (13) exon 4 G126P602293R.T0/G126P602293RE9.T0.seq 739 (13) exon 4 G126P611387R.T0/G126P611387RG7.T0.seq 717 (25) exon 4, 5 G126P67490R.T0/G126P67490RD8.T0.seq 731 (04) exon 4, 5, 6 G126P68083F.T0/G126P68083FC9.T0.seq 731 (07) exon 4, 5, 6 G126P64682R.T0/G126P64682RH9.T0.seq 733 (02) exon 6, 7 G126P69523R.T0/G126P69523RG9.T0.seq 733 (??) exon 6, 7 G126P69883F.T0/G126P69883FD3.T0.seq 738 (10) exon 8, 9 G126P609473F.T0/G126P609473FC2.T0.seq 761 (24) exon 8, 9 G126P606736F.T0/G126P606736FH9.T0.seq 692 (20) exon 8, 9 G126P611477F.T0/G126P611477FF12.T0.seq 950 (41) exon 9 >Second savignyi whole gene ortholog to seq 2/4 Checked for contiguity between exons not a hybrid gene 68% to seq 2 and seq 3, 78% to first savignyi ortholog of seq 2/4 MLQRVFNEINVSTGFVVLTVFLALYYWYRRPKNYPPGPRGIPFLGVLPFLGNYAERTMHK WSKKYGPVMSVRMGRQDWVFLGDHETIRQ (0) ALVNQGNSFSGRPLIATLDQITEGHGIVLLDYGDWWKRQRSFGFSTLRG (2) FGVGKRSMEDRITEEVAYLNDAIRSHDGKAFDIK (0) SILSNAVSNNISSIVMGRRFEYDDEHSKEIMARLAMG (2) FNDPDTSFFLQILIFMPACVHLPYFSRVNKKLMEDVHVTR (1) SELLREIIAEHKASYDQDNHRDFIDAFLGEHNAENGTDAFT (0) DKQLLHYVRDLFFAGSETSTSTLRWTLLCLIHHPEKQEKLRKEIFEVL (1) GQEKIPAVDNKAYMPYTCAFMQEVYRYRTLAPFGVAHMTNEDVNLNGYSIPNGTT (0) IYVNLWAVHNNPDVWDEPNKFKPERHLDDKGNFVQSNHVIPFSVGPRHCLGEQLARMEIFIYL VSLVQKFEFLPDPDATELPDIENGSYGPICAPKPFKMVAREV* G126P66001F.T0/G126P66001FD9.T0.seq 747 (07) exon 1, 2 G126P600523F.T0/G126P600523FG11.T0.seq 708 (08) exon 2, 3 G126P600643F.T0/G126P600643FC9.T0.seq 725 (09) exon 2, 3 G126P69906R.T0/G126P69906RE4.T0.seq 969 (12) exon 3 walked from RE4 to FC8 G126P605356F.T0/G126P605356FF5.T0.seq 762 (20) exon 4 G126P69993F.T0/G126P69993FC8.T0.seq 717 (09) exon 4, 5 intron 3-4 = 1600bp G126P603029R.T0/G126P603029RF12.T0.seq 943 (15) exon 4, 5 G126P603996F.T0/G126P603996FA6.T0.seq 739 (15) exon 5, 6 G126P66969R.T0/G126P66969RF11.T0.seq 710 (03) exon 6 walked to exon 7 G126P66256F.T0/G126P66256FC11.T0.seq 964 (05) exon 7 G126P604570R.T0/G126P604570RD6.T0.seq 735 (14) exon 7, 8 G126P604249F.T0/G126P604249FC7.T0.seq 711 (16) exon 7, 8 G126P612840R.T0/G126P612840RC1.T0.seq 711 (29) exon 7, 8 G126P612199R.T0/G126P612199RD4.T0.seq 742 (32) exon 7, 8 walked to exon 9 G126P607416R.T0/G126P607416RF5.T0.seq 731 (21) exon 9 G126P608773F.T0/G126P608773FA7.T0.seq 728 (23) exon 9 G126P608264R.T0/G126P608264RF7.T0.seq 993 (24) exon 9 >related savignyi 2/4 like exon sequences (probably two more closely related genes) TLVKQGSIFSGRPSIPILEEMTKGHGILLLDYGEKWKSQRKFGLMTLRG (2) GLVKQGTAFSGRPSIDIIERVSKGNGMIFLNYDEHWKKQRRFGLSTLRG (2) = RB10 FGVGKRSMEDRITEEVAYLNDAIRTHDGKAFNIQ (0) = RB10 SILGNAISNNICSIVMGRRFDYDDERFKEIITRLARR (2) FNDPEVSLVRQILIFMPALVNAPYFSRINAELMENVRVI (1) FIDPEVSSALQIFVFMPALVNFPYFSRIYGELMKDVRVI (1) PESLREMVEEHKASYEQDNHRDFIDAFLGEQKAENGAKTFT (0) SELLREIVADHKALYDQDNHRDFIDAFLGEQKSENGSETFT (0) DMQLLHYVRDLFVAGTETTTSTLRWSLLCLIHDPEIQDKLRKEIFEVL (1) GQEKIPAFEDKSKMPYTRAFIQEIYRHRTLLPLSVTHMTNEDANICGYTIQKGTT (0) ISSNLWAVHNDPDVWNEPSKFKPERHLDDKGNFVQSSHVIPFSVGPRHCLGEQLARME VFIYLVSLVQKFEFLPDPDATELPDIKIGSNGPAYVPLPFNMVARVV* IAPNLWAVHNDPVVWDEPNKFKPERHLDADGNFVQLKHVIPFSVGPRHCLGEQLARMEVF IFLVSLVQKFEFLPDPKAKVLSDNENGASGAAYVPLPFKIVAKVV G126P61537F.T0/G126P61537FD1.T0.seq 721 (00) exon 1 G126P64657R.T0/G126P64657RH5.T0.seq 766 (01) exon 1, 2 G126P69683F.T0/G126P69683FC11.T0.seq 762 (08) exon 2 G126P65262R.T0/G126P65262RC7.T0.seq 736 (07) exon 2 G126P68944R.T0/G126P68944RB10.T0.seq 738 (09) exon 3 G126P64729R.T0/G126P64729RG12.T0.seq 725 (00) exon 3, 4 G126P608695R.T0/G126P608695RC1.T0.seq 731 (21) exon 5 partial G126P612819R.T0/G126P612819RB12.T0.seq 726 (30) exon 4, 5 G126P65190R.T0/G126P65190RF6.T0.seq 753 (03) exon 5, 6 G126P67778F.T0/G126P67778FG5.T0.seq 719 (05) exon 6 G126P607271F.T0/G126P607271FG11.T0.seq 775 (20) exon 6, 7 G126P609438F.T0/G126P609438FB4.T0.seq 709 (22) exon 7 G126P64695R.T0/G126P64695RH10.T0.seq 752 (01) exon 8, 9 G126P601373R.T0/G126P601373RB4.T0.seq 705 (09) exon 9 >sequence 4, 8, 92 (48 accessions) 83% to sequence 2, 38% to 2U1, 2R1, 2D6 faces away from seq 220 on same clone note the end of seq 4 is identical to the end of seq 1 MLQHLLGDINVSSLVIFFTAFLALYYWYTRPKNFPPGPRGVPFLGVIPFLGNY PERVMRKWSKKYGPVMSVRMGREDWVILNDYENIQK (0) ALVKQGHSFSGRPDIPVFTQINNGMGLLTVDYNDHWKMQRRFGITTLRG (2) FGVGKRSMEDRIVEEVAYLNDAIRSHNDKPFDIL (0) GVLSNAVSNNICSIVMGRRFDYDDERYKEIMFRLSRS (2) TKDPEANFYITVLMFVPFLVNFPPFSRINKEMMDDVKVILG (1) DHLDEIVSEHKSTFNKDDARDFIDAFIAEKNSQNKHSSFT (0) DSQLLHYVVDLFEAGTETTTSTLMWSILCMIHNPEKQEKLRKEICSVV (1) GQDRVPAMNDKAQMPYTCAFMQEVFRYRTLVPLSLMHMTNEDVVLNGYNIPKGTT (0) VSPNLWAVHNDPDVWDEPSKFKPERHLDDKGNFVQSKHVVAFSVGPRHCLG EQLARMEYFIYLVSMVQKFEFLPDPNEPNLPDIEKGSNGAAFVPLPFKQIARVV* DEV19056.x1 exon 1 LQW246757.y1 exons 1, 2 LQW195694.x1 exons 1, 2 LQW41553.y1 exons 1, 2 DEV29656.x1 exons 1, 2 LQW242270.y1 exons 1, 2, 3, 4 OPPOSITE END = SEQ 220 (GENE CLUSTER?) LQW188756.x2 exons 3, 4 DEV55352.x1 exon 4 LQW252475.y1 exons 5, 6 opposite end .x1 = seq 220 (- strand) LQW36797.x1 exons 5, 6 LQW263538.y1 exons 5, 6, 7 LQW26095.x1 exons 5, 6, 7, 8 LQW269368.y1 exons 5, 6, 7, 8 DEV40081.y1 exons 6, 7, 8 DEV29656.y1 exons 7, 8 LQW221848.x1 exon 8 LQW174458.x2 exon 8 LQW111344.x01 exon 8 LQW60970.y1 exon 8 LQW8752.x1 exon 8 LQW246757.x1 exon 8 LQW145059.x1 exon 8 LQW145059.x2 exon 8 LQW187803.y1 exon 8 LQW103513.x1 exon 8 DEV37657.y1 exon 8 DEV37657.y2 exon 8 DEV39543.y1 exon 8 LQW224972.x1 exon 8 LQW212168.x1 exon 8 LQW46430.x1 exon 8 DEV9515.y1 exon 8 LQW259311.x2 exon 9 LQW259311.x1 exon 9 DEV36161.x1 exon 9 DEV46240.x1 exon 9 LQW95486.y1 exon 9 LQW258179.y1 exon 9 DEV9515.x1 exon 9 LQW146181.y1 exon 9 LQW227602.y1 exon 9 LQW198468.y1 exon 9 LQW183999.y1 exon 9 DEV13827.y1 exon 9 LQW188756.y1 exon 9 DEV39712.x1 exon 9 DEV19056.y1 exon 9 DEV5183.x01 exon 9 >SEQUENCE 211 94% to seq 4, 4 diffs probably = seq 4 opposite end = seq 2 689 PERHLDDQGTFVQSKHVVAFSVGPRHCLGEPLARMEYLIYLVSMVQKFEFLPDPNEPNLP 510 509 DIEKGSNGAAFVPLP 465 LQW211598.y1 HEME >SEQUENCE 27, 28, 220 SIMILAR TO SEQ 2 and seq 8 BUT NOT SAME SEQ Faces away from seq 8 on same clone There appear to be at least two and maybe three closely related sequences MLTNLIANPSISPVLAILSCVIAFYYWYKRPKNMPPGPRGIPFLGIIPFVGMN PEQAFMQWSKKYGPVITVRMGRKDWVVLCDHDTIHQ (0) VLVKQSTVCSGRPKIPIVSELSKGHGILFADYCEKWKSQRKFGMKTLRE (2) FGVGKKCTEDRVLEEVDFLCNEIRSKNGKPFDIQ (0) DIMCNAVSNIIMNIVIGRRCNYDENFFTDVISRFTKW (2) FNDPTAGAMFTGMMFLPQLKYVPPFSKYYKIFRDDIGALH (1) EFFEEVIKEHEKNFDGNNLRDFIDAFLLEMKKNESGSEFT (0) YIQLLNYIRDLFDGGTETTVSTSRWAILCMLHYPETQKKLRNEIMTII (1) GPNTPASMSHKSDMPYTCAFIQEVLRFRTLVPLSVPHKVNEDATVNGYTIPKGVT (0) VSPNLWAVHNDPDVWDEPSKFKPERHLDDKGNFVQSNHVIPFSVGPRHCLGEQLARMEIFIFL ISMVQKFEFLPDPNEPDLPEINHGTNGAAFVPLPYKIVANQI* LQW219274.y1 upstream of exon 6 opp end = exon 1 DEV10453.x1 exon 1 LQW219274.x1 exon 1 LQW242270.x1 exon 1 opposite end .y1 = seq 4 LQW252475.x1 exon 1 plus 711 bp upstream LQW275290.x1 exon 2 LQW195694.y1 exon 2 opposite end .x1 = seq 4 LQW212515.y1 exon 2, 3, 4 LQW211000.y1 exon 3, 4 LQW173295.y1 exon 3, 4 DEV3674.y1 exon 3, 4 LQW275290.y1 exon 6, 7 2 aa diffs I-HELIX DEV23276.x1 exon 6 2 DEV10453.y1 exon 6 2 LQW212515.x1 exon 7, 8 LQW268927.y1 exon 7, 8 LQW173295.x1 exon 8 DEV3674.x1 exon 9 LQW211000.x1 exon 8 DEV21239.y1 exon 9 one diff with 18, 23, 27, 55 DEV40662.y1 >sequence 42, 59, 218 36% TO 2U1 Fugu MLSLFFSSVSIFFRCFSFLFNSWTLTFATSVLLLLVIMDKTD KKMPGSPPGPRGLPILGMLPFMMSYPERLMADWSKKHGPVIM (0) VKMGPKNVVILGSSDAAHAAFVKNTHLANRPQDGLEIFAGGKGILFINS SMFHSEQRRFCLSALREFGMGRRTLEPKIVDCAALLCDQIDDVCGHDVST (1) GPIQIEQMIYVTMSNVISHLVFGHDSLNDNKGLCELLLRTIEPNKYNALAGILMFLP SLKNVPPFSTTTRRAIEFREDLHRYIKMEIDRHRASRDPNQPRDFIDKFLNEIEKIKVRHNSNNNNNNNLILNNNVK (1) GSKSRRKIAGASFSEDQLIPLVRDLFMAGTDTSSTTITWVVIFLASFPDVQTRLHEELDSVLGQNRTPSVSMEDKMPYMRAVIQ (0) ETFRMRPPLPLSVPHVAQCNTTLMGYRVPKDSIILTNTWGIQNNPKFWVDPDTFKPQRHIDDLGKFIKSPNVI PFNIGSRNCLGQQLAKMELFITIASLCRRFWFTLPTGETPDLKGESTFILRPFPFNVVATKRV* DEV45222.y1 exon 1 LQW242739.x1 exon 1 LQW242739.x2 exon 1 LQW131160.y1 exon 1 LQW33948.y1 exon 1 LQW135435.y1 exon 1 DEV15725.y2 exon 1 DEV15725.y1 exons 1, 2 LQW185195.y1 exons 1, 2 AV963814.1 EST exons 2, 3 AV963844.1 EST exons 2, 3 AV957999.1 EST exons 2, 3 LQW181338.x1 exon 3 LQW181338.x3 exon 3 LQW74897.y1 exon 3 LQW158751.y1 exon 3 DEV35314.x1 exon 3 DEV35314.x4 exon 3 AV852807.1 EST exon 4 DEV57124.y1 exon 4 LQW47584.x1 exon 4 LQW167366.x1 exon 4 2 diffs LQW32310.x1 exon 4 DEV29829.x1 exons 4, 5 LQW33948.x1 exons 4, 5 DEV50829.x1 exons 4, 5 LQW131920.x1 exon 5 LQW185195.x1 exon 5 LQW220705.x1 exon 5 DEV45222.x1 exon 5 >sequence 5 4 accessions to sequence 1 PKG to heme 42% TO 2R1 VLTNIWRVHNNQNVWKNPHEFRPDRHLDSNGNFVSSNNVIPFACGYRRCLGEQIAKAE IFLFIVNIVKRFHLVVDQVTGPPTLEKDPKGAVNTPAPF LQW185918.x1 DEV58821.x2 DEV58821.x1 LQW152115.x1 PERF TO END LQW228498.x1 HEME 2 DIFFS GCiWno174_g15.g1 >GCiWno174_g15.g1 NTTTATGCCTGGNCNCAGAGGATGCAAAATTGCGTGTCTACTGGAACACTGTGTATGATCATGGACTGATGCCTTCTTAT AATATTATCTGCTATGAGCTGTATTTATTTATTAAAAGCTGTATTTTTGTAGCAAAAGTGTGTAAGTAAAGCAGGATTAT ATATAGATATGAAACTGTTTAAAACGTGTGCTTAACAAATTGTGCTGTCAGTTTTTTCTCGCTCGAACGCTGAAACGAAA AGGTGCTGGCGTGTTCACGGCTCCCTTAGGATCTTTTTCCAACGTCGGCGGACCGGTTACTTGATCCACCACCAAGTGAA ACCGTTTGACAATATTTACTATAAAAAGAAATATCTCTGCTTTGGCTATTTGCTCGCCCAAACAACGCCTATAACCACAT GCAAAAGGAATGACGTTGTTAGATGAGACGAAATTGCCGTTGCTGTCAAGATGACGATCGGGTCGAAACTCGTGTGGATT TTTCCAAACATTTTGATTATTGTGGACCCTCCAAATGTTGGTAAATACCTATATGTTAGAATTAAGCACAAAACGTACAT GTTATACTTTATTATATATATCATTATTAATGTAACTTATTTATCCTAGCCTGACAGGGCAACGCCAGTCTCCAAAACAG AGGCGTTCTGTCCTACATATCATGTCCGCTTATACGAGTTACCACTTATATAACTTCATAGGCGATTTTTTTGGTTATTT TTGTTCAACGTCTGGCTGCCAATTTAGACGACCACATAAGGTAGACCCATATGGGCTGATGTGTGCTGATTGACCAATGT ACTTACTGGAGTATCTTTAGGAATGTCATAACCGGACCATGGCACGCTTCCAACAGTTCGATGAAGCAGATTCCCCGTGG CAATGGGATCGTGCCGGTGTTTTTCTTGTATAAACCAACG >GCiWno174_g15.g1_4 LVYTRKTPARSHCHGESASSNCWKRAMVRL*HS*RYSSKYIGQSAHISPYGSTLCGRLNW QPDVEQK*PKKSPMKLYKW*LV*ADMICRTERLCFGDWRCPVRLG*ISYINNDIYNKV*H VRFVLNSNI*VFTNIWRVHNNQNVWKNPHEFRPDRHLDSNGNFVSSNNVIPFACGYRRCL GEQIAKAEIFLFIVNIVKRFHLVVDQVTGPPTLEKDPKGAVNTPAPFRFSVRARKN*QHN LLSTRFKQFHIYI*SCFTYTLLLQKYSF**INTAHSR*YYKKASVHDHTQCSSRHAILHP LXPGIX >GCiWno174_g15.g1_5 VGLYKKNTGTIPLPRGICFIELLEACHGPVMTFLKILQ*VHWSISTHQPIWVYLMWSSKL AARR*TKITKKIAYEVI*VVTRISGHDM*DRTPLFWRLALPCQARINKLH***YI**SIT CTFCA*F*HIGIYQHLEGPQ*SKCLEKSTRVSTRSSS*QQRQFRLI*QRHSFCMWL*ALF GRANSQSRDISFYSKYCQTVSLGGGSSNRSADVGKRS*GSREHASTFSFQRSSEKKLTAQ FVKHTF*TVSYLYIILLYLHTFATKIQLLINKYSS*QIIL*EGISP*SYTVFQ*TRNFAS SXXRHKX >GCiWno174_g15.g1_6 RWFIQEKHRHDPIATGNLLHRTVGSVPWSGYDIPKDTPVSTLVNQHTSAHMGLPYVVV*I GSQTLNKNNQKNRL*SYISGNSYKRT*YVGQNASVLETGVALSG*DK*VTLIMIYIIKYN MYVLCLILTYRYLPTFGGSTIIKMFGKIHTSFDPIVILTATAISSHLTTSFLLHVVIGVV WASK*PKQRYFFL**ILSNGFTWWWIK*PVRRRWKKILREP*TRQHLFVSAFEREKTDST IC*AHVLNSFISIYNPALLTHFCYKNTAFNK*IQLIADNIIRRHQSMIIHSVPVDTQFCI LXXQA*X >sequence 7, 100, 101 complete 19 accessions 36% to 2J2, 36% to 2Y1 MLDYLTFTNLALFAIALLLFYIWLTPKYKNLPPGPMGVPFLGCLPFMETLAERTFTKWSKKYGPI ITVQLGDHRTVILNSYEAIEE (0) AFIKKGEKFNGRFKTYFTEFASEGLGMVFIDGEKWKEHRKFGTRALAG (2) AGMYGKTIEQRVLEEAENICHVIRSKNEEPFILE (0) DDLILSVANVINGITIRERCDEEGNENLLKYAAIVVEG (2) FRKDGLIYSLLSVIPWCRFFPQTQKHIKSLKDGLKAGNGKTF (1) agt TLFDNLIEQHQQQHDRLHPRDLIDLYLNQMKDFS (0) KPQLRYFLKDLFAAGTETSSSTIRWALFYLIVNPDIQDKVHKEIDDVI (1) GHNGVVRYDTKLPYTKAVLQETYRIRTATPLGVPRRNTEDVTLMGYFIPKNTQ (0) IIPNLWWVHNDPEYWNEPDVFKPERHLDEEGNLIMSNRVIPFSIGARHCLGENLARTEIFL FLVSILQKFTVLPNPEDPNPPLECSPGIVNSPHKYPLIMKER* AV956864 EST exons 1, 2, 3, 4 and part of 5 LQW15076.y1 exons 4, 5 DEV13161.x01 exon 5 LQW241946.y2 exon 5 LQW148541.y1 exon 5 DEV38450.x1 C-helix LQW169782.x1 LQW189302.y1 LQW189302.x1 N-TERM LQW211779.y1 LQW243977.y1 LQW243977.x1 mid LQW247662.y1 LQW247662.x1 C-helix LQW155205.x1 C-helix LQW266480.y1 LQW70591.x1 LQW70591.y1 C-helix LQW70591.y2 C-helix LQW208910.x1 DEV43834.y1 N-TERM DEV8515.y1 LQW145047.y2 C-helix LQW25145.x1 mid GCiWno946_o03.g1 ex 7 GCiWno41_m16.g1 ex 6 DFCRKEILEHKKNLDENEPGDYIDAFLVEMKKH LQW201878.x1 from a similar gene but not same gene >cicl015f07_3 = seq 7 FTNLALFAIALLLFYIWLTPKYKNLPPGPMGVPFLGCLPFMETLAERTFTKWSKKYGPII TVQLGDHRTVILNSYEAIEEAFTKKGEKFNGRFKTYFTEFASEGLGIFFIDGEKWKEHRK FGTRALAGAGMYGKTIEQRVLEEAENICHVIRSKNEEPFILEDYLILSVANVINGITIKE RCDEEGNENLLKYVASVVEGFRKDGLIYSLLSVIPWCR >GCiWno946_o03.g1 TCGATTCGAGCTNCGGTACCCTTTAAGATTACTATATACAAAAGTTATTATTATAAAATAACATTTTAATATATTTATTA TTAACACCATAACGTTATTCAATTTCTTTACAGAAACCACAACTACGTTATTTTTTAAAAGATCTTTTCGCTGCTGGAAC CGAAACGAGCAGTAGCACAATACGTTGGGCGTTATTTTACCTCATTGTTAACCCTGATATTCAGGATAAAGTGCACAAGG AAATAGACGATGTTATAGGTAAAATGGTATGGGAGTCATGGGACTGTATATTTAAATTGATTTTCGTTTGCAATCGTCAT AACTTTGGGTTATTTCGTATTTACCAACATATATAGCAAATAAATATTAGTTGTTTTTTAATAACTTTTGATTATTTTTA TAAATTACTTCTACCCTCTTACTCTTTTGTAACCGATTTGTGTATACGTCTATGCACAGTTTCTGCTTGAAATACTTATA ACTTACCCCAATAAATACAACGTATTTCATTTACAAACAGGGCATAACGGAGTTGTTCGTTACGACACCAAACTACCATA CACTAAAGCGGTCCTTCAAGAGACTTATAGAATACGAACAGCGACGCCTCTTGGCGTGCCAAGACGAAATACTGAGGATG TTACATTGATGGGATACTTTATACCAAAGAACACTCAGGTATAATAATACATGATGCTATCCATATTTGAATACATGCAG GTTTTAACTAGTTTTGATGTGGAAATCAGGTCTAAAACATATAGTACCGTCAGGGNTAAATGTAAACCGCTATATAGCAC ATCAGTTCGTTAACAATTAAGTTCCATGTCGATTTAGATCATTCCNTAACCTTGGTGGGTCCACAACGACCCAGAGTATT GGAACGAACCCCGACGTTTC >_1 SIRAXVPFKITIYKSYYYKITF*YIYY*HHNVIQFLYRNHNYVIF*KIFSLLEPKRAVAQ YVGRYFTSLLTLIFRIKCTRK*TML*VKWYGSHGTVYLN*FSFAIVITLGYFVFTNIYSK *ILVVF**LLIIFINYFYPLTLL*PICVYVYAQFLLEILITYPNKYNVFHLQT GHNGVVR YDTKLPYTKAVLQETYRIRTATPLGVPRRNTEDVTLMGYFIPKNTQV**YMMLSIFEYMQ VLTSFDVEIRSKTYSTVRXKCKPLYSTSVR*QLSSMSI*IIP*PWWVHNDPEYWNEPRRF >_2 RFELRYPLRLLYTKVIIIK*HFNIFIINTITLFNFFTETTTTLFFKRSFRCWNRNEQ*HN TLGVILPHC*P*YSG*SAQGNRRCYR*NGMGVMGLYI*IDFRLQSS*LWVISYLPTYIAN KY*LFFNNF*LFL*ITSTLLLFCNRFVYTSMHSFCLKYL*LTPINTTYFIYKQGITELFV TTPNYHTLKRSFKRLIEYEQRRLLACQDEILRMLH*WDTLYQRTLRYNNT*CYPYLNTCR F*LVLMWKSGLKHIVPSGXNVNRYIAHQFVNN*VPCRFRSFXNLGGSTTTQSIGTNPDV >_3 DSSXGTL*DYYIQKLLL*NNILIYLLLTP*RYSISLQKPQLRYFLKDLFAAGTETSSSTI RWALFYLIVNPDIQDKVHKEIDDVIGKMVWESWDCIFKLIFVCNRHNFGLFRIYQHI*QI NISCFLITFDYFYKLLLPSYSFVTDLCIRLCTVSA*NTYNLPQ*IQRISFTNRA*RSCSL RHQTTIH*SGPSRDL*NTNSDASWRAKTKY*GCYIDGILYTKEHSGIIIHDAIHI*IHAG FN*F*CGNQV*NI*YRQG*M*TAI*HISSLTIKFHVDLDHSXTLVGPQRPRVLERTPTF 2N9 mid region 8235 GEPFDPVPLLNNAVANIICQIVFGRRFDYTDHMFQRMLHHLTEMAYLEGSIWAL 8074 (0) 7991 LYDSFPALMKHLPGPHNGIFSSSSSLQ GFIWREIQRHKSDLDPSNPRDYIDAFLIEEGNGN-NQLGFE ALFDNLIEQHQQQHDRLHPRDLIDLYLNQMKDFSVSQLYFKIT ERNLVLCCLDLFLAGSETTSKTLQWGLIYLIRKPHIQ 7606 (1) >GCiWno41_m16.g1 CHROMAT_FILE: GCiWno41_m16.g1 PHD_FILE: GCiWno41_m16.g1.phd.1 CHEM: term DYE: big TIME: Sat Sep 1 11:02:18 2001 TEMPLATE: GCiWno41_m16 DIRECTION: rev Length = 868 Score = 75.3 bits (182), Expect = 7e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 1 ALFDNLIEQHQQQHDRLHPRDLIDLYLNQMKDFS 34 ALFDNLIEQHQQQHDRLHPRDLIDLYLNQMKDFS Sbjct: 378 ALFDNLIEQHQQQHDRLHPRDLIDLYLNQMKDFS 277 >GCiWno41_m16.g1 TATTGTTATAATAATAAAGGTAATAAAATGTTATAATAAGAATAACTTTTGCATAGTAGGTTGGGGGAAGATGGGACACC TTTTTATTTGATTTTCTCGTTCCATTTGGTAGTAAATAAAGATCCTCACGACTCACATAAACCGCAGTTAATTGGATATT ATGTGCTAAAGGTGTCCCGATTTCCCCCACCCTACTATGTAATAACAAAGAAATTAAATGTTATAATAATAGTAATAACT TTTGTATATAGTAATCTTAAAATACAGTTGACTTACAGAAAAGTCTTTCATTTGATTCAAATACAAATCAATCAGATCTC TTGGGTGGAGACGGTCATGTTGTTGCTGGTGTTGTTCTATCAAGTTATCGAACAACGCTGCAATAATTATTACCATGAAA TGAACGAACGAATGATGTAACTTATTGGCTCATCCTCGTATGATGGGCAAAATAATTGTAACACCGCTTACGAGTTACCA CGCATGTGTCTTTGTAAGTAAAAACTTTTTTTATGTTTTTGTATTGTATTGCTAATTACTTAGAGTTTATAGACAACCCA TAAGCAACCACTGGGTTGGAGCAAATGCCGTTAAGTTTCTTGCCCAAGAATACGCCCACAGTAGTGTAGCAACCACGAGC CTTGAACCCGTAACATCTCGGTAAGAGGCAGGTTCAAATGCAGTTTAGCAAAAAGTATTGTATCCTATTTCATAAATCGC TTATTTAGTAATTTACATTTTTCTCTTTAACTAAATGTTNTACCGTTTCCCGCTTTGAGTCCATCTTTCAGGCTTTTTAT GTGTTTTTGAGTCTGCGGAAAGAATCGACACCAGGGAATAACCGACNNACACGAATAAATCAAACCAT >_4 WFDLFVXVGYSLVSILSADSKTHKKPERWTQSGKRXNI*LKRKM*ITK*AIYEIGYNTFC *TAFEPASYRDVTGSRLVVATLLWAYSWARNLTAFAPTQWLLMGCL*TLSN*QYNTKT*K KFLLTKTHAW*LVSGVTIILPIIRG*ANKLHHSFVHFMVIIIAALFDNLIEQHQQQHDRL HPRDLIDLYLNQMKDFSVSQLYFKITIYKSYYYYYNI*FLCYYIVGWGKSGHL*HIISN* LRFM*VVRIFIYYQMERENQIKRCPIFPQPTMQKLFLL*HFITFIIITI >_5 MV*FIRVXRLFPGVDSFRRLKNT*KA*KMDSKRETVXHLVKEKNVNY*ISDL*NRIQYFL LNCI*TCLLPRCYGFKARGCYTTVGVFLGKKLNGICSNPVVAYGLSINSK*LAIQYKNIK KVFTYKDTCVVTRKRCYNYFAHHTRMSQ*VTSFVRSFHGNNYCSVVR*LDRTTPATT*PS PPKRSD*FVFESNERLFCKSTVF*DYYIQKLLLLL*HLISLLLHSRVGEIGTPLAHNIQL TAVYVSREDLYLLPNGTRKSNKKVSHLPPTYYAKVILIITFYYLYYYNNX >_6 GLIYSCXSVIPWCRFFPQTQKHIKSLKDGLKAGNGXTFS*REKCKLLNKRFMK*DTILFA KLHLNLPLTEMLRVQGSWLLHYCGRILGQET*RHLLQPSGCLWVVYKL*VISNTIQKHKK SFYLQRHMRGNS*AVLQLFCPSYEDEPISYIIRSFISW**LLQRCSIT**NNTSNNMTVS TQEI*LICI*IK*KTFL*VNCILRLLYTKVITIIITFNFFVIT**GGGNRDTFST*YPIN CGLCES*GSLFTTKWNEKIK*KGVPSSPNLLCKSYSYYNILLPLLL*QX A related EST >cits048p05 CGGCCGCTACTGCCTAAACTTGCTAGAAAGTATGGACCCATTTTCACTATTACAGCTGGGTATAGACGCGTGGTGTTTCT TGTTGGCTATGACTTAATTAAAGAAGTTATCACTGACAGAGCAAAAGATTTTGCATCAAGATGTCCCAACATGCCAGGAA GAATTGTCCGTGGAGAAGGTTTAGATGGCATTGCTGCAGCCCCATATGGTCCCAAATGGATGGCAAACCGTAAGTTCTTT TACTCTGCCATGCGCACCATGGGGTTGGGAAAACGTGGGATAGAAAAGTGTGTGGTTGATGAGATTCCCTACATTGTTGA AGAACTTGAGAAGCTTTGCACCAAAAATGAGTTGTTTGAACCATCGAGTGTATTTGACTCCGCTGTACTGAACGTGCTTG CATATTTCACTTTTGGAAACAGATATTCCTATCAAGACGAAAAATTTAAAGAGCTGATTCACATCAATAATGATTTCTTT CAAAAAGCAAAGTTTCTGAATCAGCCACTATTCTTCCTCCTCAGTTTGGTACCTGGCCTGCATAAATACTGGCTTCCTCA ATGTGGAAAAGATCTAAAAGAATCAGTTGGGAAAATCAACAAATTTGTAAAAGCTGAGATTGAACAACATCGACAAAATT TTGACCGCAAAAATCCAAGAGATTATATTGACTGTTATCTCAAAGAGCTCGATCAGATGAATGATCAAAGCGAACTATCG G RPLLPKLARKYGPIFTITAGYRRVVFLVGYDLIKEVITDRAKDFASRCPNMPGRIVRGEG LDGIAAAPYGPKWMANRKFFYSAMRTMGLGKRGIEKCVVDEIPYIVEELEKLCTKNELFE PSSVFDSAVLNVLAYFTFGNRYSYQDEKFKELIHINNDFFQKAKFLNQPLFFLLSLVPGL HKYWLPQCGKDLKESVGKINKFVKAEIEQHRQNFDRKNPRDYIDCYLKELDQMNDQSELS >GCiWno434_a04.g1 CHROMAT_FILE: GCiWno434_a04.g1 PHD_FILE: GCiWno434_a04.g1.phd.1 CHEM: term DYE: big TIME: Thu Oct 11 12:43:00 2001 TEMPLATE: GCiWno434_a04 DIRECTION: rev Length = 940 Score = 91.7 bits (224), Expect = 8e-19 Identities = 41/42 (97%), Positives = 42/42 (99%) Frame = +3 Query: 1 FRKDGLIYSLLSVIPWCRFFPQTQKHIKSLKDGLKAGNGKTF 42 FRKDGLIYSLLSVIPWCRFFPQTQKH+KSLKDGLKAGNGKTF Sbjct: 156 FRKDGLIYSLLSVIPWCRFFPQTQKHMKSLKDGLKAGNGKTF 281 >GCiWno434_a04.g1 TACGAATTCGAGCTCGTACCCTATTTTTTTAACGGTGTATTTATTTTCGTGCATGCGGTGTGAAAAATCGAATGTTAAAT TCACCGAAAATATAGCATATGCTATGCCATGTAAAAATAGGAAATATTAAAGCTATCAATAATTTCCCAAACAGGTTCCG GAAAGATGGTTTGATTTATTCGTTGCTGTCGGTTATTCCGTGGTGTCGATTCTTTCCGCAGACTCAAAAACACATGAAAA GCCTGAAAGATGGACTCAAAGCGGGAAACGGTAAAACATTTAGTTGAAGAGAAGAATGTAAATTACGAAATAAACGATTT ATGAAATAGGATACAATACTTTTTGCTAAACTGCATTTGAACCTGCCTCTTACCATGATGTTACGGGTTCAAGGCTCGTG GTTGCTACACTATACTGTGGGCGTATTCTTGGGCAAGAAACTTAACGGCATTTGCTCCAACCCAGTGGTTGCTTATAGGT TGTCTATAAACTCTAAGTAATTAGCAATACAATACAAAAACATAAAAAAAAGTTTTCACCTACAAAGACACATGTGTGGT AACTCGTAAGCGGTGTTACAATTATTTTGCCCATCATACGAGGATGAGCCAATAAGTTACATCATTCGTTCGTTCATTTC ATGGTAAAAATTATTGCAGCGTTGTTCGATAACTTGATAGAACAACACCAGCAACAACATGACCGTCTCCACCCAAGAGA TCTGATTGATTTGTATTTGAATCAAATGAAAGACTTTTCTGNTAGTCAACTGTATTTTAAGATTACTATATACAAAAGTT ATTACTATTATTATAATATTTAATTTCTTTGGTATACTGNANGGGTGGGGGGGGAAAATCGGGGAAACCTTTAGCACATA ATATCCCATTAACTGCGGTCTATGTGAGTCGTTGAGGATCTTTATTTACTACCCAATGGN >_1 YEFELVPYFFNGVFIFVHAV*KIEC*IHRKYSICYAM*K*EILKLSIISQTGSGKMV*FI RCCRLFRGVDSFRRLKNT*KA*KMDSKRETVKHLVEEKNVNYEINDL*NRIQYFLLNCI* TCLLP*CYGFKARGCYTILWAYSWARNLTAFAPTQWLLIGCL*TLSN*QYNTKT*KKVFT YKDTCVVTRKRCYNYFAHHTRMSQ*VTSFVRSFHGKNYCSVVR*LDRTTPATT*PSPPKR SD*FVFESNERLFX*STVF*DYYIQKLLLLL*YLISLVYXXGGGGKSGKPLAHNIPLTAV YVSR*GSLFTTQWX >_2 TNSSSYPIFLTVYLFSCMRCEKSNVKFTENIAYAMPCKNRKY*SYQ*FPKQVPERWFDLF VAVGYSVVSILSADSKTHEKPERWTQSGKR*NI*LKRRM*ITK*TIYEIGYNTFC*TAFE PASYHDVTGSRLVVATLYCGRILGQET*RHLLQPSGCL*VVYKL*VISNTIQKHKKKFSP TKTHVW*LVSGVTIILPIIRG*ANKLHHSFVHFMVKIIAALFDNLIEQHQQQHDRLHPRD LIDLYLNQMKDFSXSQLYFKITIYKSYYYYYNI*FLWYTXXVGGENRGNL*HIISH*LRS M*VVEDLYLLPNG >_3 RIRARTLFF*RCIYFRACGVKNRMLNSPKI*HMLCHVKIGNIKAINNFPNRFRKDGLIYS LLSVIPWCRFFPQTQKHMKSLKDGLKAGNGKTFS*REECKLRNKRFMK*DTILFAKLHLN LPLTMMLRVQGSWLLHYTVGVFLGKKLNGICSNPVVAYRLSINSK*LAIQYKNIKKSFHL QRHMCGNS*AVLQLFCPSYEDEPISYIIRSFISW*KLLQRCSIT**NNTSNNMTVSTQEI *LICI*IK*KTFLXVNCILRLLYTKVITIIIIFNFFGILXGWGGKIGETFST*YPINCGL CESLRIFIYYPM >LQW155205.y1 TAGCCTGGACCGCGCTGTCGTATCTATAAGTCTCTTGAAGGACGCTTTAGTGTATGGTAGTTTGGTGTCGTAACGAACAA CTCCGTTATGCCCTGTTTGTAAATAATATACGTTGTATTTATTGGGCTAAGTTTTAAATATTTCATGCAGAAGTTGTGTT TAGGAGTAAATAAATAGTCGGCTAAGAGCATGTGGTTACAAAAGACTTAAGACTAAGAGGTGGTATTTGCTTTATAAGTA TAAAAGTAATTAAAAAACTTTGTTTTTTGTGATAATAGTAAAAAGTGCTTACAATTATGACGGTTGCATGCGAAAACCCA TATACATATATACGGTCACAAATCTTTGAATCACCTATAACGTCGTCTATTTCTTTATGCACTTTATCCTGAATATCAGG GTTAACAATGAGGTAAAATAACGCCCAACGTATGGTGCTACTACTCGTTTCGGTTCCAGCAGCGAAAAGATCTTTTAAAA AATAACGTAGTTGTGGTTTCTGTGAAGAAATTGAGTATTGTTATAATAATAAAGGTAATAAAATGTTATAATAAGAATAA CTTTTGCATAGTAGGTTGGGGGGAGATGGAACACCTTTTTATTTGATTTTCTCGTTCCATTTGGTAGTAAATAAAGATCC TCACGACTCACATAGAACGCAGTTAATGGGATATTATGTGCTCAAGGTGTCCAGATTTTCCCACCCTAATATGTAATAAC AAGAAATTAAATGTATAATAAAGTAATACTTTGTATTAGTATCTTAAATACGTGATTCAGAAATCTTCATTGATCAATAC ATAATCAGACCTGGGGGAACGGCACTTGAGCGGGTGACATCAGTTCAAAAGTCAGACTACTGAAGAAACAAGAGTAACGG CCAGAGAGGAAATGGCGCAAGCAAAAATGAAAAAAAAAGAGGGAAAACACAAAACGACAGCCACAAAAACATGACTACCC >_4 G*SCFCGCRFVFSLFFFHFCLRHFLSGRYSCFFSSLTFELMSPAQVPFPQV*LCIDQ*RF LNHVFKILIQSITLLYI*FLVITY*GGKIWTP*AHNIPLTAFYVSREDLYLLPNGTRKSN KKVFHLPPTYYAKVILIITFYYLYYYNNTQFLHRNHNYVIF*KIFSLLEPKRVVAPYVGR YFTSLLTLIFRIKCIKK*TTL*VIQRFVTVYMYMGFRMQPS*L*ALFTIITKNKVF*LLL YL*SKYHLLVLSLL*PHALSRLFIYS*TQLLHEIFKT*PNKYNVYYLQTGHNGVVRYDTK LPYTKASFKRLIDTTARSRL >_5 VVMFLWLSFCVFPLFFSFLLAPFPLWPLLLFLQ*SDF*TDVTRSSAVPPGLIMY*SMKIS ESRI*DTNTKYYFIIHLISCYYILGWENLDTLST*YPINCVLCES*GSLFTTKWNEKIK* KGVPSPPNLLCKSYSYYNILLPLLL*QYSISSQKPQLRYFLKDLFAAGTETSSSTIRWAL FYLIVNPDIQDKVHKEIDDVIGDSKICDRIYVYGFSHATVIIVSTFYYYHKKQSFLITFI LIKQIPPLSLKSFVTTCS*PTIYLLLNTTSA*NI*NLAQ*IQRILFTNRA*RSCSLRHQT TIH*SVLQETYRYDSAVQAX >_6 GSHVFVAVVLCFPSFFFIFACAISSLAVTLVSSVV*LLN*CHPLKCRSPRSDYVLINEDF *ITYLRY*YKVLLYYTFNFLLLHIRVGKSGHLEHIISH*LRSM*VVRIFIYYQMERENQI KRCSISPQPTMQKLFLL*HFITFIIITILNFFTETTTTLFFKRSFRCWNRNE**HHTLGV ILPHC*P*YSG*SA*RNRRRYR*FKDL*PYICIWVFACNRHNCKHFLLLSQKTKFFNYFY TYKANTTS*S*VFCNHMLLADYLFTPKHNFCMKYLKLSPINTTYIIYKQGITELFVTTPN YHTLKRPSRDL*IRQRGPGX >GCiWno464_n10.g1 CHROMAT_FILE: GCiWno464_n10.g1 PHD_FILE: GCiWno464_n10.g1.phd.1 CHEM: term DYE: big TIME: Mon Oct 15 09:58:50 2001 TEMPLATE: GCiWno464_n10 DIRECTION: rev Length = 925 Score = 92.8 bits (227), Expect = 4e-19 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -1 Query: 1 FRKDGLIYSLLSVIPWCRFFPQTQKHIKSLKDGLKAGNGKTF 42 FRKDGLIYSLLSVIPWCRFFPQTQKHIKSLKDGLKAGNGKTF Sbjct: 688 FRKDGLIYSLLSVIPWCRFFPQTQKHIKSLKDGLKAGNGKTF 563 >GCiWno400_a20.b1 CHROMAT_FILE: GCiWno400_a20.b1 PHD_FILE: GCiWno400_a20.b1.phd.1 CHEM: term DYE: big TIME: Wed Oct 10 12:08:39 2001 TEMPLATE: GCiWno400_a20 DIRECTION: fwd Length = 871 Score = 92.8 bits (227), Expect = 4e-19 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 1 FRKDGLIYSLLSVIPWCRFFPQTQKHIKSLKDGLKAGNGKTF 42 FRKDGLIYSLLSVIPWCRFFPQTQKHIKSLKDGLKAGNGKTF Sbjct: 123 FRKDGLIYSLLSVIPWCRFFPQTQKHIKSLKDGLKAGNGKTF 248 >sequence 209 A different C-term from seq 27 or 10 last exon has 7 diffs from seq 10 LQW203867.x1 exon 9 LQW35630.x1 exon 9 3 diffs with seq 10 GCiWno809_c05.g1 GCiWno49_j21.g1 GCiWno46_e07.g1 GCiWno973_a07.b1 k-helix exon has 5 diffs with seq 10 GCiWno520_h02.b1 MIEAFLRQWTDTTTVIIFLFTLLFYYWYRRPLRFPPGPRGLPLV GVLPFLRKYTARTMHKWSNKYGPVMSVRMGNEDWVVMGNYEAVHQ (0?) 6 diffs to seq 199 SFVKAGNVFSGRPVLKVANEIAEGKGIVMRDFNTTWKTHRKFGSITLRG (2?) FGVGKKSLEERIYEEVEVMNKEILSKEGKPFDIT (0?) EILTNAVMNVISIITTDQRFEYDDEHFRLLQQIFTKW (2?) FLEPENTAAFAQIIYVPLLCNIPPYRSKYLEVKRDMKRVSG (?) VFQQMVEQHRKTFDKNNLRDFIDAFICEGKKGTDESFT (0) DGQLVQYVREMFEAGTETMTGTVRWAMLCLIHYPDAQKKLREEIFEAI GNNNRPSISDRKAMPFTSAFIQEVFRFRTRVPLGVQHMTTETVNFANYVIPKGTT (0) ILANMWAVHNDPDVWDEPSKFKPERHLDDKGNFVQSNHVIPFSVGPRHCLGEQLARME IFIFLVSMVQKFEFLPDPNEPDLPEINDGVKGNGFFPYPFNFVASEI* Top of seq 27 for comp MLTNLIANPSISPVLAILSCVIAFYYWYKRPKNMPPGPRGIPFLGIIPFVGMN PEQAFMQWSKKYGPVITVRMGRKDWVVLCDHDTIHQ (0) >GCiWno799_o14.b1 CHROMAT_FILE: GCiWno799_o14.b1 PHD_FILE: GCiWno799_o14.b1.phd.1 CHEM: term DYE: big TIME: Tue Dec 4 12:05:33 2001 TEMPLATE: GCiWno799_o14 DIRECTION: fwd Length = 828 Score = 148 bits (370), Expect = 2e-35 Identities = 79/127 (62%), Positives = 80/127 (62%), Gaps = 39/127 (30%) Frame = -3 Query: 1 GVLPFLRKYTARTMHKWSNKYGPVMSVRMGNEDWLAMGN--------------------- 39 GVLPFL KYTARTMHKWS KYGPVMSVRMGNEDW+ MGN Sbjct: 397 GVLPFLGKYTARTMHKWSKKYGPVMSVRMGNEDWVVMGNYEAVHQVLFENFKTAV**TST 218 Query: 40 ------------------SFVKAGNVFSGRPVLKVANEIAEGKGIVMRDFNTTWKTHRKF 81 SFVKAGNVFSGRPVLKVANEIAEGKGIVMRDFN WKTH KF Sbjct: 217 HKQVD*IGTALLNVTIFQSFVKAGNVFSGRPVLKVANEIAEGKGIVMRDFNAPWKTHSKF 38 Query: 82 GSITLRG 88 SI LRG Sbjct: 37 RSIPLRG 17 >GCiWno673_d07.b1_1 ISKPQYSKPVHTNKLIR*ALRF*MLQYFRAL*KQATCSLDVLC*RWRMR*LRARELL*EI LTQHGKHTESLEALLFGGI*HDLC*R*PLVRKRLNLNNIVLAIFTFKQNSKSNFILFRFG VGKKSLEERIYEEVEVMNKEILSKEGKPFDITVRACIYYV*TSIIHFNMNMRFFAYFWYS CVGGKMGHL*HIISKHPDYVLNK**QSIRVVGIRLYISLKVK*MFFNFV*EILTNAVMNV ISIITTDQRFEYDDEHFRLLXXFSRNVKSHFAYILGTEIMRSYMMD*TVLM >GCiWno673_d07.b1_2 FQNRSIVNQYTQTS*LDRHCDSECYNISELCKSRQRVLWTSCVEGGE*DS*GQGNCYERF *HNMENTQKVWKHYSSGVYSMICVNVNR*CEND*I*II*Y*RSLRSNKILNLTLFCSGSG LVRRA*KSESMKRWR**TKKFFQKKENHLTSQYVPVYIMYKRALYTLT*I*DFSLTFGIA VWGERWDTFST*YPSILTMF*INNNSLLESWEYGYIFL*R*NKCFLTLFRKS*PTQS*TS SAS*LPIKGLNMMTSIFDYFXXFHEMLRAILRIY*VQKSCEVT*WIELC* >GCiWno673_d07.b1_3 FKTAV**TSTHKQVD*IGTAILNVTIFQSFVKAGNVFSGRPVLKVANEIAEGKGIVMRDF NTTWKTHRKFGSITLRGYIA*FVLTLTVSAKTIKFK*YSTSDLYVQTKF*I*LYFVQVRG W*EELRRANL*RGGGNEQRNSFKRRKTI*HHSTCLYILCINEHYTL*HEYEIFRLLLV*L CGGKDGTPLAHNIQAS*LCFK*IITVY*SRGNTVIYFFEGKINVF*LCLGNLDQRSHERH QHHNYRSKV*I**RAFSTTSXXFTKC*EPFCVYTRYRNHAKLHDGLNCAD >GCiWno673_d07.b1 ATTTCAAAACCGCAGTATAGTAAACCAGTACACACAAACAAGTTGATTAGATAGGCACTGCGATTCTGAATGTTACAATA TTTCAGAGCTTTGTAAAAGCAGGCAACGTGTTCTCTGGACGTCCTGTGTTGAAGGTGGCGAATGAGATAGCTGAGGGCAA GGGAATTGTTATGAGAGATTTTAACACAACATGGAAAACACACAGAAAGTTTGGAAGCATTACTCTTCGGGGGTATATAG CATGATTTGTGTTAACGTTAACCGTTAGTGCGAAAACGATTAAATTTAAATAATATAGTACTAGCGATCTTTACGTTCAA ACAAAATTCTAAATCTAACTTTATTTTGTTCAGGTTCGGGGTTGGTAAGAAGAGCTTAGAAGAGCGAATCTATGAAGAGG TGGAGGTAATGAACAAAGAAATTCTTTCAAAAGAAGGAAAACCATTTGACATCACAGTACGTGCCTGTATATATTATGTA TAAACGAGCATTATACACTTTAACATGAATATGAGATTTTTCGCTTACTTTTGGTATAGCTGTGTGGGGGGAAAGATGGG ACACCTTTAGCACATAATATCCAAGCATCCTGACTATGTTTTAAATAAATAATAACAGTCTATTAGAGTCGTGGGAATAC GGTTATATATTTCTTTGAAGGTAAAATAAATGTTTTTTAACTTTGTTTAGGAAATCTTGACCAACGCAGTCATGAACGTC ATCAGCATCATAACTACCGATCAAAGGTTTGAATATGATGACGAGCATTTTCGACTACTTCANCANTTTTCACGAAATGT TAAGAGCCATTTTGCGTATATACTAGGTACAGAAATCATGCGAAGTTACATGATGGATTGAACTGTGCTGATG >GCiWno673_d07.b1 CHROMAT_FILE: GCiWno673_d07.b1 PHD_FILE: GCiWno673_d07.b1.phd.1 CHEM: term DYE: big TIME: Fri Nov 2 12:35:19 2001 TEMPLATE: GCiWno673_d07 DIRECTION: fwd Length = 873 Score = 63.2 bits (151), Expect = 5e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 EILTNAVMNVISIITTDQRFEYDDEHFRLL 30 EILTNAVMNVISIITTDQRFEYDDEHFRLL Sbjct: 691 EILTNAVMNVISIITTDQRFEYDDEHFRLL 780 >GCiWno520_h02.b1_4 XEVXGYEQKKFLSKGRKTILTSQVRAXYILCINEHYTL*HEYEIFRLLLI*LCGGRWDTF ST*YPSILTMF*INNNSLLESWGYGYIFL*R*NKYFLTLFRKS*PTQS*TSSAS*LPIKG LNMMTSISDYFSKFSRNGKMPFCV*YYGTEIHAKFT*WI*TVLSDYPEMFNLPFAGSWNP RTRLLSHR*FMFLCFAIYPLTEASIWK*NGT*KGFQVCKTLLNIYFKIKMLFFYILQPFF NKW*SNIEKPLTKITFATLLMLLFVKGRRAQTKVLRYDTL*LI*ANSPSFSVII >GCiWno520_h02.b1_5 RGXGL*TKEIPFKREENHFDITGTCLXYIMYKRALYTLT*I*DFSLTFDIAVWGKMGHL* HIISEHPDYVLNK**QSIRVVGIRLYISLKVK*IFFNFV*EILTNAVMNVISIITTDQRF EYDDEHFRLLQQIFTKW*DAILRIILWYRNTCEVHMMDLNCAE*LS*NV*PSVRRFLEPE NTAAFAQIIYVPLLCNIPPYRSKYLEVKRDMKRVSGL*NTSKYIF*NKNVIFLHSTAVFQ QMVEQHRKTFDKNNLRDFIDAFICEGKKGTDESFTV*YFVVNLSQFPFF*RNNX >GCiWno520_h02.b1_6 KRXRVMNKRNSFQKGGKPF*HHRYVPXIYYV*TSIIHFNMNMRFFAYF*YSCVGEDGTPL AHNIRAS*LCFK*IITVY*SRGDTVIYFFEGKINIF*LCLGNLDQRSHERHQHHNYRSKV *I**RAFPTTSANFHEMVRCHFAYNTMVQKYMRSSHDGFELC*VIILKCLTFRSQVPGTR EHGCFRTDNLCSFALQYTPLPKQVFGSKTGHEKGFRFVKHF*IYILK*KCYFFTFYSRFS TNGRAT*KNL*QK*PSRLY*CFYL*REEGHRRKFYGMILCS*FKPIPLLLA**X >LQW203042.y1 >lcl|LQW203042.y1 CHROMAT_FILE: LQW203042.y1 PHD_FILE: LQW203042.y1.phd.1 CHEM: term DYE: ET TIME: Wed Aug 22 12:21:14 2001 TEMPLATE: LQW203042 DIRECTION: rev TAGAAGGATCTCGATCAATTCAGCTCGGTACAAGGGTATGATATAGAATTACGGGAGAATATGGGACACCTTTACACATA GTATCCAAATACCATTATCATGATGTTTTAAACACTAAAACGACGCGGCCTGTATATGGGAGTCGCGACGATACGGTTTT ATAATAATTTTGAAAATAATTTTGAAAATAATCGTTCTTATTTGTTTACTACCACATGGGACGAGGAAATAGAACGAAAA TTGTCTCATCTTTCCCCAGCCTGTTATAGGCTACTTTATAACATCCTGGCTGTAAACAAGGGGGTTTTCATCTAAGTTTT GCAGAATAAATAAAACTATTAATTATAAACTGACCATAAACCCTCTATATTATAACTTGCCTATTGCGGCAAATATTTCT TCCCGAAGTTTTGTTTGCGCATCTGGGTCATGGATGAGACACAGCATCGTCCATCTGACAGTTCCTGTCATTGTTTCTGT TCCAGCTTCGAACATTTCACGCACATATTGTACAAGCTGCCCATCCTGAGAAGAGCCACCGAACGAAAACATGTCTTATA TAGATAGAGATGCTCAAATGTGATCTAAGGTATCCCAAAGTTTCAAAAAAGCAGCAGCCTTCTTACCGATCGGGTAAATG CCAGGAAAAACATTTCAATTTTTCGACTGAACGAAGCTGTGTACACGTTTATCACTTTCTGACATACCTGCTGACGCAAA ATTTCCGCGCCGATTCAAATCAATTACATCATCTAAAAATTAAACATCATATGTCTTACTGATACCACGTGAGAAAGCGG CGTCTATCCAAAGATTCCGAATTAAAACCATTGCCCGCTAGTTTCGTAAACCTTCCGTAACAACCATCGTAGGTGTCCAA GAATCTTGGAGATCGAAAAGAACATTCATTAGCAAAGCGTAAACAGTTCCATTGGCCTCAAAAAACCACTCGTAGC >LQW203042.y1_4 YEWFFEANGTVYALLMNVLFDLQDSWTPTMVVTEGLRN*RAMVLIRNLWIDAAFSRGISK TYDV*FLDDVIDLNRRGNFASAGMSESDKRVHSFVQSKN*NVFPGIYPIGKKAAAFLKLW DTLDHI*ASLSI*DMFSFGGSSQDGQLVQYVREMFEAGTETMTGTVRWTMLCLIHDPDAQ TKLREEIFAAIGKL*YRGFMVSL*LIVLFILQNLDENPLVYSQDVIK*PITGWGKMRQFS FYFLVPCGSKQIRTIIFKIIFKIIIKPYRRDSHIQAASF*CLKHHDNGIWILCVKVSHIL P*FYIIPLYRAELIEILL >LQW203042.y1_5 LRVVF*GQWNCLRFANECSFRSPRFLDTYDGCYGRFTKLAGNGFNSESLDRRRFLTWYQ* DI*CLIFR*CN*FESARKFCVSRYVRK**TCTQLRSVEKLKCFSWHLPDR*EGCCFFETL GYLRSHLSISIYIRHVFVRWLFSGWAACTICA*NVRSWNRNNDRNCQMDDAVSHP*PRCA NKTSGRNICRNRQVII*RVYGQFIINSFIYSAKLR*KPPCLQPGCYKVAYNRLGKDETIF VLFPRPMW**TNKNDYFQNYFQNYYKTVSSRLPYTGRVVLVFKTS**WYLDTMCKGVPYS PVILYHTLVPS*IDRDPSX >LQW203042.y1_6 ATSGFLRPMELFTLC**MFFSISKILGHLRWLLRKVYETSGQWF*FGIFG*TPLSHVVSV RHMMFNF*MM*LI*IGAEILRQQVCQKVINVYTASFSRKIEMFFLAFTRSVRRLLLF*NF GIP*ITFEHLYLYKTCFRSVALLRMGSLYNMCVKCSKLEQKQ*QELSDGRCCVSSMTQMR KQNFGKKYLPQ*ASYNIEGLWSVYN**FYLFCKT*MKTPLFTARML*SSL*QAGER*DNF RSISSSHVVVNK*ERLFSKLFSKLL*NRIVATPIYRPRRFSV*NIMIMVFGYYV*RCPIF SRNSISYPCTELN*SRSFX DEV18495.x1 CHEM: term DYE: ET TIME: Wed Mar 21 15:33:43 2001 TEMPLATE: DEV18495 DIRECTION: fwd Length = 554 Score = 78.0 bits (189), Expect = 3e-14 Identities = 43/70 (61%), Positives = 54/70 (76%), Gaps = 3/70 (4%) Frame = -1 Query: 54 FSRGISKTYDV*FLDDVIDL---NRRGNFASAGMSESDKRVHSFVQSKN*NVFPGIYPIG 110 ++ GISKT + + +I + N +FASAG+S+ +KR+HSFVQSKN*NVFPGIYPI Sbjct: 350 YTVGISKT*KMF*IKKMIKIKFENCAKSFASAGISKINKRLHSFVQSKN*NVFPGIYPIF 171 Query: 111 KKAAAFLKLW 120 KKAAAFLKLW Sbjct: 170 KKAAAFLKLW 141 >DEV18495.x1_4 SVIIGYV*LRYPRVNSNDKRDFCFVYTSYTKFRWVRSVKVSYLETNAPNKVVVLSAGQSF CIEATALLHSGYQ*DIKNVLNKKNDKN*I*KLREKFCVSRYFKN**TFTQLRSVEKLKCF SWHLPDL*KGCCFFETLGYLRSHLSISIYIKHVFVRWLFSGWAACTICA*NVRSWNRNND RNCQ >DEV18495.x1_5 *RNNRIRVTTLSSRK*QRQT*FLFRIHLLHEISLG*IRKSVLP*NKCAEQSGGVKCRTIF LYRSDRFTTQWVSVRHKKCFK*KK**KLNLKTARKVLRQQVFQKLINVYTASFSRKIEMF FLAFTRSLKRLLLF*NFGIP*ITFEHLYLYKTCFRSVALLRMGSLYNMCVKCSKLEQKQ* QELSX >DEV18495.x1_6 LA***DTCNYVILA*IATTNVISVSYTPPTRNFAGLDP*KCLTLKQMRRTKWWC*VPDNL FV*KRPLYYTVGISKT*KMF*IKKMIKIKFENCAKSFASAGISKINKRLHSFVQSKN*NV FPGIYPIFKKAAAFLKLWDTLDHI*ASLSI*NMFSFGGSSQDGQLVQYVREMFEAGTETM TGTVX Next walk >rciht025j24 Length = 708 Score = 114 bits (283), Expect = 1e-25 Identities = 57/60 (95%), Positives = 58/60 (96%), Gaps = 1/60 (1%) Frame = -3 Query: 1 SVIIGYV-LRYPRVNSNDKRDFCFVYTSYTKFRWVRSVKVSYLETNAPNKVVVLSAGQSF 59 SVII YV LRYPRVNSNDKRDFCFVYTSYTKFRWVRSVKVSYL+TNAPNKVVVLSAGQSF Sbjct: 226 SVIIEYV*LRYPRVNSNDKRDFCFVYTSYTKFRWVRSVKVSYLKTNAPNKVVVLSAGQSF 47 >rciht025j24_4 LQQIFTKW*DAILRIILWYRNTCEVHMMDLNCAE*LS*NV*PSVRRFLEPENTAAFAQII YVPLLCNIPPYRSKYLEVKRDMKRVSGM*NTSKYIF*NKNVIFLHSTAVFQQMVEQHRKT FDKNNLRDFIDAFICEGKKGTDESFTV*YFVVNLSQFPFLLA***NTCNYVILA*IATTN VISVSYTPPTRNFAGLDP*KCLTLKQMRRTKWWC*VPDNLFV*KRPLYYTVGISKT >rciht025j24_5 SANFHEMVRCHFAYNTMVQKYMRSSHDGFELC*VIILKCLTFRSQVPGTREHGCFRTDNL CSFALQYTPLPKQVFGSKTGHEKGFRYVKHF*IYILK*KCYFFTFYSRFSTNGRAT*KNL *QK*PSRLY*CFYL*REEGHRRKFYGMILCS*FKPIPLSFSVIIEYV*LRYPRVNSNDKR DFCFVYTSYTKFRWVRSVKVSYLKTNAPNKVVVLSAGQSFCIEATALLHSGYQ*DX >rciht025j24_6 FSKFSRNGKMPFCV*YYGTEIHAKFT*WI*TVLSDYPEMFNLPFAGSWNPRTRLLSHR*F MFLCFAIYPLTEASIWK*NGT*KGFQVCKTLLNIYFKIKMLFFYILQPFFNKW*SNIEKP LTKITFATLLMLLFVKGRRAQTKVLRYDTL*LI*ANSPFF*RNNRIRVTTLSSRK*QRQT *FLFRIHLLHEISLG*IRKSVLP*NKCAEQSGGVKCRTIFLYRSDRFTTQWVSVRX >rciht035c13 Length = 727 Score = 114 bits (283), Expect = 1e-25 Identities = 57/60 (95%), Positives = 58/60 (96%), Gaps = 1/60 (1%) Frame = -3 Query: 1 SVIIGYV-LRYPRVNSNDKRDFCFVYTSYTKFRWVRSVKVSYLETNAPNKVVVLSAGQSF 59 SVII YV LRYPRVNSNDKRDFCFVYTSYTKFRWVRSVKVSYL+TNAPNKVVVLSAGQSF Sbjct: 212 SVIIEYV*LRYPRVNSNDKRDFCFVYTSYTKFRWVRSVKVSYLKTNAPNKVVVLSAGQSF 33 >rciht035c13_4 GLNMMTSISDYFSKFSRNGKMPFCV*YYGTEIHAKFT*WI*TVLSDYPEMFNLPFAGSWN PRTRLLSHR*FMFLCFAIYPLTEASIWK*NGT*KGFQVCKTLLNIYFKIKMLFFYILQPF FNKW*SNIEKPLTKITFATLLMLLFVKGRRAQTKVLRYDTL*LI*ANSPFF*RNNRIRVT TLSSRK*QRQT*FLFRIHLLHEISLG*IRKSVLP*NKCAEQSGGVKCRTIFLYRSDRFTT PV >rciht035c13_5 GFEYDDEHFRLLQQIFTKW*DAILRIILWYRNTCEVHMMDLNCAE*LS*NV*PSVRRFLE PENTAAFAQIIYVPLLCNIPPYRSKYLEVKRDMKRVSGM*NTSKYIF*NKNVIFLHSTAV FQQMVEQHRKTFDKNNLRDFIDAFICEGKKGTDESFTV*YFVVNLSQFPFLLA***NTCN YVILA*IATTNVISVSYTPPTRNFAGLDP*KCLTLKQMRRTKWWC*VPDNLFV*KRPLYY TSX >rciht035c13_6 V*I**RAFPTTSANFHEMVRCHFAYNTMVQKYMRSSHDGFELC*VIILKCLTFRSQVPGT REHGCFRTDNLCSFALQYTPLPKQVFGSKTGHEKGFRYVKHF*IYILK*KCYFFTFYSRF STNGRAT*KNL*QK*PSRLY*CFYL*REEGHRRKFYGMILCS*FKPIPLSFSVIIEYV*L RYPRVNSNDKRDFCFVYTSYTKFRWVRSVKVSYLKTNAPNKVVVLSAGQSFCIEATALLH QX >ciht025j24 Length = 671 Score = 98.7 bits (242), Expect = 1e-20 Identities = 48/51 (94%), Positives = 49/51 (95%), Gaps = 1/51 (1%) Frame = +2 Query: 1 SVIIGYV-LRYPRVNSNDKRDFCFVYTSYTKFRWVRSVKVSYLETNAPNKV 50 SVII YV LRYPRVNSNDKRDFCFVYTSYTKFRWVRSVKVSYL+TNAPNKV Sbjct: 518 SVIIEYV*LRYPRVNSNDKRDFCFVYTSYTKFRWVRSVKVSYLKTNAPNKV 670 >LQW163322.x1 >lcl|LQW163322.x1 CHROMAT_FILE: LQW163322.x1 PHD_FILE: LQW163322.x1.phd.1 CHEM: term DYE: ET TIME: Wed Aug 22 11:17:42 2001 TEMPLATE: LQW163322 DIRECTION: fwd AACGGCAGTGCAGCTTTTGTATAGAAGCGACCGCTTTACTACACAGTGGGTATCAGTAAGACATAAAAAATGTTTTAAAT AAAAAAAATGATAAAAATTAAATTTGAAAACTGCGCGAAAAGTTTTGCGTCAGCAGGTATTTCAAAAATTAATAAACGTT TACACAGCTTCGTTCAGTCGAAAAATTGAAATGTTTTTCCTGGCATTTACCCGATCTTTAAAAAGGCTGCTGCTTTTTTG AAACTTTGGGATACCTTAGATCACATTTGAGCATCTCTATCTATATAAAACATGTTTTCGTTCGGTGGCTCTTCTCAGGA TGGGCAGCTTGTACAATATGTGCGTGAAATGTTCGAAGCTGGAACAGAAACAATGACAGGAACTGTCAGATGGGCGATGC TGTGTCTCATCCATTACCCAGATGGGCAAAAAAAACTTCGGGAAGAAATATTTGAAGCAATAGGCAAGTTATAATATAGA GGGTTTATGGTCAGTTTATAATTAATAGTTTTATTTATTCTGCAAAACTTAGATTAAACCCCCTTGTTTACAACCAGGAT GTTATAAAGTATAACAGGCTGGGGAAAGATGGGACAATTTTCGTTATATTTCCTCGTCCCATGTGGTAGTAAACAAATAA GAACGTTCAAAGAATTATTATAAAACCGTATCGTCGCGACTCCCATATACAGGCCGCGTCGATATTGTTTAAAACATCAT GATAATGGTACTTGGATACTATGTGCTAAAGGTGTCCCATATTCCCCCGTAATTCTATATCATACCCTTTTACAGATTTA TCATTTTACATTGTATTACTGTTGATCTATACATAAGTGGGATACGTAGGCACTGATCCAATTCGGGACATGTGTACCCA TCCCAGCTATCAAATGTAAAATCGGTAAAATTGGACTTCTGGCTTCCACGGAACACTCGAAAGGATACACAGATATTACA CGGCTTCAAAGTAGCGCATCAAATAAACCTATGACAGCTCACATGTATTAAGAGACGCAACTTA >GCiWno379_j24.b1_4 XL*LX*ANFPFF*RNNRIRVXTLSSRK*QRQT*FLFRIHLLHEISLG*IRKSILP*NKCA EQSGGVKCRTIFLYRSDRFTTQWVSVRHKKMF*IKKMIKIKFENCAKSFASAGISKINKR LHSFVQSKN*NVFPGIYPIFKKAAAFLKLWDTLDHI*ASLSI*NMFSFGGSSQDGQLVQY VREMFEAGTETMTGTVRWAMLCLIHYPDAQTKLREEIFAAIGKL*YRGFMVSL*LIVLFI LQNLDENPLVYNQDVIKYIRLGKDRTMFVRCFS >GCiWno379_j24.b1_5 FVVNXSQFPFLLA***NTCXYVIFA*IATTNVISVSYTPPTRNFAGLDP*KYLTLKQMRR TKWWC*VPDNLFV*KRPLYYTVGISKT*KNVLNKKNDKN*I*KLR*KFCVSRYFKN**TF TQLRSVEKLKCFSWHLPDL*KGCCFFETLGYLRSHLSISIYIKHVFVRWLFSGWAACTIC A*NVRSWNRNNDRNCQMGDAVSHPLPRCANKTSGRNICRNRQVII*RVYGQFIINSFIYS AKLR*KPPCLQPGCYKVYQAGQR*DHVCSLF*X >GCiWno379_j24.b1_6 FCS*XKPISLSFSVIIEYVXLRYLRVNSNDKRDFCFVYTSYTKFRWVRSVKVSYLKTNAP NKVVVLSAGQSFCIEATALLHSGYQ*DIKKCFK*KK**KLNLKTALKVLRQQVFQKLINV YTASFSRKIEMFFLAFTRSLKRLLLF*NFGIP*ITFEHLYLYKTCFRSVALLRMGSLYNM CVKCSKLEQKQ*QELSDGRCCVSSITQMRKQNFGKKYLPQ*ASYNIEGLWSVYN**FYLF CKT*MKTPLFTTRML*SISGWAKIGPCLFVVLV >GCiWno973_a07.b1_4 F*SVKDAVL*FCKYTCXYTKWEKKIMK*WHLTLRYFILTYAALFYKGXGPPLSSFIYINI LFDAERDVAHN*MW*LILGNNNRPSISDRKAMPFTSAFIQEVFRFRTRVPLGVQHMTTET VNFANYVIPKGTTVLL*GIL*CRCNIVYSILYFCEMLFRYFRFLPICGRCTTILMCGTNQ ASLNLSVTSMTKETLFSLNT*YLSRWVHVIAWENNLLEWKSSSSWFQWFRSLSFFRIRTN QIFLRLMTELRATVSFHTRSTLLLVRFNLM >GCiWno973_a07.b1_5 VLECERCGFIVL*IYLXIYQMGKENHEIVASYPALLHINLRGSILQRXRSASKLVYLY*H PF*R*TGCCT*LNVVTYFR*QQPPEHKRSQSNAIHLSFYTRGVSISHSRSFGRPAHDNRN RKLRKLCYSKRNHGTVIGYIVMSL*YSI*YFVFL*NVVSIF*ILANMWAVHNDPDVWDEP SKFKPERHLDDKGNFVQSKHVIPFSVGPRHCLGEQLARMEIFIFLVSMVQKFEFLPDPNE PDLPEINDGVKGNGFFPYSFNFVASEI*SNX >GCiWno973_a07.b1_6 FRV*KMRFYSSVNILVXIPNGKRKS*NSGILPCATSY*PTRLYSTKV*VRL*ARLFILTS FLTLNGMLHITKCGDLF*VTTTARA*AIAKQCHSPQLLYKRCFDFALAFLWASST*QQKP *TSQTMLFQKEPRYCYRVYCNVVVI*YIVFCIFVKCCFDILDSCQYVGGAQRS*CVGRTK QV*T*ASPR*QRKLCSV*TRDTFLGGSTSLLGRTTCSNGNLHLPGFNGSEV*VSSGSERT RSS*D**RS*GQRFLSILVQLCC**DLI*X Walk 1 >GCiWno1017_g22.g1 CHROMAT_FILE: GCiWno1017_g22.g1 PHD_FILE: GCiWno1017_g22.g1.phd.1 CHEM: term DYE: big TIME: Thu Dec 27 11:52:37 2001 TEMPLATE: GCiWno1017_g22 DIRECTION: rev Length = 905 Score = 208 bits (523), Expect = 6e-53 Identities = 107/118 (90%), Positives = 110/118 (92%), Gaps = 4/118 (3%) Frame = -3 Query: 50 SVKDAVL-FCKYTCXYTKWEKKIMK-WHLTLRYFILTYAALFYKGXGPPLSSFIYINILF 107 SV+DAVL FCKYT YTKWEKKIMK WHLTLRYFILT AALFYKG GPPLSSFIYINILF Sbjct: 492 SVEDAVL*FCKYTLLYTKWEKKIMK*WHLTLRYFILTNAALFYKGLGPPLSSFIYINILF 313 Query: 108 DAERDVAHN-MW-LILGNNNRPSISDRKAMPFTSAFIQEVFRFRTRVPLGVQHMTTET 163 DAERDVAHN MW LILGNNNRPSISDRK+MPFTSAFIQEVFRFRTRVPLGVQHMTT+T Sbjct: 312 DAERDVAHN*MW*LILGNNNRPSISDRKSMPFTSAFIQEVFRFRTRVPLGVQHMTTQT 139 >GCiWno1017_g22.g1_4 NTPCCKPPWPRDVIKGITRGGEKDGNNCSVIISSFPMWVVKQIRKVQKDYV*NPYGRRLP IYRPASLLFKTS**WYLDTRX*RCPIFPPLILYHTLLQIYHFNIFIHVVLLD*MGYR*AR ESHIS*SWFKQLTTLF*SVEDAVL*FCKYTLLYTKWEKKIMK*WHLTLRYFILTNAALFY KGLGPPLSSFIYINILFDAERDVAHN*MW*LILGNNNRPSISDRKSMPFTSAFIQEVFRF RTRVPLGVQHMTTQTVNFANYVIPKGTTVLL*GIL*CRCNIVYSILYVCEMLFR*VPSSN R >GCiWno1017_g22.g1_5 KHPML*TPLAQGCYKRYNQGWGKGWEQLFGYNFLVPHVGSKTNKEGSEGLCIKPVWSATP HIQARVVIV*NIMIMVFGY*VXKVSHIPPVNSISYPFTDISL*YFYTCSTIRLDGIPLGT *ITYFVIVV*TINNAVLEC*RCGFIIL*IYFVIYQMGKENHEIVASYPALLHINQRGSIL QRFRSASKLVYLY*HPF*R*TGCCT*LNVVTYFR*QQPPEHKRSQINAIHLSFYTRGVSI SHSRSFGRPTHDNTNRKLRKLCYSKRNHGTVIGYIVMSL*YSI*YFVCL*NVVSIGTELE SX >GCiWno1017_g22.g1_6 QTPHVVNPPGPGML*KV*PGVGKRMGTIVRL*FPRSPCG**NK*GRFRRIMYKTRMVGDS PYTGPRRYCLKHHDNGIWILGXKGVPYSPR*FYIIPFYRYITLIFLYM*YY*IRWDTVRH VNHIFRDRGLNN*QRCFRVLKMRFYNSVNILCYIPNGKRKS*NSGILPCATSY*PTRLYS TKV*VRL*ARLFILTSFLTLNGMLHITKCGDLF*VTTTARA*AIANQCHSPQLLYKRCFD FALAFLWASNT*QHKP*TSQTMLFQKEPRYCYRVYCNVVVI*YIVFCMFVKCCFDRYRAR IX LQW194191.y2 LQW194191.y2.phd.1 LQW194191.x1 14:34:39 2001 TEMPLATE: LQW194191 DIRECTION: rev Length = 916 Score = 65.2 bits (156), Expect(2) = 2e-18 Identities = 30/34 (88%), Positives = 33/34 (96%) Frame = +2 Query: 27 FPPLILYHTLLQIYHFNIFIHVVLLD*MGYR*AR 60 + P+ILYHTLLQIYHFNIFIHVVLLD*+GYR*AR Sbjct: 437 YSPVILYHTLLQIYHFNIFIHVVLLD*VGYR*AR 538 Score = 46.1 bits (107), Expect(2) = 2e-18 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = +1 Query: 5 ASLLFKTS**WYLDTRX*RCPIFP 28 ASLLFKTS**WYLDT *RCPIFP Sbjct: 373 ASLLFKTS**WYLDTMC*RCPIFP 444 >LQW194191.y2_1 XTLSXYHYVRECSKLDRHMTGLSDGRCCVSSITRWQKNSGRTI*SNRQVII*RVYGQFII NSFIYSAKLRLNPLVYNQDVIKYNRLGKDGTIFVIFPRPMW**TNKNVQRIIIKPYRRDS HIQAASLLFKTS**WYLDTMC*RCPIFPRNSISYPFTDISL*YFYTCSTIRLGGIPLGT* ITYFVIVV*TITNAVSEC*RCGYIVLYIYFVIYPMGQDTHEIVASYVSYLYEQRGLSTSL RRSKRY**HL*VTDVLLLAFSNTRVQ*NAPVSRLSSSGP*TG*ISSVS*SIKFSKSGPEL LSRCFX >LQW194191.y2_2 VHSAXTTMCVNVRSWTDT*QDCQMGDAVSHPLPDGKKIREELFEAI GKL*YRGFMVSL*L IVLFILQNLD*TPLFTTRML*SITGWGKMGQFSLYFLVPCGSKQIRTFKELL*NRIVATP IYRPRRYCLKHHDNGIWILCAKGVPYSPVILYHTLLQIYHFNIFIHVVLLD*VGYR*ARE SHIS*SWFKQLPTLFQSVEDAVI*FCTYTLLYTQWDKTLMK*WHLT*ATYMNNAVYLHRY VDLSVINNIFE*RMCYSWLLVTREYNETLPFQGCPRLGHEQDEFQASVDQSSSANQDLNC YLVAL >LQW194191.y2_3 YTQPVPLCA*MFEAGQTHDRTVRWAMLCLIHYQMAKKFGKNYLKQ*ASYNIEGLWSVYN* *FYLFCKT*IKPPCLQPGCYKV*QAGERWDNFRYISSSHVVVNK*ERSKNYYKTVSSRLP YTGRVVIV*NIMIMVFGYYVLKVSHIPP*FYIIPFYRYITLIFLYM*YY*IRWDTVRHVN HIFRDRGLNNYQRCFRVLKMRLYSSVHILCYIPNGTRHS*NSGILRELLI*TTRSIYIVT SI*ALLITSLSNGCATLGF**HASTMKRSRFKVVLVWAMNRMNFKRQLINQVQQIRT*IA ISLL YVREMFEAGQTHDRT-VRWAMLCLIHYQMAKKKIREELFEAI YVREMFEAGTETMTGXVRWAMLCLIHYPDAQKKLREEIFEAI GCiWno874_b07.g1 Best hit LQW163322.x1 LQW163322.x1.phd.1 LQW163322.y1 11:17:42 2001 TEMPLATE: LQW163322 DIRECTION: fwd Length = 1024 Score = 63.6 bits (152), Expect = 2e-10 Identities = 31/42 (73%), Positives = 35/42 (82%), Gaps = 1/42 (2%) Frame = +1 Query: 7 YVREMFEAG-QTHDRTVRWAMLCLIHYQMAKKKIREELFEAI 47 YVREMFEAG +T TVRWAMLCLIHY +KK+REE+FEAI Sbjct: 337 YVREMFEAGTETMTGTVRWAMLCLIHYPDGQKKLREEIFEAI 462 5 diffs with seq 209 >GCiWno874_b07.g1 CHROMAT_FILE: GCiWno874_b07.g1 PHD_FILE: GCiWno874_b07.g1.phd.1 CHEM: term DYE: big TIME: Mon Dec 10 12:34:53 2001 TEMPLATE: GCiWno874_b07 DIRECTION: rev Length = 977 Score = 173 bits (433), Expect = 1e-42 Identities = 98/115 (85%), Positives = 102/115 (88%), Gaps = 6/115 (5%) Frame = -3 This is seq 209 Query: 1 YVREMFEAG-QTHDRTVRWAMLCLIHYQMAKKKIREELFEAIGKL-YRGFMVSL-LIVLF 57 YVREMFEAG +T VRWAMLCLIHY A+KK+REE+FEAIGKL YRGFMVSL LIVLF Sbjct: 627 YVREMFEAGTETMTGXVRWAMLCLIHYPDAQKKLREEIFEAIGKL*YRGFMVSL*LIVLF 448 Query: 58 ILQNLD-TPLFTTRML-SITGWGKMGQFSLYFLVPCGSKQIRTFKELL-NRIVAT 109 ILQNLD TPLFTTRML SITGWGKMGQFSLYFLVPCGSKQIRTFKELL N IVAT Sbjct: 447 ILQNLD*TPLFTTRML*SITGWGKMGQFSLYFLVPCGSKQIRTFKELL*NHIVAT 283 >sequence 10, 11, 22 28 accessions 45% to 2C8 might be two closely related genes this seq from NLWA is almost identical to seq 2 (may be part of a gene cluster) YFFIVLKYCTDVLINLLSADVFQELVDQHRISFDKNNIRDFIDAFICEVDNGKDDSFT (0) DRQLVQYLREIFEAGTQTTTGTLNWAILCLIHYPQAQKKLRNEILDVI 508 GNNNRPSISDRKSMPFTSAFIQEVFRFRTRVRTGVPHKTTETVNFANYVIPKGTTIVA NLWAVHNDPDVWDEPSKFKPERHLDDKGNFVQSKHVIPFSVGPRHCLGEQLARMKIFIFLVSMVQKFEF LPDPNEPDLPEIDDGVIGNGFFPYPFNFVANEI* DEV12046.y1 I-HELIX FID not FTD in seq 11 DEV16908.x1 DEV3110.y1 DEV36061.y1 DEV39761.y1 DEV40662.x1 FID not FTD one more diff DEV49690.x1 I-HELIX * LQW134849.x01 LQW134849.x1 LQW141933.y1 LQW172858.y1 LQW197304.x1 LQW210937.y1 LQW214724.x2 LQW214724.y1 I-HELIX * OPPOSITE END OF SEQ 11 LQW238538.x1 I-HELIX * OPPOSITE END OF SEQ 22 LQW238538.y1 LQW251009.x1 FID not FTD LQW254973.x1 LQW254973.y1 LQW271884.y1 LQW29511.x1 FID not FTD one more diff I-HELIX LQW29511.y1 LQW51603.x1 I-HELIX * OPPOSITE END OF SEQ 11 LQW51603.y1 LQW63108.y1 FID not FTD one more diff I-HELIX LQW63573.x1 I-HELIX * LQW77027.y1 GCiWno973_a07.b1 CHROMAT_FILE: GCiWno973_a07.b1 PHD_FILE: GCiWno973_a07.b1.phd.1 CHEM: term DYE: big TIME: Tue Dec 25 11:42:59 2001 TEMPLATE: GCiWno973_a07 DIRECTION: fwd Length = 811 Score = 150 bits (374), Expect(2) = 3e-56 Identities = 67/69 (97%), Positives = 69/69 (99%) Frame = -1 Query: 166 NLWAVHNDPDVWDEPSKFKPERHLDDKGNFVQSKHVIPFSVGPRHCLGEQLARMKIFIFL 225 N+WAVHNDPDVWDEPSKFKPERHLDDKGNFVQSKHVIPFSVGPRHCLGEQLARM+IFIFL Sbjct: 316 NMWAVHNDPDVWDEPSKFKPERHLDDKGNFVQSKHVIPFSVGPRHCLGEQLARMEIFIFL 137 Query: 226 VSMVQKFEF 234 VSMVQKFEF Sbjct: 136 VSMVQKFEF 110 Score = 91.3 bits (223), Expect(2) = 3e-56 Identities = 45/58 (77%), Positives = 46/58 (78%) Frame = -2 Query: 102 ILGNNNRPSISDRKSMPFTSAFIQEXXXXXXXXXXGVPHKTTETVNFANYVIPKGTTV 159 ILGNNNRPSISDRK+MPFTSAFIQE GV H TTETVNFANYVIPKGTTV Sbjct: 582 ILGNNNRPSISDRKAMPFTSAFIQEVFRFRTRVPLGVQHMTTETVNFANYVIPKGTTV 409 >GCiWno809_c05.g1 CHROMAT_FILE: GCiWno809_c05.g1 PHD_FILE: GCiWno809_c05.g1.phd.1 CHEM: term DYE: big TIME: Wed Dec 5 19:20:32 2001 TEMPLATE: GCiWno809_c05 DIRECTION: rev Length = 890 Score = 148 bits (369), Expect(2) = 3e-55 Identities = 66/69 (95%), Positives = 68/69 (97%) Frame = +1 Query: 166 NLWAVHNDPDVWDEPSKFKPERHLDDKGNFVQSKHVIPFSVGPRHCLGEQLARMKIFIFL 225 N+WAVHNDPDVWDEPSKFKPERHLDDKGNFVQS HVIPFSVGPRHCLGEQLARM+IFIFL Sbjct: 403 NMWAVHNDPDVWDEPSKFKPERHLDDKGNFVQSNHVIPFSVGPRHCLGEQLARMEIFIFL 582 Query: 226 VSMVQKFEF 234 VSMVQKFEF Sbjct: 583 VSMVQKFEF 609 Score = 90.1 bits (220), Expect(2) = 3e-55 Identities = 45/58 (77%), Positives = 46/58 (78%) Frame = +2 Query: 102 ILGNNNRPSISDRKSMPFTSAFIQEXXXXXXXXXXGVPHKTTETVNFANYVIPKGTTV 159 ILGNNNRPSISDRK+MPFTSAFIQE GV H TTETVNFANYVIPKGTTV Sbjct: 137 ILGNNNRPSISDRKAMPFTSAFIQEVFRFRTRVP*GVQHMTTETVNFANYVIPKGTTV 310 >cinc016b21 Length = 698 Score = 197 bits (496), Expect = 1e-49 Identities = 100/121 (82%), Positives = 102/121 (83%), Gaps = 3/121 (2%) Frame = +2 Query: 59 DRQLVQYLREIFEAGTQTTTGTLNWAILCLIHYPQAQKKLRNEIL---GNNNRPSISDRK 115 DRQLVQYLREIFEAGTQTTTGTLNWAILCLIHYPQAQKKLRNEIL GNNNRPSISDRK Sbjct: 347 DRQLVQYLREIFEAGTQTTTGTLNWAILCLIHYPQAQKKLRNEILDVIGNNNRPSISDRK 526 Query: 116 SMPFTSAFIQEXXXXXXXXXXGVPHKTTETVNFANYVIPKGTTVSFIAMWNLWAVHNDPD 175 SMPFTSAFIQE GVPHKTTETVNFANYVIPKGTT+ + NLWAVH DPD Sbjct: 527 SMPFTSAFIQEVFRFRTRVRTGVPHKTTETVNFANYVIPKGTTI----VANLWAVHXDPD 694 Query: 176 V 176 V Sbjct: 695 V 697 Score = 85.0 bits (207), Expect = 1e-15 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = +1 Query: 19 ADVFQELVDQHRISFDKNNIRDFTDAFICEVDNGKDDSFT 58 ADVFQELVDQHRISFDKNNIRDF DAFICEVDNGKDDSFT Sbjct: 88 ADVFQELVDQHRISFDKNNIRDFIDAFICEVDNGKDDSFT 207 >cinc016b21 CGGCACGAGGCCTCGTGCCCTTTGCTTTGCAATATACCCCCTTACCGAAGCAAGTATTTGGAAGTAAAGCGGGACATGAT GCAAATGGCCGACGTTTTTCAAGAACTGGTAGACCAACACAGAATATCTTTCGACAAAAATAACATTCGAGACTTTATTG ATGCTTTCATTTGCGAGGTTGACAATGGAAAAGACGACAGTTTTACAGTAATAATAACTTATACAAATGATAAGTAAAAG GTTCATTTAATATAGGCTATAGCAAAAACAGTGTATTGCGACACGAAGTGTAAGCTAACTCGAACCAAAATGTACAACTT TCGTTAATATATCTCTCAAATCAAAGGATCGACAGCTTGTACAGTACCTGCGGGAAATATTTGAAGCTGGAACGCAAACC ACCACCGGTACACTTAATTGGGCAATACTATGTCTCATCCATTATCCACAAGCACAAAAGAAACTGAGAAATGAAATTCT TGACGTCATTGGTAACAACAACCGCCCGAGCATAAGCGATCGCAAATCAATGCCATTCACCTCAGCATTTATACAAGAGG TGTTTCGATTTCGTACACGTGTCCGAACAGGCGTTCCGCATAAAACAACAGAAACTGTAAACTTCGCAAACTATGTAATT CCTAAGGGAACAACGATCGTAGCCAATCTATGGGCGGTGCACNACGATCCTGATGTGT >cinc016b21_1 RHEASCPLLCNIPPYRSKYLEVKRDMMQMADVFQELVDQHRISFDKNNIRDFIDAFICEV DNGKDDSFTVIITYTNDK*KVHLI*AIAKTVYCDTKCKLTRTKMYNFR*YISQIKGSTAC TVPAGNI*SWNANHHRYT*LGNTMSHPLSTSTKETEK*NS*RHW*QQPPEHKRSQINAIH LSIYTRGVSISYTCPNRRSA*NNRNCKLRKLCNS*GNNDRSQSMGGAXRS*CV >cinc016b21_2 GTRPRALCFAIYPLTEASIWK*SGT*CKWPTFFKNW*TNTEYLSTKITFETLLMLSFARL TMEKTTVLQ***LIQMISKRFI*YRL*QKQCIATRSVS*LEPKCTTFVNISLKSKDRQLV QYLREIFEAGTQTTTGTLNWAILCLIHYPQAQKKLRNEILDVIGNNNRPSISDRKSMPFT SAFIQEVFRFRTRVRTGVPHKTTETVNFANYVIPKGTTIVANLWAVHXDPDVX >cinc016b21_3 ARGLVPFALQYTPLPKQVFGSKAGHDANGRRFSRTGRPTQNIFRQK*HSRLY*CFHLRG* QWKRRQFYSNNNLYK**VKGSFNIGYSKNSVLRHEV*ANSNQNVQLSLIYLSNQRIDSLY STCGKYLKLERKPPPVHLIGQYYVSSIIHKHKRN*EMKFLTSLVTTTARA*AIANQCHSP QHLYKRCFDFVHVSEQAFRIKQQKL*TSQTM*FLREQRS*PIYGRCTTILMC >cibd036p10 Length = 599 Score = 193 bits (485), Expect = 2e-48 Identities = 91/98 (92%), Positives = 93/98 (94%) Frame = +1 Query: 137 GVPHKTTETVNFANYVIPKGTTVSFIAMWNLWAVHNDPDVWDEPSKFKPERHLDDKGNFV 196 GVPHKTTETVNFANYVIPKGTT+ + NLWAVHNDPDVWDEPSKFKPERHLDDKGNFV Sbjct: 1 GVPHKTTETVNFANYVIPKGTTI----VANLWAVHNDPDVWDEPSKFKPERHLDDKGNFV 168 Query: 197 QSKHVIPFSVGPRHCLGEQLARMKIFIFLVSMVQKFEF 234 QSKHVIPFSVGPRHCLGEQLARMKIFIFLVSMVQKFEF Sbjct: 169 QSKHVIPFSVGPRHCLGEQLARMKIFIFLVSMVQKFEF 282 >cibd036p10 GGCGTTCCGCATAAAACAACAGAAACTGTAAACTTCGCAAACTATGTAATTCCTAAGGGAACAACGATCGTAGCCAATCT ATGGGCGGTGCACAACGATCCTGATGTGTGGGACGAACCAAGCAAGTTTAAACCTGAGCGTCACCTCGATGACAAAGGAA ACTTTGTTCAGTCTAAACACGTGATACCTTTCTCGGTGGGTCCACGTCATTGCTTGGGAGAACAACTTGCTCGAATGAAA ATCTTCATCTTCCTGGTTTCAATGGTTCAGAAGTTTGAGTTTCTTCCGGATCCGAACGAACCAGATCTTCCTGAGATTGA TGACGGAGTTATCGGGAACGGTTTCTTTCCATATCCGTTTAACTTTGTTGCCAATGAGATTTAACACCAACACCTATGTC AGTAGCGCTTAATGCTTGATATATTTACTCTATACTTTTTGCTTTGCAAGTATATCTAGGGTTGTGACTTTCCATAAAAT GATCGAAGATAATTTACAAAGTCTCAACAAATATAAAAAGTTATTTTTTATACGTATACCTAACTTCGGCATTATATCGT ACATCCAGCATGCTTCATATCTCACTGTTCATATTGTAG GVPHKTTETVNFANYVIPKGTTIVANLWAVHNDPDVWDEPSKFKPERHLDDKGNFVQSKH VIPFSVGPRHCLGEQLARMKIFIFLVSMVQKFEF LPDPNEPDLPEIDDGVIGNGFFPYPFNFVANEI* >sequence 5, 12, 194 DEQLHHYTRDLLVAAINTTT AAFGWCVVSLLRHPECQDKIWQEVDKVIGDETPSCKHQENMPYMRSFIQEIHRH RSIATLNLPHRTVRSVRLCGYDIPKDTPVLTNIWRVHNNQNVWKNPH EFRPDRHLDSNGNFVSSNNVIPFACGYRRCLGEQIAKAEIFLFIVNIVKRF HLVVDQVTGPPTLEKDPKGAVNTPAPFRFSVRARK LQW173019.y2 LQW18289.x1 exxr to pkg DEV16259.x1 I-HELIX DEV52712.y1 I-HELIX 2 DIFFS LQW229033.y1 I-helix LQW1044.x2 I-helix GCiWno59_m08.g1 GCiWno329_m07.b1 GCiWno150_b22.g1 >GCiWno150_b22.g1 CCATATACCCCCACTACTATTTAGTAGGGCGGTGGAAAACGGGCACCTTTAACCATACTATCTAAATATCCTAGTCGCGT TTTAAACAAATAACAATGGCTTATGTATAAGTCGTAAGTAGGCCTATATACGGTTTATAACTCTATGAATGTTTTTTGTT TACTACCAAATGGGACGAGAAAATAGAATAAAAAGTGTCCCATCTTCCCCCACCCTTACTGTATAAAAAAAAGTTGCCAT GATAGGTTAAGCAAAAAGAGGTAATAATGCTATGTAGCGAAATAGAACATCAAGCGAATATTTTATGGTAAATGCCGTTA CGTTATTAAGTGTTTGGTCCTGGACGCTGTTCTATAACGGCCAATCGCTACTGACCAGACTGCTGCGCTATAGGCTTCCT TTATTAATAATTTATATTCACGTAAACAAGCATATAGTAGGGTGGGGGAAGGCGGGACACCTTTTCATTCCATTTTCTCC TCTCATTTGGTTTTAAACAAAGAACATTCAAAGAATTATAAAAACCGTATCCTCACGACCCCCATAGACCGTTGTTAATT GTTTAAAAACACAATTAGGATATTATGTGCTAAAGGCGCACCGTCTTCCCCAAGCCTACCATGCGTTTTTATTTAAATCA GGCGACGAAACTCCCAGTTGCAAACACCAAGAANACATGCCGTACATGCGCTCGTTTATACAAGAAATACACCGGCACCG ATCCATTGCAACGCTGAATCTGCCTCATCGAACTGTTCGAAGCGTGCGACTGTGCGGTTATGACATTCCTAAAGATACCT CCAGTAGTACATTGGCCAATCAGCACACATCAGACATATGCGNTTACCTTATGTGTNTTTCTAAATTCGCAGCCAGACGT TTGACAANAATA >GCiWno150_b22.g1_1 PYTPTTI**GGGKRAPLTILSKYPSRVLNK*QWLMYKS*VGLYTVYNSMNVFCLLPNGTR K*NKKCPIFPHPYCIKKSCHDRLSKKR**CYVAK*NIKRIFYGKCRYVIKCLVLDAVL*R PIATDQTAAL*ASFINNLYSRKQAYSRVGEGGTPFHSIFSSHLVLNKEHSKNYKNRILTT PIDRC*LFKNTIRILCAKGAPSSPSLPCVFI*IRRRNSQLQTPRXHAVHALVYTRNTPAP IHCNAESASSNCSKRATVRL*HS*RYLQ*YIGQSAHIRHMRLPYVXF*IRSQTFDXNX >GCiWno150_b22.g1_2 HIPPLLFSRAVENGHL*PYYLNILVAF*TNNNGLCISRK*AYIRFITL*MFFVYYQMGRE NRIKSVPSSPTLTV*KKVAMIG*AKRGNNAM*RNRTSSEYFMVNAVTLLSVWSWTLFYNG QSLLTRLLRYRLPLLIIYIHVNKHIVGWGKAGHLFIPFSPLIWF*TKNIQRIIKTVSSRP P*TVVNCLKTQLGYYVLKAHRLPQAYHAFLFKSGDETPSCKHQEXMPYMRSFIQEIHRHR SIATLNLPHRTVRSVRLCGYDIPKDTSSSTLANQHTSDICXYLMCXSKFAARRLTXI >GCiWno150_b22.g1_3 IYPHYYLVGRWKTGTFNHTI*IS*SRFKQITMAYV*VVSRPIYGL*LYECFLFTTKWDEK IE*KVSHLPPPLLYKKKLP**VKQKEVIMLCSEIEHQANILW*MPLRY*VFGPGRCSITA NRY*PDCCAIGFLY**FIFT*TSI**GGGRRDTFSFHFLLSFGFKQRTFKEL*KPYPHDP HRPLLIV*KHN*DIMC*RRTVFPKPTMRFYLNQATKLPVANTKXTCRTCARLYKKYTGTD PLQR*ICLIELFEACDCAVMTFLKIPPVVHWPISTHQTYAXTLCVFLNSQPDV*QX >GCiWno329_m07.b1 TTGTTTAAAACCAAATGAGAGGAGAAAATGGAATGAAAAGGTGTCCCGCCTTCCCCCACCCTACTATATGCTTGTTTACG TGAATATAAATTATTAATAAAGGAAGCCTATAGCGCAGCAGTCTGGTCAGTAGCGATTGGCCGTTATAGAACAGCGTCCA GGACCAAACACTTAATAACGTAACGGCATTTACCATAAAATATTCGCTTGATGTTCTATTTCGCTACATAGCATTATTAC CTCTTTTTGCTTAACCTATCATGGCAACTTTTTTTTTATACAGTAAGGGTGGGGGAAGATGGGACACTTTTTATTCTATT TTCTCGTCCCATTTGGTAGTAAACAAAAAACATTCATAGAGTTATAAACCGTATATAGGCCTACTTACGACTTATACATA AGCCATTGTTATTTGTTTAAAACGCGACTAGGATATTTAGATAGTATGTGTTAAAGGTGCCCGTTTTCAACCGCCCTACT AAATAGTAGTGTGGGGTTATATGGGACATATTTTCATTATGTTTTTCCCGTCCCATTTTTTACATAATTTTAACATAGGT GCAAAAACAATAAAGCTTGTATAAAACTCAGTAGTTTGTAACTTAGAAATACTGATCCTTGTAACCGTTCCAAATAAACT TACCGATAACCTGGTCCACCTCTTGCCATATTTTTGCCCTGACACTCTGGATGGCCGAACAAAGACACCACACACCAACC CAACGCTGGGAGTCGCTGTATTAATAGCCAGCCACCAATAAATCTTGAGTGGAATGAATGGAGCTGGTCATCCTATAACA CATTTATTATTTGCATTGGTGGCGGAGTGGGTTATTCCTTTCGGCGGGTAATAGTTGGGGCAGTTTTTAATGGGCACCGG GCGCGGGCCCTCT >GCiWno329_m07.b1_4 RARARCPLKTAPTITRRKE*PTPPPMQIINVL*DDQLHSFHSRFIGGWLLIQRLPALGWC VVSLFGHPECQGKNMARGGPGYR*VYLERLQGSVFLSYKLLSFIQALLFLHLC*NYVKNG TGKT**KYVPYNPTLLFSRAVENGHL*HILSKYPSRVLNK*QWLMYKS*VGLYTVYNSMN VFCLLPNGTRK*NKKCPIFPHPYCIKKKLP**VKQKEVIMLCSEIEHQANILW*MPLRY* VFGPGRCSITANRY*PDCCAIGFLY**FIFT*TSI**GGGRRDTFSFHFLLSFGFKQ >GCiWno329_m07.b1_5 EGPRPVPIKNCPNYYPPKGITHSATNANNKCVIG*PAPFIPLKIYWWLAINTATPSVGLV CGVFVRPSRVSGQKYGKRWTRLSVSLFGTVTRISISKLQTTEFYTSFIVFAPMLKLCKKW DGKNIMKICPI*PHTTI**GG*KRAPLTHTI*IS*SRFKQITMAYV*VVSRPIYGL*LYE CFLFTTKWDEKIE*KVSHLPPPLLYKKKVAMIG*AKRGNNAM*RNRTSSEYFMVNAVTLL SVWSWTLFYNGQSLLTRLLRYRLPLLIIYIHVNKHIVGWGKAGHLFIPFSPLIWF*TX >GCiWno329_m07.b1_6 RGPAPGAH*KLPQLLPAERNNPLRHQCK**MCYRMTSSIHSTQDLLVAGY*YSDSQRWVG VWCLCSAIQSVRAKIWQEVDQVIGKFIWNGYKDQYF*VTNY*VLYKLYCFCTYVKIM*KM GREKHNENMSHITPHYYLVGRLKTGTFNTYYLNILVAF*TNNNGLCISRK*AYIRFITL* MFFVYYQMGRENRIKSVPSSPTLTV*KKSCHDRLSKKR**CYVAK*NIKRIFYGKCRYVI KCLVLDAVL*RPIATDQTAAL*ASFINNLYSRKQAYSRVGEGGTPFHSIFSSHLVLNX >GCiWno59_m08.g1 CTGGCCTTCGCTTACTGTAATATTCTACTACTATCATTATTACCTCTTTTTGCTTAACCTATCATGGCAACTTTTTTTTT ATACAGTAAGGGTGGGGGAAGATGGGACACTGTTTATTCTATTTTCTCGTCCCATTTGGTAGTAAACAAAAAACATTCAT AGAGTTATAAACCGTATATAGGCCTACTTACGACTTACACATAAGCCATTGTTATTTGTTTAAAACGCGACTAGGATATT TAGATAGTATGTGTTAAAGGTGCCCGTTTTCAACCGCCCTACTAAATAGTAGTGTCGGGTTATATGGGACATATTTTCAT TATGTTTTTCCCGTCCCATTTTTTACATAATTTTAACATAGGTGCAAAAACAATAAAGCCTGTATAAAACTCAGTAGTTT GTAACTTAGAAATACTGATCTTTGTAACCGTTCAAAATAAACTTACCGATAACCTTGTCCACCTCTTGCCATATTTTGTC CTGACACTCTGGATGCCGAAGCAAAGACACAACACACCAACCAAACGCTGCAGTCGTTGTATTAATAGCAGCTACCAATA AATCTCGAGTGTAATGGTGGAGTTGCTCATCCTATAACACATTTATTTTTGTATTGTGGCGTATTGCTTATTCTTTTGCT GNTATATGTTTGTAGTTTTTTATGTGTAGTTTGCTGTGCCGTCCTGTCGTATTGGTTAAATTGAACGAATGAACACAATG TAAGTTGTTTACCACGCGTGGCGAGGCCACAACAGTCGTTATAACGCGGGGCTTTCTTGATTCAAATATCTCCGTGCCAG CGGCCGCGAACTATTGTGCCCGCGGG >GCiWno59_m08.g1_4 PRAQ*FAAAGTEIFESRKPRVITTVVASPRVVNNLHCVHSFNLTNTTGRHSKLHIKNYKH IXAKE*AIRHNTKINVL*DEQLHHYTRDLLVAAINTTTAAFGWCVVSLLRHPECQDKIWQ EVDKVIGKFILNGYKDQYF*VTNY*VLYRLYCFCTYVKIM*KMGREKHNENMSHITRHYY LVGRLKTGTFNTYYLNILVAF*TNNNGLCVSRK*AYIRFITL*MFFVYYQMGRENRINSV PSSPTLTV*KKSCHDRLSKKR******NITVSEGQ >GCiWno59_m08.g1_5 PAGTIVRGRWHGDI*IKKAPRYNDCCGLATRGKQLTLCSFVQFNQYDRTAQQTTHKKLQT YXSKRISNTPQYKNKCVIG*ATPPLHSRFIGSCY*YNDCSVWLVCCVFASASRVSGQNMA RGGQGYR*VYFERLQRSVFLSYKLLSFIQALLFLHLC*NYVKNGTGKT**KYVPYNPTLL FSRAVENGHL*HILSKYPSRVLNK*QWLMCKS*VGLYTVYNSMNVFCLLPNGTRK*NKQC PIFPHPYCIKKKLP**VKQKEVIMIVVEYYSKRRPX >GCiWno59_m08.g1_6 RGHNSSRPLARRYLNQESPAL*RLLWPRHAW*TTYIVFIRSI*PIRQDGTANYT*KTTNI XQQKNKQYATIQK*MCYRMSNSTITLEIYW*LLLIQRLQRLVGVLCLCFGIQSVRTKYGK RWTRLSVSLF*TVTKISISKLQTTEFYTGFIVFAPMLKLCKKWDGKNIMKICPI*PDTTI **GG*KRAPLTHTI*IS*SRFKQITMAYV*VVSRPIYGL*LYECFLFTTKWDEKIE*TVS HLPPPLLYKKKVAMIG*AKRGNNDSSRILQ*AKAX >ciht008o06 3 aa diffs Length = 696 Score = 115 bits (284), Expect = 1e-25 Identities = 53/56 (94%), Positives = 54/56 (95%) Frame = +1 Query: 1 NMPYMRSFIQEIHRHRSIATLNLPHRTVRSVRLCGYDIPKDTPVSTLANQHTSDMW 56 NMPYMRSFIQEIHRHRSIATLNLPHRTVRSVRLCGYDIPKDTPVSTLA HTSD+W Sbjct: 76 NMPYMRSFIQEIHRHRSIATLNLPHRTVRSVRLCGYDIPKDTPVSTLAILHTSDIW 243 >ciht008o06 CNGCACGAGGCCCAAGCCTACCATGCGTTTTTATTTAAATCAGGCAACGAAACTCCCAGTTGCAAGCACCAAGAAAACAT GCCGTACATGCGCTCGTTTATACAAGAAATACACCGGCACCGATCCATTGCAACGCTGAATCTGCCTCATCGAACTGTTC GAAGCGTGCGACTGTGCGGTTATGACATTCCTAAAGATACTCCAGTAAGTACATTGGCCATTCTGCACACATCAGACATA TGGGTTTACCTTATGTGTTTTTCTAAATTCGCAGCCAGACCTTCATGGGCGAGAAAAATCGCCCATGAAGGTATATAAGT GGTAACTCGTATAAGCGGACATGATATGTAGGACAGAACGCCTCTGTTTTGGAGACTGGCGTTGCCCTGTCAGGCTAGGA TAAATAAGTTACATTAATAATGATATATATAATAAAGTATAACATGTACGTTTTGTGCTTAATTCTAACATAGGTACTTA CCAACATTTGGAGGGTCCACAATAATCAAAATGTTTGGAAAAATCCACACGAGTTTCGACCCGATCGTCATCTTGACGGC AACGGCAATTTCGTCTCATCTAACAACGTCATTCCTTTTGCATGTGGTTATAGGCGTTGTTTGGGCGAGCAAATAGCCAA AGCAGAGATATTTCTTTTTATAGTAAATATTGTCAAACGGTTTCACTTGGTAGTGG VLTNIWRVHNNQNVWKNPHEFRPDRHLDSNGNFVSSNNVIPFACGYRRCLGEQIAKAEIFLFIVNIVKRFHLVV >GCiWno582_d02.b1 CHROMAT_FILE: GCiWno582_d02.b1 PHD_FILE: GCiWno582_d02.b1.phd.1 CHEM: term DYE: big TIME: Wed Oct 24 12:56:49 2001 TEMPLATE: GCiWno582_d02 DIRECTION: fwd Length = 880 Score = 121 bits (300), Expect = 2e-27 Identities = 55/56 (98%), Positives = 56/56 (99%) Frame = -1 Query: 1 NMPYMRSFIQEIHRHRSIATLNLPHRTVRSVRLCGYDIPKDTPVSTLANQHTSDMW 56 NMPYMRSFIQEIHRHRSIATLNLPHRTVRSVRLCGYDIPKDTPVSTLANQHTSD+W Sbjct: 310 NMPYMRSFIQEIHRHRSIATLNLPHRTVRSVRLCGYDIPKDTPVSTLANQHTSDIW 143 >GCiWno582_d02.b1 CATCATATGTATGGCNNCTGCAGGAATCGACTTCTAGAGGGATCCCCATACGAGTTACCACTTATATAACTTCATGGGCG ATTTTTTTGGTTATTTTTGTTCAACGTCTGGCTGCGAATTTAGAAAAACACATAAGGTAAACCCATATGTCTGATGTGTG CTGATTGGCCAGTGTACTTACTGGAGTATCTTTAGGAATGTCATAACCGCACAGTCGCACGCTTCGAACAGTTCGATGAG GCAGATTCAGCGTTGCAATGGATCGGTGCCGGTGTATTTCTTGTATAAACGAGCGCATGTACGGCATGTTTTCTTGGTGC TTGCAACTGGGAGTTTCGTCGCCTGATTTAAAAAATAAAACTTACAGTAGGCTTGGGGAAGACGGTGCGCCTTTAGCACA TAATATCCTAATTGTGTTTTTAAACAATTAACAACGGTCTATGGGGGTCGTGAGGATACGGTTTTTATAATTCTTTGAAT GTTCTTTGTTTAAAACCAAATGAGAGGAGAAAATGGAATGAAAAGGTGTCCCGCCTTCCTCTACTATACTTGTTTACGTG ATTAAATTATTAATAAAGTAAGCCTATACGCCTACAGCAGTCTGGTCAGTGGCGATGGGCCGTTAAAACAGCGTTTAGGA CCAAACACTTAAAGTAAAGGTATTTACCATAAAATATTCGCTTGATGTTCTATGCTACTACATAGCATTATTACCTCTTT TTGCTTAACCTATCATGGCAACTTTTTTTTATACAGTAAAGGTTGGGGGAACATGGGAACACTGTTTAATTCTATTTTTC TCGGCCCATTTGGGCAGTAACACAAAAAACTTTTCTTAAGAGTTATAAAACCCGTATTATAGGCCTCACTTTACCACTTT >GCiWno582_d02.g1 TACGAATTCGAGCTCGTACCCAGAGTTCTTTTTATACCAAATGGGTCGAGAAAATAGAACGAAAACATGTCCCATATTAC CCGACTCTATATCTTGTATTTTCAAATGAATCTACGATTTATTTACATCAGTATATAGCGTTACCCTACTGTTCTACTGT GTTAAGGCAATCTAAATAAAATAATGTTTATACAGACTCTCTTTCGGAAAGCAGTAACTAATGTCACATGCTCCGTTCTA ATGGGAAAACGATACGACTACGACGATCCAGTTTTGAACAATATTACAGAACATATAAGGTAACTGAACCACTTTTTATA CGCGATGGACATGCTTTACCCAATTGATGAAAGGATAAACACATACATTTCCAACGTATGCTTGAATATAATATAGTACT GTGGGGTACCGTACCTCCTAAATCCCATATTTCATGATCGTGTTTTACCTATTAACAACGTTATTAAAGTCGTCAAGACA CGGTTATGTAATTTTGTAACACATTGTGTTTACTACCAAATAATACATTGTGTTTACTACCAAATAATACATTGTGGTTG CTACCAAATGAGACGAGAAAAGAGAATGAAAACTTGTCCCGTCTTACCCAACTGTACATACTAACTTTTTCATGTATGTC ATAATACGCAGACCGAGTAAAACAGTCGTCATGTACTCACCGATTCTTCGGTTTATCCCGCCTTTCCGTTGGACATACAA GAAGATAGTAAACAGCATTGAACAGGTTACAGGTATAACTGATATAATACATGTTAATGCTGTCTATAATTTGGTTTAAT CCTGTACTGTATGCTCACGTGTTAAAAATCGTTCGAAAAATATATATCCAAATATATTAATAATAGTCTACATATGAATA TANTACCATAAGGACCACTAGTGCAGTAATACCCTGTAGTGCTGGACTG LQW173019.y2 LQW173019.y2.phd.1 LQW173019.x1 11:47:54 2001 TEMPLATE: LQW173019 DIRECTION: rev Length = 992 Score = 122 bits (304), Expect = 3e-28 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = -3 Query: 1 NMPYMRSFIQEIHRHRSIATLNLPHRTVRSVRLCGYDIPKDTPVSTLANQHTSDMW 56 NMPYMRSFIQEIHRHRSIATLNLPHRTVRSVRLCGYDIPKDTPVSTLANQHTSDMW Sbjct: 273 NMPYMRSFIQEIHRHRSIATLNLPHRTVRSVRLCGYDIPKDTPVSTLANQHTSDMW 106 >LQW173019.y2 >lcl|LQW173019.y2 CHROMAT_FILE: LQW173019.y2 PHD_FILE: LQW173019.y2.phd.1 CHEM: term DYE: ET TIME: Wed Aug 22 11:47:54 2001 TEMPLATE: LQW173019 DIRECTION: rev ACTAAGCCTGTCCATACGAGTACACTTATATACTTCATGGGCGATTTTTTTGGTTATTTTTGTTCAACGTCTGGCTGCGA ATTTAGAAAAACACACAAGGTAAACCCACATGTCTGATGTGTGCTGATTGGCCAATGTACTTACTGGAGTATCTTTAGGA ATGTCATAACCGCACAGTCGCACGCTTCGAACAGTTCGATGAGGCAGATTCAGCGTTGCAATGGATCGGTGCCGGTGTAT TTCTTGTATAAACGAGCGCATGTACGGCATGTTTTCTTGGTGTTTGCAACTGGGGGTTTCGTTGCCTGATTTAAATAAAA ACGCATAGTAGGCTTGGGGAAGACGGTTGCGCCTTTAGCACATAATATCCTAATTGTGTTTTTAAACAATTAACAACGGT CTATGGGGGTCGTGAGGATACGGTTTTTATAATTCTTTGAATGTTCTTTGTTTAAAACCCAATGAGAGGAGAAAATGGAA TGAAAAGGTGTCCCGCCTTCCCCTACTACATACTTGTTTACGTGATTAAATTATGAATAAAGTAAGCCTACGCCTACAGC AGTCTGGTCAGTAGCGATTGGCCGTTATAGAACAGCGTCCAGGACCAAACACTTAATAACGTAACGGCATTTACCATAAA ATATTCGCTTGATGTTCTATTTCGCTACATAGCATTATTACCTCTTTTTGCTTAACCTATCATGGCAACTTTTTTTATAC AGTAAGGGTGGGGGAAGATGGACACTTTTATTCTATTTTCTGGTCCCATTGTAGTAACAAAAGCTCATGAGTATAACCGT ATTAGCCTATAGAATAATAAAAGCATGGTATTGTTAAAAGGATGGCATAGGATGAGTGTAGAGCGTTTCAGGCTAAAAAA AGGGGGTATGACATTGGAGGTACGCAATAGAACTTCTGGAAACAACGATACGGTGTAAGGTGAAAAAAAAGTCAGTTTGA GTGAAACTCTTCTGGTTTTTTGATTGTTNNGN >LQW173019.x1 >lcl|LQW173019.x1 CHROMAT_FILE: LQW173019.x1 PHD_FILE: LQW173019.x1.phd.1 CHEM: term DYE: ET TIME: Wed Aug 22 11:24:41 2001 TEMPLATE: LQW173019 DIRECTION: fwd GGCACACGTTGCCATACTTAAGGTGGTAGCCACTACAAGGAGTGCCCCGTGTATAGTGCTGAACACGAACGTATATCAGC TAGTTCTCTATCATAACCACCACTGTGGTCGCGGCAAACATCAGAATGCACAACAAATGGTTCCCATCATTCAACCCACA CGTCTCATATCCTATGGTCATATAAATATACCAAACTGGACATCCTACAGCATATCAATTTCACCATACCAACAATCATC ACCATATTAAACCCCTCAATATAGATTCATCAATATGAATGCTAAACAAATGCCACAGTACCTAGCACAATCATACACAC ACCACACTCGATCCATCCTCAACACAAGCAACATACCAATCCTAATGACCTCAGACACACCAACCACCAACGTCACAACA ATACATAATATAGATCACAACACAATAAGTCATTACCGCCTGCACAATACACCTCACCAACTTGTTGTAGCCACAATACT ACATAGCAGATCACACTACGCTACCNATACCAACTACACAAACATAGCGCAATTCCACGCTACAGGTCCCAACTTATAGG CGACCACCACACACAATTCCACTTATTACAACACCATCAGCAACAAACACAAATACAAATACACTATCGATGATACATAG AGCACTATAGCGACAAATACACCAACCATACATATGATCATCCAACTACAACCATGACACAGACAATATAGATAGCCACA CACAATATAGGCACATATACTACACCACTCACACACCAAATGACTAGACAGTCTGCCACCACCTAAGTGGCGATTACCAC ATCACACAACACACACCAATACCTAACTCAACTCATACATACTACCCATACATANCACGCACTTACAGATCTGAGACGCT CACTGCGTACCACCAAATCATACTCATAACCCATCACAACTTAACAATCGATAAACACACAATTGACCAGATCGACGTAA AGATATTACAACACCAGTAATTAAAACACACTACTACAACCGATCTATACACACAACATTACACCACCAACATTTACAAC ATATTATTATCCTACATATGAGAACACACTACCCGAGCCATAGTCAGCTTCATAATCATCATCAACCAGCCAATTAACAA TTACTGTCATCTGACACCAGACACATACGGCACTATCACTCACGCTACTCTGACACACACACATCAAACTACATGGACTT ACAACACAAAAGTGCACAACACATAACCAGCGAGACATCATTACACATTAGAGTTACACACACAATACTAATAGTTATGT GTTACACAAATCTAAGACCAACACTACATGAAATATGATCTATACAAACACCAATATACCTACCAACCACTAGACCTATT ACACAATATCAACACAGACTAAATGCGCTAGACAATAATATACAGCAACTAAACCACACAAACAAACAACAACAAACTAC ACACAACAACAAGTACATAAAGACATAATAACCACTAACCTCCACACACACACATGTAATGCACACCCAGTACAAGACAA CCAAACACACAACCATACACATTAGACGACACAACACACACATACTAAATATCACACCACAGAACAAATATTAACAACAC ACACAACACAACACAATAGAATAACACACATACACACTCTCAAGACCAACTATCATTAACTCAACATAGGAATTACATTG GTCTACCACTCAGCACATTCACAAGACAACTACGAACACCATCACCGCTATACACAACCAATCACAGCATACAGGACACT ACCGTACTTCACCATCCACACGCACTACATCATTCCTTCATCCATGAGAATCATACTACACGACTAGCCCACTTCATACA AAGTCTAACTGCAACAATACACAACCAGCCAACAACTCACTATAACAACACATCAACATATATCCAACCAACAATCAAAC ACCAGTACTCATACACACTCACCACAAACACTATACCCTCTATAGACAGCAACACCATAACTACACATATCAAGACAATC AAAATCCCCATACACCCACAACACAAGACCAACCAAGCTAATTCAACACATCCGCACGCACCACACCACCAAATACATAA ATAACCACAATAAAATAATACTAATAAACAACAATCAACCATACATATCATCAACAACCACAAGCACCCACAC LQW18289.x1 LQW18289.x1.phd.1 LQW18289.y1 15:50:36 2001 TEMPLATE: LQW18289 DIRECTION: fwd Length = 292 Score = 121 bits (300), Expect = 9e-28 Identities = 55/56 (98%), Positives = 56/56 (99%) Frame = +3 Query: 1 NMPYMRSFIQEIHRHRSIATLNLPHRTVRSVRLCGYDIPKDTPVSTLANQHTSDMW 56 NMPYMRSFIQEIHRHRSIATLNLPHRTVRSVRLCGYDIPKDTPVSTLANQHTSD+W Sbjct: 36 NMPYMRSFIQEIHRHRSIATLNLPHRTVRSVRLCGYDIPKDTPVSTLANQHTSDIW 203 >LQW18289.x1 >lcl|LQW18289.x1 CHROMAT_FILE: LQW18289.x1 PHD_FILE: LQW18289.x1.phd.1 CHEM: term DYE: ET TIME: Wed Mar 21 15:50:36 2001 TEMPLATE: LQW18289 DIRECTION: fwd GCAGTGCCGAAACTCCCAGTTGCAAGCACCAAGAAAACATGCCGTACATGCGCTCGTTTATACAAGAAATACACCGACAC CGATCCATTGCAACGCTGAATCTGCCTCATCGAACTGTTCGAAGCGTGCGACTGTGCGGTTATGACATTCCTAAAGATAC TCCAGTAAGTACATTGGCCAATCAGCACACATCAGACATATGGGTTTACCTTATGTGTTTTTCTAAATTCGCAGCCAGAC GTTGAACAATAATAATCAAAAAAATCGCCCATGAAGTTATATAAGTGGTAAC >LQW18289.y1 >lcl|LQW18289.y1 CHROMAT_FILE: LQW18289.y1 PHD_FILE: LQW18289.y1.phd.1 CHEM: term DYE: ET TIME: Wed Mar 21 15:50:54 2001 TEMPLATE: LQW18289 DIRECTION: rev GGCCACACACATAAATTGAAGCATACGAACATGAGAGTCACTTTTATATCAACCCAGGCAGCATAACAGGTGCCTTTTCA CCAACTGCAAGGTAAGACATTAGCCTATTGATTTTTATTGAGCATATTGATACTAGCACTTTTATTGACAAAGTCCTGTT TACTTTATTGCAAGTTAAAATACTAGCATACTTATGAATGAATGTAACTTACTTTATCCTTGCTTGGTAGGAGCACGACA GTTGTTATAACACAGGTGTTTATACACCTCGTACCACCTTATGAGTTACCATGTATGTTACTTTGTGTTTTTTGGGGGGG ATTTCGTTTATGTTTAACTGATAATTTGTACACCACTTTAGTAACCACTGGGTTGGAGCAATTGTCGTATGTGTCTTACC CAGGACACATACGCCCACAATGGTAGCAGCGACGAGGCCTGAACCCAATAAACTTAACGGCAATTGCTTCAACCCAGTGG TCACAAATGGGTTTTTCAAATTATCAGCCATACATAAAAAAATAAAAAAAAATATTCTCCCATGAAGTAACATACATGGT AACTCGTAAGCTTGCATGAGATGTATGAAACAGAACACCCGTGTTACAACGACTGTTGTTTTCCGGCCACGCAAAGATAA AGTAATTATATTCATTATACATTCATATTTTCAGTG >sequence 13, 55, 80 46% to 2C8 The C-terminal parts match for 13 and 55 but not the I-helix region. This is a different gene ITAGQRFEYDDQFFIQIRRHLWFMDPDRTAAFSAMVFVPLLCHIPPYRKKYEQIKQDTKE MMGLFQQLVDQHRKTFDKNNLRDFIDAFILENENGTDESFT DSLICKDRQLVHYVRELFKAGTETSTGTLRWAMLCLIHYPGAQEK IRKEIFDVLGNSTFPSMSDRNAMPYTSAFIQEVFRFRTLAPLGVPHKTTDTVNFANYIIPKG TTILSNLWAVHNDPTVWNNPRQFKPERHIDDKGKYVQSNHVIPFSVGPRHCLGEQLARMEIFIFLV SMVQKFEFLPDPNKTDLPELDDGVNGVAFVPYPFKLVAKEI* DEV1691.y1 LGJ489.y1 LQW217248.x2 LQW193647.x1 >cibd060b13 Length = 512 Score = 131 bits (325), Expect = 4e-30 Identities = 64/69 (92%), Positives = 65/69 (93%), Gaps = 3/69 (4%) Frame = +3 Query: 7 DRQLVHYVRELFKAGTETSTGTLRWAMLCLIHYPGAQEKIRKEIFDVLGK---PSMSDRN 63 DRQLVHYVRELFKAGTETSTGTLRWAMLCLIHYPGAQEK+RKEIFDVLG PSMSDRN Sbjct: 306 DRQLVHYVRELFKAGTETSTGTLRWAMLCLIHYPGAQEKMRKEIFDVLGNSTFPSMSDRN 485 Query: 64 AMPYTSAFI 72 AMPYTSAFI Sbjct: 486 AMPYTSAFI 512 >cibd060b13 ACATTACGGCTGGACAACGGTTTGAATACGACGATCAGTTCTTTATACAAATTCGACGACATTTATGGTTTATGGATCCG GACCGAACCGCTGCGTTTTCTGCTATGGTGTTTGTCCCGTTACTGTGTCACATTCCACCTTACCGTAAAAAGTACGAGCA GATAAAGCAAGATACGAAAGAAATGATGGGCCTGTTTCAGCAACTGGTCGACCAGCATAGGAAAACCTTCGACAAAAATA ATCTACGGGATTTCATCGACGCTTTTATTCTGGAGAATGAAAATGGGACTGACGAAAGTTTTACGGACCGACAGCTTGTA CATTACGTACGTGAACTCTTCAAAGCTGGTACTGAAACTTCTACGGGTACTCTTAGATGGGCGATGTTGTGTCTCATTCA CTATCCTGGAGCACAGGAGAAAATGAGAAAGGAAATATTTGACGTCTTAGGCAATAGCACTTTTCCCAGCATGAGTGATC GTAACGCGATGCCATACACTTCCGCGTTCATA >cibd060b13_3 ITAGQRFEYDDQFFIQIRRHLWFMDPDRTAAFSAMVFVPLLCHIPPYRKKYEQIKQDTKE MMGLFQQLVDQHRKTFDKNNLRDFIDAFILENENGTDESFT DRQLVHYVRELFKAGTETS TGTLRWAMLCLIHYPGAQEKMRKEIFDVLGNSTFPSMSDRNAMPYTSAFI QEVFRFRTLAPLGVPHKTTDTVNFANYIIPKGTTILSN LWAVHNDPTVWNNPRQFKPERHIDDKGKYVQSNHVIPFSVGPRHCLGEQLARMEIFIFLV SMVQKFEFLPDPNKTDLPELDDGVNGVAFVPYPFKLVAKEI* >rcibd060a13 Length = 765 Score = 112 bits (277), Expect = 7e-25 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = -2 Query: 9 LGNSTFPSMSDRNAMPYTSAFIQEVFRFRTLAPLGVPHKTTDTVNFANYIIPKG 62 L NSTFPSMSDRNAMPYTSAFIQEVFRFRTLAPLGVPHKTTDTVNFANYIIPKG Sbjct: 764 LXNSTFPSMSDRNAMPYTSAFIQEVFRFRTLAPLGVPHKTTDTVNFANYIIPKG 603 >rcibd060a13 TGTGTTGTATTTAAAACTGCGACTTGTATATATTTATTAGACTCACAGCAAAACACGGCAATAGAAAAAGACAGTAACAC TTATATAGAATAGAACGTATTGCATTTGGAAATATGCGACTTAAAGGGGTATACCAACGAAAATCCAAAATTTGTAAATG TGTAGAGATGCTCAAATGTGGTAAAAACTACCACCTAAGTTTCAAAAAACAAAATACTTCAAAAAAATAAAAATTTTGAT TTTTCGTTGTTATGCCATTTGAAGAACAAGAAATTTCGCTAAATTTCTTTAGCGACCAATTTAAACGGATAAGGCACAAA CGCTACACCATTAACCCCATCATCCAATTCTGGAAGATCTGTTTTGTTCGGATCGGGAAGAAACTCAAACTTCTGAACCA TTGAAACCAGAAAGATGAAAATTTCCATTCTAGCTAGTTGTTCTCCCAAGCAATGACGTGGACCCACTGAGAAAGGTATT ACGTGATTCGATTGAACATATTTTCCTTTATCGTCAATGTGGCGCTCAGGTTTAAATTGACGTGGGTTGTTCCATACAGT AGGATCGTTGTGCACTGCCCATAAGTTTGATAAAATCGTGGTTCCTTTTGGAATAATATAGTTAGCAAAGTTGACAGTGT CTGTTGTCTTGTGTGGAACCCCTAACGGAGCTAACGTTCGAAACCGAAACACTTCTTGTATGAACGCGGAAGTGTATGGC ATCGCGTTACGATCACTCATGCTGGGAAAAGTGCTATTGNCTAAG NSTFPSMSDRNAMPYTSAFIQEVFRFRTLAPLGVPHKTTDTVNFANYIIPKGTTILSN LWAVHNDPTVWNNPRQFKPERHIDDKGKYVQSNHVIPFSVGPRHCLGEQLARMEIFIFLV SMVQKFEFLPDPNKTDLPELDDGVNGVAFVPYPFKLVAKEI* >sequence 14, 37, 69 25 accessions 50% to 2C8 MLPSGYIFVFVFLCIYYLLQWRRRPKNFPPGPLGIPLFGIA PFAGVDMHKYLATYYAKYGGVMSFRLATKDWIVLNDIEAITQ (0) ALLKQGESFSGRPQSYLMNQLTEGCGIVFSTGPRWQAQRRFVLTALKT (2) (C-helix) LGMGKRSTMVGIINEENQNFLSVIQSSGGKVNIL (0) SEFRKLLSNIVSNLIMGKRFNYEDEKLQAIVDHR (2) PTSSVVMFIPFLRFIPPFKQGYQRLIASTQRVL (1) DIISEITEEHKNSFDENNLRDFIDIFLLEMKRRNSEYFT (0) ELQLLHLVRDLFVGAIDTTTATLGWGIICLLHYPECQVRIQEEIDDVI (1) GCAEPDMSHHESMPYLRAFIQEVHRFQTIAPLNIPHCVTEDCVLFGYHIPKS TPVMSNIWRVHNDPKYWENPEKFSPERHLDSEGRFVPSNRVLSFAVGHRSCLG VQLARVELFLFYASTLKKYEFQIDPEYGLPDWSNDRSGTVKTPKKFSVLLKSR* LQW4880.y1 exon 1 opposite = LQW4880.x1 (exon 6) DEV1604.y1 exon 1 opposite = DEV1604.x1 ? LQW232493.y1 exon 1 opposite = LQW232493.x1 (exon 7) LGJ1425.x1 exon 1 opposite = LGJ1425.y1 (exon 7) LQW269127.y1 exon 2 opposite = LQW269127.x1 (exon 7) LQW48810.x1 exon 2 opposite = LQW48810.y1 (exon 2) LQW48810.y1 exon 2 opposite = LQW48810.x1 (exon 2) DEV27943.y1 exon 2 opposite = DEV27943.x1 (exons 8,9 fused) LQW265377.x1 exons 2 and 3 opposite = LQW265377.y1 (exons 8,9) exons 4 and 5 are missing LQW37658.y1 exon 6 opposite LQW37658.x1 ? LQW98270.x1 exon 6 opposite = LQW98270.y1 ? LQW160072.x1 exon 6 LQW160072.y1 (C-terminal and 3 prime UTR) LQW160072.x2 exon 6 LQW160072.y1 (C-terminal and 3 prime UTR) DEV47237.x1 exon 6 no opposite LQW4880.x1 exon 6 opposite = LQW4880.y1 (exon 1) DEV55412.x1 exon 7 opposite = DEV55412.y1 ? LQW232493.x1 exon 7 opposite = LQW232493.y1 (exon 2) LQW103809.x01 exon 7 opposite = LQW103809.y1 ? LQW103809.x1 exon 7 opposite = LQW103809.y1 ? LQW269127.x1 exon 7 opposite = LQW269127.y1 (exon 2) LGJ1425.y1 exon 7 seq 14 opposite = LGJ1425.x1 (exon 1) LQW231417.x1 exons 8,9 fused opposite = LQW231417.y1 LQW265377.y2 exons 8,9 fused opposite = LQW265377.x1 (exons 2, 3) DEV27943.x1 exons 8,9 fused opposite = DEV27943.y1 (exon 2) LQW160072.y2 exons 8,9 fused opposite = LQW160072.x1 (exon 6) GCiWno663_c10.b1 ex 3, 4 Probable savignyi ortholog to exon 4 DEIRRLQANNTCNFLSGKHFDYKDKRLQAIIDHR (2) Two candidates for exon 4 in intestinalis XEIRRLEANIISKVLIGKRFDYTDERLNSIIDCR GCiWno350_k07.b1 related seq SEFRKLLSNIVSNLIMGKRFNYEDEKLQAIVDHR GCiWno663_c10.b1 this is it >GCiWno663_c10.b1 TTCTCGTCTATTTTTTTCTTTCATTCTATTATTCATTTTGGTAGTAAACAAAGAACATTCAAGGAACTATGAAACCTTGT CCTCGCGACTTTCATAGACCGTTGTTACTTGTTTAAAACACGACCAGGATATTTATATATTTTATGCTAAAGATGTCCCA TCTTCCCCCACCCCACTATATATATTTACCATTTTTTAGTCTAGGAATGGGAAAAAGAACCATGGTCGGAATTATAAACG AAGAAAACCAGAATTTTTTATCCGTAATACAATCTTCTGGAGGAAAGGTTAACATTTTGGTAAGCCATATTTTTTTATTG GTACACGTCCTTTTATTTTTAACGTTATATGCATTTCTTACTACAGTCTGAATTTCGGAAACTCCTGTCGAATATTGTTA GTAATCTGATAATGGGAAAGCGTTTTAACTACGAAGACGAGAAGTTGCAAGCTATTGTGGATCATAGGTAATAAATGATA TAACTTAACCATGCAAGGTATAAAACTGCAAAGTGCCATTATATATAGCTGGGGGTGGGGGAAGATGGGACCCCNNNNGC NCANNNNATCCANNNNTCCCTGACCGCCGCCCGAACCAANCCCACAACCGCCCCATGGGAGCCCGCGACAACACCGGCGC ACCACCCACTCGACCCNCGCGCCCCACCACGAGACCACACCACACGCAAAGGGGCCCCACCCTTCCCTTCCCTCCTTTCT ATCACTCTCCCTCTTTTCCCCACTTGGTCTACTCATTTTTATCTCTTCTTTCTCTCCCCTCATTTCTTACCCCCCCTGTC CTGCCCGTCCACACGCCCCCCCCGTTTGCCTAATTTTTGTCTCGCTCTTCTTCCACTCTCTTACCGCGCTTCCCACTCAA TCCCN >_1 FSSIFFFHSIIHFGSKQRTFKEL*NLVLATFIDRCYLFKTRPGYLYILC*RCPIFPHPTI YIYHFLV*EWEKEPWSEL*TKKTRIFYP*YNLLEERLTFW*AIFFYWYTSFYF*RYMHFL LQSEFRKLLSNIVSNLIMGKRFNYEDEKLQAIVDHR**MI*LNHARYKTAKCHYI*LGVG exon 4 EDGTPXAXXIXXSLTAARTXPTTAPWEPATTPAHHPLDPRAPPRDHTTRKGAPPFPSLLS ITLPLFPTWSTHFYLFFLSPHFLPPLSCPSTRPPRLPNFCLALLPLSYRASHSIP >_2 SRLFFSFILLFILVVNKEHSRNYETLSSRLS*TVVTCLKHDQDIYIFYAKDVPSSPTPLY IFTIF*SRNGKKNHGRNYKRRKPEFFIRNTIFWRKG*HFGKPYFFIGTRPFIFNVICISY YSLNFGNSCRILLVI**WESVLTTKTRSCKLLWIIGNK*YNLTMQGIKLQSAIIYSWGWG KMGPXXXXXSXXP*PPPEPXPQPPHGSPRQHRRTTHSTXAPHHETTPHAKGPHPSLPSFL SLSLFSPLGLLIFISSFSPLISYPPCPARPHAPPVCLIFVSLFFHSLTALPTQS >_3 LVYFFLSFYYSFW**TKNIQGTMKPCPRDFHRPLLLV*NTTRIFIYFMLKMSHLPPPHYI YLPFFSLGMGKRTMVGIINEENQNFLSVIQSSGGKVNILVSHIFLLVHVLLFLTLYAFLT exon 3 TV*ISETPVEYC**SDNGKAF*LRRREVASYCGS*VINDIT*PCKV*NCKVPLYIAGGGG RWDPXXXXXPXXPDRRPNQXHNRPMGARDNTGAPPTRPXRPTTRPHHTQRGPTLPFPPFY HSPSFPHLVYSFLSLLSLPSFLTPPVLPVHTPPPFA*FLSRSSSTLLPRFPLNP Try to use savignyi to close gap and find exon 4 >scf/ciona01/G126/seq_dir/hrs/G126P69589F.T0/G126P69589FF10.T0.seq 724 0 724 ABI Length = 724 Minus Strand HSPs: Score = 175 (61.6 bits), Expect = 3.7e-13, P = 3.7e-13 Identities = 34/34 (100%), Positives = 34/34 (100%), Frame = -1 Query: 34 RPTGTIVVFLPFLRFIPPFKQKFQKMVDSTEQVI 67 RPTGTIVVFLPFLRFIPPFKQKFQKMVDSTEQVI Sbjct: 427 RPTGTIVVFLPFLRFIPPFKQKFQKMVDSTEQVI 326 >scf/ciona01/G126/seq_dir/hrs/G126P69589F.T0/G126P69589FF10.T0.seq 724 0 724 ABI TTGAATATCGCCCTGTGGTGGAATTTTCAATTACATTTTGTAAAGAACCG TATTTTATCATATGTTAGTAAAAAATCACCGCGGACAGTGCTGGTCTGTG GACCTGCGTTTGAGAATCACCAGTTTAGAAAGCCAAGGCTCGCTTTTCTA GCTTAAGAGCAAATCTCATCCCAACAAATCCCTTTCATTGTACATTTGTA CAACTACCACGAAATTCATATTATTAGATCGGGCATATTTACAGACAATA GCATAAAGAGGGTATAAAGCTTGGCAGGAGAAATAGATGACTTGCCACGG TTTTAATAACAATTTTAACAATACCTATGACTTGCTCTGTGCTGTCCACC ATTTTTTGAAATTTTTGTTTGAAGGGTGGTATGAATCGAAGAAACGGCAA GAAAACAACAATGGTACCGGTAGGCCTGGGAACACATTGGCGAATTTGTA TAAAGTAGTAATATTCCTGTAACGTTAAATGTCATGTCTGTCATTTAAAG GTAATTATTAGGAATATTAAATAAGACTTGTATGGCGAATTTGTATAAAG TAGTAATATTCCTGTAACGTTAAATGTCATGTCTGTCATTTAAAGGTAAT TATTAGAAATATTAAATAAGACTTGTATATTGTATCGCCTTTAGCAATAT ATANAACGGAATGTTAGTGTATGCTTCCATACCTGTGGTCTATAATCGCT TGTAAATCTCTTATCTTGTAGTCA >_1 LENYDLLVLWWEFFTIFTRFCVTFCLT*CYMYLVC*NKKLNVEYFYSLGMGKRTMDAIIN EETNRFIASVQLAGGTVNILV*KVSLGYYDKIFMLYPQNGNVFLITYD**HR*KNHNLH* K*DTNLHPREREISRGVNTFHTLRVLIDFTIE*VKRLCNAQQNTYRTRFDGFRPIIHAIF YRGSTLTTKIRDYKRL*TTGMKAYTNIPVYTSLKAIQYTSLI*YS**X >_2 LKTMISSSCGGNSLPSLPDSVLRFASLNVICTLCVKIKN*MSNIFTVWEWESVPWMQLLT KKQIALSLQSN*PAELSTYWFEKFHWDIMIRYLCFIPKMEMSF**PMISNTVKRIITCIK NKILIFIRVNGKSQGASTHSTH*GF**ILR*NKLNACVMHSKILTGRDSTASGQ*YMQFS IGEAL*LQR*EITSDYRPQV*KHTLTFRFIHR*RRYNIQVLFNIPNN >_3 *KL*SPRPVVGILYHLYPILCYVLPHLMLYVPCVLK*KTKCRIFLQFGNGKAYHGCNY*R RNKSLYRFSPISRRNCQHTGLKSFIGIL**DIYALSPKWKCLFDNL*LVTPLKES*LALK IRY*SSSA*TGNLKGRQHIPHIKGFDRFYDRIS*TLV*CTAKYLQDEIRRLQANNTCNFL SGKHFDYKDKRLQAIIDHRYESIH*HSGLYIAKGDTIYKSYLIFLII Do these overlap? >_4 DYKIRDLQAIIDHRYGSIH*HSVXYIAKGDTIYKSYLIFLIITFK*QT*HLTLQEYYYFI QIRHTSLI*YS**LPLNDRHDI*RYRNITTLYKFANVFPGLPVPLLFSCRFFDSYHPSNK NFKKWWTAQSKS*VLLKLLLKPWQVIYFSCQALYPLYAIVCKYARSNNMNFVVVVQMYNE RDLLG*DLLLS*KSEPWLSKLVILKRRSTDQHCPR*FFTNI**NTVLYKM*LKIPPQGDI Q >_5 *LQDKRFTSDYRPQVWKHTLTFRXIYC*RRYNIQVLFNISNNYL*MTDMTFNVTGILLLY TNSPYKSYLIFLIITFK*QT*HLTLQEYYYFIQIRQCVPRPTGTIVVFLPFLRFIPPFKQ KFQKMVDSTEQVIGIVKIVIKTVASHLFLLPSFIPSLCYCL*ICPI**YEFRGSCTNVQ* KGFVGMRFALKLEKRALAF*TGDSQTQVHRPALSAVIFY*HMIKYGSLQNVIENSTTGRY SX >_6 TTR*EIYKRL*TTGMEAYTNIPXYILLKAIQYTSLI*YF**LPLNDRHDI*RYRNITTLY repeat KFAIQVLFNIPNNYL*MTDMTFNVTGILLLYTNSPMCSQAYRYHCCFLAVSSIHTTLQTK ISKNGGQHRASHRYC*NCY*NRGKSSISPAKLYTLFMLLSVNMPDLII*ISW*LYKCTMK GICWDEICS*ARKASLGFLNW*FSNAGPQTSTVRGDFLLTYDKIRFFTKCN*KFHHRAIF X >scf/ciona01/G126/seq_dir/hrs/G126P68275F.T0/G126P68275FC12.T0.seq 684 0 684 ABI Length = 684 Plus Strand HSPs: Score = 101 (35.6 bits), Expect = 7.3e-05, P = 7.3e-05 Identities = 20/33 (60%), Positives = 25/33 (75%), Frame = +1 Query: 1 LGMGKRSMVGIINEENQNFLSVIQSSGGKVNIL 33 LGMGKR+M IINEE F++ +Q +GG VNIL Sbjct: 142 LGMGKRTMDAIINEETNRFIASVQLAGGTVNIL 240 >scf/ciona01/G126/seq_dir/hrs/G126P68275F.T0/G126P68275FC12.T0.seq 684 0 684 ABI CTTGAAAACTATGATCTCCTCGTCCTGTGGTGGGAATTCTTTACCATCTT TACCCGATTCTGTGTTACGTTTTGCCTCACTTAATGTTATATGTACCTTG TGTGTTAAAATAAAAAACTAAATGTCGAATATTTTTACAGTTTGGGAATG GGAAAGCGTACCATGGATGCAATTATTAACGAAGAAACAAATCGCTTTAT CGCTTCAGTCCAATTAGCCGGCGGAACTGTCAACATACTGGTTTGAAAAG TTTCATTGGGATATTATGATAAGATATTTATGCTTTATCCCCAAAATGGA AATGTCTTTTTGATAACCTATGATTAGTAACACCGTTAAAAGAATCATAA CTTGCATTAAAAATAAGATACTAATCTTCATCCGCGTGAACGGGAAATCT CAAGGGGCGTCAACACATTCCACACATTAAGGGTTTTGATAGATTTTACG ATAGAATAAGTTAAACGCTTGTGTAATGCACAGCAAAATACTTACAGGAC GAGATTCGACGGCTTCAGGCCAATAATACATGCAATTTTCTATCGGGGAA GCACTTTGACTACAAAGATAAGAGATTACAAGCGATTATAGACCACAGGT ATGAAAGCATACACTAACATTCCGGTTTATACATCGCTAAAGGCGATACA ATATACAAGTCTTATTTAATATTCCTAATAATTN >_1 LENYDLLVLWWEFFTIFTRFCVTFCLT*CYMYLVC*NKKLNVEYFYSLGMGKRTMDAIIN EETNRFIASVQLAGGTVNILV*KVSLGYYDKIFMLYPQNGNVFLITYD**HR*KNHNLH* K*DTNLHPREREISRGVNTFHTLRVLIDFTIE*VKRLCNAQQNTYRTRFDGFRPIIHAIF YRGSTLTTKIRDYKRL*TTGMKAYTNIPVYTSLKAIQYTSLI*YS**X >_2 LKTMISSSCGGNSLPSLPDSVLRFASLNVICTLCVKIKN*MSNIFTVWEWESVPWMQLLT KKQIALSLQSN*PAELSTYWFEKFHWDIMIRYLCFIPKMEMSF**PMISNTVKRIITCIK NKILIFIRVNGKSQGASTHSTH*GF**ILR*NKLNACVMHSKILTGRDSTASGQ*YMQFS IGEAL*LQR*EITSDYRPQV*KHTLTFRFIHR*RRYNIQVLFNIPNN >_3 *KL*SPRPVVGILYHLYPILCYVLPHLMLYVPCVLK*KTKCRIFLQFGNGKAYHGCNY*R RNKSLYRFSPISRRNCQHTGLKSFIGIL**DIYALSPKWKCLFDNL*LVTPLKES*LALK IRY*SSSA*TGNLKGRQHIPHIKGFDRFYDRIS*TLV*CTAKYLQDEIRRLQANNTCNFL SGKHFDYKDKRLQAIIDHRYESIH*HSGLYIAKGDTIYKSYLIFLII LQW69473.x1 CHEM: term DYE: ET TIME: Fri May 4 12:32:48 2001 TEMPLATE: LQW69473 DIRECTION: fwd Length = 478 Score = 66.0 bits (158), Expect = 5e-11 Identities = 32/33 (96%), Positives = 33/33 (99%) Frame = -1 Query: 1 LGMGKRTMVGIINEENQNFLSVIQSSGGKVNIL 33 LGMGKR+MVGIINEENQNFLSVIQSSGGKVNIL Sbjct: 379 LGMGKRSMVGIINEENQNFLSVIQSSGGKVNIL 281 >_4 MPTCRL*EIDT*ILCANDVPSSPTPLYIYHFLA*EWEKEAWSEL*TKKTRIFYP*YNLLE ERLTFW*AIFFYWYTSFYF*RYMHFLLQSEFRKLLSNIVSNLIMGKRFNYEDEKLQAIVD HR**MI*LNHARYKTAKCHYI*YRVGEDGTPLAHNIQWD >_5 HAYLSTIGDRHLDIMC*RCPIFPHPTIYLPFFSLGMGKRSMVGIINEENQNFLSVIQSSG GKVNILVSHIFLLVHVLLFLTLYAFLTTV*ISETPVEYC**SDNGKAF*LRRREAASYCG S*VINDIT*PCKV*NCKVPLYIV*GGGRWDTVST*YTVGX >_6 CLLVDYRRSTLRYYVLTMSHLPPPHYIFTIF*PRNGKKKHGRNYKRRKPEFFIRNTIFWR KG*HFGKPYFFIGTRPFIFNVICISYYSLNFGNSCRILLVI**WESVLTTKTRSCKLLWI IGNK*YNLTMQGIKLQSAIIYSIGWGKMGHR*HIIYSGX >GCiWno663_c10.b1 CHROMAT_FILE: GCiWno663_c10.b1 PHD_FILE: GCiWno663_c10.b1.phd.1 CHEM: term DYE: big TIME: Fri Nov 2 11:02:35 2001 TEMPLATE: GCiWno663_c10 DIRECTION: fwd Length = 885 Score = 59.7 bits (142), Expect = 4e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 1 LGMGTRSMVGIINEENQNFSSVIQSSGGQVNIL 33 LGMG R+MVGIINEENQNF SVIQSSGG+VNIL Sbjct: 201 LGMGKRTMVGIINEENQNFLSVIQSSGGKVNIL 299 >GCiWno709_i09.b1 CHROMAT_FILE: GCiWno709_i09.b1 PHD_FILE: GCiWno709_i09.b1.phd.1 CHEM: term DYE: big TIME: Tue Nov 6 11:40:56 2001 TEMPLATE: GCiWno709_i09 DIRECTION: fwd Length = 892 Score = 71.4 bits (172), Expect = 1e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 1 RPTSSVVMFIPFLRFIPPFKQGYQRLIASTQRVL 34 RPTSSVVMFIPFLRFIPPFKQGYQRLIASTQRVL Sbjct: 264 RPTSSVVMFIPFLRFIPPFKQGYQRLIASTQRVL 163 >GCiWno709_i09.b1 TCTCCACAGAAATATATCGATAAAATCTCTAAGGTTGTTTTCGTCGAAAGAATTTTTGTGCTCTTCAGTTATTTCAGAGA TAATATCTGTACGGCGTATGGCACAAAGTTAATATGTTATAAATATAAGGGAATAAACTACACTAGTATTAAGCCATGTA CCTAAAACCCGTTGCGTGCTGGCGATTAATCTCTGATAGCCTTGTTTGAATGGTGGTATAAATCGAAGAAACGGAATAAA CATAACGACGCTGCTTGTCGGCCTGCATTACAGTTTATTGTAAAATTAACGCATTATAAACAAAATTAAGCACTTGTATA CACTTTGTGTAGATAAATGGGTATGATATATAGTGGGGGTAGGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCNNCCCCCCCCCCCCCCCCC CCCCCCCCCCCC >GCiWno709_i09.g1 CAAGCTTAAAACAGTGGTTATCTATATATAATATACCTTTGGTGGGAGGCGTTTCATAGATAACTGGAAATGTAAAAACT AAAACTAGCACCGATACTGTGGCAAAAACGCGTAGTATACCCAGAAACTAAGTGTAGTAGGGTGGGAGAAGATGGACCAC CTTTTCAATATATTTTCTCGTCCCATTTGGTAGGAAACAAGATCACCTATGATATAATATAAGAATAAAAACGTAGACCA TCTTACCCCGCCCAATAGACCGTCATCCAATATCTATATTTAAAGTGTGCGAGAAGCCCATGCGGTGCTGCGTGTTGTGG CTGCTGTATAGGTTTCTGTAACATTGCATTTGCTCTACACGGAAATGGCAAACTTTTAACCGACTTCCGTGTTACTCTAA CTTTGATTACTTATGTCTGTTCTATTTTGTATGCTGTTGGCTTATGTGCATATTTTTTGTCTTGATAGTCTTATGAAAGT TACCTAAACCGGGATTGCAAAACTCAAAGTCTCACAGTAACAACAATTTTACATTTTTTACCTATATTCTTTCAATGAAT CATTAAACAAAATGAAATTACACCTATACTANATACACGGCTAAGCCATATTTCCACGGAGCGAAGAAAGACACATTAAA AGCAGATTATACGAAACGCTGTGTTGTTGAATTATCTTTAAGTTACATNCATGGTATTTCTACTTATCCACCGGGTGTTT ATCTTCGTGTGCGCTGTAGCCCAAGTTTGGCATTGGCTGCTGCAATTGGCGTTTCANACATGCTATGAAGGGTATGGTTG TTAAAAAGGCCAAAGGCATTACGGGCTGCTTGCCCTTATTCGATTTTAACCCCGATTCCCATAAAAAAACCTTAAGGTAA AAATAGGTTCTATTTTTATTTGTTCCATTTGCACGCTTCGGTATACAGAGGTTT >GCiWno500_a16.g1 CHROMAT_FILE: GCiWno500_a16.g1 PHD_FILE: GCiWno500_a16.g1.phd.1 CHEM: term DYE: big TIME: Tue Oct 16 11:38:05 2001 TEMPLATE: GCiWno500_a16 DIRECTION: rev Length = 938 Score = 82.7 bits (201), Expect = 4e-16 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 34 DIISEITEEHKNSFDENNLRDFIDIFLLEMKRRNSEYFT 72 DIISEITEEHKNSFDENNLRDFIDIFLLEMKRRNSEYFT Sbjct: 337 DIISEITEEHKNSFDENNLRDFIDIFLLEMKRRNSEYFT 221 >GCiWno500_a16.g1 TTTACCAAAATCGTAACTTTAATATATAATTGCTAAGTTTTCTGTAAAATGCAGGTTAAGAATAGTCTTTATGCTGTGCC GAAATAGGAACAAAATAAACAGATTCCGGCGTCATTCTCCTCGACTACATTTTGGAAACTATAACGTACAATTTAAATGC AATTTTCCTCTAAACGTGGCAAATTTTTCGTTAATAACACGAAAGTCAAGCTTTACTTACTGTGAAATATTCGCTGTTCC GTCGTTTCATCTCCAACAGAAATATATCGATAAAATCTCTAAGGTTGTTTTCGTCGAAAGAATTTTTGTGCTCTTCAGTT ATTTCAGAGATAATATCTGTACGGCGTATGGCACAAAGTTAATATGTTATAAATATAAGGGAATAAACTACACTAGTATT AAGCCATGTACCTAAAACCCGTTGCGTGCTGGCGATTAATCTCTGATAGCCTTGTTTGAATGGTGGTATAAATCGAAGAA ACGGAATAAACATAACGACGCTGCTTGTCGGCCTGCATTACAGTTTATTGTAAAATTAACGCATTATAAACAAAATTAAG CACTTGTATACACTTTGTGTAGATAAATGGGTATGATATATAGTGGGGGTAGGGCNCCNCNCCCCCCCCCCCCCCCTCCC CTTCTCCCCTTTTCCTTCTTTTCCCTCTCTTTCCTTTTTGTTTTCCCTTGCGTTTGTCCGTGCCGTCCTACCGCGCGCCT CCCGTCCTTTCTGTTTTGCCTCTTACCTGATTGTCGCCTTCTTTTTCGTGCGGGTTCGTTCTGGTGTTTACTNGCTTCCG TCTATCCTGTTCATCACTCACTATTTTCTTTGATTATACTGTCTACCCTTTAGCTCGAGTGGCTTGTGTCACTGCGTCAC TTTCTGTGCGATTTTTCTCATTTATGTACTCTTTCTGTGTTTTGTTCTTCATTGTAAT >_4 YNEEQNTERVHK*EKSHRK*RSDTSHSS*RVDSIIKENSE**TG*TEASKHQNEPARKRR RQSGKRQNRKDGRRAVGRHGQTQGKTKRKEREKKEKGRRGGGGGGXGALPPLYIIPIYLH KVYTSA*FCL*CVNFTINCNAGRQAASLCLFRFFDLYHHSNKAIRD*SPARNGF*VHGLI LV*FIPLYL*HINFVPYAVQILSLK*LKSTKILSTKTTLEILSIYFCWR*NDGTANISQ* VKLDFRVINEKFATFRGKLHLNCTL*FPKCSRGE*RRNLFILFLFRHSIKTILNLHFTEN LAIIY*SYDFGK >_5 LQ*RTKHRKST*MRKIAQKVTQ*HKPLELKGRQYNQRK**VMNRIDGSX*TPERTRTKKK ATIR*EAKQKGREARGRTARTNARENKKEREGKEGKGEKGRGGGGXXXPTPTIYHTHLST QSVYKCLILFIMR*FYNKL*CRPTSSVVMFIPFLRFIPPFKQGYQRLIASTQRVLGTWLN TSVVYSLIFITY*LCAIRRTDIISEITEEHKNSFDENNLRDFIDIFLLEMKRRNSEYFTV SKA*LSCY*RKICHV*RKIAFKLYVIVSKM*SRRMTPESVYFVPISAQHKDYS*PAFYRK LSNYILKLRFW*X >_6 ITMKNKTQKEYINEKNRTESDAVTQATRAKG*TV*SKKIVSDEQDRRKXVNTRTNPHEKE GDNQVRGKTERTGGAR*DGTDKRKGKQKGKRGKRRKRGEGEGGGGGXXPYPHYISYPFIY TKCIQVLNFVYNALILQ*TVMQADKQRRYVYSVSSIYTTIQTRLSEINRQHATGFRYMA* Y*CSLFPYIYNILTLCHTPYRYYL*NN*RAQKFFRRKQP*RFYRYISVGDETTEQRIFHS K*SLTFVLLTKNLPRLEENCI*IVRYSFQNVVEENDAGICLFCSYFGTA*RLFLTCILQK T*QLYIKVTILVX For comp >Ci27 MLTNLIANPSISPVLAILSCVIAFYYWYKRPKNMPPGPRGIPFLGIIPFVGMN PEQAFMQWSKKYGPVITVRMGRKDWVVLCDHDTIHQ (0) VLVKQSTVCSGRPKIPIVSELSKGHGILFADYCEKWKSQRKFGMKTLRE (2) FGVGKKCTEDRVLEEVDFLCNEIRSKNGKPFDIQ (0) DIMCNAVSNIIMNIVIGRRCNYDENFFTDVISRFTKW (2) DEIRRLQANNTCNFLSGKHFDYKDKRLQAIIDHR (2) FNDPTAGAMFTGMMFLPQLKYVPPFSKYYKIFRDDIGALH (1) RPTSSVVMFIPFLRFIPPFKQGYQRLIASTQRVL (1) EFFEEVIKEHEKNFDGNNLRDFIDAFLLEMKKNESGSEFT (0) Savignyi ortholog >scf/ciona01/G126/seq_dir/hrs/G126P67716F.T0/G126P67716FC1.T0.seq 764 0 764 ABI Length = 764 Plus Strand HSPs: Score = 131 (46.1 bits), Expect = 3.6e-08, P = 3.6e-08 Identities = 21/35 (60%), Positives = 32/35 (91%), Frame = +3 Query: 2 RPTSSVVMFIPFLRFIPPFKQGYQRLIASTQRVLG 36 RPT ++V+F+PFLRFIPPFKQ +Q+++ ST++V+G Sbjct: 48 RPTGTIVVFLPFLRFIPPFKQKFQKMVDSTEQVIG 152 >sequence 15, 63 N-term does not seem to have ortholog to I-helix region in savignyi MESVWVVIKWVKETMMSNSSFETIVAVATLLLLLMFVSENWNWLKIPGPI PWPIIGNLGSLKGTKFLSIHEMYKIYGRIFRLKFGRVEAVVLCDVELIKE ALLDRGRSLSGRPQFASYRLVSGCKSVVTNDPRCLREWVNY KSTMVQTLCSISKNNEMKELMNERIGSVLVYMIQELEKGGDGQNFAEDIVTKTVANFLCT VCYGGTYDFNSK (0) EFNNLIEMSRHYTDNLSKSILRDMIPLAE (0) ILPSVNKGRADFAKTSYHLHLWFLKR (2) VEEVIQHFQPNKLNDLASVMVSDLTNDPTENISNITEKDRNSIAAIINDLVQG (?) GYHSLYSMALWVVTYMIKYPEEVKKIENELNEVLDDYLPTLHDQESLPHTMAFINE (0) VLRCRPSLPLAVPHSATEDTKLGGYDISKDTMVVASLYSANRDPKVWANPDQFDPSR FLAKDDLGVTVLDETKVEQVFTFSLGDRKCPGEDIGRSFLFLTTAYLAHTCKLKPDPAK PPTFQTKPGSITRPKDFGVQLNVKKCWLGVFKPDDNEE* LQW103446.y1 LQW103446.x1 DEV11417.x1 GCiWno937_j11.b1 GCiWno473_k21.g1 GCiWno456_a24.b1 GCiWno622_k05.b1 GCiWno59_g04.g1 LQW219332.x1 LQW219332.x1.phd.1 LQW219332.y1 13:29:49 2001 TEMPLATE: LQW219332 DIRECTION: fwd Length = 844 Score = 66.7 bits (160), Expect = 3e-11 Identities = 37/46 (80%), Positives = 38/46 (82%) Frame = +3 Query: 30 VEEVIQHFQPNKLNDLASVMVSDLTNDPTENISNITEKDRNSIAAI 75 VEEVIQHFQPNKLNDL SVMVSDLTNDPTENI I K SIAA+ Sbjct: 675 VEEVIQHFQPNKLNDLXSVMVSDLTNDPTENIL-I*LKRIESIAAL 809 Score = 64.4 bits (154), Expect = 2e-10 Identities = 32/37 (86%), Positives = 32/37 (86%) Frame = +3 Query: 1 EFNNLIEMSRHYTDNLSKSILRDMIPLAEVEEVIQHF 37 EFNNLIEMSRHYTDNLSKSILRDMIPLAEV I F Sbjct: 174 EFNNLIEMSRHYTDNLSKSILRDMIPLAEVNTCILVF 284 >LQW219332.x1 >lcl|LQW219332.x1 CHROMAT_FILE: LQW219332.x1 PHD_FILE: LQW219332.x1.phd.1 CHEM: term DYE: ET TIME: Wed Aug 22 13:29:49 2001 TEMPLATE: LQW219332 DIRECTION: fwd AAAAAACGGCAGTGCATGGGGAAACTATGATTTTAACAGCAAGGTTGTTTTATATCATTTTTTTGGTTTTTATTTTCGTA ATTTTTGTTTTTTTTGGTTCTTATATATATAATTTTGGTTCTTATATACGCCAAGGCATGCTCTTTTGTAACCATGAAAA CTTTTTGCAACAGGAATTCAACAATTTGATTGAAATGAGCCGACATTACACGGACAACTTGTCAAAATCGATATTGCGCG ACATGATCCCACTTGCAGAAGTAAACACATGTATTCTGGTATTTTAAAATTGATAGAGTGGAGTAAGATGGGTCACCTTT TCATTCTATTTTCTAGTTCGAATTGGTAATAAACGAAGAACATTCAAAGAATTATAAAACCGTTTCGTTACGACTTCCAT ATACGCTGTTGTTAATTGTTTAAAACACGATCAGGATATTTGGATATTATGTGTTAAAGGTGTCCCATGTGTTAAATGTT AAAGGTGTGTCTTCCCTCGCTCTCTACTATATAACAGACACATCGTTTCAGATTCTTCCAAGCGTAAACAAAGGAAGAGC AGATTTTGCCAAGACGAGCTACCACCTCCACCTCTGGTTCTTAAAAAGGTACAAACCGGGAAATAAAACGCCCATGCTTT GCGACCAATTTAAAATAATGTGTCCACTCATAGGGTAGAAGAGGTCATTCAACATTTCCAACCAAACAAACTAAACGACT TGGNCTCAGTGATGGTCTCTGACTTAACTAATGACCCCACAGAAAATATTCTAATATAACTGAAAAGGATCGAATCGATA GCAGCATTATCAACGACTTGGTCAAGTTACCCCGGGTTCGTGGG >LQW219332.x1_1 KKRQCMGKL*F*QQGCFISFFWFLFS*FLFFLVLIYIILVLIYAKACSFVTMKTFCNRNS TI*LK*ADITRTTCQNRYCAT*SHLQK*THVFWYFKIDRVE*DGSPFHSIF*FELVINEE HSKNYKTVSLRLPYTLLLIV*NTIRIFGYYVLKVSHVLNVKGVSSLALYYITDTSFQILP SVNKGRADFAKTSYHLHLWFLKRYKPGNKTPMLCDQFKIMCPLIG*KRSFNISNQTN*TT WXQ*WSLT*LMTPQKIF*YN*KGSNR*QHYQRLGQVTPGSWX >LQW219332.x1_2 KNGSAWGNYDFNSKVVLYHFFGFYFRNFCFFWFLYI*FWFLYTPRHALL*P*KLFATGIQ QFD*NEPTLHGQLVKIDIARHDPTCRSKHMYSGILKLIEWSKMGHLFILFSSSNW**TKN IQRIIKPFRYDFHIRCC*LFKTRSGYLDIMC*RCPMC*MLKVCLPSLSTI*QTHRFRFFQ A*TKEEQILPRRATTSTSGS*KGTNREIKRPCFATNLK*CVHS*GRRGHSTFPTKQTKRL GLSDGL*LN**PHRKYSNITEKDRIDSSIINDLVKLPRVRG >LQW219332.x1_3 KTAVHGETMILTARLFYIIFLVFIFVIFVFFGSYIYNFGSYIRQGMLFCNHENFLQQEFN NLIEMSRHYTDNLSKSILRDMIPLAEVNTCILVF*N**SGVRWVTFSFYFLVRIGNKRRT FKEL*NRFVTTSIYAVVNCLKHDQDIWILCVKGVPCVKC*RCVFPRSLLYNRHIVSDSSK RKQRKSRFCQDELPPPPLVLKKVQTGK*NAHALRPI*NNVSTHRVEEVIQHFQPNKLNDL XSVMVSDLTNDPTENILI*LKRIESIAALSTTWSSYPGFV >GCiWno735_m10.b1_1 I*SLAE*KRSFSVMLN**KKHYLIEGGLSQVVRSLHRIDWYLVARALLQTTHVV*GNG*T TSRRWYRLYAVSQKTMK*KNL*TNASDLCLFI*SRN*RKVAMVRTLQKILSLRQSQISCA LCAMGEPMISIARLFHIIFLVFIYVIFVFLVLIYIIFGSHIRQGKLFRNHENFLQQEFNN LIEMSRHYTDNLSKSILRDMIPLAEVNTCILVF*N**SGERWVTFSFYFLVRIGNKRRTF KEL*NRFHTTTIYAXCNC*NTIRIFGYMCLRCPMXKC*RCAFPPLYYIRILISDLPRVT >GCiWno735_m10.b1_2 FEVWPSKSGRSL*C*IDKRSIT**REVSLRSSAVCIV*TGIWLQERCYKRPTLFKGMGKL QVDDGTDFMQYLKKQ*NERTYERTHRICACLYDPGIRERWRWSELCRRYCH*DSRKFPVH CVLWGNL*FQ*QGCFISFFWFLYT*FLFFWFLYI*FLVLIYDKASSFVTMKTFCNRNSTI *LK*ADITRTTCQNRYCAI*SHLQK*THVFWYFKIDRVGKDGSPFHSIF*FELVINEEHS KNYKTVSIRLPYTLVVIVKTRSGYLDICV*DVPCXNVKGVPSLLSTIYGYSFRIFQG* >GCiWno735_m10.b1_3 LKFGRVKAVVLCDVELIKEALLDRGRSLSGRPQFASYRLVSGCKSVVTNDPRCLREWVNY KSTMVQTLCSISKNNEMKELMNERIGSVLVYMIQELEKGGDGQNFAEDIVTKTVANFLCT VCYGGTYDFNSKV VSYHFFGFYIRNF CFFGSYIYNFWFSYTTRQALS*P*KLFATGIQQF D*NEPTLHGQLVKIDIARYDPTCRSKHMYSGILKLIEWGKMGHLFILFSSSNW**TKNIQ RIIKPFPYDYHIRXL*LLKHDQDIWIYVFKMSHV*MLKVCLPSSLLYTDTHFGSSKGN >GCiWno735_m10.b1 ATTTGAAGTTTGGCCGAGTAAAAGCGGTCGTTCTCTGTGATGTTGAATTGATAAAAGAAGCATTACTTGATAGAGGGAGG TCTCTCTCAGGTCGTCCGCAGTTTGCATCGTATAGACTGGTATCTGGTTGCAAGAGCGTTGTTACAAACGACCCACGTTG TTTAAGGGAATGGGTAAACTACAAGTCGACGATGGTACAGACTTTATGCAGTATCTCAAAAAACAATGAAATGAAAGAAC TTATGAACGAACGCATCGGATCTGTGCTTGTTTATATGATCCAGGAATTAGAGAAAGGTGGCGATGGTCAGAACTTTGCA GAAGATATTGTCACTAAGACAGTCGCAAATTTCCTGTGCACTGTGTGCTATGGGGGAACCTATGATTTCAATAGCAAGGT TGTTTCATATCATTTTTTTGGTTTTTATATACGTAATTTTTGTTTTTTTGGTTCTTATATATATAATTTTTGGTTCTCAT ATACGACAAGGCAAGCTCTTTCGTAACCATGAAAACTTTTTGCAACAGGAATTCAACAATTTGATTGAAATGAGCCGACA TTACACGGACAACTTGTCAAAATCGATATTGCGCGATATGATCCCACTTGCAGAAGTAAACACATGTATTCTGGTATTTT AAAATTGATAGAGTGGGGAAAGATGGGTCACCTTTTCATTCTATTTTCTAGTTCGAATTGGTAATAAACGAAGAACATTC AAAGAATTATAAAACCGTTTCCATACGACTACCATATACGCTNGTTGTAATTGTTAAAACACGATCAGGATATTTGGATA TATGTGTTTAAGATGTCCCATGTNTAAATGTTAAAGGTGTGCCTTCCCTCCTCTCTACTATATACGGATACTCATTTCGG ATCTTCCAAGGGTAACA We are looking for a short 19aa exon to bridge the phase 0 and phase 2 ends on existing exons >GCiWno473_k21.b1 CHROMAT_FILE: GCiWno473_k21.b1 PHD_FILE: GCiWno473_k21.b1.phd.1 CHEM: term DYE: big TIME: Mon Oct 15 10:55:02 2001 TEMPLATE: GCiWno473_k21 DIRECTION: fwd Length = 901 Score = 37.5 bits (85), Expect(2) = 4e-04 Identities = 20/22 (90%), Positives = 20/22 (90%), Gaps = 1/22 (4%) Frame = +2 Query: 1 TKEEQILPRRATTSTSGS-KGT 21 TKEEQILPRRATT TSGS KGT Sbjct: 749 TKEEQILPRRATTFTSGSLKGT 814 Score = 25.4 bits (54), Expect(2) = 4e-04 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +3 This might be it Query: 19 KGTNREIKRPCFATNLK 35 K NREIK P ATNLK Sbjct: 807 KVQNREIKTPWLATNLK 857 >GCiWno735_m10.b1 CHROMAT_FILE: GCiWno735_m10.b1 PHD_FILE: GCiWno735_m10.b1.phd.1 CHEM: term DYE: big TIME: Wed Nov 28 13:26:45 2001 TEMPLATE: GCiWno735_m10 DIRECTION: fwd Length = 897 This seq spans the N and C-terminal parts of the gene Score = 62.8 bits (150), Expect = 7e-10 Identities = 31/40 (77%), Positives = 32/40 (79%) Frame = +1 Query: 34 LFKGMGKLPVDEFNNLIEMSRHYTDNLSKSILRDMIPLAE 73 LF+ EFNNLIEMSRHYTDNLSKSILRDMIPLAE Sbjct: 496 LFRNHENFLQQEFNNLIEMSRHYTDNLSKSILRDMIPLAE 615 Score = 51.5 bits (121), Expect(2) = 1e-12 Identities = 21/29 (72%), Positives = 25/29 (85%) Frame = +2 Query: 23 WLQERCYKRPTLFKGMGKLPVDEFNNLIE 51 WLQERCYKRPTLFKGMGKL VD+ + ++ Sbjct: 125 WLQERCYKRPTLFKGMGKLQVDDGTDFMQ 211 Score = 40.2 bits (92), Expect(2) = 1e-12 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +3 Query: 1 ALLERGRSLSGRPQLPSYRLVS 22 ALL+RGRSLSGRPQ SYRLVS Sbjct: 60 ALLDRGRSLSGRPQFASYRLVS 125 >scf/ciona01/G126/seq_dir/hrs/G126P607922F.T0/G126P607922FA4.T0.seq file 21 0 998 ABI Length = 998 Minus Strand HSPs: This seq is 68% to seq 36 Score = 71 (25.0 bits), Expect = 0.20, P = 0.18 Identities = 15/47 (31%), Positives = 25/47 (53%), Frame = -3 Query: 11 WVVTYMIKYPEEVKKIENELNEVLDDY-LPTLHDQESLPHTMAFINE 56 W + ++ YPE + I E+ + +P++ D+ LP T AFI E Sbjct: 408 WAILALLYYPEYAELIYGEIYKAFGSTGVPSMKDRGKLPLTCAFIQE 268 >scf/ciona01/G126/seq_dir/hrs/G126P602032R.T0/G126P602032RD5.T0.seq file 14 0 731 ABI Length = 731 Minus Strand HSPs: Score = 89 (31.3 bits), Expect = 0.0017, P = 0.0017 Identities = 19/47 (40%), Positives = 28/47 (59%), Frame = -1 This seq is 78% to seq 36 = probable ortholog to seq 36 Query: 11 WVVTYMIKYPEEVKKIENELNEVL-DDYLPTLHDQESLPHTMAFINE 56 W V + +PE V + NE+ EVL D +P + D++ +P T AFI E Sbjct: 386 WSVLAFLYHPEYVSLMYNEIYEVLGSDGVPCMKDRDKMPKTCAFIQE 246 A related savignyi hit this seq is 69% to seq 67 = probable ortholog to 67 >scf/ciona01/G126/seq_dir/hrs/G126P69880F.T0/G126P69880FD5.T0.seq file 11 765 ABI Length = 765 Plus Strand HSPs: Score = 113 (39.8 bits), Expect = 3.9e-06, P = 3.9e-06 Identities = 19/56 (33%), Positives = 33/56 (58%), Frame = +2 Query: 1 GYHSLYSMALWVVTYMIKYPEEVKKIENELNEVLDDYLPTLHDQESLPHTMAFINE 56 G H+ WV+ ++ YP+ +++I NE+ + + +PTL DQ LP+ AF+ E Sbjct: 311 GQHTTSGTFFWVINILLFYPKVLQRITNEVRSKIGERIPTLEDQADLPYVEAFLTE 478 >GCiWno151_b22.b1_1 FGS*TAFQ*NDCTIMRHRMFPIILPLILALISCALCAMGKPMILTARLFYIIFLVFIFVI FVFFGSYIYNFWFLYTPRHALL*P*KLFATGIQQFD*NEPTLHGQLVKIDIARHDPTCRS KHMYSGILKLIEWSKMGHLFILFSSSNW**TKNIQRIIKPFRYDFHIRCC*LFKTRSGYL DIMC*RCPMC*MLKVCLPSLSTI*QTHRFRFFQA*TKEEQILPRRATTSTSGS*KGTNRE IKRPCLRPI*NNVSTHRVEEVIQHFQPNKLNDLASVMVSDLTNDPTGNISNITEXGSNSI APFX >GCiWno151_b22.b1_2 SGHRLLSSKTTARSCVIECFQ*YYR*YWP*FPVHCVLWGNL*F*QQGCFISFFWFLFS*F LFFLVLIYIIFGSYIRQGMLFCNHENFLQQEFNNLIEMSRHYTDNLSKSILRDMIPLAEV NTCILVF*N**SGVRWVTFSFYFLVRIGNKRRTFKEL*NRFVTTSIYAVVNCLKHDQDIW ILCVKGVPCVKC*RCVFPRSLLYNRHIVSDSSKRKQRKSRFCQDELPPPPLVLKKVQTGK *NAHACDQFKIMCPLIG*KKSFNISNQTN*TTWPQ*WSLT*LMTPQEIFLI*LXKDRTR* HHF >GCiWno151_b22.b1_3 RVIDCFPVKRLHDHAS*NVSNNITANTGPNFLCTVCYGETYDFNSKVVLYHFFGFYFRNF CFFWFLYI*FLVLIYAKACSFVTMKTFCNRNSTI*LK*ADITRTTCQNRYCAT*SHLQK* THVFWYFKIDRVE*DGSPFHSIF*FELVINEEHSKNYKTVSLRLPYTLLLIV*NTIRIFG YYVLKVSHVLNVKGVSSLALYYITDTSFQILPSVNKGRADFAKTSYHLHLWFLKRYKPGN KTPMLATNLK*CVHS*GRRSHSTFPTKQTKRLGLSDGL*LN**PHRKYF*YN*XRIELDS TI LFFLVLIYIIFGSYIRQGMLFCNHENFLQQEFNNLIEMSRHYTDNLSKSILRDMIPLAEV NTCILVF NDCTIMRHRMFPIILPLILALISCALCAMGKPMILTARLFYIIFLVFIFVI FVFFGSYIYNFWFLYTPRHALL NVSNNITANTGPNFLCTVCYGETYDFNSKVVLYHFFGFYFRNF CFFWFLYI NTIRIFG YYVLKVSHVLNVKGVSSLALYYITDTSFQILPSVNKGRADFAKTSYHLHLWFLKRYKPGN KTPMLATNLK >DEV46242.x1_1 VIQHFQPNKLNDLAQ*WSLT*LMTPQKIFLI*LKRIETR*QQLSTTWYKVTHKRCRVGKM GHLSFSS**KQNIKLYLRDFHRPLLIV*NTGYLVIIVIFPHSTIRCIG*KIA*TCCKKGY HSLYSMALWVVTYMIKYPEEVKKIENELNEVLDDYLPTLHDQESLPHTMAFINEVRMQKL SNLNAPGKIANDVLPC*VX >DEV46242.x1_2 SFNISNQTN*TTWLSDGL*LN**PHRKYF*YN*KGSKLDSSNYQRLGTR*HINGVGWGRW DTSHLVVNKNRI*NCIFATSIDRC*LFKTQDIWL*L*SFPTVLYDV*VKKLLKHVAKKVI ILCTLWRYGWSHT**STQKK*KRLKTS*MKCWTTIFLRYMTRSLYHTPWPLSMRLECKSY LI*THLEKSLMMCYRAEF >DEV46242.x1_3 HSTFPTKQTKRLGSVMVSDLTNDPTENISNITEKDRNSIAAIINDLVQGNT*TV*GGEDG TPLI**LIKTEYKTVSSRLP*TVVNCLKHRIFGYNCNLSPQYYTMYRLKNCLNMLQKRLS FSVLYGAMGGHIHDKVPRRSEKD*KRVK*SVGRLSSYVT*PGVSTTHHGLYQ*G*NAKVI *FERTWKNR**CVTVLS >GCiWno456_a24.b1 CHROMAT_FILE: GCiWno456_a24.b1 PHD_FILE: GCiWno456_a24.b1.phd.1 CHEM: term DYE: big TIME: Fri Oct 12 11:21:16 2001 TEMPLATE: GCiWno456_a24 DIRECTION: fwd Length = 933 Score = 60.5 bits (144), Expect = 3e-09 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 1 KIENELNEVLDDYLPTLHDQESLPHTM 27 KIENELNEVLDDYLPTLHDQESLPHTM Sbjct: 702 KIENELNEVLDDYLPTLHDQESLPHTM 782 >GCiWno456_a24.b1_1 C*LFKTRSGYLDIMC*RCSMC*MLKVCLPSLSTI*QTHRFRFFQA*TKEEQILPRRATTS TSGS*KGTNREIKRPCFATNLK*CVHS*GRRGHSTFPTKQTKRLGLSDGL*LN**PHRKY F*YN*KGSKLDSSNYQRLGTR*HINGVGWGRWDTSHLVVNKNRI*NCIFATSIDRC*LFK TQDIWL*L*SFPTVLYDV*VKKLLKHVAKKVIILCTLWRYGWSHT*XSTQKK*KRLKTS* MKCWTTIFLRYMTRSLYHTPWAFINEVRMAXVSXLTHLXKSLMMCYRAEVCARMSIAHGT LVESRL*VQS* >GCiWno456_a24.b1_2 VNCLKHDQDIWILCVKGVPCVKC*RCVFPRSLLYNRHIVSDSSKRKQRKSRFCQDELPPP PLVLKKVQTGK*NAHALRPI*NNVSTHRVEEVIQHFQPNKLNDLASVMVSDLTNDPTENI SNITEKDRNSIAAIINDLVQGNT*TV*GGEDGTPLI**LIKTEYKTVSSRLP*TVVNCLK HRIFGYNCNLSPQYYTMYRLKNCLNMLQKRLSFSVLYGAMGGHIHDXVPRRSEKD*KRVK *SVGRLSSYVT*PGVSTTHHGPLSMRLEWXKYXY*RTWXNR**CVTVLRSVPVCQLHTGP **KVGYKCKV >GCiWno456_a24.b1_3 LIV*NTIRIFGYYVLKVFHVLNVKGVSSLALYYITDTSFQILPSVNKGRADFAKTSYHLH LWFLKRYKPGNKTPMLCDQFKIMCPLIG*KRSFNISNQTN*TTWPQ*WSLT*LMTPQKIF LI*LKRIETR*QQLSTTWYKVTHKRCRVGKMGHLSFSS**KQNIKLYLRDFHRPLLIV*N TGYLVIIVIFPHSTIRCIG*KIA*TCCKKGYHSLYSMALWVVTYMIXYPEEVKKIENELN EVLDDYLPTLHDQESLPHTMGLYQ*G*NGXSIXIDAPGKIANDVLPC*GLCPYVNCTRDL SRK*AISAKL First walk >GCiWno151_b22.b1_1 FGS*TAFQ*NDCTIMRHRMFPIILPLILALISCALCAMGKPMILTARLFYIIFLVFIFVI FVFFGSYIYNFWFLYTPRHALL*P*KLFATGIQQFD*NEPTLHGQLVKIDIARHDPTCRS KHMYSGILKLIEWSKMGHLFILFSSSNW**TKNIQRIIKPFRYDFHIRCC*LFKTRSGYL DIMC*RCPMC*MLKVCLPSLSTI*QTHRFRFFQA*TKEEQILPRRATTSTSGS*KGTNRE IKRPCLRPI*NNVSTHRVEEVIQHFQPNKLNDLASVMVSDLTNDPTGNISNITEXGSNSI APFX >GCiWno151_b22.b1_2 SGHRLLSSKTTARSCVIECFQ*YYR*YWP*FPVHCVLWGNL*F*QQGCFISFFWFLFS*F LFFLVLIYIIFGSYIRQGMLFCNHENFLQQEFNNLIEMSRHYTDNLSKSILRDMIPLAEV NTCILVF*N**SGVRWVTFSFYFLVRIGNKRRTFKEL*NRFVTTSIYAVVNCLKHDQDIW ILCVKGVPCVKC*RCVFPRSLLYNRHIVSDSSKRKQRKSRFCQDELPPPPLVLKKVQTGK *NAHACDQFKIMCPLIG*KKSFNISNQTN*TTWPQ*WSLT*LMTPQEIFLI*LXKDRTR* HHF >GCiWno151_b22.b1_3 RVIDCFPVKRLHDHAS*NVSNNITANTGPNFLCTVCYGETYDFNSKVVLYHFFGFYFRNF CFFWFLYI*FLVLIYAKACSFVTMKTFCNRNSTI*LK*ADITRTTCQNRYCAT*SHLQK* THVFWYFKIDRVE*DGSPFHSIF*FELVINEEHSKNYKTVSLRLPYTLLLIV*NTIRIFG YYVLKVSHVLNVKGVSSLALYYITDTSFQILPSVNKGRADFAKTSYHLHLWFLKRYKPGN KTPMLATNLK*CVHS*GRRSHSTFPTKQTKRLGLSDGL*LN**PHRKYF*YN*XRIELDS TI >GCiWno454_k20.b1 CHROMAT_FILE: GCiWno454_k20.b1 PHD_FILE: GCiWno454_k20.b1.phd.1 CHEM: term DYE: big TIME: Fri Oct 12 11:14:25 2001 TEMPLATE: GCiWno454_k20 DIRECTION: fwd Length = 928 Score = 42.2 bits (97), Expect = 0.004 Identities = 17/24 (70%), Positives = 20/24 (82%) Frame = -3 Query: 72 SWLQERCYKRPTLFKGMGKLPVDN 95 SW+QERCY+RP LFK MG L VD+ Sbjct: 875 SWVQERCYQRPPLFKXMGXLQVDD 804 Score = 36.4 bits (82), Expect(2) = 7e-29 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -3 Query: 91 LPVDNTIRIFGYYVLKVFHVL 111 L V NTIRIFGYYVLKV HVL Sbjct: 230 LIV*NTIRIFGYYVLKVSHVL 168 Score = 112 bits (277), Expect(2) = 7e-29 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = -2 Query: 115 GVSSLALYYITDTSFQILPSVNKGRADFAKTSYHLHLWFLKRYKPGNKTPML 166 GVSSLALYYITDTSFQILPSVNKGRADFAKTSYHLHLWFLKRYKPGNKTPML Sbjct: 168 GVSSLALYYITDTSFQILPSVNKGRADFAKTSYHLHLWFLKRYKPGNKTPML 13 >GCiWno454_k20.b1 TAAATTGGTCGCAAGCATGGGCGTTTTATTTCCCGGTTTGTACCTTTTTAAGAACCAGAGGTGGAGGTGGTAGCTCGTCT TGGCAAAATCTGCTCTTCCTTTGTTTACGCTTGGAAGAATCTGAAACGATGTGTCTGTTATATAGTAGAGAGCGAGGGAA GACACACCAACACATGGGACACCTTTAACACATAATATCCAAATATCCTGATCGTGTTTTAAACAATTAACAACAGCGTA TATGGAAGTCGCAAGGAAACGGTTTTATAATTCTTTGAATGTTCTTCGTTTATTACCAATTCGAACTAGAAAATAGAATG AAAAGGTGACCCATCTTTCCCCACTCTATCAATTTTAAAATAACAGAATACATGTGTTTACTTCTGCAAGTGGGATCATG TCGCGCAATATCGATTTTGACAAGTTGTCCGTGTAATGTCGGCTCATTTCAATCAATTTGTTGAATTCCTGTTGCAAAAA GTTTTCATGGTTACGAAAGAGCATGACTTGGCGTATATGAGAACCAAAAATTATATATATAAGAACCAAAAAAAACAAAA ATTACGTATATAAAAACAAAAAAAATGATATGAAACAACCTTGCTGTTGAAATCATAGGTTTCCCCATAGCACACAGTGC ACAGGAAATTTGCGACTGTCTTTAGTGACATATCTTNCTGCAAGTTCTGACCATCGCCACCTTTNCTCTATTCTGGATCA TATAAACAAGCACAGATCCGATGNNCGTCGTCATAAGATCTTTCATTTCATTGGTGTTTGAGATACTGCATAAAGTCTGT ACCATCGTCGACTTGTAGTTNACCCATTNCCTTAAACAACGGGGGTCGTTGGTAACACCGCTCTTGCACCCANGAACCAG TCTTTCGATGCAAACTTGCGACGAACTGGAAGAAAACTTCCTTTATCG >GCiWno454_k20.b1_4 DKGSFLPVRRKFASKDWFXGARAVLPTTPVV*GNGXTTSRRWYRLYAVSQTPMK*KIL*R RXSDLCLFI*SRIEXRWRWSELAXRYVTKDSRKFPVHCVLWGNL*FQQQGCFISFFLFLY T*FLFFLVLIYIIFGSHIRQVMLFRNHENFLQQEFNKLIEMSRHYTDNLSKSILRDMIPL AEVNTCILLF*N**SGERWVTFSFYFLVRIGNKRRTFKEL*NRFLATSIYAVVNCLKHDQ DIWILCVKGVPCVGVSSLALYYITDTSFQILPSVNKGRADFAKTSYHLHLWFLKRYKPGN KTPMLATNL >GCiWno454_k20.b1_5 R*RKFSSSSSQVCIERLVXGCKSGVTNDPRCLRXWVNYKSTMVQTLCSISNTNEMKDLMT TXIGSVLVYMIQNRXKVAMVRTCXKICH*RQSQISCALCAMGKPMISTARLFHIIFFVFI YVIFVFFGSYIYNFWFSYTPSHALS*P*KLFATGIQQID*NEPTLHGQLVKIDIARHDPT CRSKHMYSVILKLIEWGKMGHLFILFSSSNW**TKNIQRIIKPFPCDFHIRCC*LFKTRS GYLDIMC*RCPMCWCVFPRSLLYNRHIVSDSSKRKQRKSRFCQDELPPPPLVLKKVQTGK *NAHACDQFX >GCiWno454_k20.b1_6 IKEVFFQFVASLHRKTGSWVQERCYQRPPLFKXMGXLQVDDGTDFMQYLKHQ*NERSYDD XHRICACLYDPE*XKGGDGQNLQXDMSLKTVANFLCTVCYGETYDFNSKVVSYHFFCFYI RNFCFFWFLYI*FLVLIYAKSCSFVTMKTFCNRNSTN*LK*ADITRTTCQNRYCAT*SHL QK*THVFCYFKIDRVGKDGSPFHSIF*FELVINEEHSKNYKTVSLRLPYTLLLIV*NTIR IFGYYVLKVSHVLVCLPSLSTI*QTHRFRFFQA*TKEEQILPRRATTSTSGS*KGTNREI KRPCLRPIX >GCiWno456_a24.b1 TGTTAATTGTTTAAAACACGATCAGGATATTTGGATATTATGTGTTAAAGGTGTTCCATGTGTTAAATGTTAAAGGTGTG TCTTCCCTCGCTCTCTACTATATAACAGACACATCGTTTCAGATTCTTCCAAGCGTAAACAAAGGAAGAGCAGATTTTGC CAAGACGAGCTACCACCTCCACCTCTGGTTCTTAAAAAGGTACAAACCGGGAAATAAAACGCCCATGCTTTGCGACCAAT TTAAAATAATGTGTCCACTCATAGGGTAGAAGAGGTCATTCAACATTTCCAACCAAACAAACTAAACGACTTGGCCTCAG TGATGGTCTCTGACTTAACTAATGACCCCACAGAAAATATTTCTAATATAACTGAAAAGGATCGAAACTCGATAGCAGCA ATTATCAACGACTTGGTACAAGGTAACACATAAACGGTGTAGGGTGGGGAAGATGGGACACCTCTCATTTAGTAGTTAAT AAAAACAGAATATAAAACTGTATCTTCGCGACTTCCATAGACCGTTGTTAATTGTTTAAAACACAGGATATTTGGTTATA ATTGTAATCTTTCCCCACAGTACTATACGATGTATAGGTTAAAAAATTGCTTAAACATGTTGCAAAAAAGGTTATCATTC TCTGTACTCTATGGCGCTATGGGTGGTCACATACATGATANAGTACCCAGAAGAAGTGAAAAAGATTGAAAACGAGTTAA ATGAAGTGTTGGACGACTATCTTCCTACGTTACATGACCAGGAGTCTCTACCACACACCATGGGCCTTTATCAATGAGGT TAGAATGGCANAAGTATCNNTATTGACGCACCTGGNAAAATCGCTAATGATGTGTTACCGTGCTGAGGTCTGTGCCCGTA TGTCAATTGCACACGGGACCTTAGTAGAAAGTAGGCTATAAGTGCAAAGTTAA >GCiWno456_a24.b1_1 C*LFKTRSGYLDIMC*RCSMC*MLKVCLPSLSTI*QTHRFRFFQA*TKEEQILPRRATTS TSGS*KGTNREIKRPCFATNLK*CVHS*GRRGHSTFPTKQTKRLGLSDGL*LN**PHRKY F*YN*KGSKLDSSNYQRLGTR*HINGVGWGRWDTSHLVVNKNRI*NCIFATSIDRC*LFK TQDIWL*L*SFPTVLYDV*VKKLLKHVAKKVIILCTLWRYGWSHT*XSTQKK*KRLKTS* MKCWTTIFLRYMTRSLYHTPWAFINEVRMAXVSXLTHLXKSLMMCYRAEVCARMSIAHGT LVESRL*VQS* >GCiWno456_a24.b1_2 VNCLKHDQDIWILCVKGVPCVKC*RCVFPRSLLYNRHIVSDSSKRKQRKSRFCQDELPPP PLVLKKVQTGK*NAHALRPI*NNVSTHRVEEVIQHFQPNKLNDLASVMVSDLTNDPTENI SNITEKDRNSIAAIINDLVQGNT*TV*GGEDGTPLI**LIKTEYKTVSSRLP*TVVNCLK HRIFGYNCNLSPQYYTMYRLKNCLNMLQKRLSFSVLYGAMGGHIHDXVPRRSEKD*KRVK *SVGRLSSYVT*PGVSTTHHGPLSMRLEWXKYXY*RTWXNR**CVTVLRSVPVCQLHTGP **KVGYKCKV >GCiWno456_a24.b1_3 LIV*NTIRIFGYYVLKVFHVLNVKGVSSLALYYITDTSFQILPSVNKGRADFAKTSYHLH LWFLKRYKPGNKTPMLCDQFKIMCPLIG*KRSFNISNQTN*TTWPQ*WSLT*LMTPQKIF LI*LKRIETR*QQLSTTWYKVTHKRCRVGKMGHLSFSS**KQNIKLYLRDFHRPLLIV*N TGYLVIIVIFPHSTIRCIG*KIA*TCCKKGYHSLYSMALWVVTYMIXYPEEVKKIENELN EVLDDYLPTLHDQESLPHTMGLYQ*G*NGXSIXIDAPGKIANDVLPC*GLCPYVNCTRDL SRK*AISAKL >GCiWno59_g04.g1 CAATTTGAGCTCTGTAAAAAGTTATATACATGATAAAGTACCCAGAAGAAGTGAAAAAGATTGAAAACGAGTTAAATGAA GTGTTGGACGACTATCTTCCTACGTTACATGACCAGGAATCTCTACCACACACCATGGCCTTTATCAATGAGGTTAGAAT GCAAAAGTTATCTAATTTGAACGCACCTGGAAAAATCGCTAATGATGTGTTACCGTGCTGAGTTCTGTGCCCGTATGTCA ATTGCACAACGGACCTTAAGTAGAAAGTAGGCTATAAAGTGCAAAGTTAATAACTTAAAAATGTCAGTTTCGATTTGAGC ACAATATGTGTTTTTGGATGTAGCAATTGCTTTAGAGTTTAGACAGAAGCGTGCTATTGTTTTTTTAGGTTTTGAGATGC AGACCGAGCCTTCCATTGGCGGTACCGCATTCAGCTACGGAGGATACCAAGCTCGGTGGATACGACATCAGCAAAGACAC GATGGTGGTAGCAAGTTTATATTCAGCAAATCGTGACCCAAAAGTGTGGGCGAACCCGGACCAATTTGACCCAAGTCGAT TTTTAGCCAAAGATGATTTGGGTGTGACAGTGTTGGATGAAACGAAAGTGGAACAAGTATTCACATTCTCTTTGGGGGAC CGAAAATGTCCAGGCGAAGACATCGGAAGATCATTTCTTTTCTTAACCACAGCGTACCTCGCGCATACTTGCAAGTTAAA GCCAGACTCAGCCAAACCACCAACTTTTCAAACTAAGCCTGGTTCGATAACCAGACCAAAAGATTTTGGTGGTCAGCTTA ATGTTAAAAAATGTTGGCTGGGCGTGTTTAAGCCAGATGATACCGAAGAGTTAGAAGATGTCAACAGAAAGTGAAAGCAT GNACCATCCTACCCCAACTGCTATTATTAGGGGGAGTAGCATCCAAAATCGCTTTCATATAATTAAACCT >GCiWno59_g04.g1_1 QFELCKKLYT**STQKK*KRLKTS*MKCWTTIFLRYMTRNLYHTPWPLSMRLECKSYLI* THLEKSLMMCYRAEFCARMSIAQRTLSRK*AIKCKVNNLKMSVSI*AQYVFLDVAIALEF RQKRAIVFLGFEMQTEPSIGGTAFSYGGYQARWIRHQQRHDGGSKFIFSKS*PKSVGEPG PI*PKSIFSQR*FGCDSVG*NESGTSIHILFGGPKMSRRRHRKIISFLNHSVPRAYLQVK ARLSQTTNFSN*AWFDNQTKRFWWSA*C*KMLAGRV*AR*YRRVRRCQQKVKAXTILPQL LLLGGVASKIAFI*LNL >GCiWno59_g04.g1_2 NLSSVKSYIHDKVPRRSEKD*KRVK*SVGRLSSYVT*PGISTTHHGLYQ*G*NAKVI*FE RTWKNR**CVTVLSSVPVCQLHNGP*VESRL*SAKLIT*KCQFRFEHNMCFWM*QLL*SL DRSVLLFF*VLRCRPSLPLAVPHSATEDTKLGGYDISKDTMVVASLYSANRDPKVWANPD QFDPSRFLAKDDLGVTVLDETKVEQVFTFSLGDRKCPGEDIGRSFLFLTTAYLAHTCKLK PDSAKPPTFQTKPGSITRPKDFGGQLNVKKCWLGVFKPDDTEELEDVNRK*KHXPSYPNC YY*GE*HPKSLSYN*TX >GCiWno59_g04.g1_3 I*AL*KVIYMIKYPEEVKKIENELNEVLDDYLPTLHDQESLPHTMAFINEVRMQKLSNLN APGKIANDVLPC*VLCPYVNCTTDLK*KVGYKVQS**LKNVSFDLSTICVFGCSNCFRV* TEACYCFFRF*DADRAFHWRYRIQLRRIPSSVDTTSAKTRWW*QVYIQQIVTQKCGRTRT NLTQVDF*PKMIWV*QCWMKRKWNKYSHSLWGTENVQAKTSEDHFFS*PQRTSRILAS*S QTQPNHQLFKLSLVR*PDQKILVVSLMLKNVGWACLSQMIPKS*KMSTESESMXHPTPTA IIRGSSIQNRFHIIKP >_4 FCTLCAMGGHIHDKVPEE*KRLKTS*MKCWTTIFLRYMTRSLYHTPWPLSMRLECKSYLI *THLEKSLMMCYRAEFCARMSIAQRTLSRK*AIKCKVNNLKMSVSI*AQYVFLGGAIALE FRQKRAIVFLGFEMQTEPSIGGTAFSYGGYQARWIRHQQRHDGGSKFIFSKS*PKSVGEP GPI*PKSIFNQR*FGCESVG*NKSGTSVHILFGGSKMSRRRHRKIISFLNHSVPCAYLQV KARPSQTTNFSN*AWFDNQTKRFWRSA*C*KILAGRFK >_5 XLYSMRYGWSHT**STRRVK KIENELNEVLDDYLPTLHDQESLPHTMAFINEVRMQKLSN LNAPGKIANDV LPC*VLCPYVNCTTDLK*KVGYKVQS**LKNVSFDLSAICVFGWSNCFR V*TEACYCFFRF*DADRAFHWRYRIQLRRIPSSVDTTSAKTRWW*QVYIQQIVTQKCGRT RTNLTQVDF*PKMIWV*KCWMKQKWNKCSHSLWGIENVQAKTSEDHFFS*PQRTLRILAS *SQTQPNHQLFQLSLVR*PDQKILAFSLMLKNFGWAF*X >_6 SVLYALWVVTYMIKYQKSEKD*KRVK*SVGRLSSYVT*PGVSTTHHGLYQ*G*NAKVI*F ERTWKNR**CVTVLSSVPVCQLHNGP*VESRL*SAKLIT*KCQFRFERNMCFWVEQLL*S LDRSVLLFF*VLRCRPSLPLAVPHSATEDTKLGGYDISKDTMVVASLYSANRDPKVWANP DQFDPSRFLTKDDLGVKVLDETKVEQVFTFSLGDRKCPGEDIGRSFLFLTTAYLAHTCKL KPDPAKPPTFPTKPGSITRPKDFGVQLDVKKFWLGVLX >sequence 16 48% to 1A1 EENLVNCLVDIYTAGTDAPTNVILWAIVTLLHKPNLQHLLFHEINNKT (1) NSNEDLSNRWPLLKAFIQENFRFNPPAPLSIPHQTNQGVKLDKYFIPKDTM IISNIYAVNHDPKIWKNPYEFNIYRHIDTDGKFVPSTKVIAFGIGCRSCLG EKLGRLEIFYFLANMIKRFEILPDPGSKDLP PINEGGNSILHLPIHFKVVFKPRENEDYFSL* DEV8425.x1 LQW263226.x1 GCiWno1017_n21.b1 GCiWno153_h17.g1 >GCiWno268_l16.b1_4 XARHWSLTXCARIGILPQHWGGFYPIIDLNNLKPIPLSRK*AITKYITVAMLHIFVILNH HTQEENLVNCLVDIYTAGTDAPTNVILWAIVTLLHKPNLQHLLFHEINNKTSKFKNRYCR VRERLDTFSLYFLVPVL*FFENCTFIFNECSWFTTKWEEKIECKDFSCFPTVLYKHSYTI VYLQL*NSFAIL*KYFLPKISLSVQSIIC*MQQKNLDSNEDLSNRWPLLKAFIQENFRFN PPAPLSIPHQTNQGVKLDKYFIPKDTMVSFINTGVSHFSTAIQAMSHDPCQSFYLAKQG* GSD >GCiWno268_l16.b1_5 GTPLVLNDXCQDWHTTPTLGGVLPHHRPQQFETYTTFPKVSDHKIYYSRHVTYIRYLKPP YTGGELGQLPCRYLHCRDRRTN*RYSMGYSHTPTQTQSPASPVSRNKQ*NK*V*K*IL*G EGKIGHLFLIFSRPSFIIL*KLHFYIQ*MFLVYYQMGRKNRM*RFLMFPNRTI*T*LYNR ILTIVKQLCYTLKIFSPKDIPLCPEYYMLNATKKFRFQ*RPEQQMAITESFYSRKLSF*P TSTLEHTPSN*SRC*T*QILHPKRYHG*FH*HWCFSF*YCHSGYEP*SVPVVLPGKARLR IRX >GCiWno268_l16.b1_6 WHAIGP*RXVPGLAYYPNTGGGSTPS*TSTI*NLYHFPESKRSQNILQSPCYIYSLS*TT IHRRRTWSTAL*IFTLQGQTHQLTLFYGL*SHSYTNPISSISCFTK*TIKQVSLKIDIVG *GKDWTPFPYIFSSQFYNSLKIALLYSMNVLGLLPNGKKK*NVKISHVSQPYYINIVIQS YTYNCKTALLYFKNIFSQRYPSLSRVLYVKCNKKI*IPMKT*ATDGHY*KLLFKKTFVLT HQHP*AYPIKLIKVLNLTNTSSQKIPWLVSLTLVFLILVLPFRL*AMIRASRFTWQSKAK DPT >GCiWno268_l16.b1 GTCGGATCCTTAGCCTTGCTTTGCCAGGTAAAACGACTGGCACGGATCATGGCTCATAGCCTGAATGGCAGTACTAAAAT GAGAAACACCAGTGTTAATGAAACTAACCATGGTATCTTTTGGGATGAAGTATTTGTCAAGTTTAACACCTTGATTAGTT TGATGGGGTATGCTCAAGGGTGCTGGTGGGTTAAAACGAAAGTTTTCTTGAATAAAAGCTTTCAGTAATGGCCATCTGTT GCTCAGGTCTTCATTGGAATCTAAATTTTTTTGTTGCATTTAACATATAATACTCTGGACAGAGAGGGATATCTTTGGGA GAAAATATTTTTAAAGTATAGCAAAGCTGTTTTACAATTGTAAGTATACGATTGTATAACTATGTTTATATAGTACGGTT GGGAAACATGAGAAATCTTTACATTCTATTTTTTCTTCCCATTTGGTAGTAAACCAAGAACATTCATTGAATATAAAAGT GCAATTTTCAAAGAATTATAAAACTGGGACGAGAAAATATAAGGAAAAGGTGTCCAATCTTTCCCTCACCCTACAATATC TATTTTTAAACTTACTTGTTTTATTGTTTATTTCGTGAAACAGGAGATGCTGGAGATTGGGTTTGTGTAGGAGTGTGACT ATAGCCCATAGAATAACGTTAGTTGGTGCGTCTGTCCCTGCAGTGTAAATATCTACAAGGCAGTTGACCAAGTTCTCCTC CTGTGTATGGTGGTTTAAGATAACGAATATATGTAACATGGCGACTGTAATATATTTTGTGATCGCTTACTTTCGGGAAA GTGGTATAGGTTTCAAATTGTTGAGGTCTATGATGGGGTAGAACCCCCCCCAGTGTTGGGGTAGTATGCCAATCCTGGCA CANATCGTTAAGGACCAATGGCGTGCCAN >GCiWno511_b09.g1_4 MSCLLPNGXKNRMKISHVPNRTI*HSYQSYTYNCKPAXLYFKNXFSQRYPSLSRVLYVKC NKKI*IPMKT*ATDGHY*KLLFKKTFVLTHQHP*AYPIKLIKVLNLTNTSSQKIPWLVSL TLVFLN*VCHLGNRWYLSLAVKKIYVMNRYQQ*KPLLLPSGISCVMLFYAVKAHPRKI** YPTPLRGG*RACL*LRMASKLVAATIVDVCVFGQDTYLQLL*PRGD*WFVQSVSHTQITI THKLHVWSIVSGHEAYETYNILVYEKYESITLAFKDIHL*THATL*KNFLSDNFEHIRSQ PYPKIGRIRTS >GCiWno511_b09.g1_5 XVLFTTKWKXK*NEDFSCSQPYYIT*LSIVYLQL*TSXAIL*KYXLPKISLSVQSIIC*M QQKNLDSNEDLSNRWPLLKAFIQENFRFNPPAPLSIPHQTNQGVKLDKYFIPKDTMVSFI NTGVSQLSLPFGE*MVP*PSCQENICHESLPAVKALVATFGDLMCHVVLRCESSPAQNII IPDAAAWWLARLPLTQNGFKAGRCYHCGRMCLWARHLFTTALTQR*LMVCSICQPYTDHN HPQITCVVNRKWARGVRNI*HPCVRKIRKHNTGF*RYSFMNTCNLIKKLSFR*FRTYTQS TISKNRKNPYEX >GCiWno511_b09.g1_6 CLVYYQMEXKIE*RFLMFPTVLYNIVINRILTIVNQLCYTLKIXSPKDIPLCPEYYMLNA TKKFRFQ*RPEQQMAITESFYSRKLSF*PTSTLEHTPSN*SRC*T*QILHPKRYHG*FH* HWCFSIKFAIWGIDGTLA*LSRKYMS*IVTSSKSPCCYLRGSHVSCCFTL*KLTRAKYNN TRRRCVVVSAPASNSEWLQSWSLLPLWTYVSLGKTLIYNCSNPEVTNGLFNLSAIHRSQS PTNYMCGQS*VGTRRTKHITSLCTKNTKA*HWLLKIFIYEHMQPYKKTFFQIISNIYAVN HIQKSEESVRV >GCiWno410_g02.b1_4 LLRGSAIRA*HXLRFICAVDSWVSSY*KTLALISCVMLFYAGKLTGAKYNNTRRRCVVVS GPASNSEWLQSWSLLPLWTYVSLGKTLIYNCSNPEVTNGLFNLSAIHRSQSPTNYMCGQS *VGTRRTKHITSLCTKNTKA*HWLLKLFIYEHMQPYKITFFQIISNIYAVNHDPKIWKNP YEFNIYRHIDTDGKFVPSTKVIAFGIGCRSCLGEKLGRLEIFYFLANMIKRFEILPDPGS KDLPPINEGGNSILHLPIHFKVVFKPRENEDYFSL*ITPRP*YIVNSI*P*SCRRLTCKQ SMIQ >GCiWno410_g02.b1_5 ATSGECHQGLTXVEVHLCGG*LGVELLKNSGLNLMCHVVLRWKAHRRKI**YPTPLRGG* RACL*LRMASKLVAATIVDVCVFGQDTYLQLLQPRGD*WFVQSVSHTQITITHKLHVWSI VSGHEAYETYNILVYEKYESITLAFKVIHL*THATL*NNFLSDNFEHIRSQP*SKNLEES VRVQHLSSHRYRRKVCSFNESNRVWNRMQIVSW*ETRSS*NLLLSC*HD*EV*NPS*SRE QRSSSN*RGRQQHSSFANPF*SCFQTPRKRRLFFTINYTTTLVYSQQYMTMIVPSFNLQT VYDPX >GCiWno410_g02.b1_6 GYFGGVPSGPNXC*GSFVRWIAGCRVTEKLWP*SHVSCCFTLESSPAQNIIIPDAAAWWL AGLPLTQNGFKAGRCYHCGRMCLWARHLFTTAPTQR*LMVCSICQPYTDHNHPQITCVVN RKWARGVRNI*HPCVRKIRKHNTGF*SYSFMNTCNLIK*LSFR*FRTYTQSTMIQKSGRI RTSSTFIVTSIQTESLFLQRK*SRLESDADRVLVRNSVVLKSFTFLLT*LRGLKSFLIPG AKIFLQLTREATAFFICQSILKLFSNPEKTKIIFHYKLHHDPSI*STVYDHDRAVV*PAN SL*SX >GCiWno1017_n21.b1 ATGTGTCTTTGGGCAAGACACTTATTTACAACTGCTCCAACCCAGAGGTCACTAATGGTTTGTTCAATCTGTCAGCCATA CACAGATCACAATCACCCACAAATTACATGTGTGGTAAATCGTAAGTGGGCACGAGGCGTACGAAACATATAACATCCTT GTGTACGAAAAATACGAAAACATATAACAACCACTGGCTTTTAAAGTTATTCATTTATGAACACATGCAACCTTATAAAA TAACTTTCTTTCAGATAATTTCGAACATATACGCAGTCAACCATGATCCAAAAATCTGGAAGAATCCGTACGAGTTCAAC ATTTATCGTCACATCGATACAGACGGAAAGTTTGTTCCTTCAACGAAAGTAATCGCGTTTGGAATCGGATGCAGATCGTG TCTTGGTGAGAAACTCGGTCGTCTTGAAATCTTCTACTTTCTTGCTAACATGATTAAGAGGTTTGAAATCCTTCCTGATC CCGGGAGCAAAGATCTTCCTCCAATTAACGAGGGAGGGCACAGCATTCTTCCTTTGCCCATCCATTTTAAAGTTGCCCTC CAACCCCCAGAGAACGACCAACATTTTTCCCTATCACACTACCCCTCTAAACCAGGTGATACATTACCGCTTGCCCGACG AGACAAAATCTTTAATTCATTTCACGCTCCCCCCCTCGAATAAAACATATTCACCGCCCCCTGCAATTAACACACAAGCC CCTGCATAAAAATAATTCCGCGGAAGCACCACCACCCCCCCACTAGGTGTTTACGACCAAATTTTCTTCTTTGTAAAAGC ATGGGCCGGGAAGAACCAGAGCCCCCCCCTATCGGCCCCCCACCCGCTGTGGCACTGGGAGCGTACCCCCTCGCCCGTGT CAAAAAACCACA IISNIYAVNHDPKIWKNPYEFNIYRHIDTDGKFVPSTKVIAFGIGCRSCLG EKLGRLEIFYFLANMIKRFEILPDPGSKDLP PINEGGNSILHLPIHFKVVFKPRENEDYFSL* >sequence 17 2 accessions 71% to 2J2 RPLLPKLARKYGPIFTITAGYRRVVFLVGYDLIKE (0?) VITDRAKDFASRCPNMPGRIVRGEGLD (1?) GIAAAPYGPKWMANRKFFYSAMRT MGLGKRGIEKCVVDEIPYIVEELEKLCTKNELFE PSSVFDSAVLNVLAYFTFGNRYSYQDEKFKELIHINND FFQKAKFLNQPLFFLLSLVPGLHKYWLPQCGKDLKESVGKIN KFVKAEIEQHRQNFDRKNPRDYIDCYLKELDQMNDQSELSEL (1?) GLEMSIMDLFQAGTETTSITLRWAILYMVNNPNIQSKII LQW177698.x1 LQW103752.x1 ciht036p01 GCiWno478_p11.g1 look for N-term on minus strand >LQW177698.x1 >lcl|LQW177698.x1 CHROMAT_FILE: LQW177698.x1 PHD_FILE: LQW177698.x1.phd.1 CHEM: term DYE: ET TIME: Wed Aug 22 14:01:44 2001 TEMPLATE: LQW177698 DIRECTION: fwd GGGCAGTGCAGCTTGCTGCTGTGTGTCAGACTCTAGAGGATCCCCATAATTTAGTCTAAACCCCAGGTCCCATGGCACGC TTCGTAGTATGCCTTCACCCCTTACCCATGTAAAACACAGAAGCGTAAAAAGTGATTACAATATGCCTTACTTTAAACAT GTAGATTAATGATCATGTAAAAAAAAAATTTTTTTAAATTTGGCCCAAACCCAGGTCCCATGGCCTGGACTGTGCCTCAC CGATACAGGATCAAAAACTTTAAAAAAAACCTAAAAACAATGATTTTACTTTGTATATTTGGGTTGTTAACCATGTATAA GATTGCCCAACGTAAAGTAGTTGACGTAGTTTCAGTTCCAGCTTGAAATAAATCCATGATCGACATTTCCAAACCTGAGA AGCAAAAAGAATGAGAGAATGTAATTTATTTTATATCTGCGTTCACCATAACGAAGAACGGTAAAGTTTACAACAGCGAA AAGACGCTTAAAACAGAAACAAAATAACGCTATGGATAAAAAGCTTGACTGTTACTCCCAAAAGAACAAGAACATATCAA TGAAGGCTATTTTAAACAAAGAGTGAAATTAAGTAAAATAAATGCTGTACAGGCGCTGTGGTAAAGTGGTTAGCACGCAG AATTTACTGGTTTAGGGTCTATACTGGTTACATTGTTGAAGGTTGAAATGTGTTGTTCAGTTACAATCTATTATCACTTA CAGGTCCGATGATCGGCTGATCATCAATTGATTAGCCTTGGAATACGCAATAATTCTGATTTGCGGCAGATCTCTCAGTG TCACCTAGTTACATTGTCCTCCATGCAACCTGATACTGGATAAAAAATCGTATGGGTACGAAGAACAGTCCTGTCACCAG AACGTTCAGGATTGGGATCCTCCACCGGCAAAGAGT >GCiWno478_p11.g1_4 N*SNIRLTTIFIFSXQIYGGNSG*FLSAPFKMXMIRYRXSVGYVKCLSLSGKS*VLLV*M XICVSVLLTQIPKTNENSRLSAL*ICVGVKIVLYTRLTP*PIIPVDFLII*T*YTTFYSA NRFLCS*NPQNIALP*SHFIA*YCFFRTA*TC*KVWTHFHYYSWV*TRGVSCWL*LY*RS EFMYLYSCIYLCN*LRDTMVRG*PFFSSFQLP*PNGPLRV*IISQINII*INITHKGKPI KEYSKRASSAQVYDQNIHVISVRNRRVNKLSSFIYSYRLSLTEQKILHQDVPTCQEELSV EKV*MVNVMLICK >GCiWno478_p11.g1_5 ELV*YKTDNNFYFFXSNLRGKFRLIFKRSI*NXYD*V*GICRVRXMFVVIX*KLSVISIN XHMRFGFINPDS*N**KLTFKCALDLRWC*NCVVYPSNPLTDYTGRFPDYLNLIYDILLR K*IPLFIKPTKYCIAIITLYSVILFFQNCLNLLESMDPFSLLQLGIDAWCFLLAMTLLKK *VHVFV*LYIFM*LAS*HHG*RLALL*FIPIALTQWTFTGLNYQPN*HHLNKYYPQG*TN KRIFEASVKCSSV*SKHPCYICPQQEGK*VKFIHLFLQVITDRAKDFASRCPNMPGRIVR GEGLDGECYVNM*X >GCiWno478_p11.g1_6 RISLI*D*QQFLFFPFKSTGEIPVDF*ALHLKXI*LGIGXLSGTXNVCRYXVKVECY*YK XSYAFRFY*PRFLKLMKTHV*VRFRFALVLKLCCIPV*PLDRLYR*IS*LFEPNIRHFTP QIDSFVHKTHKILHCHNHTL*RNIVFSELPKLARKYGPIFTITAGYRRVVFLVGYDFIKE VSSCICIVVYIYVTSFVTPWLEVSPSLVHSNCPNPMDLYGSKLSAKLTSFK*ILPTRVNQ *KNIRSERQVLKCMIKTSMLYLSATGG*IS*VHSFILTGYH*QSKRFCIKMSQHARKNCP WRRFRW*MLC*YVX >ciht036p01 Length = 555 Score = 46.1 bits (107), Expect = 5e-04 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 221 DYIDCYLKELDQMNDQSELS 240 DYIDCYLKELDQMNDQSELS Sbjct: 555 DYIDCYLKELDQMNDQSELS 496 >ciht036p01 GGGTTCGATACAGGATCAAAAACTTTAAAAAAACCTAAAAACAATGATTTTACTTTGTATATTTGGGTTGTTAACCATGT ATAAGATTGCCCAACGTAAAGTAATTGACGTAGTTTCAGTTCCAGCTTGAAATAAATCCATGATCGACATTTCCAAACCT GAGAAGCAAAAAGAATGAGAGAATGTAATTTATTTTATCTCTGCGTTCACCATAACGAAGAACGGTAAAGTTTACAACAG CGAAAAAACGCTTAAAACAGAAACAAAATAACGCTATGGATAAAAAGCTTGACTGTTACACCCAAAAGAACAAGAACATA TCAATGAAAGCTACTGTAAACAAAGAGTGAAATTAAGTAAAATAAATGCTGTACAGGCGCTGTGGTAAAGTGGTTAGCAC GCAGAGTTTACTGGTTTAGGTTCGATACTGCTACCATTGTAGAAGCTGAAAATGTGTGTGTTCAATTAAAATCTACTTTA TCAATTACCAAGCTCCGATAGTTCGCTTTGATCATTCATCTGATCGAGCTCTTTGAGATAACAGTCAATATAATC >ciht036p01_4 matches seq 17 and close to 206 DYIDCYLKELDQMNDQSELSELGN**SRF*LNTHIFSFYNGSSIEPKPVNSAC*PLYHSA CTAFILLNFTLCLQ*LSLICSCSFGCNSQAFYP*RYFVSVLSVFSLL*TLPFFVMVNAEI K*ITFSHSFCFSGLEMSIMDLFQAGTETTSITLRWAILYMVNNPNIQSKIIVFRFF*SF* SCIEP >ciht036p01_5 LY*LLSQRARSDE*SKRTIGAW*LIK*ILIEHTHFQLLQW*QYRT*TSKLCVLTTLPQRL YSIYFT*FHSLFTVAFIDMFLFFWV*QSSFLSIALFCFCFKRFFAVVNFTVLRYGERRDK INYILSFFLLLRFGNVDHGFISSWN*NYVNYFTLGNLIHG*QPKYTK*NHCF*VFLKFLI LYRTX >ciht036p01_6 IILTVISKSSIR*MIKANYRSLVIDKVDFN*THTFSASTMVAVSNLNQ*TLRANHFTTAP VQHLFYLISLFVYSSFH*YVLVLLGVTVKLFIHSVILFLF*AFFRCCKLYRSSLW*TQR* NKLHSLILFASQVWKCRSWIYFKLELKLRQLLYVGQSYTWLTTQIYKVKSLFLGFFKVFD PVSNP >sequence 18, 216 11 accessions similar to sequence 1 PKG to heme 52% to 2J2 MSMLVNLITNFDMSIVLTASCAFVLVFYYWYKRPRNFPPGPRGIPLLGVV PFLGKHTEKDFRKWSKKYGPMMSVRLGQNDWIVLGDHKTINE (0) CLVKGGNSFSGRPDHPVFKQFTKNHGVAMVDYGDHWKVQRRFGLTTLRG (2) FGVGKRSMEDRIVEEIEYLNNAIRSHNGKPFNIS (0) KLFANAVSNNISSIVMGERMDYSDKIFETLTQRSTES (2) IYNSDMAGKIIRFSIFVPSLWNLLLLFSTQASKQTSVFNSIRG (1?) QAIVNWVSQHKSTYDEHNVRDFIDAFIGEQKKETDVSFT (0) DLQLIQYVRDLYVAGTETTTVTLRWAVRCLIHYPEKQNKLRKEIFDVI (1) GREKTPSMKDKAQMPYTCAFMQELFRFRTLVPLGVPHKISNDVQVEGWSIPKGTW (0) IIPNLWAVHNDPDVWDEPSKFKPERHLDEKGNFVQSKHVIPFSVGPRHCLGEQLARME IFIFLVSMVQKFEFLPDPNEPNLPEINHGVNATVFVAYPFNIVANQV* LQW70287.x1 exon 1 94% TO LQW171454.x1 LQW149448.x1 exon 1, 2 LQW171454.x1 exon 2, 100% match, exon 4 LQW1567.y01 exon 3 LQW1567.y1 exon 3 LQW89119.x1 exon 3 LQW89423.x1 exon 3 LQW10413.x1 exon 3, 4 LQW270517.y1 exon 4, 5, 6 LQW31946.y1 exon 5, 6 LQW171454.y2 exon 5, 6 1 diff LQW210348.x2 exon 6 LQW164797.y1 exon 6 1 diff LQW210348.x3 exon 6 LQW29867.x1 exon 6, 7 LQW70287.y1 exon 7 LQW164797.y1 exon 7 DEV13999.y1 exon 7, 8 LQW197022.x1 exon 7, 8 LQW145909.y1 exon 7, 8 LQW183999.y1 exon 7, 8 ,9 LQW149448.y1 exon 8, 9 LQW186464.x1 exon 8, 9 DEV9936.x1 exon 9 1 diff, opposite end seq 203 LQW36801.x1 exon 9 LQW1567.x1 exon 9 DEV5879.y1 exon 9 >LQW270517.y1_4 region of exon 4,5,6 KTKQTINA*VKS**EKYTGKRPEIRRCKTTHRRWEASGDGPCRNSPVKGGIGERGTFQI* IFVCLTITRYMNSEMHLICNILVYSRCDEKSGISGPIVLHSTIYIGI*L*C*HLIETFRQ RGFE*YIQHCYG*KNGLQ*QNI*NINPKINREV*HCLKPLFGRDL*FSIYNSDMAGKIIR FSIFVPSLWNLLLLFSTQASKQTSVFNSIRGEVN*EIFAIVNLP*HFIVSLFCRSNRKLG FAT*INL*RTQR*RLYRCFYWRTKERNRCFLYGINVFYTRVAGQRHFCLCTSSGMLTSYH ECNFNVFLFLTDFLNTFFEWLLFGTR*GPAQFS >LQW270517.y1_5 NKANDKRVGQKLVRKIHGEKT*DTKVQNNSSEMGSKWRRAMP*QSS*RWDRGKGHFPDMN FCLFNNNTLYEF*DAFNMQYSCI*QM*REIRDKWSHRSPLYYIYRNLIVMLTFDRNFSPT RFRIIYPALLWVKEWITVTKYLKH*PKDQPRGIALFKAIVWSRLIIFNL*QRHGGKNYSI FYICSFFVEFASSIFNTSVKADKCFQFHSR*S*LGNIRYSKLALTLYRFFVLQKQS*IGF RNINQLMTNTTLETLSMLLLENKRKKPMFPLRYKCILHSRGGATTFLFMHLIGHAYELPR M*L*CVFIFNGFFKHFF*MAAIWNSLGTGSVQX >LQW270517.y1_6 KQSKR*TRRSKASEKNTRGKDLRYEGAKQLIGDGKQVETGHAVTVQLKVG*GKGALSRYE FLSV*Q*HVI*ILRCI*YAIFLYIADVTRNQG*VVPSFSTLLYI*ESNCNADI**KLFAN AVSNNISSIVMGERMDYSDKIFETLTQRSTERYSIV*SHCLVETYNFQFITATWREKLFD FLYLFLLCGICFFYFQHKRQSRQVFSIPFEVKLIRKYSL**TCLNTLSFLCFAEAIVNWV SQHKSTYDEHNVRDFIDAFIGEQKKETDVSFTV*MYFTLAWRGNDISVYAPHRACLRVTT NVTLMCFYF*RIF*TLFLNGCYLELVRDRLSSA >sequence 203, 136 probably in a gene cluster with seq 18 (0) LLHNMKYLQACLRETQRMFPFVNSSPRRFRKDLVLSGYLIPAG (1) ggt LQW134525.y1 EXXR LQW134525.y01 EXXR LQW276672.y1 EXXR LQW59936.y1 EXXR TO PKG opp = seq 18 LQW59936.y1 CHEM: term DYE: ET TIME: Wed Apr 4 14:48:40 2001 TEMPLATE: LQW59936 DIRECTION: rev Length = 627 Score = 85.8 bits (209), Expect = 5e-17 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 1 NMKYLQACLRETQRMFPFVNSSPRRFRKDLVLSGYLIPAG 40 NMKYLQACLRETQRMFPFVNSSPRRFRKDLVLSGYLIPAG Sbjct: 567 NMKYLQACLRETQRMFPFVNSSPRRFRKDLVLSGYLIPAG 448 LQW276672.y1 LQW276672.y1.phd.1 LQW276672.x1 12:55:25 2001 TEMPLATE: LQW276672 DIRECTION: rev Length = 973 Score = 85.8 bits (209), Expect = 5e-17 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 NMKYLQACLRETQRMFPFVNSSPRRFRKDLVLSGYLIPAG 40 NMKYLQACLRETQRMFPFVNSSPRRFRKDLVLSGYLIPAG Sbjct: 226 NMKYLQACLRETQRMFPFVNSSPRRFRKDLVLSGYLIPAG 345 >LQW276672.y1 >lcl|LQW276672.y1 CHROMAT_FILE: LQW276672.y1 PHD_FILE: LQW276672.y1.phd.1 CHEM: term DYE: ET TIME: Fri Aug 31 12:55:25 2001 TEMPLATE: LQW276672 DIRECTION: rev TAGCCGGTCCTTATAGTACAATGTATATAAAACAAAATTTTGTTTGTAAAAAATGAATGAATGTGACTTTGCCAGGTAGG GCAACGGCAGTCGTTGTGTGGTCTGTTTCATACACTTTGTGCTCCCTTTTAAGTTATACGTGTTATAGCGACTGTCTTTT ACCGGCCACACAAGGTTAATCTATTACATTTATTCTTAGAACTTATTTTTTTGCAGTTATTGCACAACATGAAGTACTTA CAAGCCTGTCTACGTGAAACACAACGTATGTTTCCATTTGTTAACTCGTCTCCAAGAAGATTTCGGAAAGATCTCGTCCT TTCAGGTTATCTTATACCGGCAGGTGAGATATGTTAAGATATCTGTGTTTTAATGTATATGTGTATAATAATGTACACCT CATGATCACTGCCAAGTTATAACATGGGTGTCTTCTTATACACCAGACACACGGTGTATTTATACACCTTATGCTCACTG TGAAGTTATAACATGGGTGTCTTCTTATACACTAGGTACACTTGATGTATTCATACACCTCATGCTCACTGTGAAGTCAT AACATGGGTGTCTTTTTATACACCTCATGCTCACTGTGAAGTCATAACATGGGTGTCTACTTATACACCAGAAACACCGG TGTATTTATACACCTCATGCTCACTGTGAAGTTATAACATGGGTGTCTTCTTATACACTAGGCACACTTGATGTATTCAT ACAGCTCATGCTCACTGTTTAGTGTGATCATAACATAGTGTCGTTTATACACCTTATTATCCTGTCGAGTCTAACTTGGA GTCTCTTAACGCCAACATATTGGGTTCATAACCTCAGCCCATTTAGCTTACAGGGTTCCATGATACCAGGCCCGGGGGTA AAAACGGCCTATACCATTCCTTGCATAAGGGCTAACGACCATTGTTTCCATCGTGGATCCGTGTCTGGATTTGGCTTTAA ATCAGGTACACTC >LQW276672.y1_1 *PVLIVQCI*NKILFVKNE*M*LCQVGQRQSLCGLFHTLCAPF*VIRVIATVFYRPHKVN LLHLFLELIFLQLLHNMKYLQACLRETQRMFPFVNSSPRRFRKDLVLSGYLIPAGEIC*D ICVLMYMCIIMYTS*SLPSYNMGVFLYTRHTVYLYTLCSL*SYNMGVFLYTRYT*CIHTP HAHCEVITWVSFYTPHAHCEVITWVSTYTPETPVYLYTSCSL*SYNMGVFLYTRHT*CIH TAHAHCLV*S*HSVVYTPYYPVESNLESLNANILGS*PQPI*LTGFHDTRPGGKNGLYHS LHKG*RPLFPSWIRVWIWL*IRYTX >LQW276672.y1_2 SRSL*YNVYKTKFCL*KMNECDFAR*GNGSRCVVCFIHFVLPFKLYVL*RLSFTGHTRLI YYIYS*NLFFCSYCTT*STYKPVYVKHNVCFHLLTRLQEDFGKISSFQVILYRQVRYVKI SVF*CICV**CTPHDHCQVITWVSSYTPDTRCIYTPYAHCEVITWVSSYTLGTLDVFIHL MLTVKS*HGCLFIHLMLTVKS*HGCLLIHQKHRCIYTPHAHCEVITWVSSYTLGTLDVFI QLMLTV*CDHNIVSFIHLIILSSLTWSLLTPTYWVHNLSPFSLQGSMIPGPGVKTAYTIP CIRANDHCFHRGSVSGFGFKSGTL >LQW276672.y1_3 AGPYSTMYIKQNFVCKK*MNVTLPGRATAVVVWSVSYTLCSLLSYTCYSDCLLPATQG*S ITFILRTYFFAVIAQHEVLTSLST*NTTYVSIC*LVSKKISERSRPFRLSYTGR*DMLRY LCFNVYVYNNVHLMITAKL*HGCLLIHQTHGVFIHLMLTVKL*HGCLLIH*VHLMYSYTS CSL*SHNMGVFLYTSCSL*SHNMGVYLYTRNTGVFIHLMLTVKL*HGCLLIH*AHLMYSY SSCSLFSVIIT*CRLYTLLSCRV*LGVS*RQHIGFITSAHLAYRVP*YQARG*KRPIPFL A*GLTTIVSIVDPCLDLALNQVH >LQW199445.x1 >lcl|LQW199445.x1 CHROMAT_FILE: LQW199445.x1 PHD_FILE: LQW199445.x1.phd.1 CHEM: term DYE: ET TIME: Wed Aug 22 13:55:24 2001 TEMPLATE: LQW199445 DIRECTION: fwd AGAAACGGCAGGCAGCTGCATTTTTCAGTTTATGAAATGATTAAAAATTAACCATTAATTTTGCTACATGTGGCAATTTG TATTTGATTTTAGTAAAGTTGTAATTATGATGTGGATGTTTAGTGTCCTTGGCAACACACTTAATGGTATTTGCTTTTAA AGTAAGCTTTGTTTAGCAATGTTTATGATTCTGAAATTATTTCATTTCTGCAAGCTTTTTAAAATGTCAAACAAAAAATC AAAACTACACATGCATATAAACTGATAGGCAAGCTAATATTGTAGTCAAGCTCCATTTTCCAGTGAGCTCACTTGTGCTT AAGCAAGACACTGAATGAACTAGTTCTTACTAATGGGTTGTTTAAAGGCATGCATAAAAAAAACGGAAAAAAATCACCCA CAATGTTGCACAAACAGTAAGCGGGCACAATGTGTATGAAACAGAACGCCCCTATTTATAACAACTGTCATTGCGCCGCC ACGCGAACATGCAGGGATAAATAAGTTACATTTATTCTATGATTCATAACTTAAAGGCAGGCACGCAGTGTTAAATATGG CACCTATAAGTTATAGCGACTGTCATTGCCCCACCATGCAGGGATAAATAAGTTACATTCAAATAATAAGTTCCAGCATA AATCAGTTAATAAGTCACATTCAATTCTCTTACCTTTCCCTTTGTCTTTCCGTCACTGATTTAGTTTCCAACCAACGTTC AGGAATAAAAGTGTTTGGGTCGTCGTAATACTCAGGGTTCCTGCTGTTTACTGTGTTTGATGTGTCCGAATGTGGGTGCT AAAATATAGTGAATTACCTTACGGACCTTTGGGGTTTTTCCGGGAAGTGAGCTGGGGGTTTAATACTCTG LQW199445.x1 LQW199445.x1.phd.1 LQW199445.y1 13:55:24 2001 TEMPLATE: LQW199445 DIRECTION: fwd Length = 870 Score = 48.8 bits (114), Expect = 7e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 1 HSDTSNTVNSRNPEYYDDPN 20 HSDTSNTVNSRNPEYYDDPN Sbjct: 792 HSDTSNTVNSRNPEYYDDPN 733 >LQW276672.x1 >lcl|LQW276672.x1 CHROMAT_FILE: LQW276672.x1 PHD_FILE: LQW276672.x1.phd.1 CHEM: term DYE: ET TIME: Fri Aug 31 12:55:03 2001 TEMPLATE: LQW276672 DIRECTION: fwd AAGGAATACGTGCAGGGCAGGCAATATACTTTTCATTAGTTACAAATAAGTTACACCTTATTCAATATTTATACAATGCA GTGAAGCATCAAATTAATGCAAATAATATTGAATTACCGATGTATATTTTAACGTACACCCCTCAATAAAAATAAAATTT ACAGACAAAAACATAAATTTACAAAAAAAATATTGGAAATATTTTACTGGCGAATTTTCCTACCATAGAAACTTCTACAT TGCATTAATCAGTAAACATTAAAACCAATAAGCTAAATTTGTTTCATAGGAATGTGTGTCTAACTATCTCTGCCTCCCCT GTGTTTTAAAGAGTTTGGTGAATATGTAAAGATCAATTTTTCTGCACGGCATTAATCAGTAAACAATAAACGTAAAATTT AGATTTGTTTTACAAGAATTTGTGTCTGAAAAAATGTGTACATGTTTAAAGAAATGGTATTTCCCTATTATAAAATGTTA GTTTTATTTTTTGTGGGTAAAGTCCCACAGTGAGGCACGCCATGGGTTCAAGGATTTAAGCCAGAGTTAGCACATTACCC CACAAATATTAGATCAGTTTTTAAGCTTGGTGAACTTGAACTGGGGGGCTTGGGATGGGAAAGAGACGAGACGAAATGCG ACTTTTATGGGGTCATGATGATACTCAACACGATAGTTGGATAATAGAGTGATCAGAAGTAGTTGTAATTCCTTGAATGG AGAATTTCCGACCAGGACACATTCGCATACCAAGTCCAAAAGGTCCAGACATTATAAACTTATTATAAGCTTCATTAAAA TTTTAAAGGGCTCGTAAGTGTCGAATGCGCATGAATTTCGTCTGCCTGCAATAAGAATATCAGGAATTCGATCTTCAAAC CTTCTCCTCCTAAGTCTTTCCAAAAAAATTCGGAGTAGTTAAACTACGAAAGTCCTAAGTTAAAGC LQW134525.y1 LQW134525.y1.phd.1 LQW134525.x1 10:52:16 2001 TEMPLATE: LQW134525 DIRECTION: rev Length = 608 Score = 83.1 bits (202), Expect = 3e-16 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = +2 Query: 1 NMKYLQACLRETQRMFPFVNSSPRRFRKDLVLSGYLIPAG 40 NMKYLQACLRETQRMFP VNSSPRRFRKDLVLSGYLIPAG Sbjct: 17 NMKYLQACLRETQRMFPXVNSSPRRFRKDLVLSGYLIPAG 136 >LQW134525.y1 >lcl|LQW134525.y1 CHROMAT_FILE: LQW134525.y1 PHD_FILE: LQW134525.y1.phd.1 CHEM: term DYE: ET TIME: Fri May 4 10:52:16 2001 TEMPLATE: LQW134525 DIRECTION: rev TTTTGCAGTTATGCACAACATGAAGTACTTACAAGCCTGTCTACGTGAAACACAACGTATGTTTCCATTNGTTAACTCGT CTCCAAGAAGATTTCGGAAAGATCTCGTCCTTTCAGGTTATCTTATACCGGCAGGTGAGATATGTTAAGATATCTGTGTT TTAATGTATATGTGTATAATAATGTACACCTCATGATCACTGCCAAGTTATAACATGGGTGTCTTCTTATACACCAGACA CACGGTGTATTTATACACCTTATGCTCACTGTGAAGTTATAACATGGGTGTCTTCTTATACACTAGGTACACTTGATGTA TTCATACACCTCATGCTCACTGTGAAGTCATAACATGGGTGTCTTTTTATACACCTCATGCTCACTGTGAAGTCATAACA TGGGTGTCTACTTATACACCAGAAACACGGTGTATTTATACACCTCATGCTCACTGTGAAGTTATAACATGGGTGTCTTC TTATACACTAGGCACACTTGATGTATTCATACACCTCATGCTCACTGTTTAGTGTTGATTATAACATAAGTGTCGTTTTA TACACCTTATGATCACTGTCGAGTTATAACATGGAAGTCTTCTTACAC >LQW134525.x1 >lcl|LQW134525.x1 CHROMAT_FILE: LQW134525.x1 PHD_FILE: LQW134525.x1.phd.1 CHEM: term DYE: ET TIME: Fri May 4 10:51:39 2001 TEMPLATE: LQW134525 DIRECTION: fwd TAACAGCTAATAAAAATACGGGTGTGTATGTCAAAATATTTTGCAGCATTCAGCAGATTGTTTTGATACAACATGTGTGT CTGATGTATAAGAAGACACCCATGTTATAACTCGAAAGTGAGCATGAGGTGTATGAATACACCATGTGTGTCTGGTGTAT AAGAAGATACCCATGTTATAACTCGAAAGTGAGCATGAGCTGTAGGAATACACCATGTGTGTCTGGTGTATAAGAAAACA CCCATGTTATAACGCGAAAGTGAGCCATATCATAAACAACAAACTAGTTACAAATAAACAACTTTTAATATACTTTTCAT TATTACAAATAAGTTACACCTTATTCAATATTTATACAATGCAGTGAAGCATCAAATTTATGCAAATAATATTGAATTAC CGATGTATATTTTAACGTACACCCCTCAATAAAAATAAAATTTACAGACAAAAACATAAATTTACAAAAAAAATATTGGA AATATTTTACTGGCGCAATTTTCCTACCATANGAAACTTCTACATTGGGCATTAATCAGTAAACNATTTAAAACCCAATA NNAGCTAAAT LQW134525.y01 LQW134525.y01.phd.1 LQW134525.x1 12:06:11 2001 TEMPLATE: LQW134525 DIRECTION: rev Length = 645 Score = 74.5 bits (180), Expect = 1e-13 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 5 LQACLRETQRMFPFVNSSPRRFRKDLVLSGYLIPAG 40 L ACLRETQRMFPFVNSSPRRFRKDLVLSGYLIPAG Sbjct: 10 LTACLRETQRMFPFVNSSPRRFRKDLVLSGYLIPAG 117 >LQW134525.y01 >lcl|LQW134525.y01 CHROMAT_FILE: LQW134525.y01 PHD_FILE: LQW134525.y01.phd.1 CHEM: term DYE: ET TIME: Fri May 4 12:06:11 2001 TEMPLATE: LQW134525 DIRECTION: rev CATGAAGTACTTACAGCCTGTCTACGTGAAACACAACGTATGTTTCCATTTGTTAACTCGTCTCCAAGAAGATTTCGGAA AGATCTCGTCCTTTCAGGTTATCTTATACCGGCAGGTGAGATATGTTAAGATATCTGTGTTTTAATGTATATGTGTATAA TAATGTACACCTCATGATCACTGCCAAGTTATAACATGGGTGTCTTCTTATACACCAGACACACGGTGTATTTATACACC TTATGCTCACTGTGAAGTTATAACATGGGTGTCTTCTTATACACTAGGTACACTTGATGTATTCATACACCTCATGCTCA CTGTGAAGTCATAACATGGGTGTCTTTTTATACACCTCATGCTCACTGTGAAGTCATAACATGGGTGTCTACTTATACAC CAGAAACACGGTGTATTTATACACCTCATGCTCACTGTGAAGTTATAACATGGGTGTCTTCTTATACACTAGGCACACTT GATGTATTCATACACCTCATGCTCACTGTTTAGTGTTGATTATAACATAAGTGTCGTTTTATACACCCTTATAGAATCAC TGTTCGAAGCTCTATAACCACTGGAAACGTCATTCCTTAACACGCCAGAACATACATAGTGTATTCATACACCTCATGCT CACTG >LQW59936.y1 >lcl|LQW59936.y1 CHROMAT_FILE: LQW59936.y1 PHD_FILE: LQW59936.y1.phd.1 CHEM: term DYE: ET TIME: Wed Apr 4 14:48:40 2001 TEMPLATE: LQW59936 DIRECTION: rev ACTCGACAGTGATCATAAGGTGTATAAAACGACACTTATGTATAATCAACACTAAACAGTGAGCATGAGGTGTATGAATA CATCAAGTGTGCCTAGTGTATAAGAAGACACCCATGTTATAACTTCACAGTGAGCATGAGGTGTATAAATACACCGTGTT TCTGGTGTATAAGTAGACACCCATGTTATGACTTCACAGTGAGCATGAGGTGTATAAAAAGACACCCATGTTATGACTTC ACAGTGAGCATGAGGTGTATGAATACATCAAGTGTACCTAGTGTATAAGAAGACACCCATGTTATAACTTCACAGTGAGC ATAAGGTGTATAAATACACCGTGTGTCTGGTGTATAAGAAGACACCCATGTTATAACTTGGCAGTGATCATGAGGTGTAC ATTATTATACACATATACATTAAAACACAGATATCTTAACATATCTCACCTGCCGGTATAAGATAACCTGAAAGGACGAG ATCTTTCCGAAATCTTCTTGGAGACGAGTTAACAAATGGAAACATACGTTGTGTTTCACGTAGACAGGCTTGTAAGTACT TCATGTTGTGCAATAACTGCAAAAAAATAAGTTCTAAGAATAAATGTAATAGATTAACCTTGTGTGG >LQW59936.x1 >lcl|LQW59936.x1 CHROMAT_FILE: LQW59936.x1 PHD_FILE: LQW59936.x1.phd.1 CHEM: term DYE: ET TIME: Wed Mar 21 14:54:37 2001 TEMPLATE: LQW59936 DIRECTION: fwd TAACTTTTCTATTTTAATTAAACATAGGAGTCACTGAAACGATGGTGTTCACGTCTTCGCCCCAGAACACAGAAATTATG TTTCGTAACGAGGAGAGATGCCCGTTTCGTGACCCGCTGGGTCCTGTAGCAAAAATACGAGATGAACGGAACGAGTACCA CGGCTTGACTAATTCTAATGGGGAAGATTGGTGGAGGGTAAGTAAACGAATAAGAGTGAATGAGTAAATGAATAAATAGG TAGATTATGGTAGCAGCGACGAGCCTAAAACACAAACCTCTGGGTTAGAAGTTATAAACCATTGCTAAACTACTCCCCAA CCACACCAGGTCCGCCAAATCGTGAATCAACACTTTCTCCAAAACACGGCGGTGTGGAAATACGCGGAAGCGCATAGGAA TGTGTCCAAAGATTTCTTAAAGTTTATTGACCGAAACATGGACGAAAAGAATGAGGTGATTTGGGTAAAATTAGATTACA TGCTTGTACTTCGTTAGAAAACTCGTTTTTTTTAACAAAATACGTTACATACACTCACAAAGTTATATATGTTGTAACTG TTAAGCAAGCACGAAGTGTATGAAACAAAACACCCGTGTTATAACGACTATGGTTGCCCCGCCAAGTGAGGATATTAAAC TATTTTTTAGTTCAGTTTACAAATTCCCGGCTTTTA VRQIVNQHFLQNTAVWKYAEAHRNVSKDFLKFIDRNMDEKNEV I-helix region seq 136 >LQW59936.x1_1 *LFYFN*T*ESLKRWCSRLRPRTQKLCFVTRRDARFVTRWVL*QKYEMNGTSTTA*LILM GKIGGG*VNE*E*MSK*INR*IMVAATSLKHKPLG*KL*TIAKLLPNHTRSAKS*INTFS KTRRCGNTRKRIGMCPKIS*SLLTETWTKRMR*FG*N*ITCLYFVRKLVFFNKIRYIHSQ SYICCNC*ASTKCMKQNTRVITTMVAPPSEDIKLFFSSVYKFPAFX >LQW59936.x1_2 NFSILIKHRSH*NDGVHVFAPEHRNYVS*RGEMPVS*PAGSCSKNTR*TERVPRLD*F*W GRLVEGK*TNKSE*VNE*IGRLW*QRRA*NTNLWVRSYKPLLNYSPTTPGPPNRESTLSP KHGGVEIRGSA*ECVQRFLKVY*PKHGRKE*GDLGKIRLHACTSLENSFFLTKYVTYTHK VIYVVTVKQARSV*NKTPVL*RLWLPRQVRILNYFLVQFTNSRLL >LQW59936.x1_3 TFLF*LNIGVTETMVFTSSPQNTEIMFRNEERCPFRDPLGPVAKIRDERNEYHGLTNSNG EDWWRVSKRIRVNE*MNK*VDYGSSDEPKTQTSGLEVINHC*TTPQPHQVRQIVNQHFLQ NTAVWKYAEAHRNVSKDFLKFIDRNMDEKNEVIWVKLDYMLVLR*KTRFF*QNTLHTLTK LYML*LLSKHEVYETKHPCYNDYGCPAK*GY*TIF*FSLQIPGF >sequence 20, 87 2 accessions 53% to 2U1 C-HELIX 44% TO 2F1 QALVMQGQIFSGRPNMPALTQVTDGLGLATIDYTDHWKTQRRFGQTTLR this matches seq 90 FGVGKRSMEDRIVEEVEYLNNAIRSHNGKPFDI matches seq 18 DLQLLQYVRDLFVAGTETTTSTLRWSILCLIHNPEKQEKLRKEIYKVTG (1?) looks like seq 2 but different joint QDRVPAMSDKAQMPYTCAFMQEVFRYRTLVPLSLFHATNDDVSLNGYRIPKGTT (0) VLPNLWAVHNDPDVWDEPSSKFKPERHLDEKGNFVQSKHVIPFSVGPRQCLGEQLARMEIFIFLV SMVQKFEFLPDPNEPNLPEIENGSCGTVFVPFRFKQIAKMK* LQW256489.x1 LQW272521.x1 LQW272521.y1 LQW222687.x1 GCiWno456_p09.g1 GCiWno687_n09.b1 GCiWno425_i01.g1 GCiWno855_l16.b1 GCiWno1021_j12.g1 GCiWno425_i01.g1 GCiWno687_n09.b1 GCiWno677_l07.b1 + >GCiWno856_c11.g1 CHROMAT_FILE: GCiWno856_c11.g1 PHD_FILE: GCiWno856_c11.g1.phd.1 CHEM: term DYE: big TIME: Mon Dec 10 10:49:04 2001 TEMPLATE: GCiWno856_c11 DIRECTION: rev Length = 875 Score = 104 bits (258), Expect = 1e-22 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 1 QALVMQGQIFSGRPNMPALTQVTDGLGLATIDYTDHWKTQRRFGQTTLR 49 QALVMQGQIFSGRPNMPALTQVTDGLGLATIDYTDHWKTQRRFGQTTLR Sbjct: 666 QALVMQGQIFSGRPNMPALTQVTDGLGLATIDYTDHWKTQRRFGQTTLR 520 >GCiWno856_c11.g1 TTCAGCTCGGACCCTTCTTTGTTTATACTACCAAATGGGACAAGAAATGGAATGAAAAGTTGCCCATTTTCACCCCACCC TCTATAATAGTCTAACTCTATATGTTGGAGGATTCCTATGTCATGTGTTGGAGGATTCCTATGAGGTGGCTTACCAGTAT GTCGAATGGTTTTCCGTTATGTGAACGAATAGCATTGTTCAAGTATTCGACTTCTTCCACAATGCGATCTTCCATGCTTC GCTTGCCAACACCAAACCTTATAAGTAAAGCAGGTAATATAGTGGGTGAGGAGAAAGGGCACAGTTTAACTATATTTTTT TGTCCCATTTGAAAGTAAACACATACTTCTTATGGACCGTCGTTAATTGTCCGGATATTTAGATAATATGTGATAAAGGT GTCACATCTTCCCCTCCCTGCTATATCACTTTATGTTTAATTTACCCAAATGTAACAATCTAAATCTTTATACGTCAATG AATTTGACAGTAATGACTGTACATCCGTTTGACTCACCCTCTCAGAGTAGTTTGCCCGAACCGACGTTGAGTTTTCCAAT GATCAGTATAGTCTATGGTAGCCAAACCAAGTCCATCTGTTACCTGGGTTAATGCCGGCATGTTTGGCCTTCCAGAGAAA ATTTGACCTTGCATCACTAATGCCTGTTGGAAGTAATTTCATTTGACGCTTATACACCAAGTTTATTTTATATAGTACCG TGGGGTAAGATGCGACACCTCACACCTGTANGACATAATATCCTAATATACGATCGATTTTTTAAAACATTAACACGGTC TATCGGAGTCGTGCGACTAAGGTTTACAATTCTTTAATGGTCCTTATTTACCACCAATGGGGCGGGAAATAAATG >GCiWno856_c11.g1_4 FISRPIGGK*GPLKNCKP*SHDSDRPC*CFKKSIVY*DIMSYRCEVSHLTPRYYIK*TWC ISVK*NYFQQALVMQGQIFSGRPNMPALTQVTDGLGLATIDYTDHWKTQRRFGQTTLRG* VKRMYSHYCQIH*RIKI*IVTFG*IKHKVI*QGGEDVTPLSHII*ISGQLTTVHKKYVFT FKWDKKI*LNCALSPHPLYYLLYL*GLVLASEAWKIALWKKSNT*TMLFVHITENHSTYW *ATS*ESSNT*HRNPPTYRVRLL*RVG*KWATFHSISCPIW*YKQRRVRAE >GCiWno856_c11.g1_5 IYFPPHWW*IRTIKEL*TLVARLR*TVLMF*KIDRILGYYVXQV*GVASYPTVLYKINLV YKRQMKLLPTGISDARSNFLWKAKHAGINPGNRWTWFGYHRLY*SLENSTSVRANYSERV SQTDVQSLLSNSLTYKDLDCYIWVN*T*SDIAGRGRCDTFITYYLNIRTINDGP*EVCVY FQMGQKNIVKLCPFSSPTILPALLIRFGVGKRSMEDRIVEEVEYLNNAIRSHNGKPFDIL VSHLIGILQHMT*ESSNI*S*TIIEGGVKMGNFSFHFLSHLVV*TKKGPS*X >GCiWno856_c11.g1_6 HLFPAPLVVNKDH*RIVNLSRTTPIDRVNVLKNRSYIRILCXTGVRCRILPHGTI*NKLG V*ASNEITSNRH**CKVKFSLEGQTCRH*PR*QMDLVWLP*TILIIGKLNVGSGKLL*EG ESNGCTVITVKFIDV*RFRLLHLGKLNIK*YSREGKM*HLYHILSKYPDN*RRSIRSMCL LSNGTKKYS*TVPFLLTHYITCFTYKVWCWQAKHGRSHCGRSRILEQCYSFT*RKTIRHT GKPPHRNPPTHDIGILQHIELDYYRGWGENGQLFIPFLVPFGSINKEGSELX >GCiWno677_l07.b1 exact match to I-helix region ATCTACAACTGTTGCAATATGTTCGGGATTTGTTTTTTTGCTGGGACAGAAACGACAACCAGTACACTAAGGTGGTCAAT CCTGTGTTTGATTCATAATCCGGAGAAGCAAGAAAAACTACGAAAGGAAATCTATAAAGTTATGGGTAAATTTTAAATCA AGGGGTATGTTGGTGTTCTAAATGATAAAGTTACTTTTAAATAGGCCAGGATAGGGTACCGGCGATGAGTGACAAAGCTC AGATGCCTTACACTTGCGCGTTCATGCAGGAAGTTTTTAGATACCGCACTCTGGTTCCCTTAAGCTTATTTCATGCAACA AATGATGATGTAAGCTTGAATGGATACCGTATCCCGAAAGGAACAACAGTAAGAATTGTATATATATGCTGTACTTAATA TAATGGTAGTAGGATGGGAAAGATGAGACACTTTTTGATTCTTTCGTCCCATTTGGTAGTAAACACAGCGGATCGTTTGA AGATTTTAATCCATATGCTCACGGCTCCCATAGACCGTTGTTAGTTGTTTAAAACACGATACAGATATTTTGATCTTACG TTCTAAAGATGTCCCATCTTACCCCACCCAACTAGATATACTATATTCGTATCATGTTACATTAGACCCAACTTAACCTT GGCCCGAACTTGTGGTTGGATATTTACTTATCCCTCCGTATTTATAAATCATATTATGGGAATCCAAGCGTGTCTTGCCT TTGGTTCTTCGTAAAGCCTATACGGATAAATTATTTAATAAATATCCCCGGGTTTACCTAACCTTATGGGCGGGCACAAA CCATCCTGGAGGTGGGGGAACAAACCCAGCAGGTATAACCTTGGCCGCCCTCTTCCATGAAAAGGGAAACTTTTGTCCCA CCTAAAACCCGGGAACCCTTTTTCGGGGGGGCCACCAACAAGGCTTGGAGGAAACAATATCTCTCAAGGGAAATTTTTAT TTTTTGGGGTTAAAG >GCiWno677_l07.b1_1 exact match to I-helix region IYNCCNMFGICFFAGTETTTSTLRWSILCLIHNPEKQEKLRKEIYKVMGKF*IKGYVGVL NDKVTFK*ARIGYRR*VTKLRCLTLARSCRKFLDTALWFP*AYFMQQMMM*A*MDTVSRK EQQ*ELYIYAVLNIMVVGWER*DTF*FFRPIW**TQRIV*RF*SICSRLP*TVVSCLKHD TDILILRSKDVPSYPTQLDILYSYHVTLDPT*PWPELVVGYLLIPPYL*IILWESKRVLP LVLRKAYTDKLFNKYPRVYLTLWAGTNHPGGGGTNPAGITLAALFHEKGNFCPT*NPGTL FRGGHQQGLEETISLKGNFYFLGLK >GCiWno677_l07.b1_2 exact match to I-helix region STTVAICSGFVFLLGQKRQPVH*GGQSCV*FIIRRSKKNYERKSIKLWVNFKSRGMLVF* MIKLLLNRPG*GTGDE*QSSDALHLRVHAGSF*IPHSGSLKLISCNK**CKLEWIPYPER NNSKNCIYMLYLI*W**DGKDETLFDSFVPFGSKHSGSFEDFNPYAHGSHRPLLVV*NTI QIF*SYVLKMSHLTPPN*IYYIRIMLH*TQLNLGPNLWLDIYLSLRIYKSYYGNPSVSCL WFFVKPIRINYLINIPGFT*PYGRAQTILEVGEQTQQV*PWPPSSMKRETFVPPKTREPF FGGATNKAWRKQYLSREIFIFWG* >GCiWno677_l07.b1_3 exact match to I-helix region LQLLQYVRDLFFCWDRNDNQYTKVVNPVFDS*SGEARKTTKGNL*SYG*ILNQGVCWCSK **SYF*IGQDRVPAMSDKAQMPYTCAFMQEVFRYRTLVPLSLFHATNDDVSLNGYRIPKG TTVRIVYICCT*YNGSRMGKMRHFLILSSHLVVNTADRLKILIHMLTAPIDRC*LFKTRY RYFDLTF*RCPILPHPTRYTIFVSCYIRPNLTLARTCGWIFTYPSVFINHIMGIQACLAF GSS*SLYG*II**I SPGLPNLMGGHKPSWRWGNKPSRYNLGRPLP*KGKLLSHLKPGNPF SGGPPTRLGGNNISQGKFLFFGVK >GCiWno944_b18.g1 CHROMAT_FILE: GCiWno944_b18.g1 PHD_FILE: GCiWno944_b18.g1.phd.1 CHEM: term DYE: big TIME: Tue Dec 25 10:02:56 2001 TEMPLATE: GCiWno944_b18 DIRECTION: rev Length = 909 Score = 179 bits (449), Expect(2) = 7e-62 Identities = 90/96 (93%), Positives = 90/96 (93%), Gaps = 3/96 (3%) Frame = -2 Query: 1 TTVRIVYICCT-YNGSRMGKMRHFLILSSHLVVNTADRLKILIHMLTAPIDRC-LFKTRY 58 TTVRIVYICCT YNGSRMGKMRHF ILSSHLVVNTADRLKI IHMLTAPIDRC LFKTRY Sbjct: 788 TTVRIVYICCT*YNGSRMGKMRHFXILSSHLVVNTADRLKIXIHMLTAPIDRC*LFKTRY 609 Query: 59 RYFDLTF-RCPILPHPTRYTIFVSCYIRPNLTLART 93 RYFDLTF RCPILPHPTRYTIFVSCYIRPNLT ART Sbjct: 608 RYFDLTF*RCPILPHPTRYTIFVSCYIRPNLTCART 501 Score = 79.6 bits (193), Expect(2) = 7e-62 Identities = 38/64 (59%), Positives = 41/64 (63%), Gaps = 5/64 (7%) Frame = -1 Query: 88 LTLARTCGWIFTYPSVFINHIMGIQACLAFXXXXX-----XXXXXXXPNLWAVHNNPDVW 142 L L + CG IFTYP VFINHIMGI+ACLA PNLWAVHN+PDVW Sbjct: 519 LNLCQNCGCIFTYPPVFINHIMGIKACLALFLVNAYRIN*LINIQVLPNLWAVHNDPDVW 340 Query: 143 DEPS 146 DEPS Sbjct: 339 DEPS 328 >GCiWno456_p09.g1 TCCTTTCGGGATACGGTATCCATTCAAGCTTACATCATCATTTGTTGCATGAAATAAGCTTAAGGGAACCAGAGTGCGGT ATCTAAAAACTTCCTGCATGAACGCGCAAGTGTAAGGCATCTGAGCTTTGTCACTCATCGCCGGTACCCTATCCTGGCCT ATTTAAAAGGAATTTTATTATTTAGAACACCAACATACCCCTTGATTTAGAAATTTACCCGTAACTTTATAGATTTCTTT TCGTAGTTTTTCTTGCTTCTCCGGATTATGAATCAAACACAGAATTGACCACCTTAGTGTACTGGTTGTCGTTTCTGTCC CAGCAACAAACAAATCCCGAACATATTGCAACAGTTGTAGATCCTAAAATAAAATTGAATCACCATGTATTCACCACAGA AAAAAAATAGAACGCGTATCTCCAATGTTGACAAAGGAGAGGGGCCATACACTCTCTCTCTTTCGCGGGTCGTTTCCGTT TACCATCGTAGTCAATGGAATCGATGGCGTTTTATGTAGTTTTTCTTCGTGTTTTGACTTAATTTTAAATCATAGGGTAA AACAACTATTTTCTAATATATATATATATTTTTTTAACAACCCGTATTTTGAAGGTTTTTAATTAAATTTATTTAATATT TAAATTTCCTAAACAATTAAGTGGTAAAGTGTAAGCGTTAACCTACCAAATAACTAAACTGGCCTAATAAACTTGAACAG TTGGGTGTAGTTNNTTAAAATAAACAGCTAAAACCTCTTAAAACTACCATGCGCCTATCTTTTACAATGGAGACCAAGCG AAATGGGAAACGGAGTGGCGGTCACGTGAATAGAANAAAGATATATCACGTTTTTTGGCAGTTGCGCGTNCTACTCTNTT TTATTTCTGGGGTNATCACTCATAAAAGGGTAAATGAATCGACAGAGAAT >GCiWno944_b18.g1 TTCGAGCTCGGTACCATTAGACCAATTAACACTTATAAANCATTTTTTGGTTAAATTATTAAATTACTTCATCTTTGCAA TTTGCTTAAACCGGAAAGGAACAAACACAGTACCACACGACCCATTTTCAATTTCTGGAAGGTTCGGTTCGTTCGGATCC GGAAGAAACTCAAATTTCTGAACCATTGAAACCAGGAAGATGAAGATTTCCATTCGAGCTAGTTGTTCTCCCAAGCACTG ACGTGGACCCACCGAGAAAGGTATCACGTGTTTAGACTGAACAAAGTTTCCCTTCTCATCGAGATGACGCTCAGGTTTAA ACTTGCTTGATGGTTCGTCCCACACATCAGGATCGTTGTGTACTGCCCATAGGTTAGGTAATACCTGTATATTTATTAAT TAATTTATCCTATAAGCATTAACGAGAAACAAAGCAAGACACGCTTTGATTCCCATAATATGATTTATAAATACGGGAGG ATAAGTAAATATACAACCACAGTTCTGGCACAAGTTAAGTTGGGTCTAATGTAACATGATACGAATATAGTATATCTAGT TGGGTGGGGTAAGATGGGACATCTTTAGAACGTAAGATCAAAATATCTGTATCGTGTTTTAAACAACTAACAACGGTCTA TGGGAGCCGTGAGCATATGGATTANAATCTTCAAACGATCCGCTGTGTTTACTACCAAATGGGACGANAGAATCNAAAAG TGTCTCATCTTTCCCATCCTACTACCATTATATTAAGTACAGCATATATATACAATTCTTACTGTTGTTCCTTTCGGGAT ACGGTATCCATTTCAGCTTACATCATCATTTGNTGCATGAAATAAGCTTAAGGGAACCCAGAGTGCGGTATCTAANAACT TCCTGCATGAACGCGGCAGTGTAAGGCAN >GCiWno944_b18.g1_4 XPYTAAFMQEVXRYRTLGSLKLISCXK**CKLKWIPYPERNNSKNCIYMLYLI*W**DGK DETLXDSXVPFGSKHSGSFEDXNPYAHGSHRPLLVV*NTIQIF*SYVLKMSHLTPPN*IY YIRIMLH*TQLNLCQNCGCIFTYPPVFINHIMGIKACLALFLVNAYRIN*LINIQVLPNL WAVHNDPDVWDEPSSKFKPERHLDEKGNFVQSKHVIPFSVGPRQCLGEQLARMEIFIFLV SMVQKFEFLPDPNEPNLPEIENGSCGTVFVPFRFKQIAKMK*FNNLTKKXFISVNWSNGT ELE >GCiWno944_b18.g1_5 ALHCRVHAGSX*IPHSGFP*AYFMXQMMM*AEMDTVSRKEQQ*ELYIYAVLNIMVVGWER *DTFXFXRPIW**TQRIV*RX*SICSRLP*TVVSCLKHDTDILILRSKDVPSYPTQLDIL YSYHVTLDPT*LVPELWLYIYLSSRIYKSYYGNQSVSCFVSR*CL*DKLINKYTGIT*PM GSTQRS*CVGRTIKQV*T*ASSR*EGKLCSV*TRDTFLGGSTSVLGRTTSSNGNLHLPGF NGSEI*VSSGSERTEPSRN*KWVVWYCVCSFPV*ANCKDEVI**FNQKMXYKC*LV*WYR ARX >GCiWno944_b18.g1_6 CLTLPRSCRKXLDTALWVPLSLFHAXNDDVS*NGYRIPKGTTVRIVYICCT*YNGSRMGK MRHFXILSSHLVVNTADRLKIXIHMLTAPIDRC*LFKTRYRYFDLTF*RCPILPHPTRYT IFVSCYIRPNLTCARTVVVYLLILPYL*IILWESKRVLLCFSLMLIG*IN**IYRYYLTY GQYTTILMCGTNHQASLNLSVISMRRETLFSLNT*YLSRWVHVSAWENN*LEWKSSSSWF QWFRNLSFFRIRTNRTFQKLKMGRVVLCLFLSGLSKLQR*SNLII*PKNXL*VLIGLMVP SSX >GCiWno456_p09.g1_4 ILCRFIYPFMSDXPRNKXE*XAQLPKNVIYLXSIHVTATPFPISLGLHCKR*AHGSFKRF *LFILXNYTQLFKFIRPV*LFGRLTLTLYHLIV*EI*ILNKFN*KPSKYGLLKKYIYILE NSCFTL*FKIKSKHEEKLHKTPSIPLTTMVNGNDPRKRESVWPLSFVNIGDTRSIFFLW* IHGDSILF*DLQLLQYVRDLFVAGTETTTSTLRWSILCLIHNPEKQEKLRKEIYKVTGKF LNQGVCWCSK**NSF*IG QDRVPAMSDKAQMPYTCAFMQEVFRYRTLVPLSLFHATNDDV SLNGYRIPKG >GCiWno456_p09.g1_5 SLSIHLPFYE*XPQK*XRVXRATAKKRDISXFYSRDRHSVSHFAWSPL*KIGAW*F*EVL AVYFXXLHPTVQVY*ASLVIW*VNAYTLPLNCLGNLNIK*I*LKTFKIRVVKKIYIYIRK *LFYPMI*N*VKTRRKTT*NAIDSIDYDGKRKRPAKERECMAPLLCQHWRYAFYFFSVVN TW*FNFILGSTTVAICSGFVCCWDRNDNQYTKVVNSVFDS*SGEARKTTKRNL*SYG*IS KSRGMLVF*IIKFLLNRPG*GTGDE*QSSDALHLRVHAGSF*IPHSGSLKLISCNK**CK LEWIPYPERX >GCiWno456_p09.g1_6 FSVDSFTLL*VXTPEIKXSXTRNCQKT*YIFXLFT*PPLRFPFRLVSIVKDRRMVVLRGF SCLF*XTTPNCSSLLGQFSYLVG*RLHFTT*LFRKFKY*INLIKNLQNTGC*KNIYIY*K IVVLPYDLKLSQNTKKNYIKRHRFH*LRW*TETTRERERVYGPSPLSTLEIRVLFFFCGE YMVIQFYFRIYNCCNMFGICLLLGQKRQPVH*GGQFCV*FIIRRSKKNYEKKSIKLRVNF *IKGYVGVLNNKIPFK*ARIGYRR*VTKLRCLTLARSCRKFLDTALWFP*AYFMQQMMM* A*MDTVSRKX >SEQUENCE 90 C-HELIX 53% TO 2C9 TDGLGLATIDYTDHWKTQRRFGQTTLR LQW171763.x1 >sequence 21 2 accessions 49% to 2R1 HQNIIGFFSDMFLAGTKTIT SQLRWGFLIMVKHQDCQNKVRREIDDVIGTVKLKHRKLKHRSIMPYTCAVVHELFRF RTVVPLSLPRMNVADVTVGGYRIPKGTN (0?) VIMNIWALHNDDCRWREPERFIPERHLNADGKFMKPKNVLPFGVGARSCIAEHLARNKIFLFLVSTLKNF TLSVPNGDSPSLDAGSNGTIFIPSDYNIVAQYRD* LQW66232.y2 LQW66232.y1 DEV42165.y1 EXXR LQW60791.y1 LQW80804.x1 GCiWno963_a08.g1 >GCiWno963_a08.g1 AAACTCATGTTCCATTATTCCTAAAAGCTGTATCAATAAAAAGAGTATTTTGTTTTCTTTTTATAAGGCTATATAAACAG ATAAACAATATTTATTATATCTACAAATAGTTTTAAGTATATTTATACAATTTGTATTTATTGTTTCCCCTTTTCTATTA ATTCCCTATTAATCCCTATACTGCGCTACTATGTTGTAATCACTTGGTATAAATATTGTACCGTTAGAACCCGCGTCCAA ACTGGGCGAGTCCCCGTTTGGAACAGAAAGAGTGAAATTCTTTAAAGTAGAAACAAGAAAAAGAAAAATCTTATTTCTTG CCAAATGCTCTGCGATACACGAGCGCGCCCCAACACCAAAGGGTAAAACATTTTTGGGTTTCATAAATTTTCCATCCGCG TTCAAATGTCTTTCAGGGATAAAACGCTCTGGCTCCCTCCACCGGCAGTCGTCATTATGCAAAGCCCAAATATTCATTAT GACCTGTGTAACGTGGTAACTGTTAAAAGCCCGCCTCGTGAGGACGAATGAGACATTTATATTTATAACCACTGCTTCAT ATAGTAAGGCGGAGAAAGATGGAACACCTTTTCATTACATTTTTTCGTTCTACTTTGTAGTAATTAAACAAAGAACATTC AAAGAAATATAAAACCCTATCCTGACGACTCAGATAGACCGTTGTTAATCGTTTANAACACAATCAGGATATCTGGACAT TGTGTACTANNAGTANTCCATGAACCACAGCGCANGTGTATGGCATTATTTGAACGGNGTTNTTACTTTACTGTACCATG GCGACCTGTAAGAAAGGGCAC >GCiWno46_h08.g1 CHROMAT_FILE: GCiWno46_h08.g1 PHD_FILE: GCiWno46_h08.g1.phd.1 CHEM: term DYE: big TIME: Sat Sep 1 11:38:31 2001 TEMPLATE: GCiWno46_h08 DIRECTION: rev Length = 885 Score = 101 bits (250), Expect = 1e-21 Identities = 47/49 (95%), Positives = 49/49 (99%) Frame = -1 Query: 1 QNIIGFFSDMFLAGTKTITSQLRWGFLIMVKHQDCQNKVRREIDDVIGK 49 QNIIGFFSDMFLAGT+TITSQLRWGFLIM+KHQDCQNKVRREIDDVIGK Sbjct: 486 QNIIGFFSDMFLAGTETITSQLRWGFLIMMKHQDCQNKVRREIDDVIGK 340 >GCiWno46_h08.g1 ATCATCCGTGGTAGACTAGAGGTCAACGGTTCTGAATCGAAATAGTTCATGAACCACAGCGCAGGTGTATGGCATTATTG AACGGTGTTTTAACTTTACTGTACCATGGCGACATGTAAGAAAGGGCAACAAAATATGGGGCGTTCGTGGGACAAAGGGT ATAAACTTCAGGTTTCTGTATAAAATGGATGAAGTTCTTCGGCGAGGCAGTCATAAAAGGAGACTTATATAGTTTAGGGC TTTAGGCTAATTTGGGCACATAATCTCTCAGTTTGTTCAATACCGTTGGTAAAATGTTAAAAATTATCGTAATTTAATTA AACACAAATAGCATTGTTACTTACCAATGACGTCATCAATCTCTCGTCTAACTTTGTTCTGACAATCTTGGTGTTTCATC ATAATTAGAAACCCCCATCGTAATTGTGACGTAATAGTTTCGGTTCCAGCCAAGAACATATCCGAGAAAAATCCAATGAT ATTCTGGTGGGGGTTAAATAGCGTTAATTCAACTAAATTATGCATATTTAGTGTGTCTTTTATAGCACATAGAGAATAAA TGGTTTCAAGGCTCGATGCTGCTATACCATTCAGGGTATGTGTCCTTGGGCAAGACATTTAACAGCAATTGCTCCAACCC AATGGTCATGCCCCGTTTGGTAGTAAATAAAGAATATTCAAATAATTGTTTAACTATATACCCTCATGACTCCTATAAAT TCAACCATATCCTTATGACTCCCATAGACAGTTGTTAATTGTTTAAAACACGATCANGCTATTTGAATATTATTGTTAAA AAGGGTTGTTCCATCTTNCCCCCACCTACTATATGTTATTATTTCAGTATCCTAATTGGGGGGGAGATGGNACACATTTT AACTN >GCiWno46_h08.g1_4 XLKCVPSPPQLGY*NNNI**VGXRWNNPF*Q*YSNSXIVF*TINNCLWES*GYG*IYRSH EGI*LNNYLNILYLLPNGA*PLGWSNCC*MSCPRTHTLNGIAASSLETIYSLCAIKDTLN MHNLVELTLFNPHQNIIGFFSDMFLAGTETITSQLRWGFLIMMKHQDCQNKVRREIDDVI GK*QCYLCLIKLR*FLTFYQRY*TN*EIMCPN*PKALNYISLLL*LPRRRTSSILYRNLK FIPFVPRTPHILLPFLTCRHGTVKLKHRSIMPYTCAVVHELFRFRTVDL*STTDD = seq 21 >GCiWno46_h08.g1_5 VKMCXISPPIRILK**HIVGGGKMEQPFLTIIFK*XDRVLNN*QLSMGVIRIWLNL*ES* GYIVKQLFEYSLFTTKRGMTIGLEQLLLNVLPKDTYPEWYSSIEP*NHLFSMCYKRHTKY A*FS*INAI*PPPEYHWIFLGYVLGWNRNYYVTITMGVSNYDETPRLSEQS*TRD**RHW *VTMLFVFN*ITIIFNILPTVLNKLRDYVPKLA*SPKLYKSPFMTASPKNFIHFIQKPEV YTLCPTNAPYFVALSYMSPWYSKVKTPFNNAIHLRCGS*TISIQNR*PLVYHG*X >GCiWno46_h08.g1_6 S*NVXHLPPN*DTEIITYSRWGXDGTTLFNNNIQIA*SCFKQLTTVYGSHKDMVEFIGVM RVYS*TII*IFFIYYQTGHDHWVGAIAVKCLAQGHIP*MV*QHRALKPFILYVL*KTH*I CII*LN*RYLTPTRISLDFSRICSWLEPKLLRHNYDGGF*L**NTKIVRTKLDERLMTSL VSNNAICV*LNYDNF*HFTNGIEQTERLCAQISLKP*TI*VSFYDCLAEELHPFYTET*S LYPLSHERPIFCCPFLHVAMVQ*S*NTVQ*CHTPALWFMNYFDSEPLTSSLPRMX >sequence 23, 76 3 accessions 53% to 2R1 a real seq different from 18 DLQLIQYVRDLYVAGTETTT GTLRWAVLCLVHHPEKQNKLRKEIFDVIGREKTPSMKDKAQM PYTCAFMQELFRFRTLAPLGVPHKISNDVQVQGWSIPKGTWLVCNLWAVHNDPDVWDEP SKFKPERHLDEKGNFVQSKYVMPFSVGPRHCLGEQLARMEIFIFLVSMVQKFEF LPDPNEPQLSEVQQGVSGFMCVPHPFKQIAKEV LQW269817.x1 DEV29825.x1 LQW193874.y1 cinc027f08 GCiWno590_k18.b1 = RTLAPLGVPHKISNDVQVQGWSIPKGTW not 18 GCiWno697_m22.g1 = RTLAPLGVPHKISNDVQVQGWSIPKGTW not 18 four sequences match 18 and do not match this seq GCiWno56_k09.g1 = VQSKYVMPFSVGPRHCLG and EFLPDPNEPQLSEVQQGVSGFMCVPHPFKQIAKEV cinc027f08 = VQSKYVMPFSVGPRHCLG and EFLPDPNEPQLSEVQQGVSGFMCVPHPFKQIAKEV rcinc027f08 = VQSKYVMPFSVGPRHCLG and EFLPDPNEPQLSEVQQGVSGFMCVPHPFKQIAKEV 4 seqs support the end of 18 so 18 and 23 are different seqs >cinc027f08 Length = 735 Score = 152 bits (379), Expect = 1e-36 Identities = 69/69 (100%), Positives = 69/69 (100%) Frame = +1 Query: 1 NLWAVHNDPDVWDEPSKFKPERHLDEKGNFVQSKYVMPFSVGPRHCLGEQLARMEIFIFL 60 NLWAVHNDPDVWDEPSKFKPERHLDEKGNFVQSKYVMPFSVGPRHCLGEQLARMEIFIFL Sbjct: 136 NLWAVHNDPDVWDEPSKFKPERHLDEKGNFVQSKYVMPFSVGPRHCLGEQLARMEIFIFL 315 Query: 61 VSMVQKFEF 69 VSMVQKFEF Sbjct: 316 VSMVQKFEF 342 >cinc027f08 GGGCCTTACACATGCGCATTCATGCAAGAATTGTTTCGTTTCCGCACGCTTGCACCTCTGGGTGTACCGCACAAGATCAG CAATGATGTTCAAGTAGAAGGGTGGTCCATTCCAAAGGGAACATGGCTTGTGTGTAACTTATGGGCGGTACACAACGATC CTGATGTGTGGGACGAACCAAGCAAGTTTAAACCTGAGCGTCACCTCGATGAGAAGGGAAACTTTGTTCAGTCTAAATAC GTGATGCCTTTCTCGGTGGGTCCACGTCATTGCTTGGGAGAACAACTAGCTCGAATGGAAATCTTCATCTTCCTAGTTTC AATGGTTCAGAAGTTTGAGTTTCTTCCGGATCCGAATGAACCACAGTTGTCCGAGGTTCAACAGGGCGTCTCAGGATTCA TGTGTGTACCCCATCCCTTTAAACAAATTGCCAAGGAAGTTTGAATTAACTAACAATCCACGTATAAATTACTATAACAT ATACATATGCTACAGTGTATATCATAGCAAGCAAACGAACAAATATAAGTGCGCTAAGTTATTGAGCTCGCATATCGGGG CCATATAAATTCTTTTTTTGCCCACAGTTGTTCTTTTTCTTTGCCATGATCGTTTTAATACTTAAATTCTTTACTCTCGC ATCTAGTTATTATAATCTGTTGACTGTATTTCAACCATAATGCCGCATATTTTATATAAGCATATAATTACGACCACTTT CATTTTTGATCGAAG GPYTCAFMQELFRFRTLAPLGVPHKISNDVQVEGWSIPKGTWLVCNLWAVHNDPDVWDEP SKFKPERHLDEKGNFVQSKYVMPFSVGPRHCLGEQLARMEIFIFLVSMVQKFEFLPDPNE PQLSEVQQGVSGFMCVPHPFKQIAKEV* >GCiWno56_k09.g1 CHROMAT_FILE: GCiWno56_k09.g1 PHD_FILE: GCiWno56_k09.g1.phd.1 CHEM: term DYE: big TIME: Sat Sep 1 13:07:24 2001 TEMPLATE: GCiWno56_k09 DIRECTION: rev Length = 889 Score = 148 bits (369), Expect = 1e-35 Identities = 68/69 (98%), Positives = 68/69 (98%) Frame = -2 Query: 1 NLWAVHNDPDVWDEPSKFKPERHLDEKGNFVQSKYVMPFSVGPRHCLGEQLARMEIFIFL 60 NLWAVHNDPDVWDEPSKFK ERHLDEKGNFVQSKYVMPFSVGPRHCLGEQLARMEIFIFL Sbjct: 645 NLWAVHNDPDVWDEPSKFKLERHLDEKGNFVQSKYVMPFSVGPRHCLGEQLARMEIFIFL 466 Query: 61 VSMVQKFEF 69 VSMVQKFEF Sbjct: 465 VSMVQKFEF 439 SEQUENCE 76, 23 91% TO LQW145909.y1 VERY LIKE SEQ 18 52% TO 2C9 274 LIQYVRDLYVAGTETTTGTLRWAVLCLVHHPEKQNKLRKEIFDVI (1?) REKTPSMKDKAQMPYTCAFMQELFRFRTLAPLGVPHKISNDVQVQGWSIPKGTW (0) LVCNLWAVHNDPDVWDEPSKFKPERHLDEKGNFVQSKYV MPFSVGPRHCLGEQLARMEIFIFLVSMVQKFEFLPDPNEPQLSEVQQGVSGFMCVPHPFKQIAKEV* LQW210348.x2 LQW210348.x3 I-HELIX LQW20757.y1 I-HELIX GCiWno590_k18.b1 >GCiWno590_k18.b1 ACGTATTTAGACTGAACAAAGTTTCCCTTCTCATCGAGGTGGCGCTCAGGTTTAAACTTGCTTGGTTCGTCCCACACATC AGGATCGTTGTGCACCGCCCATAAGTTACACACAAGCTGGAATAGACAAATAGTTGATTATATAAAATGATTTTTTTTAT TAAAGCATATCTTCTTACCCACGTTCCCTTTGGAATGGACCACCCTTGTACTTGAACATCATTGCTGATCTTGTGCGGTA CACCGAGAGGTGCAAGCGTGCGGAAACGAAACAATTCTTGCATGAATGCGCATGTGTAAGGCATTTGAGCTTTGTCCTTC ATGCTAGGTGTCTTTTCTCGGCCTAAAATAAATAAAATCTTTCTTTAGCTTACATTGTATTGAAGAATGACTACAAGTCT ATAGTGTAATTAAGCTGTGTTAACATACCGATTACATCAAAGATTTCCTTTCGTAGTTTGTTTTGTTTCTCCGGGTGATG AACTAAGCATAGCACAGCCCAACGCAACGTTCCTGTTGTTGTTTCAGTTCCAGCAACGTACAAGTCGCGTACGTATTGGA TCAACTGCAGATCCTACAACATGCAGTATATACGTGTAACATAATCTGTCGTGTACATATAGTCTTCCATATATACATAG TAGACTGGAGAAATCATATAGTGGGCTCTTTTAGATTGCGAANATGTGGTTAATTAATTATGCANATATTTTTTCTTTAC TACCAATTAGAAATAGGTCAACAAAACATGACGAANACATGTCATGTCACACCCCACCCATATTACTCCACCCTACTACA CAATGTTATGGGCTGAAATTAAAAGCACAGCGTNACCACCTTTACCGTAAAGGAACATCAGTTTCTTTTTTTTGTTCTCC ATAAAAGCATCGATAAGTCTCTAAGG >GCiWno590_k18.b1_4 P*RLIDAFMENKKKKLMFLYGKGGXAVLLISAHNIV**GGVIWVGCDMTCXRHVLLTYF* LVVKKKYXHN*LTTXSQSKRAHYMISPVYYVYMEDYMYTTDYVTRIYCML*DLQLIQYVR DLYVAGTETTTGTLRWAVLCLVHHPEKQNKLRKEIFDVIGMLTQLNYTIDL*SFFNTM*A KERFYLF*AEKRHLA*RTKLKCLTHAHSCKNCFVSARLHLSVYRTRSAMMFKYKGGPFQR ERG*EDML**KKSFYIINYLSIPACV*LMGGAQRS*CVGRTKQV*T*APPR*EGKLCSV* IR >GCiWno590_k18.b1_5 LETYRCFYGEQKKETDVPLR*RWXRCAFNFSP*HCVVGWSNMGGV*HDMXSSCFVDLFLI GSKEKIXA*LINHXFAI*KSPLYDFSSLLCIYGRLYVHDRLCYTYILHVVGSAVDPIRTR LVRCWN*NNNRNVALGCAMLSSSPGETKQTTKGNL*CNRYVNTA*LHYRLVVILQYNVS* RKILFILGREKTPSMKDKAQMPYTCAFMQELFRFRTLAPLGVPHKISNDVQVQGWSIPKG TWVRRYALIKKIILYNQLFVYSSLCVTYGRCTTILMCGTNQASLNLSATSMRRETLFSLN TX >GCiWno590_k18.b1_6 LRDLSMLLWRTKKRN*CSFTVKVVTLCF*FQPITLCSRVE*YGWGVT*HVFVMFC*PISN W**RKNXCIIN*PHXRNLKEPTI*FLQSTMYIWKTICTRQIMLHVYTACCRICS*SNTYA TCTLLELKQQQERCVGLCYA*FITRRNKTNYERKSLM*SVC*HSLITL*TCSHSSIQCKL KKDFIYFRPRKDT*HEGQSSNALHMRIHARIVSFPHACTSRCTAQDQQ*CSSTRVVHSKG NVGKKICFNKKNHFI*STICLFQLVCNLWAVHNDPDVWDEPSKFKPERHLDEKGNFVQSK YV SEQUENCE 25, 35, 93, 89 RYG TO MID 332% TO 1A1 39% to seq 49, 67 37% to 1B1 fugu 35% to 1B1 human 37% to 1A1 human MDSLVFVLVDTVLVMKYQILLLLVIVYAIKLLAASQSRRLNIPGPYPWPVIGNVIEMGGQPQFSLTNMAK (?) RYGPVYLMKLGTADVLVLNNYEVIKEALLRQRRIFGGRPIFDSFKKISQGLGVVFNSTMT QGDEWMKLKMTIVKHVHRFVSSEETKGYVAHHVQMEAVELVRILTEKCRS SPNEVIFPIEQINLAIANVVCAIMFGHRYQHGNK (0) EFQDLISLNEQFGDVIGSGSQVDVIPWMK (0) IFPKFRNALKVFDFLTNRLNNWMRLR (2) TKEHRLTYKHGVIRDIVDSFIAESIDHPEQSALNDDVIMALTTDVFGA GQDTMSTTMQWVFVYMMHFKECQRK IHAELDSVIGPGELPHISDRRRLPYLEAVMHEIFRHSTFTSTTIPHVTTQDTVLDGHFIP KGILVFINQFGANHDPNHWVDPDKFIPERFLDGKGNLISRPHDRYLLFSTGARKCPG DELSRMLILHFMATMFALCEVSSDPQKPATL DAVYNLSMRPKELRTIVRSNKLAVPETIQSLTCPE DEV48420.y1 DEV9534.x1 DEV9534.y1 MID REGION 220-247 57% TO 1B1 LQW103187.y1 DEV58814.y1 DEV58814.x2 DEV58814.x1 LQW187619.y1 DEV8890.x1 GCiWno954_j01.g1 GCiWno491_d01.g1 GCiWno510_e17.g1 GCiWno955_i14.g1 DEV37717.y1 DEV37717.y2 DEV31193.y1 LQW250443.x1 GCiWno164_d18.b1 >scf/ciona01/G126/seq_dir/hrs/G126P64121R.T0/G126P64121RE4.T0.seq 742 file 2 742 ABI Length = 742 Minus Strand HSPs: 76% match to seq 89 next best 35% to seq 49 so this is the ortholog of seq 89 Score = 147 (51.7 bits), Expect = 4.7e-10, P = 4.7e-10 Identities = 26/34 (76%), Positives = 30/34 (88%), Frame = -1 Query: 1 SPNEVIFPIEQINLAIANVVCAIMFGHRYQHGNK 34 S N+ I P+E INLA+ANVVC+IMFGHRYQHGNK Sbjct: 505 STNQAIEPVENINLAVANVVCSIMFGHRYQHGNK 404 >scf/ciona01/G126/seq_dir/hrs/G126P66860F.T0/G126P66860FG1.T0.seq file 2 729 ABI Length = 729 Minus Strand HSPs: 79% to seq 25 (subtract off intron region) = ortholog of seq 25 Score = 139 (48.9 bits), Expect = 3.8e-09, P = 3.8e-09 Identities = 24/33 (72%), Positives = 30/33 (90%), Frame = -1 Query: 31 HGNKEFQDLISLNEQFGDVIGSGSQVDVIPWMK 63 H +EFQDLISLNEQFG V+G+GSQ+DV+PW+K Sbjct: 576 HVTQEFQDLISLNEQFGQVVGAGSQIDVMPWIK 478 STNQAIEPVENINLAVANVVCSIMFGHRYQHGNK EFQDLISLNEQFGQVVGAGSQIDVMPWIK >scf/ciona01/G126/seq_dir/hrs/G126P64874R.T0/G126P64874RE5.T0.seq 995 0 995 ABI Length = 995 Plus Strand HSPs: Score = 167 (58.8 bits), Expect = 5.8e-12, P = 5.8e-12 Identities = 32/33 (96%), Positives = 32/33 (96%), Frame = +3 Query: 1 STNQAIEPVENINLAVANVVCSIMFGHRYQHGN 33 STNQAIEPVENINLAVANVVCSIM GHRYQHGN Sbjct: 696 STNQAIEPVENINLAVANVVCSIMXGHRYQHGN 794 >scf/ciona01/G126/seq_dir/hrs/G126P64874R.T0/G126P64874RE5.T0.seq_1 995 0 995 ABI SEPELMWWTVNFFGLILFILQSMLV**FLAINIEMDILTAAITTICSFKIEITIVLTIVY AVKWFMALHKDRPKIPGPYPWPVIGNVVEMGSQPQISLTNMAKK*VQVTR*RPLQELITD FAGTVLFILSSSGPLTC*SSIIMT**KKH*YVNEGCSPAARYLSRSRRSRKVAALCSTAA *RKGRRGNV*R*RS*SIFIDSSRPHKPRASWLVTCKKKPFNWCTFYPKNAEALRTKRLSP LKISILQSQTLYARSCXDIDTNMGIXVXXDFKYIDIRSACTPAYVVVECAA*QMLHCIPS YTIPSHYTDVTDAMLINPRSEVSI*PRRVACX >scf/ciona01/G126/seq_dir/hrs/G126P64874R.T0/G126P64874RE5.T0.seq_2 995 0 995 ABI LNLSSCGGL*ISSV*FSLFYRAC*YNNF*RSTSKWISSQPP*LRYALSK*KSLLSLRSCT P*SGLWRYIKTDQRSRVHIHGQ*SGMWWRWDRNRRFHSPTWQRSKCR*RVNDHCRN*SLI SQVRSYLSYQARDR*RADPQ*L*RNKRSINTSTRGVLRPPGI*VVQEDLARSRHCVQQQL DARGGVATYEDDDREASSSIHRVPTNQGLRGWSRAKRNRSTGAHFIRKMPKLYEPSD*AR *KYQSCSRKRCMLDHVRTSIPTWE*X*XXILNILIYVLLVRPRMW*SSVLHSKCCIVFLP IRFPVIIPMSLMPC*SILDRKFQFDPGELHVX >scf/ciona01/G126/seq_dir/hrs/G126P64874R.T0/G126P64874RE5.T0.seq_3 995 0 995 ABI *T*AHVVDCEFLRSNSLYFTEHASIIISSDQHRNGYPHSRHNYDMLFQNRNHYCPYDRVR REVVYGVT*RPTKDPGSISMASDRECGGDGIATADFTHQHGKEVSAGDALTTTAGINH*F RRYGPIYLIKLGTADVLILNNYDVIKEALIRQRGVFSGRPVFESFKKISQGRGIVFNSSL TQGAAWQRMKMTIVKHLHRFIASPQTKGFVAGHVQKETVQLVHILSEKCRSSTNQAIEPV ENINLAVANVVCSIMXGHRYQHGNXGNX*F*IY*YTFCLYARVCGSRVCCIANVALYSFL YDSQSLYRCH*CHVDQSSIGSFNLTQASCML >scf/ciona01/G126/seq_dir/hrs/G126P69591F.T0/G126P69591FE11.T0.seq 732 0 732 ABI Length = 732 Plus Strand HSPs: Score = 175 (61.6 bits), Expect = 3.7e-13, P = 3.7e-13 Identities = 33/33 (100%), Positives = 33/33 (100%), Frame = +1 Query: 2 TNQAIEPVENINLAVANVVCSIMFGHRYQHGNK 34 TNQAIEPVENINLAVANVVCSIMFGHRYQHGNK Sbjct: 109 TNQAIEPVENINLAVANVVCSIMFGHRYQHGNK 207 >scf/ciona01/G126/seq_dir/hrs/G126P69591F.T0/G126P69591FE11.T0.seq_1 732 file 9 ANWVYDXRSGVEKLPPGTCKRNRSTGAHFIRKMPKLTNQAIEPVENINLAVANVVCSIMF GHRYQHGNKVILIFKYIDIRSACYAGVCGSRVCCIANVALYSFLYDSQS*YRCH*CNVDQ SRIGGFNLTQAEFACRVSVFLCSLPT*SLAV*K*PSQFTHCAIIRGGYMPGASI*STLQS LFVCSGYC*VIETSRSAEKNQISIFVEFSLKSRFDSLHANFXELFQFAL*VDRRSPFADK LRRI >scf/ciona01/G126/seq_dir/hrs/G126P69591F.T0/G126P69591FE11.T0.seq_2 732 0 732 ABI QTGXTXIVRGWKNSRLVRAKETVQLVHILSEKCRSLRTKRLSPLKISILQSQTLYARSCS DIDTNMGIR*F*FLNILIYVLLVTPAYVVVECAA*QMLHCIPSYTIPSHNTDVTDAMLIN LESEVSI*PKPSSHVACLFSYARYQPNPSRYENDPHNSRTARLYAVDICRGLRSNRRCSL CLFVRDIVRSLRHRGRRRKIKFLFLSNSRSNRVLTVCTQTXSSCFNLRCELIAEVRLPTN FAG >scf/ciona01/G126/seq_dir/hrs/G126P69591F.T0/G126P69591FE11.T0.seq_3 732 0 732 ABI KLGXRXSFGGGKTPAWYVQKKPFNWCTFYPKNAEAYEPSD*AR*KYQSCSRKRCMLDHVR TSIPTWE*GNFDF*IY*YTFCLLRRRMW*SSVLHSKCCIVFLLIRFPVIIPMSLMQC*SI SNRRFQFDPSRVRMSRVCFPMLATNLIPRGMKMTLTIHALRDYTRWIYAGGFDLIDAAVF VCLFGILLGH*DIEVGGEKSNFYFCRILAQIAF*QFARKLXRAVSICAVS*SQKSVCRQT SQD >scf/ciona01/G126/seq_dir/hrs/G126P603918R.T0/G126P603918RC9.T0.seq file 15 0 734 ABI Length = 734 Minus Strand HSPs: Score = 159 (56.0 bits), Expect = 1.9e-11, P = 1.9e-11 Identities = 32/50 (64%), Positives = 36/50 (72%), Frame = -3 Query: 14 LAVANVVCSIMFGHRYQHGNKEFQDLISLNEQFGQVVGAGSQIDVMPWIK 63 L ++ S + H +EFQDLISLNEQFGQVVGAGSQIDVMPWIK Sbjct: 216 LGAGRIISSQLLYSNKCHVTQEFQDLISLNEQFGQVVGAGSQIDVMPWIK 67 >scf/ciona01/G126/seq_dir/hrs/G126P603918R.T0/G126P603918RC9.T0.seq_4 734 0 734 ABI ARLGPLAYLLFTYQLVGNTPPQVPKXYTLLVDYTPRXECPTRSVLQVIRNFPCSFAEPFF SNR*FRSLYLSRIAINHVIKTNLQISYEVNIDSID*RFAHFIDKLCIRFVIIFRLEANRN IIY*DVIISGP*NDELVSSVRGENNRFKLSVRRRTIGADVTSVKLASHAIGELGAGRIIS SQLLYSNKCHVTQEFQDLISLNEQFGQVVGAGSQIDVMPWIKVRMTSQTGVSE*XTTWSF SVQV >scf/ciona01/G126/seq_dir/hrs/G126P603918R.T0/G126P603918RC9.T0.seq_5 734 0 734 ABI GTAWTAGVSLVYVSACGEYPSPSTKXIHAVSGLYTAXRMSNAIGSASHSEFSL*FRRTIL FKPLISIIILIAYRYKPRDQNKSSNQL*GQY*QH*LTLCTFH**VVYSFRHNFSIRSESQ HNLLRCHNIRAVK*RTRFVGSRRK*SLQIISSAADDRG*RHIR*AGFARYR*TRRRSYYF VTITLL**VSRHTGVPGPDQFERTIRSSGWCR*PNRRYAVDQGAYDVTNRC**MXHNMEF QCPSX >scf/ciona01/G126/seq_dir/hrs/G126P603918R.T0/G126P603918RC9.T0.seq_6 734 0 734 ABI RHGLDRWRISCLRISLWGIPLPKYQNXTRC*WIIHRXSNVQRDRFCKSFGIFPVVSQNHS FQTANFDHYTYRVSL*TT*SKQIFKSVMRSILTALIDALHISLISCVFVSS*FFD*KRIA T*FTEMS*YPGRKMTNSFRRFAAKIIASNYQFGGGRSGLTSHPLSWLRTLSVNSAQVVLF RHNYSTLISVTSHRSSRT*SV*TNNSVKWLVQVAKSTLCRGSRCV*RHKQVLVNXPQHGV SVSKX >scf/ciona01/G126/seq_dir/hrs/G126P606937R.T0/G126P606937RD6.T0.seq 723 0 723 ABI Length = 723 Minus Strand HSPs: this clone bridges the gap Score = 276 (97.2 bits), Expect = 5.4e-26, Sum P(2) = 5.4e-26 Identities = 57/63 (90%), Positives = 57/63 (90%), Frame = -1 Query: 2 LFV-RDIVRSLRHRGRRRKIKFLFLSNSRSNRVLTVCTQTXSSCFNLRCELIAEVRLPTN 60 LFV RDIVRSLRHRGRRRKIKFLFLSNSRSNRV T CTQT SSCFNLRCELIAEV PTN Sbjct: 705 LFVVRDIVRSLRHRGRRRKIKFLFLSNSRSNRVSTFCTQTFSSCFNLRCELIAEVGWPTN 526 Query: 61 FAG 63 FAG Sbjct: 525 FAG 517 Score = 35 (12.3 bits), Expect = 5.4e-26, Sum P(2) = 5.4e-26 Identities = 6/6 (100%), Positives = 6/6 (100%), Frame = -3 Query: 64 ECPTRS 69 ECPTRS Sbjct: 52 ECPTRS 35 >scf/ciona01/G126/seq_dir/hrs/G126P607974F.T0/G126P607974FF7.T0.seq 735 0 735 ABI Length = 735 Plus Strand HSPs: Score = 124 (43.7 bits), Expect = 1.4e-17, Sum P(2) = 1.4e-17 Identities = 22/22 (100%), Positives = 22/22 (100%), Frame = +2 Query: 6 SSCFNLRCELIAEVGWPTNFAG 27 SSCFNLRCELIAEVGWPTNFAG Sbjct: 38 SSCFNLRCELIAEVGWPTNFAG 103 Score = 113 (39.8 bits), Expect = 1.4e-17, Sum P(2) = 1.4e-17 Identities = 21/21 (100%), Positives = 21/21 (100%), Frame = +2 Query: 30 PTRSVLQVIRNFPCSFAEPFF 50 PTRSVLQVIRNFPCSFAEPFF Sbjct: 572 PTRSVLQVIRNFPCSFAEPFF 634 GCiWno839_n06.b1 exon 2 GCiWno135_g10.b1 exon 2 GCiWno151_k07.b1 exon 2 GCiWno527_f10.b1 exon 2 GCiWno39_n10.b1 exon 2 GCiWno240_b21.g1 exon 2 GCiWno865_b24.g1 exon 2 f_GECi27_c13 exon 2 GCiWno1029_e23.g1 exon 2 GCiWno760_g24.b1 exon 3 GCiWno302_d05.b1 exon 3 GCiWno42_i03.b1 exon 3 GCiWno106_e02.b1 exon 3 GCiWno426_l10.b1 exon 3 GCiWno510_b17.b1 exon 3 GCiWno307_h23.b1 exon 3 GCiWno954_j01.g1 last of seq GCiWno491_d01.g1 last of seq GCiWno510_e17.g1 last of seq GCiWno955_i14.g1 last of seq >GCiWno527_f10.b1 CHROMAT_FILE: GCiWno527_f10.b1 PHD_FILE: GCiWno527_f10.b1.phd.1 CHEM: term DYE: big TIME: Wed Oct 17 12:16:19 2001 TEMPLATE: GCiWno527_f10 DIRECTION: fwd Length = 864 Score = 73.4 bits (177), Expect = 5e-13 Identities = 33/34 (97%), Positives = 34/34 (99%) Frame = +2 Query: 1 SPNKVIFPIEQINLAIANVVCAIMFGHRYQHGNK 34 SPN+VIFPIEQINLAIANVVCAIMFGHRYQHGNK Sbjct: 98 SPNEVIFPIEQINLAIANVVCAIMFGHRYQHGNK 199 >GCiWno527_f10.b1_1 FCIL*RNERICCTPCTNGSRGTRSDPYRKVPKFPERSDFSNRADQLGHCERRVCNHVWAS IPTRKQGTAYSL*NINDLMWSDWAV*NQY*RLR*AQV**VTCYRQILRDRKYNTDFKLLT QVETYSRFDKNQKH*LKNRCS*KDKFG**HSY*NTLPFS*F*IKSRNRMLPPVLEITRPL NSGLYAPLIAPQFQTLTPSSSWCRVCIRSFRPNPSRYENDPRVLRHRRLVADDSKASPAA PMQSLRRALVXFVCEGIVRPXSSVVANRGSIFGSFRTNRVREGSCSHA >GCiWno527_f10.b1_2 FVSSEETKGYVAHHVQMEAVELVRILTEKCRSSPNEVIFPIEQINLAIANVVCAIMFGHR YQHGNKVQLTACKT*MI*CGLTGLCKTNIDAFDKRRYSRLPVTGRYSEIGSIILILSF*L KLRPIRVSIKTKSTD*KIGVVKKTNLGNNIHTKIRCPFPNFKLSRGIECCRLCWRSRDP* IPVCMHHLLHLNFKR*PHRVRGVVSAFEVFALIPRGMKMTPASFVTDD*LRMTRKLRRRL RCNRSGERSXCLFVRVLLGHXAPWSPIVVLFLAVFAQIAFARAAVRT >GCiWno527_f10.b1_3 LYPLKKRKDMLHTMYKWKPWNSFGSLPKSAEVPRTK*FFQSSRSTWPLRTSCVQSCLGID TNTETRYSLQLVKHK*FNVV*LGCVKPILTPSISAGIVGYLLPADTPR*EV*Y*F*AFNS S*DLFAFR*KPKALTKK*V*LKRQIWVITFILKYAALFLILN*VAE*NVAACAGDHATPK FRSVCTTYCTSISNVDPIEFVVSCLHSKFSP*SLAV*K*PPRPSSQTISCG*LESFAGGS DAIAPASARXVCL*GYC*AIXLRGRQSWFYFWQFSHKSRSRGQLFAR >GCiWno518_p11.g1_1 walk 1 CRLCWRSRDP*IPVCMHHLLHLNFKR*PHRVRGVVSAFEVFALIPRGMKMTPASFVTDD* LRMTRKLRRRLRCNRSGERSFCLFVRVLLGHKSSVVSQSWFYFWQVFAQIAFATASCSHA FVRINANKMVAISSTLEY*AIDQNNSS*FACDQYTCSNATDPQEVTFFG*QHSIFPHVTH CCYKTQNTIFFTCTKHPRSQTLVVDSFALS*PLGCFWNLKPHTKTVKAN*SSPKPIHPSG KREQTRLCSKPIVICR*VKS**AFITAA*SLTTAFIPIVVY*FIPAYNKRSRL*RIVKI >GCiWno518_p11.g1_2 AACAGDHATPKFRSVCTTYCTSISNVDPIEFVVSCLHSKFSP*SLAV*K*PPRPSSQTIS CG*LESFAGGSDAIAPASARFVCL*GYC*AIKAPWSANRGSIFGKFSHKSRSRRQAVRTH L*ELMRTKWSQSRPRSNTKPSIKTIQVDLHVINIHALMQLTHRRLLFSVNSIAYSPTSRT AVTKPKTRSFLPAQNTPDHRL*LLIHLH*VSH*GAFGI*NHIQKR*KLIEVVPNPFTRVA NESRHDYAPSQSLYVVK*NRDELLSPQPSR*LPHSFP*WFTDLYQHIINALACNES*R >GCiWno518_p11.g1_3 PPVLEITRPLNSGLYAPLIAPQFQTLTPSSSWCRVCIRSFRPNPSRYENDPRVLRHRRLV ADDSKASPAAPMQSLRRALVLFVCEGIVRP*KLRGQPIVVLFLASFRTNRVRDGKLFARI CKN*CEQNGRNLVHARILSHRSKQFKLICM*SIYML*CN*PTGGYFFRLTA*HIPPRHAL LLQNPKHDLFYLHKTPQITDFSC*FICTKLAIRVLLEFKTTYKNGES*LK*SQTHSPEWQ TRADTIMLQANRYMSLSEIVMSFYHRSLVVDYRIHSHSGLLIYTSI**TLSPVTNRED GCiWno518_p11.g1 GCiWno527_f10.g1 GCiWno813_n15.g1 GCiWno155_l18.b1 >GCiWno813_n15.g1_4 QTDSCDDSKASPAAPMQSLRRALVLLFGEGIVRP*KLRGSANRGSIFGKFRTNRVRDGKL FARICKN*CEQNGRNLVHARILSHRSKQFKLICM*SIYML*CN*PTGGYFFRLTA*HIPP RHALLLQNPKHDLFYLHKTPQITDFSC*FICTKLAIRVLLESKTT*KNGKS*LK*SQTHS PEWQTRADTIMLQANRYMSLSEIVMSFYHRSLVVDYRFHSHSGLLIYTSI**TLSPVTNR EDQSY*QHLGSSLC*TAVYGI*SFH*DPFLDLVI*TCFYTTL*LTPYGYRAE >GCiWno813_n15.g1_5 PDG*LR*LESFAGGSDAIAPASARFVVW*GYC*AIKAPWVSQSWFYFWQVSHKSRSRRQA VRTHL*ELMRTKWSQSRPRSNTKPSIKTIQVDLHVINIHALMQLTHRRLLFSVNSIAYSP TSRTAVTKPKTRSFLPAQNTPDHRL*LLIHLH*VSH*GAFGI*NHIKKR*KLIEVVPNPF TRVANESRHDYAPSQSLYVVK*NRDELLSPQPSR*LPISFP*WFTDLYQHIINALACNES *RSKLLTTSWFKPLLNCCLWHMILSLGPLSRSRNLNLLLYHIIAHAIWVPS*X >GCiWno813_n15.g1_6 RRIVAMTRKLRRRLRCNRSGERSFCCLVRVLLGHKSSVGQPIVVLFLASFAQIAFATASC SHAFVRINANKMVAISSTLEY*AIDQNNSS*FACDQYTCSNATDPQEVTFFG*QHSIFPH VTHCCYKTQNTIFFTCTKHPRSQTLVVDSFALS*PLGCFWNLKPHKKTVKAN*SSPKPIH PSGKREQTRLCSKPIVICR*VKS**AFITAA*SLTTDFIPIVVY*FIPAYNKRSRL*RIV KIKVINNILVQAFAKLLFMAYDPFIRTPF*IS*FEPAFIPHYSSRHMGTELX >LQW233975.x1_1 QKETAVQLIGPCKSWIYFVRNSLEICIIW*RNYDCGNFSFYVEF*FRLR*NIKYFVCLVK LVIN*SFLLSGTDLCI**NSELLTFWCSTIMKSSKKHCYVKDASLVADRYSIHLRKFLKV *GLSLTAQ*HRETNG*N*K*QL*SMFTVLYPLKKRKDMLHTMYKWKPWNSFGSLPKSAEV LRTK*FFQSSRSTWPLRTSCVQSCLGIDTNTETRYSL*NINDLXWPDWAV*NQY*RLR*A QI**VTCYRQILEIGSXY*FKX*LQ*DLSRSIEPRPDINWLSTTWYNSSKSALPFK*GKS AGETANRLQCHKAPVLSFLLPSRSSLLLASLPXXXXXX >LQW233975.x1_2 KRKRQCSL*VHVNRGYISCVILLRYA*SGDVTTTVGIFPFMLSFDSD*DKILSTLCVW*S LL*TNLFYFQVRTCVFDETRNC*RSGAQQL*SHQRSIVTSKTHLWWPTDIRFI*ENFSRS RGCL*QHNDTGRRMDETKNDNCKACSPFCIL*RNERICCTPCTNGSRGTRSDPYRKVPKF SEQSDFSNRADQLGHCERRVCNHVWASIPTRKQGTACKT*MIXCGLTGLCKTNIDAFDKR RYSRLPVTGRYSR*EVXTDLSXNSSETYRVR*NQGLI*IGCQPHGTTHLRARFHLNREKV QVKRQIGCNAIRHLCCRSSYPPGLPCF*PHFXXXXXXX >LQW233975.x1_3 KGNGSAAYRSM*IVDIFRA*FS*DMHNLVT*LRLWEFFLLC*VLIQIEIKY*VLCVFGKA CYKLIFFTFRYGPVYLMKLGTADVLVLNNYEVIKEALLRQRRIFGGRPIFDSFKKISQGL GVVFNSTMTQGDEWMKLKMTIVKHVHRFVSSEETKGYVAHHVQMEAVELVRILTEKCRSS PNKVIFPIEQINLAIANVVCAIMFGHRYQHGNKVQLVKHK*FXVA*LGCVKPILTPSISA DIVGYLLPADTRDRKYXLI*ALTPVRLIAFDRTKA*YKLVVNHMVQLI*ERASI*IGKKC R*NGKSVAMP*GTCVVVPPTLPVFPASSLTSXXXXXX >GCiWno106_e02.b1 CHROMAT_FILE: GCiWno106_e02.b1 PHD_FILE: GCiWno106_e02.b1.phd.1 CHEM: term DYE: big TIME: Wed Sep 5 07:41:21 2001 TEMPLATE: GCiWno106_e02 DIRECTION: fwd Length = 919 Score = 63.2 bits (151), Expect = 5e-10 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 EFQDLISLNEQFGDVIGSGSQVDVIPWMK 29 EFQDLISLNEQFGDVIGSGSQVDVIPWMK Sbjct: 502 EFQDLISLNEQFGDVIGSGSQVDVIPWMK 588 >GCiWno106_e02.b1_1 repeat seq all reads stop at IGS* cannot pass it IGS*TVCSKTTAQVMVIVCFQQNDGQSWA*LRPNPQ*FSRLNDVMCKI*LIVRQTLVFLV ISTFDQNPSIFASRETS*WPFTRHNIRGGKWANRLAARDENNRLKLSVRRRTKK*TSRPC STLAR*LVNSGRGYHGTKRVQIVF*LFTVHVKCLQHIIYFTPEFYFKEFQDLISLNEQFG DVIGSGSQVDVIPWMKVCMT*QT*NADHLRV*TR*VQNQVLIGSCNDVHSAHTSPSRDCL FLFLLSTLSYPSSSLYL*TESKREMGLFLTERLNG*QKNT*PVLXYV*RYSRDLXAIFLF IFSCYVX >GCiWno106_e02.b1_2 LGHRLFAVKRRHRSWS*SVSSKTTANHGLSCVQIHNDFQG*TM*CARFS*LSAKLWCFW* FQLLIKIPRFSPPVKHHNGHLHVTTSAEENGQTGSQLATKIIASNYQFEGGRKSKRHVRV RRSHANS*TQVGVTTERKESRSCFDCLPCM*SVCSISYILHLNFILRNFKT*SV*TNNLE MLLVPEARSTSYPG*RCV*RNKLKTLTTCEFELGEFRTKF*SGLVMTCILHILPQAATAF FFFFCPLSPTLLLRFTCRPRAKEKWGYF*LNA*TDDRRTRDRYSXTCNGIHGILXRFFYL FFHVT* >GCiWno106_e02.b1_3 WVIDCLQ*NDGTGHGHSLFPAKRRPIMGLAASKSTMIFKVERCDVQDLANCPPNFGVFGD FNF*SKSLDFRLP*NIIMAIYTSQHPRRKMGKPARSSRRK*SPQIISSKADEKVNVTSVF DARTLTRELRSGLPRNEKSPDRVLIVYRACEVFAAYHIFYT*ILF*GISRPDQFERTIWR CYWFRKPGRRHTLDEGVYDVTNLKR*PLASLNSVSSEPSSNRVL**RAFCTYFPKPRLPF SFSFVHSLLPFFFALLVDREQKRNGVIFN*TPKRMTEEHVTGTQXRVTVFTGSXRDFFIY FFMLR >GCiWno151_b22.b1_4 KWCYRVRSXFSYIRNISCGVIS*VRDHH*GQVV*FVWLEMLNDFFYPMSGHIILNWSQAW AFYFPVCTFLRTRGGGGSSSWQNLLFLCLRLEESETMCLLYSRERGKTHL*HLTHGTPLT HNIQIS*SCFKQLTTAYMEVVTKRFYNSLNVLRLLPIRTRK*NEKVTHLTPLYQF*NTRI HVFTSASGIMSRNIDFDKLSV*CRLISIKLLNSCCKKFSWLQKSMPWRI*EPKIIYIRTK KNKNYENKNQKNDIKQPCC*NHRFPHSTQCTGN*GQY*R*YYWKHSMTHDRAVVLLESSL *PE >GCiWno151_b22.b1_5 KMVLSSSILXQLY*KYFLWGH*LSQRPSLRPSRLVCLVGNVE*LLLPYEWTHYFKLVASM GVLFPGLYLFKNQRWRW*LVLAKSALPLFTLGRI*NDVSVI**RAREDTPLTFNTWDTFN T*YPNILIVF*TINNSVYGSRNETVL*FFECSSFITNSN*KIE*KGDPSYSTLSILKYQN TCVYFCKWDHVAQYRF*QVVRVMSAHFNQIVEFLLQKVFMVTKEHALAYIRTKNYIYKNQ KKQKLRK*KPKK*YKTTLLLKS*VSP*HTVHRKLGPVLAVILLETFYDA*SCSRFTGKQS MTRX >GCiWno151_b22.b1_6 NGAIEFDPXSVILEIFPVGSLVKSETITEAKSFSLFGWKC*MTSSTL*VDTLF*IGRKHG RFISRFVPF*EPEVEVVARLGKICSSFVYAWKNLKRCVCYIVESEGRHTFNI*HMGHL*H IISKYPDRVLNN*QQRIWKS*RNGFIIL*MFFVYYQFELENRMKR*PILLHSINFKIPEY MCLLLQVGSCRAISILTSCPCNVGSFQSNC*IPVAKSFHGYKRACLGVYKNQKLYI*EPK KTKITKIKTKKMI*NNLAVKIIGFPIAHSAQEIRASISGNIIGNIL*RMIVQSFYWKAVY DPX >GCiWno106_e02.b1_1 IGS*TVCSKTTAQVMVIVCFQQNDGQSWA*LRPNPQ*FSRLNDVMCKI*LIVRQTLVFLV ISTFDQNPSIFASRETS*WPFTRHNIRGGKWANRLAARDENNRLKLSVRRRTKK*TSRPC STLAR*LVNSGRGYHGTKRVQIVF*LFTVHVKCLQHIIYFTPEFYFKEFQDLISLNEQFG DVIGSGSQVDVIPWMKVCMT*QT*NADHLRV*TR*VQNQVLIGSCNDVHSAHTSPSRDCL FLFLLSTLSYPSSSLYL*TESKREMGLFLTERLNG*QKNT*PVLXYV*RYSRDLXAIFLF IFSCYVX >GCiWno106_e02.b1_2 LGHRLFAVKRRHRSWS*SVSSKTTANHGLSCVQIHNDFQG*TM*CARFS*LSAKLWCFW* FQLLIKIPRFSPPVKHHNGHLHVTTSAEENGQTGSQLATKIIASNYQFEGGRKSKRHVRV RRSHANS*TQVGVTTERKESRSCFDCLPCM*SVCSISYILHLNFILRNFKT*SV*TNNLE MLLVPEARSTSYPG*RCV*RNKLKTLTTCEFELGEFRTKF*SGLVMTCILHILPQAATAF FFFFCPLSPTLLLRFTCRPRAKEKWGYF*LNA*TDDRRTRDRYSXTCNGIHGILXRFFYL FFHVT* >GCiWno106_e02.b1_3 WVIDCLQ*NDGTGHGHSLFPAKRRPIMGLAASKSTMIFKVERCDVQDLANCPPNFGVFGD FNF*SKSLDFRLP*NIIMAIYTSQHPRRKMGKPARSSRRK*SPQIISSKADEKVNVTSVF DARTLTRELRSGLPRNEKSPDRVLIVYRACEVFAAYHIFYT*ILF*GISRPDQFERTIWR CYWFRKPGRRHTLDEGVYDVTNLKR*PLASLNSVSSEPSSNRVL**RAFCTYFPKPRLPF SFSFVHSLLPFFFALLVDREQKRNGVIFN*TPKRMTEEHVTGTQXRVTVFTGSXRDFFIY FFMLR Walk 1 >GCiWno307_h23.g1_1 PGDYEIIYL**ACVLCKQIVIVYVWFVCRVKITTLVGIPRDTDISQCSQSRI*RNKHANV QVTMNLLSALRHSKPIVRGKLG*WCQQPTRSKCIAKLV*WLRVRKLVNLATRANVIIGII QINASRLVCVVIMKSLSAANRYFACNNE*AVLSSSFVFLLTNT*TLYDLIHCIVT*EWPF QNS*NNFNIT*WIEQNNLFARYHVTHKRICDVRIRNDFQG*TR*CARFS*LSAKLWCFLV ISTFDQNPSIFASR*TS*WPFTRHNIRRRKMGKPARNSRRKLSPQIISSEGGPKSKX >GCiWno307_h23.g1_2 LVIMRLFTYNRRVYYVNKSLLFTYGLSVE*K*PRWWEFPAIPIYLSVRRVEYDVISMRMC KSQ*ICCLHCVTVNRLFVENSVNGVNNQHEANVSRNLSSGCECGSWSTLLLVRM*LSE*F RLTHHV*CVSS**NHCRLPIGILHVTTNKQFCLLVLFFY*RILKRYMISYIVLLRKSGLF KTAETTLTSRDGLNKIIYSHATT*LINGFVTSESVMIFKVERGDVQDLANCPPNFGVFW* FQLLIKIPRFSPPVEHHNGHLHVTTSGGGKWANRLATRDENYPLKLSVPKAGQKVN >GCiWno307_h23.g1_3 W*L*DYLPIIGVCIM*TNRYCLRMVCL*SENNHAGGNSPRYRYISVFAE*NMT**ACECA SHNEFVVCIASQ*TDCSWKTRLMVSTTNTKQMYRETCLVVASAEVGQPCYSCECNYRNNS D*RITFSVCRHNEITVGCQSVFCM*QRISSSVF*FCFFINEYLNVI*SHTLYCYVRVAFS KQLKQL*HHVMD*TK*FIRTLPRDS*TDL*RQNP**FSRLNAVMCKI*LIVRQTLVFFGD FNF*SKSLDFRLPLNIIMAIYTSQHPAEENGQTGSQLATKIIPSNYQFRRRAKK* Walk 2 >GCiWno302_d05.g1_1 WTSFTGNSYT*LAVLLLETAMIMTDRLFSRNSDLHLFATMIFLA*QCCTR*VK*R*SVFP EIVFCI*NSGK*LVRY*TVGIFQKKKSN*NRNTGHVIVDHG*CTKSTEFNDDR*CAWQHW RRTCGCELPVENEVVIVA***NIDGRIPSKCLLSR*IVKRFPFSTKQSQFILEIVFAAAW RL*DYLPIIGVCIM*TNRYCLRMVCL*SENNHAGGNSPRYRYISVFAE*NMT**ACECAS HNEFVVCIASQ*TDCSWKTRLMVSTTNMKRMYRETCLVVASAESCQPCYSYECNYRNNSD YASRLXWX >GCiWno302_d05.g1_2 GRRLLETAIHDWPSFYWKQL*S*LIAFFLETPTYTCSLQ*SFSRNNAARDRSSSVDQCFP KLYFVFKIPENDLYVIKQSEFSRKKNRIKIETLVT*SLTMVNVQSPLSSMMIDNALGNTG DEHAGANYLWRTKS*LWLNNKILTVEYLRSVYFPGKS*NDFHSRLSKASLFSKSYLRPPG DYEIIYL**ACVLCKQIVIVYVWFVCRVKITTLVGIPRDTDISQCSQSRI*RNKHANVQV TMNLLSALRHSKPIVRGKLG*WCQQPT*SECIAKLV*WLRVRKVVNLATRTNVIIXIIQI THHVXCG >GCiWno302_d05.g1_3 DVVYWKQLYMTGRPSTGNSYDHD*SPFF*KLRPTLVRYNDLSRVTMLHAIGQVALISVSR NCILYLKFRKMTCTLLNSRNFPEKKIELK*KHWSRDR*PWLMYKVH*VQ***IMRLATLA TNMRVRITCGERSRDCGLIIKY*RSNTFEVFTFPVNRETISILD*AKPVYSRNRICGRLE IMRLFTYNRRVYYVNKSLLFTYGLSVE*K*PRWWEFPAIPIYLSVRRVEYDVISMRMCKS Q*ICCLHCVTVNRLFVENSVNGVNNQHEANVSRNLSSGCECGKLSTLLLVRM*LSX*FRL RITFXV Walk 3 LQW215364.x3 LQW215364.x3.phd.1 LQW215364.y1 12:01:58 2001 TEMPLATE: LQW215364 DIRECTION: fwd Length = 982 Score = 39.1 bits (89), Expect = 0.005 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 1 KLYFVFKIPENDLYVIK 17 KLYFVFKIPENDLYVIK Sbjct: 61 KLYFVFKIPENDLYVIK 11 >LQW215364.x3_4 APPVLRVQGVCSLGRDCALFLIFVFPPFVSVILGSFMRFLVLLPFVGRFYTAVQPANRRL GIARSVDPL*IS*LDPLLYHIIAHAILVYPHN*VGHGKQYLEFV*SVDIICIQLTMFGIR NIFVYYFICFASCYRLALSVHAATVKQKIVPSLHFKVMIQRNSPNE*STATTTPRSHR*F TNQVSTHANQLETIARNPVANREVTINQSV*RFSRNKPCR*GRVMACILIPVVSRSRARF VQHFSSAVRVHLSRDLQRSSPTTGCYNYSTRWHSLEFVRPTLVRYNDLSRVTMLHAIGQV ALISVSRNCILYLKFRKMTCTLLKLHX >LQW215364.x3_5 CPTCAAGTRCLFSRSGLCPFSDLRFSPFCVGYPRVFYALFGFASIRR*VLHRGTACQPSF RHCPFSRPVVDLVVGPAFIPHYSSRHISVSP*LSGPW*TIFRIRLKR*HYLYPVDDVWN* KYLCILLYLFRFLLSISA*RARCNG*TKNRAVSAF*SDDSKKFSQRVIYRHHHTEVASMI Y*PSEHTCKPIGNNRTQSGRKS*SYN*SVSLAV*PQ*TLSLRPSNGVYPHTCGFPLACKI CTTFLVSCPSSFVT*STAILPNNGMLQLFNPMAFARVRPTYTCSLQ*SFSRNNAARDRSS SVDQCFPKLYFVFKIPENDLYVIKAALX >LQW215364.x3_6 PHLCCGYKVFVLSVGIVPFF*SSFFPLLCRLS*GLLCAFWFCFHS*VGFTPRYSLPTVV* ALPVQ*TRCRSRSWTRFYTTL*LTPY*CIPIIEWAMVNNI*NSFKALTLFVSS*RCLELE ISLYITLFVSLPVID*RLACTLQRLNKKSCRLCILK**FKEILPTSNLPPPPHRGRIDDL LTK*AHMQTNWKQSHAIRSQIVKLQLISQFSGLAAINLVVKAE*WRVSSYLWFPARVQDL YNISRQLSEFICHVIYSDPPQQRDVTIIQPDGIRSSSSDLHLFATMIFLA*QCCTR*VK* R*SVFPEIVFCI*NSGK*LVRY*SCTX >GCiWno164_d18.b1_1 SDLSLPARKTTARSAFYPNFRNAIKIFDFLTID*TIGCDSGKQSSPLFINIQLTIADFLL IDVEQRNTDSHTNMV*FATSSIALSQSQSTTRNNQHLMMT**WH*PRTCSGLDKTRCQLL CNGSLYI*CILKNASER*LLWYRMIIL*FSFNVYWVGIWRCTFLF*FIVLYR**LFTEL* KGVFIPFGFKQKRFIMYKKSNFTTSLQTALLVKTLLGNIDIMC*R*LSYTLHYHILEPI* **YVXPVLLIXFVATYCVQLYLMQIEFNKIYHIFAESCRT*LSYRPRRTPAYL*PTASSI LGKQYARNISSFDIYVHPHTSCYHP >GCiWno164_d18.b1_2 RILACLPGKLLHDPHFILIFETL*KFSIFSQSIEQLDATQVSNLHRCSLTFS*QSLTSS* LM*NKGTQTHIQTWCDSRHRR*LYRRVNRPPGTIST***RNNGTDHGRVRGWTRHDVNYY AMGLCIYDAF*RMPAKGDCYGTE*LYCNSVLMYIGLGFGGVRFYFSSSSYIGSNYLQNCK RVFLSHLVLNKNVSLCIKKVTSRLLSKQRC**KHY*EI*ILCANANYLIPCIIIY*NLYS NDTXFLCY*XFLLQHIVFNYILCKLNLIKFTIFLQNHAELDSVIGPGELPHISDRRRLPY LESSMHEIFRHSTFTXTHIPHVTTX >GCiWno164_d18.b1_3 GS*LACQENYCTIRILS*FSKRYKNFRFSHNRLNNWMRLR*AIFTVVH*HSVNNR*LPLD *CRTKEHRLTYKHGVIRDIVDSFIAESIDHPEQSALNDDVIMALTTDVFGAGQDTMSTTM QWVFVYMMHFKECQRKVTVMVQNDYIVIQF*CILGWDLAVYVFILVHRPI*VVIIYRIVK GCFYPIWF*TKTFHYV*KK*LHDFSPNSVVSKNTIRKYRYYVLTLIILYPALSYIRTYIV MIRXSCVIDXFCCNILCSTISYAN*I**NLPYFCRIMPNLTQLSAPENSRISLTDGVFHT WKAVCTKYFVIRHLRXPTYLMLPP >GCiWno157_d09.g1_1 LN*SILLVLK*NFDRSYVLRH*HYKRFRVLFWVCRVMGDLLRHKRHSGVPKVQGFENSFQ FARTQIC*VRSTPGSVFSETNFSKN*VCFIRGRKSSSLSGQPVVCVTITNNDIVHPYMIR SSVTVG*NLKTMIGKYNLERSYANALSFYSSPFLSIQLCCVFKF*LIVFFICASQLIPSI FRFFRSFETL*KFSIFSQID*TIGCDSGKQSSPLFINIQLTIADFLLIVVEQRNTDSHTS MV*FATSSIALSQSQSTTRNNQHLMMTX*WH*PRTCSXAGQTRCQLLXHGVFXYMMHF*E CXXKVTV >GCiWno157_d09.g1_2 *IKVYSWC*NKTLTAPTFCDIDITNGFVYCFGFVASWETCYVIKDIAVCRKCKDSRIPSS SPEPRSVEFGRPRVRYLARQTLAKTEFVLYGEGNQARCRGNRWFASRSQTMTLFIHI*LD LL*R*GRI*KQ**ESTTLNEATRMLCPFILPPFYLYSSAVFLNFDL*CSLSALPN*SLQF LDFSEVSKRSKSFRFSHKSIEQLDATQVSNLHRCSLTFS*QSLTSS*LL*NKGTQTHIQA WCDSRHRR*LYRRVNRPPGTIST***RYNGTDHGRVRXLDRHDVNYYXMGSLXI*CIFKN AXRR*LX >GCiWno157_d09.g1_3 KLKYTLGVKIKL*PLLRFATLTLQTVSCIVLGLSRHGRLVTS*KT*RCAESARIREFLPV RPNPDLLSSVDPGFGI*RDKL*QKLSLFYTGKEIKLVVGATGGLRHDHKQ*HCSSIYD*I FCNGRVEFENNDRKVQP*TKLRECFVLLFFPLFIYTALLCF*ILTYSVLYLRFPTNPFNF *IFPKFRNALKVFDFLTNRLNNWMRLR*AIFTVVH*HSVNNR*LPLDCCRTKEHRLTYKH GVIRDIVDSFIAESIDHPEQSALNDDXIMALTTDVFGGWTDTMSTTMXWGLXIYDAFLRM PXEGDC >GCiWno596_c24.g1 CHROMAT_FILE: GCiWno596_c24.g1 PHD_FILE: GCiWno596_c24.g1.phd.1 CHEM: term DYE: big TIME: Thu Oct 25 11:51:48 2001 TEMPLATE: GCiWno596_c24 DIRECTION: rev Length = 914 Score = 153 bits (383), Expect = 4e-37 Identities = 82/87 (94%), Positives = 83/87 (95%), Gaps = 4/87 (4%) Frame = +2 Query: 1 NNWMRLR-AIFTVVH-HSVNNR-LPLDC-RTKEHRLTYKHGVIRDIVDSFIAESIDHPEQ 56 N+WMRLR AIFTVVH HSVNNR LPLDC RTKEHRLTYKHGVIRDIVDSFIAESIDHPEQ Sbjct: 380 NDWMRLR*AIFTVVH*HSVNNR*LPLDCCRTKEHRLTYKHGVIRDIVDSFIAESIDHPEQ 559 Query: 57 SALNDDVIMALTTDVFGAGQDTMSTTM 83 SALNDDVIMALTTDVFGAGQDTMSTTM Sbjct: 560 SALNDDVIMALTTDVFGAGQDTMSTTM 640 >GCiWno596_c24.g1 TTCGGTATTTAGCGAGACAAACTTTAGCAAAAACTGAGTTTGTTTTATACGGGAAAGGAAATCAAGCTCGTTGTCGCGGC AACCGGTGGTTTGCGTCACGATCACAAACAATGACATTGTTCATCCATATATGATTAGATCTTCTGTAACGGTAGGGTAG AATTTGAAAACAATGATAGGAAAGTACAACATTGAACGAAGCTACGCGAATGCTTTGTCCTTTTATTCTTCCCCCTTTTT ATCTACAGCTCTGCTGTGTTTTTAAATTTTGACTTATAGTGTTCTTTATCTGCGCTTCCCAACTAATCATTTCAATTTTT AGATTTTTCCGAAGTTTCGAAACGCTCTAAAAGTTTTCGATTTCCTCACAAATCGATTGAACGATTGGATGCGACTCAGG TAAGCAATCTTCACCGTTGTTCATTAACATTCAGTTAACAATCGCTGACTTCCTCTTGATTGTTGTAGAACAAAGGAACA CAGACTCACATACAAGCACGGTGTGATTCGCGACATCGTCGATAGCTTTATCGCAGAGTCAATCGACCACCCGGAACAAT CAGCACTTAATGATGACGTAATAATGGCACTGACCACGGACGTGTTCGGGGCTGGACAAGACACGATGTCAACTACTATG CAATGGGTCTTTGTATATATGATGCATTTTAAAGAATGCCAGCGAAAGGTGACTGTTATGGTACAGAATGATTATATTGT AATTTCAGTTTACTGGATATTGGGTTGGGAATTGGCGGAGTACGTTTTTATTTAGTTCATCGCCCCATTTAGGAGGAATT ATTTACCGATTATAGGAAGGGGTTTTTTATCCCATTNGGTTTTAACAAAAACGTTATTTTGTTTAAAAAAAGTTTTTGCC AATTTTTTTTAAACAGGTGGTTAGTAAAACCTTA >SEQUENCE 26, 81 no introns 37% to 2U1 human 41% to seq 2 MEITTFLLCMLMLVLIMFMWRRSSTNFPPGIEGIPLFGCIPSLGMHKERTIAKWGREKG WPIFYLRMGITKIEVLNTFESIEEAYVKKGQYFIDRHLPIFLRHYSTGKGVVFLNGEK WKVQRRFGIHTLRDLGMGKSGMESKIVHEIDHLSEYLVNNNQESGLVDITPIITRAVSNIVC QLVFNRRFNLDEEFLFIDSVNNKLMKSVTTLKQIMLTLQHIPIFNRIPAIAKIK XXXXXXXXXXXX MRNYIKSHKETLDKNNPRDFIDAFLIASEEDKSEDTSFDDEQLLYYIQDLFFGGTDTTSF TLTWTFLYLAMYPDKQEQLHAEIDEVLGSNGIVSMSCLDKMPYAQAVMQEIFRLRPLVPL SMPRKTLSRITLMGYDIPKGTVFMPNIWSVHHNADRWPNPEDFMPERHIDSEGKFVKSKE IIPFSLGPRNCLGIRLAEMEHFMFMIGLLQKLHFSLPEDQPPPDVRGSSFVVLLLPPDFNMKITTR* AV873268 EST AV980934 EST N-terminal to C-helix LQW19143.x1 LQW135203.x1 JWB639.y1 LGK1072.y1 NTERM LQW24275.x1 LQW54158.x1 LQW178557.y1 >Ortholog to seq 26 in Ciona savignyi no introns MDFTSVLLFLLVVVLVFLWNRRGSGNFPPGFDGVPLLGCIPLFGAHRERSIAEWGREKG SWPIFYIKLGITKVVVLNTFESIEEAFVKKGQYFVERHIPIFLKRYSKGGKGIVFSNGEI WKHQRRFGIHTLRDLGMGKSGMENKIQSEIEHLSDYLVNSPNIVGKKSVDIVPIITKAVSNIIC QLVFNTRFNLDDKITFIDSAAGIKLVKNASWVRQVKMTLCYVPLLNRIPTIAKLK QEREALHNTRHDL LRKYIQMHKETLDKGSPRDFIDAFLIAGEQDKEENSSFNDEQLLFYIQDLFFGGTDTTSF TLTWTFLYLSLFPEKQKRLHDEIDEVIGSSGNISMSFLEKMPYAQAVMQEIFRVRPLVPL GMPRKCGQNISLMGHNLPKDTSVIPNIWSAHHNPDRWPEPDSFLPERHIDSNGNFIKSKD IIPFVLGPRNCLGIRLAEMEHFMFMVGLLQKLQFALPAGQGKVDTRGSSSIVLLLPPDVDLVITSR* Identities = 336/498 (67%), Positives = 411/498 (82%) savignyi 1 MDFTSVLLFLLVVVLV-FLWNRRGSGNFPPGFDGVPLLGCIPLFGAHRERSIAEWGREKG 59 M+ T+ LL +L++VL+ F+W RR S NFPPG +G+PL GCIP G H+ER+IA+WGREKG intestinalis 1 MEITTFLLCMLMLVLIMFMW-RRSSTNFPPGIEGIPLFGCIPSLGMHKERTIAKWGREKG 59 Query: 60 SWPIFYIKLGITKVVVLNTFESIEEAFVKKGQYFVERHIPIFLKRYSKGGKGIVFSNGEI 119 WPIFY+++GITK+ VLNTFESIEEA+VKKGQYF++RH+PIFL+ YS G KG+VF NGE Sbjct: 60 -WPIFYLRMGITKIEVLNTFESIEEAYVKKGQYFIDRHLPIFLRHYSTG-KGVVFLNGEK 117 Query: 120 WKHQRRFGIHTLRDLGMGKSGMENKIQSEIEHLSDYLVNSPNIVGKKSVDIVPIITKAVS 179 WK QRRFGIHTLRDLGMGKSGME+KI EI+HLS+YLVN+ G VDI PIIT+AVS Sbjct: 118 WKVQRRFGIHTLRDLGMGKSGMESKIVHEIDHLSEYLVNNNQESGL--VDITPIITRAVS 175 Query: 180 NIICQLVFNTRFNLDDKITFIDSAAGIKLVKNASWVRQVKMTLCYVPLLNRIPTIAKLKQ 239 NI+CQLVFN RFNLD++ FIDS KL+K+ + ++Q+ +TL ++P+ NRIP IAK+K Sbjct: 176 NIVCQLVFNRRFNLDEEFLFIDSVNN-KLMKSVTTLKQIMLTLQHIPIFNRIPAIAKIKN 234 Query: 240 EREALHNTRHDLLRKYIQMHKETLDKGSPRDFIDAFLIAGEQDKEENSSFNDEQLLFYIQ 299 L + R YI+ HKETLDK +PRDFIDAFLIA E+DK E++SF+DEQLL+YIQ Sbjct: 235 XXXXXXXXXXXXMRNYIKSHKETLDKNNPRDFIDAFLIASEEDKSEDTSFDDEQLLYYIQ 293 Query: 300 DLFFGGTDTTSFTLTWTFLYLSLFPEKQKRLHDEIDEVIGSSGNISMSFLEKMPYAQAVM 359 DLFFGGTDTTSFTLTWTFLYL+++P+KQ++LH EIDEV+GS+G +SMS L+KMPYAQAVM Sbjct: 294 DLFFGGTDTTSFTLTWTFLYLAMYPDKQEQLHAEIDEVLGSNGIVSMSCLDKMPYAQAVM 353 Query: 360 QEIFRVRPLVPLGMPRKCGQNISLMGHNLPKDTSVIPNIWSAHHNPDRWPEPDSFLPERH 419 QEIFR+RPLVPL MPRK I+LMG+++PK T +PNIWS HHN DRWP P+ F+PERH Sbjct: 354 QEIFRLRPLVPLSMPRKTLSRITLMGYDIPKGTVFMPNIWSVHHNADRWPNPEDFMPERH 413 Query: 420 IDSNGNFIKSKDIIPFVLGPRNCLGIRLAEMEHFMFMVGLLQKLQFALPAGQGKVDTRGS 479 IDS G F+KSK+IIPF LGPRNCLGIRLAEMEHFMFM+GLLQKL F+LP Q D RGS Sbjct: 414 IDSEGKFVKSKEIIPFSLGPRNCLGIRLAEMEHFMFMIGLLQKLHFSLPEDQPPPDVRGS 473 Query: 480 SSIVLLLPPDVDLVITSR* 498 S +VLLLPPD ++ IT+R* Sbjct: 474 SFVVLLLPPDFNMKITTR* 492 >sequence 30 2 accessions 37% to 1A1 IYCLLSWHRRPKNFPPGPRGFPVLGIVPYFGKYPEKVLSKFADQYESRVMSF RMGRMDWIVLNDIETITQ LQW211491.y1 DEV3838.y1 >sequence 31 1 accession 49% to 2U1 IHEVYRFRTLFPLGLPHKTSHQVILDSYVIPQGTT NLWAVHNDPKVFDEPEEFKPERHLYGNGEFGRSPYVIPFSVGPRHCLGEQLASMMLFI YLVSLVRSFEFLPDPKLNGLPDIRSGASGPVFLPKSFNVVAREL* LQW215043.x2 LQW162532.y1 LQW189216.y1 cilv035a12 GCiWno822_j06.b1 >cilv035a12 Length = 639 Score = 89.3 bits (218), Expect = 6e-18 Identities = 44/57 (77%), Positives = 47/57 (82%) Frame = +1 Query: 1 GTLRWAILCLLHYPEKQAKLRKEIIQVLGKEIDDVIVVRYDTKMPYASAFIHEVYRF 57 GTLRWAILCLLHYPEKQAKLRKEIIQVLG D + + +MPYASAFIHEVYRF Sbjct: 184 GTLRWAILCLLHYPEKQAKLRKEIIQVLG---DQEVTILKKHEMPYASAFIHEVYRF 345 >cilv035a12 TTAAAACGAACCCTTCTCGGGTTTATAAACATACACGAAAAGACATATGACAGCACGAACATTAGGGACTTTATTGACGC CTTTCTTCTGCTCAAGCATCGCCAACTGGACGAGTCATTTAACGACAAACAGTTAATACATTATATATACGACTTATTTT TGGGCGGGACCGAAACAACGACTGGTACCCTACGATGGGCCATTCTATGTTTACTGCATTATCCTGAAAAGCAAGCCAAG TTACGGAAAGAAATAATTCAAGTACTCGGAGATCAAGAAGTTACAATTCTAAAGAAACACGAGATGCCGTATGCAAGCGC TTTCATTCACGAAGTTTATAGATTCAGGACTTTATTTCCTCTTGGTTTACCACATAAAACAAGTCATCAGGTTATTTTGG ACAGCTACGTTATACCACAGGGAACAACGGTATGCACTAATCTTTGGGCGGTACACAACGACCCAAAGGTATTTGACGAG CCCGAGGAATTTAAACCTGAGCGTCATCTTTATGGAAACGGGGAGTTCGGACGCTCTCCCTACGTCATACCCTTTTCAGT TGGACCTCGTCACTGCTTAGGCGAGCAGCTAGCATCTATGATGTTGTTTATATATTTAGTTTCACTCGTTAGGAGTTTC >cilv035a12_1 LKRTLLGFINIHEKTYDSTNIRDFIDAFLLLKHRQLDESFNDKQLIHYIYDLFLGGTETT TGTLRWAILCLLHYPEKQAKLRKEIIQVLGDQEVTILKKHEMPYASAFIHEVYRFRTLFP LGLPHKTSHQVILDSYVIPQGTTVCTNLWAVHNDPKVFDEPEEFKPERHLYGNGEFGRSP YVIPFSVGPRHCLGEQLASMMLFIYLVSLVRSF >GCiWno822_j06.b1 CHROMAT_FILE: GCiWno822_j06.b1 PHD_FILE: GCiWno822_j06.b1.phd.1 CHEM: term DYE: big TIME: Wed Dec 5 21:05:01 2001 TEMPLATE: GCiWno822_j06 DIRECTION: fwd Length = 818 Score = 82.7 bits (201), Expect = 4e-16 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 1 YLVSLVRSFEFLPDPKLNGLPDIRSGASGPVFLPKSFNV 39 YLVSLVRSFEFLPDPKLNGLPDIRSGASGPVFLPKSFNV Sbjct: 279 YLVSLVRSFEFLPDPKLNGLPDIRSGASGPVFLPKSFNV 163 >GCiWno822_j06.b1 AAAATCAAAAGGCAAGCATAGTTAAAAAATAAAAACTTTTGACATGGCTGTGCCAAATGTATAGTATGTAACTTAATCGT ATTAATATATGCATAAAACGTGTAGAAAAGAACGTCAGTTATAAGCGTTGTCGATGTACTCGAATCACAGCTCTCGAGCC ACGACATTAAAACTTTTAGGCAAAAACACCGGGCCGCTGGCACCGCTTCTTATATCGGGTAAACCGTTTAACTTAGGATC CGGAAGAAATTCGAAACTCCTAACCAGTGAAACTAAATATATAAACAACATCATAGATGCTAGCTGCTCGCCTAAGCAGT GACGAGGTCCAACTGAAAAGGGATGACGTAGGGGGAGCGTCCGAACTCCCCGTTTCCATAAAGATGACGCTCAGGTTTAA ATTCCTCGGGCTCGTCAAATACCTTTGGGAACATTTTTTGGGGCCCACTTTGGCCTAAATCTTATGTTCTATGGCTTGCT GACGCGTATATCACTTCAGCCACGCAGCAAGATAGAATATAAACCATTTACCGTTGTTCCCTGTGGTATAACGTAGCTGT CCAATATAACCTGATGACTTGTTTTATGTGGTAAACCAAGAGGAAATAAAGTCCTGAATCTATACACTTCGTGAATGAAT GCGCTTGTATATGGCATCTCGTGTTTCTTCAGAATTGTAACTTCTTGATCTCCTGTTGTGGGGAANAATGGCATTAACTG AAAATATTTTGTAAAAAAACAAGTTTTATCCTCGCGTATAGCAAGGCAACGGCAACGGCTACCATGAGTGGNTCGGTTTC GTACACTATTCCTGCTCA >GCiWno822_j06.b1_4 SRNSVRNRXTHGSRCRCLAIREDKTCFFTKYFQLMPXFPTTGDQEVTILKKHEMPYTSAF IHEVYRFRTLFPLGLPHKTSHQVILDSYVIPQGTTVNGLYSILLRG*SDIRVSKP*NIRF RPKWAPKNVPKGI*RARGI*T*ASSLWKRGVRTLPLRHPFSVGPRHCLGEQLASMMLFIY LVSLVRSFEFLPDPKLNGLPDIRSGASGPVFLPKSFNVVAREL*FEYIDNAYN*RSFLHV LCIY*YD*VTYYTFGTAMSKVFIF*LCLPFDF >GCiWno822_j06.b1_5 EQE*CTKPXHSW*PLPLPCYTRG*NLFFYKIFSVNAIXPHNRRSRSYNSEETRDAIYKRI HSRSV*IQDFISSWFTT*NKSSGYIGQLRYTTGNNGKWFIFYLAAWLK*YTRQQAIEHKI *AKVGPKKCSQRYLTSPRNLNLSVIFMETGSSDAPPTSSLFSWTSSLLRRAASIYDVVYI FSFTG*EFRISSGS*VKRFTRYKKRCQRPGVFA*KF*CRGSRAVIRVHRQRL*LTFFSTR FMHILIRLSYILYIWHSHVKSFYFLTMLAF*FX >GCiWno822_j06.b1_6 *AGIVYETXPLMVAVAVALLYARIKLVFLQNIFS*CHXSPQQEIKKLQF*RNTRCHIQAH SFTKCIDSGLYFLLVYHIKQVIRLYWTATLYHREQR*MVYILSCCVAEVIYASASHRT*D LGQSGPQKMFPKVFDEPEEFKPERHLYGNGEFGRSPYVIPFQLDLVTA*ASS*HL*CCLY I*FHWLGVSNFFRILS*TVYPI*EAVPAARCFCLKVLMSWLESCDSSTSTTLITDVLFYT FYAYINTIKLHTIHLAQPCQKFLFFNYACLLIX >sequence 32, 196 3 accessions 1 aa diff between members 43% to 2U1 KLPLFRAFVQEIFRFKTLLPLSIQHRASHDVEIGGYVIPKGTK (0) VFPNLHAVHHDPNTWENPSDFNIYRHVDKHGKFIPSKKVI PFGIGARSCLGEKLANVEVFLFLANIIKRF EILPDPESKELPDFKDGINGFIYVPYRYKVVTKPRIINE* DEV29724.y1 I-HELIX DEV55011.y1 I-HELIX GCiWno527_f20.b1 GCiWno1052_f02.g1 LQW12052.x1 LQW236803.x1 LQW32358.x1 GCiWno667_g03.g1 GCiWno681_i17.g1 CHROMAT_FILE: GCiWno681_i17.g1 PHD_FILE: GCiWno681_i17.g1.phd.1 CHEM: term DYE: big TIME: Fri Nov 2 13:52:36 2001 TEMPLATE: GCiWno681_i17 DIRECTION: rev Length = 925 Score = 199 bits (502), Expect = 5e-51 Identities = 92/95 (96%), Positives = 95/95 (99%) Frame = -2 Query: 1 LPRRTISPTMLRRITFYCIFKSNQVFPNLHAVHHDPNTWENPSEFNIYRHVDKHGKFIPS 60 LPRRTISPTMLRR+TF+CIFKSNQVFPNLHAVHHDPNTWENPS+FNIYRHVDKHGKFIPS Sbjct: 372 LPRRTISPTMLRRMTFHCIFKSNQVFPNLHAVHHDPNTWENPSDFNIYRHVDKHGKFIPS 193 Query: 61 KKVIPFGIGARSCLGEKLANVEVFLFLANIIKRFE 95 KKVIPFGIGARSCLGEKLANVEVFLFLANIIKRFE Sbjct: 192 KKVIPFGIGARSCLGEKLANVEVFLFLANIIKRFE 88 >GCiWno681_i17.g1 ATTGCGAGCTCGGTACCCAACGTAAATAAAACCGTTGATGCCATCTTTAAAGTCCGGAAGCTCTTTGCTCTCAGGATCGG GAAGAATCTCAAACCTTTTAATGATGTTAGCGAGGAAGAGAAAGACCTCAACATTTGCCAGCTTCTCACCAAGACAAGAT CGAGCTCCGATTCCGAACGGGATCACTTTCTTAGAGGGAATAAACTTTCCGTGTTTATCAACGTGACGATAAATGTTAAA ATCGCTCGGATTTTCCCAAGTATTTGGATCGTGGTGTACAGCGTGAAGGTTCGGGAAAACCTGGTTGGATTTAAATATAC AATGAAATGTCATGCGCCGTAGCATAGTCGGTGATATAGTGCGCCTAGGCAAGACGCTTTAACGGCAATTGCTCCAACCC AGTGGTCTCTAACGAGTTGTCCAAATTATCAGCCACACAAAAGAAAATCCCCTCAAAAATAATCACCCCCAAAGTAACAT ATATACTTGGTAACTCGTAATACGAAATGAATGAAACAGAACACCCGTGTTATAACGACTGTTATTTTCCGGCCACGCGA GGATAAAGTAAATTACATTCATTCACTTCATACTGTTTTAGATCGAAACCAACAACCTTTGTTCCTTTTGGAATGACGTA ACCTCCAATCTCTACGTCATGACTGGCTCTATGTTGAATTGACAGGGGCAGGAGTGTTTTGAATCGAAATATTTCCTGAA CAAACGCACGGAATAGTGGAAGCTTGTCTCTGTGGTCGATGCTGGGAACGACTTGTTCACCTTNCACGAANATTTCAAGT TGGAAAATCAACATCCAGGGAAAATTGTATGGGCAAGTGTGCAAACCAACAGTTTTGACCGGGATAANAAGTGCTACCAT CTGCTATCCCGTGGCACAGNAAAGGGGTTAAACAGGTAGGCCTAC >_4 *AYLFNPFXVPRDSRW*HXLSRSKLLVCTLAHTIFPGC*FSNLKXSXKVNKSFPASTTET SFHYSVRLFRKYFDSKHSCPCQFNIEPVMT*RLEVTSFQKEQRLLVSI*NSMK*MNVIYF ILAWPENNSRYNTGVLFHSFRITSYQVYMLLWG*LFLRGFSFVWLIIWTTR*RPLGWSNC R*SVLPRRTISPTMLRRMTFHCIFKSNQVFPNLHAVHHDPNTWENPSDFNIYRHVDKHGK FIPSKKVIPFGIGARSCLGEKLANVEVFLFLANIIKRFE ILPDPESKELPDFKDGINGFI YVGYRARN >_5 VGLPV*PLXCATG*QMVALXIPVKTVGLHTCPYNFPWMLIFQLEXFVXGEQVVPSIDHRD KLPLFRAFVQEIFRFKTLLPLSIQHRASHDVEIGGYVIPKGTKVVGFDLKQYEVNECNLL YPRVAGK*QSL*HGCSVSFISYYELPSIYVTLGVIIFEGIFFCVADNLDNSLETTGLEQL PLKRLA*AHYITDYATAHDISLYI*IQPGFPEPSRCTPRSKYLGKSERF*HLSSR**TRK VYSL*ESDPVRNRSSILSW*EAGKC*GLSLPR*HH*KV*DSSRS*EQRASGL*RWHQRFY LRWVPSSQX >_6 RPTCLTPXLCHGIADGSTXYPGQNCWFAHLPIQFSLDVDFPT*NXRXR*TSRSQHRPQRQ ASTIPCVCSGNISIQNTPAPVNST*SQS*RRDWRLRHSKRNKGCWFRSKTV*SE*M*FTL SSRGRKITVVITRVFCFIHFVLRVTKYICYFGGDYF*GDFLLCG**FGQLVRDHWVGAIA VKASCLGALYHRLCYGA*HFIVYLNPTRFSRTFTLYTTIQILGKIRAILTFIVTLINTES LFPLRK*SRSESELDLVLVRSWQMLRSFSSSLTSLKGLRFFPILRAKSFRTLKMASTVLF TLGTELAX >GCiWno1052_f02.g1 TTCAAGCTCGGTACCCGCAGATATGCGGATATATACACCCTCGACGGCCTCCTAGTACTCGTTACTGGTTCTTGGCTTTC GTAGCCTGTTTGTAACGTGGAGGAACGCAACTAAAACCGCTGATGCCATTATTAAAGTCCGGAAGCTCTTTGCTCTCAGG ATCGGGAAGAATCTCAAACCTTTTAATGATGTTAGCGAGGAAGAGGAAGACCTCAACATTTGCCAGCTTCTCACCAAGAC AAGATCGAGCTCCGATTCCGAACGGGATCACTTTCTTTGAGGGAATAAACTTTCCGTGTTTATCAACGTGACGATAAATG TTAAAATCGCTCGGATTTTCCCAAGTATTTGGATCGTGGTGTACAGCGTGAAGGTTCGGGAAAACCTGGTTGGATTTAAA TATACAATCAAATGTCATGCGCCGTAGCATAGTCGGTGATATAGTGCGCCTAGGCAAGACGCTTTAACAGCAATTGCTCC AACCCAGTGGTCTCTAACGAGTTGTCCAAATTATCAGCCACACAAAAGAAAATCCCCTCAAAAATAATCACCCCCAAAGT AACATATATACTTGGTAACTCGTAATACGAAATGAATGAAACAGAACACCCGTGTTATAACGACTGTTATTTTCCGGCCA CGCGAGGATAAAGTANAGTACATTCATTCACTTCATACTGTTTTAGATCGAAACCAACAACCTTTGTTCCTTTTGGAATG ACGTAACCTCCCATCTCTACGTCATGACTGGCTCTATGTTGAATTGACAGGGGCAGGAGTGTTTTGAATCGAAATATTTC CTGGACAAACGCACGGAATAGTGGAAGCTTGTCTCTGTGGTCGATGCTGGGAACGACTTGTTCCCCTTCACGAAAATTTC >GCiWno1052_f02.g1_4 KFS*RGTSRSQHRPQRQASTIPCVCPGNISIQNTPAPVNST*SQS*RRDGRLRHSKRNKG CWFRSKTV*SE*MYXTLSSRGRKITVVITRVFCFIHFVLRVTKYICYFGGDYF*GDFLLC G**FGQLVRDHWVGAIAVKASCLGALYHRLCYGA*HLIVYLNPTRFSRTFTLYTTIQILG KIRAILTFIVTLINTESLFPQRK*SRSESELDLVLVRSWQMLRSSSSSLTSLKGLRFFPI LRAKSFRTLIMASAVLVAFLHVTNRLRKPRTSNEY*EAVEGVYIRISAGTELE >GCiWno1052_f02.g1_5 EIFVKGNKSFPASTTETSFHYSVRLSRKYFDSKHSCPCQFNIEPVMT*RWEVTSFQKEQR LLVSI*NSMK*MNVLYFILAWPENNSRYNTGVLFHSFRITSYQVYMLLWG*LFLRGFSFV WLIIWTTR*RPLGWSNCC*SVLPRRTISPTMLRRMTFDCIFKSNQVFPNLHAVHHDPNTW ENPSDFNIYRHVDKHGKFIPSKKVIPFGIGARSCLGEKLANVEVFLFLANIIKRFEILPD PESKELPDFNNGISGFSCVPPRYKQATKAKNQ*RVLGGRRGCIYPHICGYRA*X >GCiWno1052_f02.g1_6 NFREGEQVVPSIDHRDKLPLFRAFVQEIFRFKTLLPLSIQHRASHDVEMGGYVIPKGTKV VGFDLKQYEVNECTXLYPRVAGK*QSL*HGCSVSFISYYELPSIYVTLGVIIFEGIFFCV ADNLDNSLETTGLEQLLLKRLA*AHYITDYATAHDI*LYI*IQPGFPEPSRCTPRSKYLG KSERF*HLSSR**TRKVYSLKESDPVRNRSSILSW*EAGKC*GLPLPR*HH*KV*DSSRS *EQRASGL**WHQRF*LRSSTLQTGYESQEPVTSTRRPSRVYISAYLRVPSLX >GCiWno527_f20.b1 TAACGAGTTGTCCAAATTATTCAGCCCACAAAAGAAAATCCCCTCAAAAATAATCACCCCCAAAGTAACATATATACTTG GTAACTCGTAATACGAAATGAATGAAACAGAACACCCGTGTTATAACGACTGTTATTTTCCGGGCACGCGAGGATAAAGT AAATTACATTCATTCACTTCATACTGTTTTAGATCGAAACCAACAACCTTTGTTCCTTTTGGAATGACGTAACCTCCAAT CTCTACGTCATGACTGGCTCTATGTTGAATTGACAGGGGCAGGAGTGTTTTGAATCGAAATATTTCCTGAACAAACGCAC GGAATAGTGGAAGCTTGTCTCTGTGGTCGATGCTGGGAACGACTTGTTCACCTTCAACGAAAATTTCAAGTTGGAAAATC AACGTCCAGGAAAATTGTATGGCAAGTGTGCAAACAAAGGCAAATTCTATTTGCTAGGTTCAGGACTATAGACATCTGTT TATGACAAAGCGCGCAATGAGAAAGCAGTTTTATAGAAAATATACTGTCTAACTTAAGTTAACTGAATTAATTTTAGAAT TGGGACATGGAAGTCTGGTGATAATAGTTACCCTACCAATATTATCGATTAGTTCTTGGTGAATTTCCTCTTGTATATTG GGATAATGTATTAACGCCAATAGCGACCAGAGTATTGCGTTAGTGCTTGTCTCTGTACAGCGATGAAAAAGTCCACCAAG CAATGTCGTAGCTCCGTCTCCTTGAAATACAATTTACCGTATAGCATTTTTGTTCGATAAGNTTAATGGGTTTCATATAA TATAGNNAGGTGGAGGGACACCTTTANGACATTATTTACACACTAAGTTACATACTTGGGTAACCCGTAAGCTGGCCCAA AAATGGGTG >GCiWno527_f20.b1_4 THFWASLRVTQVCNLVCK*CXKGVPPPXYII*NPLXLSNKNAIR*IVFQGDGATTLLGGL FHRCTETSTNAILWSLLALIHYPNIQEEIHQELIDNIG RVTIITRLPCPNSKINSVNLS* TVYFL*NCFLIARFVINRCL*S*T*QIEFAFVCTLAIQFSWTLIFQLEIFVEGEQVVPSI DHRDKLPLFRAFVQEIFRFKTLLPLSIQHRASHDVEIGGYVIPKGTKVVGFDLKQYEVNE CNLLYPRVPGK*QSL*HGCSVSFISYYELPSIYVTLGVIIFEGIFFCGLNNLDNSL >GCiWno527_f20.b1_5 HPFLGQLTGYPSM*LSV*IMS*RCPSTXLYYMKPIXLIEQKCYTVNCISRRRSYDIAWWT FSSLYRDKH*RNTLVAIGVNTLSQYTRGNSPRTNR*YW*GNYYHQTSMSQF*N*FS*LKL DSIFSIKLLSHCALCHKQMSIVLNLANRICLCLHTCHTIFLDVDFPT*NFR*R*TSRSQH RPQRQASTIPCVCSGNISIQNTPAPVNST*SQS*RRDWRLRHSKRNKGCWFRSKTV*SE* M*FTLSSRARKITVVITRVFCFIHFVLRVTKYICYFGGDYF*GDFLLWAE*FGQLVX >GCiWno527_f20.b1_6 PIFGPAYGLPKYVT*CVNNVXKVSLHLXILYETH*XYRTKMLYGKLYFKETELRHCLVDF FIAVQRQALTQYSGRYWR*YIIPIYKRKFTKN*SIILVG*LLSPDFHVPILKLIQLT*VR QYIFYKTAFSLRALS*TDVYSPEPSK*NLPLFAHLPYNFPGR*FSNLKFSLKVNKSFPAS TTETSFHYSVRLFRKYFDSKHSCPCQFNIEPVMT*RLEVTSFQKEQRLLVSI*NSMK*MN VIYFILACPENNSRYNTGVLFHSFRITSYQVYMLLWG*LFLRGFSFVG*IIWTTRX >sequence 33 1 accession 42% to 1A2 similar to seq 24 EESLRVCVADLFYAGTETSTSTILWGMIALINYPEIQEKLHKEIVNATG (1?) EEFPRLGHKDELPLLQAFIQELYRCMTLIPLGIQHQTTKNVDICGYCIPKDTV (0?) VFTNIHAVHHDPNIWKNPSEFNIYRHIDEEGKFI PSRKVIPFGIGCRSCLGEKLARIEIFLFLANIIKRF EVRPDPDSEPLLPIDDGITGFGFLPFLFKAVVLPRTNKGTQ* LQW72992.y1 LQW156142.y1 LQW156142.y1.phd.1 LQW156142.x1 12:28:22 2001 TEMPLATE: LQW156142 DIRECTION: rev Length = 881 Score = 59.7 bits (142), Expect = 9e-09 Identities = 32/49 (65%), Positives = 33/49 (67%) Frame = -1 Query: 25 VCCYPAYRNIRNGSFSKNSSFFH*LFVWDRKGVIRLMGFNGRLFLIKNP 73 +CC PAYRNIRN SK F RKGVIRLMGFNGRLFLIK P Sbjct: 791 LCC*PAYRNIRNDLSSKIVVLFTNSSSGIRKGVIRLMGFNGRLFLIKKP 645 Score = 41.4 bits (95), Expect = 0.003 Identities = 33/88 (37%), Positives = 45/88 (50%), Gaps = 4/88 (4%) Frame = -3 Query: 9 TYVM-HE*HLCN--MTDICVCCYPAYRNIRNGSFSKNSSFFH*LFVWDRKGVIRLMGFNG 65 TY++ HE*H ++ + + C P Y SF NSSF H*LFVWD + ++ G Sbjct: 840 TYIVRHE*H*VT*LISVMLLTCIP*Y*K*---SFK*NSSFIH*LFVWDPERRYQVNGI*W 670 Query: 66 RLFLIKNPIL-M*FLSGIYDIHAVHHDP 92 ++ K F +IHAVHHDP Sbjct: 669 KIISNKKTQF*CNFYQVFTNIHAVHHDP 586 >LQW156142.y1 >lcl|LQW156142.y1 CHROMAT_FILE: LQW156142.y1 PHD_FILE: LQW156142.y1.phd.1 CHEM: term DYE: ET TIME: Wed Aug 22 12:28:22 2001 TEMPLATE: LQW156142 DIRECTION: rev AAGTCGGACCGAAATTGATCTTGGTATTTTACTAAAACAGCATTTGCCGAGGGTTAGCAACTAATCTTTATATATACATT GTTTATTTGAGATATGGATTTATTTATACAGTGCAATATGTGGAAGGTTACTTAAATAATGTATTAAATAATAAATGAAG ATGACACGATAACACTGAACTTTATCTGCTGTTCATGAATCTCCCTGTAAAAGATATAGTAAAACAAGTTAATTAAGGAA AAATGTACTAAATGCTACCATAATTTTTAAACACCTTGGGTATTATTACTGAGTTCCTTTATTTGTACGTGGAAGAACCA CAGCTTTGAAGAGAAAGGGCAAAAAACCAAAACCAGTGATTCCATCGTCTATTGGAAGAAGAGGTTCGCTATCAGGATCA GGACGGACCTCGAACCTTTTGATGATGTTGGCAAGGAAGAGGAAAATCTCAATTCTTGCTAACTTCTCACCAAGACAGGA TCTGCATCCGATTCCAAACGGAATCACTTTTCTGGAAGGAATGAACTTTCCCTCTTCGTCGATATGGCGATAAATGTTGA ACTCGCTCGGATTTTTCCAGATATTTGGATCGTGGTGCACAGCGTGGATGTTCGTAAATACCTGATAAAAATTACATCAA AATTGGGTTTTTTTATTAGAAATAATCTTCCATTAAATCCCATTAACCTGATAACGCCTTTCCGGATCCCAGACGAAGAG TTAGTGAATAAAACTACTATTTTACTTGAAAGATCATTTCTAATATTACGGTATGCAGGTTAGCAGCATAACAGATATCA GTCATGTTACTTAATGTCACTCATGCCTAACTATGTATGTTTACTGGCCCTGGATCTTGGGTTACGGTCCCCACTTCCCA T >_4 GKWGP*PKIQGQ*TYIVRHE*H*VT*LISVMLLTCIP*Y*K*SFK*NSSFIH*LFVWDPE RRYQVNGI*WKIISNKKTQF*CNFYQVFTNIHAVHHDPNIWKNPSEFNIYRHIDEEGKFI PSRKVIPFGIGCRSCLGEKLARIEIFLFLANIIKRFEVRPDPDSEPLLPIDDGITGFGFL PFLFKAVVLPRTNKGTQ**YPRCLKIMVAFSTFFLN*LVLLYLLQGDS*TADKVQCYRVI FIYYLIHYLSNLPHIALYK*IHISNKQCIYKD*LLTLGKCCFSKIPRSISVRL >_5 WEVGTVTQDPGPVNIHS*A*VTLSNMTDICYAANLHTVILEMIFQVK**FYSLTLRLGSG KALSG*WDLMEDYF**KNPILM*FLSGIYEHPRCAPRSKYLEKSERVQHLSPYRRRGKVH SFQKSDSVWNRMQILSW*EVSKN*DFPLPCQHHQKVRGPS*S**RTSSSNRRWNHWFWFF ALSLQSCGSSTYK*RNSVIIPKVFKNYGSI*YIFP*LTCFTISFTGRFMNSR*SSVLSCH LHLLFNTLFK*PSTYCTV*INPYLK*TMYI*RLVANPRQMLF**NTKINFGPTX >_6 MGSGDRNPRSRASKHT*LGMSDIK*HD*YLLCC*PAYRNIRNDLSSKIVVLFTNSSSGIR KGVIRLMGFNGRLFLIKKPNFDVIFIRYLRTSTLCTTIQISGKIRASSTFIAISTKRESS FLPEK*FRLESDADPVLVRS*QELRFSSSLPTSSKGSRSVLILIANLFFQ*TMESLVLVF CPFSSKLWFFHVQIKELSNNTQGV*KLW*HLVHFSLINLFYYIFYREIHEQQIKFSVIVS SSFII*YII*VTFHILHCINKSISQINNVYIKISC*PSANAVLVKYQDQFRSDX >sequence 36, 82 7 accessions + 4 ESTs LOW 30% RANGE TO 2 FAMILY MEMBERS, NO INTRONS MASVLTVVGDYLNIWSIVLGGSA LIFYMWSRKGNLPPGPRGYPILGAMPYLVVHPEKVITKWSREIYGPILSVPLL NRTIIYLNTYEAITEAFSKQGLKLAGRPYMFLFQQISSDLGITMKTYSEHFKVQRQFGMR SLKPSRIESLVIQESRYFIDQLHDQVGKVYDMKTDVYNFT ANIICSVVLGKRFDYDDPAFKLILESSEKALGEPEDANLMMAMILIPQLRFLP PFHGANQRFLKNQHRILSMLLGIIEEHQKNFDPNNVEDFIDAYIYEQKFGIGK NTKLFENDQLKVYVRDLFIAGVETTSNTIQWSILALLYNPK YMDLMYNEVYEALGSDGVPCMKDREKMPVTCAFIQEIMRFRTITPGAAPHSAMEDIKLNGYDIPSGT MVVANLWALHNDPDTWPEPEQFNPHRHIDSD GKFIHSPKILPFSIGPRYCMGEGIAKAEIFIFLTSLLQKFTV SRDPNAVYPEEIEQGIVSAMSCPHRYNIILTAR* AV674064 EST AV973178 EST AV954996 EST BP000374 EST LQW235283.x1 LQW280554.x1 LQW66533.x1 LQW69562.x1 LQW99623.y1 LQW255433.y1 LQW192402.y1 I-HELIX LQW180741.y1 SEQUENCE 82 90% TO SEQ 36 probably SAME GENE 36% TO 2J2 IEEHQKNFDPNNVEDFIDAYIYEQKFGIGKNTKLFENDQLKVYVRDLFIAGVETTS 230 NTIQWSILALLYNPKYMDLMYNEVYEALGSDGVPCMKDREKMPVTCAFIQEIMRFRTLNP 410 GAAPHSALEDIKLNGYDIPSGPMVVATLWALLIDPDTWPKPNTSNPQRHLAPDGKF 579 Savignyi ortholog to seq 36 78% >scf/ciona01/G126/seq_dir/hrs/G126P68595F.T0/G126P68595FC9.T0.seq 1012 file 8 1012 ABI Length = 1012 682 WPEPEKFDPRRHLDSDGKFVHSPKILPFSIGPRYCMGEGIAKTEIFIFLVSLLQKFTIS 506 505 RDPDSFYPDEMDEGIVAALSIPNRYNIIL 419 >sequence 40, 19 6 accessions 41% to 1A1 RNCLAKKSAAFAGRPPFETSKLIEEGLSISFSNYRYLP TVIYSTTSVSSTICFGRSFTRQDPELKEFLRNFQSFDKAMGASQIINFWPFLKYFP 197-251 NLKTYMDQYWNFTLSMLEQHWDTYVPNNMRDLADCLWAQSNQVN NRQLTDQQRRIAYGASDAFGAGFDTISAMITWSIFYMAVFPEHQRK (0?) IREEIDRLETSMFSLRHHGDVCPYTQAWLYEVLRHISVSPLLVPHYTVKQVEVNGTMIPAGVV YNLLLIQADRDTRVWENPEQFEPERFLARDPTTGGARVVASETSKILNWGAGKRRCPGAELSRH 376 ELFIYNANLVKLCYIEQAVEGIEPAIPWPCTPGISTKPKAFRVKVTQR* DEV43978.y1 100-137 region and upstream LQW228305.x1 I-helix and upstream opp end = region from 100-137 LQW134624.x1 I-helix opp end no match LQW265875.x1 I-helix opp end poor match to KYG region may be accidental DEV5010.x1 I-helix opp end = region from 100-137 DEV21957.y1 region from 197-251 LQW240272.y1 region from 197-251 DEV57431.x1 I-helix DEV57431.y2 100-137 region LQW199164.x1 IREE to PKG exon opp end no match LQW48549.y1 PKG exon to perf opp end no match LQW141143.y1 perf opp end no match LQW17354.x1 perf to end opp end missing LQW184853.y1 perf to end opp end no match LQW17354.x2 perf to end opp end missing LQW172304.x1 PKG and perf to end opp end no match DEV12172.x1 perf to end opp end = seq 88 LQW207894.y1 perf to end opp end no match LQW184853.y1 perf to heme opp end no match GCiWno832_l19.b1 GCiWno834_j23.b1 GCiWno780_l12.g1 GCiWno777_c20.g1 GCiWno38_g15.b1 GCiWno834_j23.b1 PERF to end = seq 40 >scf/ciona01/G126/seq_dir/hrs/G126P66733F.T0/G126P66733FC7.T0.seq 705 0 705 ABI Length = 705 Plus Strand HSPs: Score = 148 (52.1 bits), Expect = 2.8e-10, P = 2.8e-10 Identities = 23/41 (56%), Positives = 32/41 (78%), Frame = +1 Query: 1 NLKTYMDQYWNFTLSMLEQHWDTYVPNNMRDLADCLWAQSN 41 NLK +MD +W+F L++HW TY P+N+RD+ADCLW QS+ Sbjct: 166 NLKAHMDVFWDFVFPNLKEHWKTYNPSNIRDIADCLWYQSH 288 >scf/ciona01/G126/seq_dir/hrs/G126P66933R.T0/G126P66933RD3.T0.seq 721 0 721 ABI Length = 721 Plus Strand HSPs: exon 5 ortholog? Score = 180 (63.4 bits), Expect = 1.1e-13, P = 1.1e-13 Identities = 32/55 (58%), Positives = 45/55 (81%), Frame = +3 Query: 2 VIYSTTSVSSTICFGRSFTRQDPELKEFLRNFQSFDKAMGASQIINFWPFLKYFP 56 V +S T+V S ICFGRSF++ DPEL++F+ ++FD+AMG++QI+NFWPFLK P Sbjct: 285 VHHSATNVISNICFGRSFSKNDPELQKFVSINRAFDRAMGSAQIVNFWPFLKSVP 449 >scf/ciona01/G126/seq_dir/hrs/G126P66933R.T0/G126P66933RD3.T0.seq_3 721 0 721 ABI ICAEPFCGFADRIKLPGRGVKTETRCQFGPIALL*GVFIF*VLFKGLLLIISLHHLY*LS SNINDFGDERITLRIKPRTNIFHIQDAITNPDEIVHHSATNVISNICFGRSFSKNDPELQ KFVSINRAFDRAMGSAQIVNFWPFLKSVPVLGRSYQVIPN*QNKNQCTQ*NVFNTFYGFK GIL*YRHLCHIIS*YWTIAVFCVE*NTVKLNNLGVGWSVKSLAPYYYYNAQTHHTISIN >scf/ciona01/G126/seq_dir/hrs/G126P67000R.T0/G126P67000RF11.T0.seq_4 812 0 812 ABI QVGPPYEQSKLFSNGF*LGIQPITRYYICIFLGR*KTAFIVITDSGNILLTDPSYEEQIM GCIVKPNRNYNMLNLKIRNRSKWFLTTRTEE*TTTVSDYXIGFS*I*NLTLIKDWYCFV* PSTLSLIQHQTL*YVFFTELSC*PMMSSLQNWYIKRLHNRFFPIINIPISF NHSPAWEKQ KRCTVKALKLYTAGPDLQKRNAMEDTASYQANLLVDQLLASVNKVSNNFYPMSRQKKNKD RF*NGNH*TKQLADKEIKLEXKTWSFSVKL >scf/ciona01/G126/seq_dir/hrs/G126P67000R.T0/G126P67000RF11.T0.seq_5 812 0 812 ABI AGGPPL*TIKTF*QRVLAWHSTNYEVLYLYLFGAVKNCFYSHY*FGQHFINGPKL*GTNN GMHS*TKQKL*HVEFENKK*IKMVPYYANGRIDDYSQ*LXYWLLLNLKSYPY*RLVLFCV TKHFKPYTTPNSLICFFY*TKLLTYDELVTKLVY*AATQPFFSNY*HSNFLQSQSGVGKA KEMHSEGSQTVHGWTGLTETKCDGRHCILPSKSPCRSIACIG**G***LLPYESTKKK*R *VLKW*SLNQTTGR*GNKTGXQNMEFQRQIX >scf/ciona01/G126/seq_dir/hrs/G126P67000R.T0/G126P67000RF11.T0.seq_6 812 0 812 ABI GRWAPLMNNQNFLATGFSLAFNQLRGIIFVSFWGGEKLLL*SLLIRATFY*RTQVMRNK* WDA*LNQTEIITC*I*K*EIDQNGSLLRERKNRRLQSVTIXLASPEFEILPLLKTGTVLC NQAL*ALYNTKLFNMFFLLN*VANL**ARYKIGILSGYTTVFFQLLTFQFPSITVRRGKS KRDAQ*RLSNCTRLDRTYRNEMRWKTLHPTKQISL*INCLHRLIRLVITFTL*VDKKKIK IGFKMVIIEPNNWQIRK*NWXPKHGVSASNX >scf/ciona01/G126/seq_dir/hrs/G126P612892F.T0/G126P612892FH1.T0.seq_1 727 0 727 ABI LNIALWWNSCVSLF*VKYEGNKNRNNATNVRCNVIVNRSNLKKIFLQKCIFAM*FGKN** H*FL*LFRTALVKHSVAFAGRPPYETSKLFSNGLSLAFNNYR*YICILLRVEKLL**SLL exon 3 IRATIY*TNQSYEEQIMGCIVKPTEL*HVEI*NKK*IKNVPYYANGRIDDYSQ*LFYWLL LNLKSYPY*RLVLFCVTKHFKPYTTPTL*YVFFTELSC*PMMSSLQNWYIKRLHNRFFPL LTX >scf/ciona01/G126/seq_dir/hrs/G126P612892F.T0/G126P612892FH1.T0.seq_2 727 0 727 ABI *ISPCGGIPVSLYFR*NMKEIKTETMQLMFGVM***TGQTLRRYFYKNVFLLCDLEKTDN INFCNCLEPPW*STR*RSQVDHLMKHQNSLATVLAWHSTITGNIFVSCCALKNCSNSHY* FGQQFIKRTKVMKNK*WDA*LNQQNYNMLKFEIRNRSKMFLTTRTEE*TTTVSDYFIGFS *I*NLTLIKDWYCFV*PSTLSLIQHQLFNMFFLLN*VANL**ARYKIGILSGYTTVFFHY *H >scf/ciona01/G126/seq_dir/hrs/G126P612892F.T0/G126P612892FH1.T0.seq_3 727 0 727 ABI EYRPVVEFLCLFILGKI*RK*KQKQCN*CSV*CDSKQVKP*EDIFTKMYFCYVIWKKLIT LIFVTV*NRPGKALGSVRRSTTL*NIKTL*QRS*LGIQQLQVIYLYLVAR*KTALIVITD SGNNLLNEPKL*RTNNGMHS*TNRIITC*NLK*EIDQKCSLLRERKNRRLQSVTILLASP EFEILPLLKTGTVLCNQAL*ALYNTNSLICFFY*TKLLTYDELVTKLVY*AATQPFFSII N >scf/ciona01/G126/seq_dir/hrs/G126P604921F.T0/G126P604921FC9.T0.seq_1 737 0 737 ABI MRYCSSPCGGNSDTASYQANLLVDQLLASVNKVSNNFYPMSRQKKNKDRF*NGNH*TKQL ADKEIKLPGKGGKNRNSMSIWSYCFTLGCVYFLGSF*GAFAHHKFTSLVLIK**HQRFWG *TNNFKNQTPN*YFPHPGRNHESGRNSSSQCNQRHFKHLFRPVIQQERPGTPKICIH*SS V*PCDGICTNR*LLAFSKICTSLGGDPTR*FRINKTKINVLSETYXNTFYGFEGIL*YRH LCHIIS >scf/ciona01/G126/seq_dir/hrs/G126P604921F.T0/G126P604921FC9.T0.seq_2 737 0 737 ABI CDTVHRPVVXIQTLHPTKQISL*INCLHRLIRLVITFTL*VDKKKIKIGFKMVIIEPNNW QIRK*NCQERGVKTETRCQFGPIALL*GVFIF*VLFKGLLLIISLHHLY*LSSNINDFGD ERITLRIKPRTNIFHIQDAITNPDEIVHHSATNVISNICFGRSFSKNDPELQKFVSINRA FDRAMGSAQIVNFWPFLKSVPVLGEILPGNSELTKQKSMYSVKRIXTHFMGLKEYYNTDI CVILSX >scf/ciona01/G126/seq_dir/hrs/G126P604921F.T0/G126P604921FC9.T0.seq_3 737 0 737 ABI AILFIALWWXFRHCILPSKSPCRSIACIG**G***LLPYESTKKK*R*VLKW*SLNQTTG R*GNKTARKGG*KQKLDVNLVLLLYFRVCLFFRFFLRGFCSS*VYITCTN*VVTSTILGM NE*L*ESNPELIFSTSRTQSRIRTK*FITVQPTSFQTFVSAGHSARTTRNSKNLYPLIER LTVRWDLHKSLTSGLF*NLYQSWGRSYQVIPN*QNKNQCTQ*NVX*HILWV*RNIIIQTF VSYYL >LQW265875.x1_1 RNGRQL*ICYVTIVITSVVHRNLIFV*NLKTYMDQYWNFTLSMLEQHWDTYVPNNMRDLA DCLWAQSN QVNSNGTAPRHTANGATDELKPRHAMNGANGNGMTHHNTNGDVTHSNGINGE PPTKINRQLTDQQRRIAYGASDAFGAGFDTISAMITWSIFYMAVFPEHQRKVICIK*LST YISSHYVNGELILASNNIVGRAKMGHPNILFSRTILLLTKNIQVILKYFSGSYKLCNCLT RSAYSARFRFTNLFNEYAYYRKMNISIVVLVTGLK*TF*PKGCNRTVIFTRTVRV*GVTV AGVMCLVLLMILRAGGL >LQW265875.x1_2 ETAGSFKYVTSLLLLRPLFIEI*YLFRISKPTWTSIGTLRCLCWNNTGTLTCPTI*ETWQ IVCGPKATRLTAMARRHATQQMAPQTS*SHATQ*MVPTVMV*HITIRMVTSHIATGLTGN PLPR*TVN*RINSAV*RMAQATHSAQVSTL*AL*SRGRFSTWPFFLNTNER*FALNDYLR IFPHIMLMAN*F*LRII**VARRWDTLTFCFLVPFCC*QRTYK*S*NISQDLINFVIV*P DRHIVLGFDLPTYLMNMHTIGR*ILVLSSWSQD*NKRFNQRDVIER*YSQEQLEYKE*Q* QVLCVWCY**YFVLEG >LQW265875.x1_3 KRQAALNMLRHYCYYVRCS*KFNICLESQNLHGPVLELYVVYVGTTLGHLRAQQYERLGR LSVGPKQPG*QQWHGATPHSKWRHRRVEATPRNEWCQR*WYDTSQYEW*RHT*QRD*RGT PYQDKPSTNGSTAPYSVWRKRRIRRRFRHYKRYDHVVDFLHGRFS*TPTKGNLH*MIIYV YFLTLC*WRIDFSFE*YSRSREDGTP*HSVFSYHFVVNKEHTSNLKIFLRIL*TL*LFNP IGI*C*VSIYQPI**ICILSEDEY*YCRLGHRIEINVLTKGM**NGNIHKNS*SIRSDSS RCYVFGVIDDTSCWRV >LQW265875.x1 >lcl|LQW265875.x1 CHROMAT_FILE: LQW265875.x1 PHD_FILE: LQW265875.x1.phd.1 CHEM: term DYE: ET TIME: Fri Aug 31 13:01:22 2001 TEMPLATE: LQW265875 DIRECTION: fwd AGAAACGGCAGGCAGCTTTAAATATGTTACGTCACTATTGTTATTACGTCCGTTGTTCATAGAAATTTAATATTTGTTTA GAATCTCAAAACCTACATGGACCAGTATTGGAACTTTACGTTGTCTATGTTGGAACAACACTGGGACACTTACGTGCCCA ACAATATGAGAGACTTGGCAGATTGTCTGTGGGCCCAAAGCAACCAGGTTAACAGCAATGGCACGGCGCCACGCCACACA GCAAATGGCGCCACAGACGAGTTGAAGCCACGCCACGCAATGAATGGTGCCAACGGTAATGGTATGACACATCACAATAC GAATGGTGACGTCACACATAGCAACGGGATTAACGGGGAACCCCCTACCAAGATAAACCGTCAACTAACGGATCAACAGC GCCGTATAGCGTATGGCGCAAGCGACGCATTCGGCGCAGGTTTCGACACTATAAGCGCTATGATCACGTGGTCGATTTTC TACATGGCCGTTTTTCCTGAACACCAACGAAAGGTAATTTGCATTAAATGATTATCTACGTATATTTCCTCACATTATGT TAATGGCGAATTGATTTTAGCTTCGAATAATATAGTAGGTCGCGCGAAGATGGGACACCCTAACATTCTGTTTTCTCGTA CCATTTTGTTGTTAACAAAGAACATACAAGTAATCTTAAAATATTTCTCAGGATCTTATAAACTTTGTAATTGTTTAACC CGATCGGCATATAGTGCTAGGTTTCGATTTACCAACCTATTTAATGAATATGCATACTATCGGAAGATGAATATTAGTAT TGTCGTCTTGGTCACAGGATTGAAATAAACGTTTTAACCAAAGGGATGTAATAGAACGGTAATATTCACAAGAACAGTTA GAGTATAAGGAGTGACAGTAGCAGGTGTTATGTGTTTGGTGTTATTGATGATACTTCGTGCTGGAGGGTTG >DEV57431.y2_1 VPNCLPKKSAAFAGRLPSKHPS*SKKDSVLVSVIIGIYL*LGSKHEVYKCTMCAWCKSRH PCYNSTVGMRCMNTPCVSGV*EDTHVIT*Q*A*GV*IHHVCLVYKKTPML*LDSEHEVYE YTMCVWCIRRHPCYN*TVSMRCMNTPCVSGV*EDTHVIT*QWA*GV*IHHVCLVYKKTPM L*LDSEHEVYEYTMCVWCIRRHPCL*LDSEH*VYEYTMCVWCISRHPCYNLTVSTRCMNM L*PX >DEV57431.y2_2 YQTASRKNPPRLLEDSLRNIQVDRRRTQY*FQ*L*VFTFD*AVSMRCINALCVPGVKVDT HVITRQWA*GV*IHHVCLVYKKTPML*LDSEHEVYEYTMCVWCIRRHPCYNLTVSMRCMN TPCVSGV*EDTHVITRQ*A*GV*IHHVCLVYKKTPML*LDSGHEVYEYTMCVWCIRRHPC YNLTVSMRCMNTPCVSGV*EDTHVYNSTVSIRCMNTPCVSGV*VDTHVIT*Q*ARGV*IC YNPX >DEV57431.y2_3 TKLPPEKIRRVCWKTPFETSKLIEEGLSISFSNYRYLPLIRQ*A*GV*MHYVCLV*K*TP ML*LDSGHEVYEYTMCVWCIRRHPCYNLTVSMRCMNTPCVSGV*EDTHVIT*Q*A*GV*I HHVCLVYKKTPML*LDSEHEVYEYTMCVWCIRRHPCYNLTVGMRCMNTPCVSGV*EDTHV IT*Q*A*GV*IHHVCLVYKKTPMFITRQ*ALGV*IHHVCLVYK*TPML*LDSEHEVYEYV ITR >LQW240272.y1_1 KGDITEPGPARFVYRLIVLLWRMIHLAVIM*LIYPIRGG*RQSL*HRCMNMI*NSPKTIT HKVTYVVTGRPKRARGL*NRTPVL*QLSLPRHARINKLHTW*LVSEHEVYETEHPC*RLS LSHHAGIHNLNNFNYIDFQGLVGDLHDTVIYSTTSVSSTICFGRSFTRQDPELKEFLRNF QSFDKAMGASQIINFWPFLKYFPVLGKSFRVISHNLYSRMGEDGTLF*SIYSYILVVNKE HSKNDKTCSVTFIDRCNCLKTIRI*ILEQRCHFPKX*MVTRR*IYMKDKYNGQQRKRARR DEKKEKKDQGKK*QEHKKKQRRNEKPX >LQW240272.y1_2 KEI*LSLVRRDLYIDLLFYFGG*FIWL**CNLFILYVAGNDSPYNTGA*I*YKILPKQ*P TK*HTW*LVGLSGHEVYETEHPCYNNCRCPVMRG*INYIRGNL*VSTRCMKQNTRVNDCR YPTTREYTT*TTLITLISRV**ATSTTR*YTAPPA*VPRFVSGEVLQGKTRS*KNFSEIF KVSTKPWARLRLSTFGHF*NTFRCWESPFG*FPIIYIVGWGKMGHFFNLYTRTFW**IKN IQRMIKLVL*LS*TVVIV*KRSGFKY*SKGVIFPSXKW*QGGEFT*RTNITGNSANGHGE TRKKKKRTRGKNSKNTKKNKEEMKNH >LQW240272.y1_3 RRYN*AWSGEICI*TYCFTLADDSFGCNNVTYLSYTWRVTTVLITQVHEYDIKFSQNNNP QSNIRGNW*A*AGTRFMKQNTRVITTVVAPSCEDK*ITYVVTCK*ARGV*NRTPVLTTVV IPPRGNTQLKQL*LH*FPGFSRRPPRHGDIQHHQREFHDLFRAKFYKARPGVERISQKFS KFRQSHGRVSDYQLLAIFKILSGAGKVLSGNFP*FI**DGGRWDTFLIYILVHFGSK*RT FKE**NLFCDFHRPL*LFKNDQDLNIRAKVSFSQAXNGDKEVNLHEGQI*RATAQTGTAR REKRKKGPGEKIARTQKKTKKK*KT >LQW176855.y1_4 FLFFFLYFFLLFFLFFIFLKRSLSKKKNNLLYLSPFDPFCYILYIPLFVFSLFFLVVSAI PITLLSVYITLYGSAFVYKSLFCFVQLS*IC*KFYLPHVHMFIYIYIYIVCLV*KS**SE INIVWLIEIL*FGIEKVKNY*HHGFKSFLLNCGLHVHYGT*DFDRSWFLTLNHGAFYSMC SHSNAIA*LHNKLNWA*EGFLIRR*ARL*Y*KNYFIRFRFILFSIRN*SFQT*IARSIQF SETYPLSYANHTSLSVFLFLSSLAVYV*CCSEI*GQRKVIEKFV*SSTHAA*WQGCN*VL INLLPRVVAAGHLRRNFCLIRF*GSEGNQNYWVLWWLFKVEYEVWYQLSYS >LQW176855.y1_5 LSFFLSLFLSSFLSIFYFS*EKSKQKKK*LTIFVTFRSLLLYFIYSAFRFFSVFLSCFSH SNHFTVCLHYTLWFCVRL*IFILFRPIELNMLKVLSPPRSYVYIYIYIYSMFSLKKLIIR N*HCMVNRNFIIWN*KG*ELLTPWF*ILFVKLWASCSLWDLRFRPELVPYPKSWRVLFYV FPQ*RHSIIA**T*LGLRRFFDKALSKAIVLKELFYQV*VYIIFDKKLIVPN MNCEEHSI LGNLSTQLCKPHVVVGFSIFIFACSLRVMLQRNMRSTKGNRKVRMKFNSRRIMARLQLSS YQFAAACCCGWAFTPEFLFDTFLRE*RESKLLGFVVAV*SRI*SLVPAQLFX >LQW176855.y1_6 SFFFSFFISFFFSFYFLFFLREV*AKKKITYYICHLSIPFVIFYIFRFSFFLCFS*LFQP FQSLYCLFTLHFMVLRSFINLYFVSSN*VKYVKSFISPTFICLYIYIYI*YV*FKKVNNP KLTLYG**KFYNLELKRLRITDTMVLNPFC*TVGFMFTMGLEISTGVGSLP*IMARSILC VPTVTP*HNCIINLIGPEKVF**GVKQGYSIKRIILSGLGLYYFR*ETDRSKHELRGAFN SRKLIHSAMQTTRRCRFFYFYLRLQFTCDAAAKYEVNER**KSSYEVQLTPHNGKAAIKF LSICCRVLLRLGIYAGIFV*YVSKGVKGIKTTGFCGGCLKSNMKFGTSSVIP >LQW273267.y1_4 SIYLWTPCLDPSQPFSQPF*FANL*LQHFKFSVV*FQNDRQHMQASSRPIPTYHPTRVVF IYLRFSYVYAPRI*VNESNRKFV*XQLTPHNGKXAIXFLSICSRVLLRLGIYAGIFV*YV SKGVKGIKTTGFCGGCLKSNMKFVLKRVNLNFCH MWLALVSNSLVTNSRLHAATIVGVHA LGQGTKR*KLQPSGR**VVQIVSHPLKNVLTKWHLFHLNVDLISGR**HETYDVLGTTLS KGITHHWEYSPDGEFPARETDRMVKTIRGFLSNQDGAL*RVGCKWARKHQVKWARSV*SP TKLHTW*LISDMRYMKQTPCYNNCRAPHARK*VQVPSRFFXI >LQW273267.y1_5 HIPMDPLFRSVPTLFATILICQFIATAL*IFRSIISKRSSTYAGIISTYPYIPPHSCRFH LSSLQLRVCAANMSQRK**KVRMXSTHAA*WQXCNKXLINLLPRVVASGHLRRNFCLIRF *GSEGNQNYWVLWWLFKVEYEVCFKAG*FKFLSHVVGARF*LTGDEFEAPCCYHCGCTCP WARH*TVKAPTQWSLMSCPNCQPSIKKRLNQMASVSFKR*FNFWQVITRDL*RFGNYPIQ GDYPSLGIFTRWGISRT*N*QNGQNNSGIFIESRWGVMTRWL*MGTKTSGKMGTFGLITH KVTYVVTHKRHEVYETDTVL*QLSCPTREEISTGTESILLXX >LQW273267.y1_6 PYTYGPLV*IRPNPFRNHSNLPIYSYSTLNFP*YNFKTIVNICRHHLDLSLHTTPLVSFS SIFASVTCMRREYESTKVIESSYEXNSRRIMAXLQ*XSYQFAPACCCVWAFTPEFLFDTF LRE*RESKLLGFVVAV*SRI*SLF*SGLI*ISVTCGWRSFLTHW*RIRGSMLLPLWVYMP LGKALNGKSSNPVVANELSKLSAIH*KTS*PNGICFI*TLI*FLAGNNTRLMTFWELPYP RGLPIIGNIHQMGNFPHVKLTEWSKQFGDFYRIKMGRYDALVVNGHENIR*NGHVRFNHP QSYIRGNS*AT*GI*NRHRVITTVVPHTRGNKYRYRVDSSXX >LQW222707.x1_4 AINCEVTPPMTAP*VYNCSAFFGWHYPDFGEPSKDEGIRLLVLCAVKSNMNLFKAG*LDF CHMWLRSFLTHW*RIRGSMLLPLWVYMPLGKALNGKSSNPVVANELSKLSAIH*KTS*PN GICFI*TLI*FLAGNNTRLMTFWELPYPRGLPIIGNIHQMGNFPHVKLTEWSKQFGDFYR IKMGRYDALVVNGHENIR*NGHVRFNHPQSYIRGNS*ADMRYMKQNTVL*QLSLPQHARI NKLHSFIHLAIT*LGNKL*FLNLFKFFQLHCRF >LQW222707.x1_5 NKL*SHSPNDSAISLQLLRFFRLALPGFW*TF*G*RNQTTGFMCC*IEYEFV*SGLIRFL SHVVALVSNSLVTNSRLHAATIVGVHALGQGTKR*KLQPSGR**VVQIVSHPLKNVLTKW HLFHLNVDLISGR**HETYDVLGTTLSKGITHHWEYSPDGEFPARETDRMVKTIRGFLSN QDGAL*RVGCKWARKHQVKWARSV*SPTKLHTW*LISGHEVYETEHRVITTVVAPTREDK *VTFIHSFSYHLAW**IIISKFI*IFSAALPFX >LQW222707.x1_6 Q*IVKSLPQ*QRHKFTIAPLFSAGITRILVNLLRMKESDYWFYVLLNRI*ICLKRVN*IS VTCGCARF*LTGDEFEAPCCYHCGCTCPWARH*TVKAPTQWSLMSCPNCQPSIKKRLNQM ASVSFKR*FNFWQVITRDL*RFGNYPIQGDYPSLGIFTRWGISRT*N*QNGQNNSGIFIE SRWGVMTRWL*MGTKTSGKMGTFGLITHKVTYVVTHKRT*GI*NRTPCYNNCRCPNTRG* ISYIHSFI*LSLSLVINYNF*IYLNFFSCTAVS savignyi orthologs for N-term >scf/ciona01/G126/seq_dir/hrs/G126P601052R.T0/G126P601052RG1.T0.seq 736 0 736 ABI Length = 736 Plus Strand HSPs: Score = 208 (73.2 bits), Expect = 1.2e-16, P = 1.2e-16 Identities = 39/39 (100%), Positives = 39/39 (100%), Frame = +3 Query: 36 LPSPRGLPIIGNVHQLTTSPHVKLSEWAKEFGDLFRIKM 74 LPSPRGLPIIGNVHQLTTSPHVKLSEWAKEFGDLFRIKM Sbjct: 618 LPSPRGLPIIGNVHQLTTSPHVKLSEWAKEFGDLFRIKM 734 >scf/ciona01/G126/seq_dir/hrs/G126P601052R.T0/G126P601052RG1.T0.seq 736 0 736 ABI ACTTGNGCGCTGAAACCCCATGTTGTGGNAATTCCTTTATCCTGTTGACA TGTGCGCTATGGAGCGTAATGCGACGCTGCTCAAAGGCGGGGCAGGTTCG TTTCGGACAGGATATGTTTGTTTTAGTCAATGGTAATCGAAAAGAGTGTT ATCACACGGGCAATCGTCAGATTACCTTGCGCCCACCGTCGGGTTACCGA AGCCATAGCCGTATGTTTTGCATGATTAAGCAGCTTCTTTAGTTGCAGTA GAAACCTATTCAACTATTGGGTTCAGGAAATCTCCGCTGAGTTTATTGCC CAGACACACTTGACTATCCAGTGACCAGTATAAGCCGAAAGATGACGTTC TACCCCACGTAACTATTCGGTCGTACAATTCTATGTCTGGGAAATGATGA GATAAGCACACCGATTATTTAAGACATAATCAGACTATTAATAGACCGAG GAAAATAATAAATCGAGTATAATTTCCGTAATCTGGTGATACCTTAGAAA AATATTTGAACTGATAATTTGTGTCAATATTTCACCAGTGGTATCGCTGT CAAATTTGAAATAGTTATTTCCGATTTCTGTTTAGAACAATCCGGCGAAG ACATTGCGTTCAGAGATCTACCATCTCCGAGGGGATTACCCATAATCGGC AATGTTCACCAACTCACAACATCCCCGCATGTAAAATTGTCGGAATGGGC AAAGGAGTTCGGAGATTTATTTCGAATCAAGATGGG >scf/ciona01/G126/seq_dir/hrs/G126P601052R.T0/G126P601052RG1.T0.seq_1 736 0 736 ABI TXALKPHVVXIPLSC*HVRYGA*CDAAQRRGRFVSDRICLF*SMVIEKSVITRAIVRLPC AHRRVTEAIAVCFA*LSSFFSCSRNLFNYWVQEISAEFIAQTHLTIQ*PV*AER*RSTPR NYSVVQFYVWEMMR*AHRLFKT*SDY**TEENNKSSIISVIW*YLRKIFELIICVNISPV VSLSNLK*LFPISV*NNPAKTLRSEIYHLRGDYP*SAMFTNSQHPRM*NCRNGQRSSEIY FESRWX >scf/ciona01/G126/seq_dir/hrs/G126P601052R.T0/G126P601052RG1.T0.seq_2 736 0 736 ABI LXR*NPMLWXFLYPVDMCAMERNATLLKGGAGSFRTGYVCFSQW*SKRVLSHGQSSDYLA PTVGLPKP*PYVLHD*AASLVAVETYSTIGFRKSPLSLLPRHT*LSSDQYKPKDDVLPHV TIRSYNSMSGK**DKHTDYLRHNQTINRPRKIINRV*FP*SGDTLEKYLN**FVSIFHQW YRCQI*NSYFRFLFRTIRRRHCVQRSTISEGITHNRQCSPTHNIPACKIVGMGKGVRRFI SNQDG >scf/ciona01/G126/seq_dir/hrs/G126P601052R.T0/G126P601052RG1.T0.seq_3 736 0 736 ABI LXAETPCCGNSFILLTCALWSVMRRCSKAGQVRFGQDMFVLVNGNRKECYHTGNRQITLR PPSGYRSHSRMFCMIKQLL*LQ*KPIQLLGSGNLR*VYCPDTLDYPVTSISRKMTFYPT* LFGRTILCLGNDEISTPII*DIIRLLIDRGK**IEYNFRNLVIP*KNI*TDNLCQYFTSG IAVKFEIVISDFCLEQSGEDIAFRDLPSPRGLPIIGNVHQLTTSPHVKLSEWAKEFGDLF RIKM JWB1167.x1 CHEM: term DYE: ET TIME: Wed Mar 21 17:11:08 2001 TEMPLATE: JWB1167 DIRECTION: fwd Length = 605 Score = 29.3 bits (64), Expect = 5.0 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -3 Query: 7 SVITRAIVRLPCAHRRVTEAIAVC 30 +++T + LPC H R EAIAVC Sbjct: 162 TLVTYPWLPLPCPHSRAAEAIAVC 91 possible N-term part of a repeat >JWB1167.x1_4 CVYKQT*LLFGLVSLYPRGWELE*SYPWLPLPCPHSSC*SYCSVWISRHDFWLVWSFISS WVGT*VTYPWLPLTCPQSSC*SYCSVCISIHNFWLVWLFIFSWLGTWVTYPWLPLPCLQS SC*SYCSVWISRHDFWLVWSFISSWVGTLVTYPWLPLPCPHSRAAEAIAVCG*ADITFAW FGHLYSNNLSML*N*KTPIRR >JWB1167.x1_5 VCV*ADMTFVWFGQFISSWVGT*VILSMVATPMPTFELLKLLQCVDKQA*LLVGLVIYIL VGGNLSDLSMVATHMPTVELLKLLQCVHKHT*LLVSLVIYILVVGNLGDLSMVATPMPTV ELLKLLQCVDKQT*LLVGLVIYILVGGNFSDLSMVTTPMPTQSSC*SYCSVWISRHYFCL VWSFIFK*LIHVIKLKNAH*TX >JWB1167.x1_6 SVCISRHDFCLVWSVYILVGGNLSDLIHGCHSHAHIRVAEAIAVCG*AGMTFGWFGHLYP RGWELE*LIHGCHSHAHSRVAEVIAVCA*AYITSG*FGYLYSRGWELG*LIHGCHSHAYS RVAEAIAVCG*ADMTFGWFGHLYPRGWEL**LIHGYHSHAHTVELLKLLQCVDKQTLLLL GLVIYIQITYPCYKTKKRPLDG >scf/ciona01/G126/seq_dir/hrs/G126P609292R.T0/G126P609292RE4.T0.seq_1 1015 0 1015 ABI GGGGXXXMTLSQVEVFXXNQTPPEFCXXERQXPPDRNXGXKXPKXGKGAKEPKXXXXXAX PGXXGNRXXXHTPKAKEXKGRXXTXQEKGKRENIFGIATK*PNAATKPTREYKAKGAIKI NREDKLDYAY*ETDGPRH*RQRISNIHGVVKCVFCLTRTYADVGSY*VHSATPEMQKHQG NMKKKTIGQVGVRIV*LVFLNGRF*V*HFLW*FLRRPQKQWVNLVASTTKRKVTKQAGIF LTKIKSLFRNMTIIPGG*ETRYKIGGAGTFNKYNG*FSSPEGLLPICDRPAFKTRG*PLG WASEQFPTKRGGL*TWG*LSNTQKNPKRRSKTPWGFNIX >scf/ciona01/G126/seq_dir/hrs/G126P609292R.T0/G126P609292RE4.T0.seq_2 1015 0 1015 ABI EAGGXVX*PYLKWRSFXXTKPPPSFVXXSAKXRPTETXGXXXPRXGRARKNPXXXXXXXP REXXGTGXKXTHQRQRKXRGGXKXXKKREKGKTFLVLLRNNQTRPLNRRVNIKRRGL*K* TAKTN*TTHIKKQTDRDIKGKEFQIFMAL*NVCSV*HVHMLMWGVIEFILQRLRCRNIKV I*KRKPLDRLEFVLYD*SF*TGGSRSSTFCGNFCAGRRNNGLIWLLQLQSER*PNKRVFS *RKLKAYFEI*Q*SPGDKKRVIK*AGRAPLINITVNFLARKGFYPFATVRHLKQGDSP*D GPPSNSPPKGVGSRPGGNSQTPKKTPSEGLKPPGVLIY >scf/ciona01/G126/seq_dir/hrs/G126P609292R.T0/G126P609292RE4.T0.seq_3 1015 0 1015 ABI RRGXXXYDLISSGGLLXKPNPPRVLXXRAPKXARQKRXXKXXQEXEGRERTQXXXXXRXP GKXREPGXXTHTKGKGXKGAGXNXXRKGKKGKHFWYCYEITKRGH*TDA*I*SEGGYKNK PRRQTRLRILRNRRTATLKAKNFKYSWRCKMCVLFNTYIC*CGELLSSFCNA*DAETSR* YEKENHWTGWSSYCMISLFKRAVLGLALSVVIFAPAAETMG*FGCFNYKAKGNQTSGYFL NEN*KLISKYDNNPRGIRNAL*NRRGGHL**I*RLIF*PGRAFTHLRPSGI*NKGIAPRM GLRAIPHQKGWALDLGVTLKHPKKPQAKV*NPLGF*Y >scf/ciona01/G126/seq_dir/hrs/G126P69239F.T0/G126P69239FF6.T0.seq_4 708 0 708 ABI EV*YFLC*FLCRPQXTMC*FVCFNYKAKGNQTXWVYS*RKLKANIEI*Q*SRKDKKRVIE SGVSVTFNKYNVLFF*PAMHFYQFATIGNLKQG**QLVLPIRAITNEIVMSIDYELNFKL QKNRLVEVLKYIWFYIYFIVLSLLFSRRYSKLYYCS*NNVI*DF**KQIPTISC*FRTSL FENV*F*IRLVCMVALFTLLLWCNCYLINTKLDFSL*YKIAITRIXTTGR*YISQS >scf/ciona01/G126/seq_dir/hrs/G126P69239F.T0/G126P69239FF6.T0.seq_5 708 0 708 ABI GLVLSVLIFVPAAEXNVLICMLQLQSER*PNXVGIFLTKIKS*YRNMTIIP*G*ETRYRI RCVGNF**I*RFIFLARNAFLPICDDRQFKTRLIATSIAYQSNYQRNCYVYRL*VKF*IT KKSTSRSS*VHLVLYLFYSFKSPFF*AIFQALLLLLK*CNLGFLIKANTDYQLLI*NIFI RKCVILN*VSMHGCFVYPFTLVQLLFDQYKIGFLFII*NCNY*NXHHRTMIHIAKX >scf/ciona01/G126/seq_dir/hrs/G126P69239F.T0/G126P69239FF6.T0.seq_6 708 0 708 ABI RSSTFCVNFCAGRRXQCVNLYASTTKRKVTKXSGYILNEN*KLISKYDNNPVRIRNAL*N QVCR*LLINITFYFSSPQCIFTNLRRSAI*NKVDSN*YCLSEQLPTKLLCL*TMS*ILNY KKID*SKFLSTSGFIFIL*F*VSFFLGDIPSFIIALKIM*SRIFNKSKYRLSAVNLEHLY SKMCNFKLG*YAWLLCLPFYFGAIVI*SIQNWISLYNIKLQLLEXPPQDDDTYRKV >scf/ciona01/G126/seq_dir/hrs/G126P61635R.T0/G126P61635RA1.T0.seq_1 738 0 738 ABI FVGTETPLGGNSNVLLGFLIKANTDYQLLI*NIFIRNV*F*IRLVCMVALFTLLLWCNCY LINTKLDFSL*YKIAITRGQWFLSLDIELYCFLI*QPFSSY*R*VDYHPISVCCAPFV*I SVLTKIFRFERALELTKINQPLDF*VFNFCPNKPCYLILNILSYRVILF*TAEAKCVAIV TVCLHF*SRLNLKYRY*SAFI*FLSKNN*RILGFYC*SQFFPVPMFSTLILLTQVYFQNI VPII*K >scf/ciona01/G126/seq_dir/hrs/G126P61635R.T0/G126P61635RA1.T0.seq_2 738 0 738 ABI SWALKPPLVXILMSX*DF**KQIPTISC*FRTSLFEMCNFKLG*YAWLLCLPFYFGAIVI *SIQNWISLYNIKLQLLEVNGS*A*TLNYIAS*YSSHSVHISVKLITTQLVFVVHPLYRL VF*PKYLGLNELLSLPR*TNLWTFKFLTFAPINRVILF*TS*VIVLSYFKQPKPNVLQS* QFAYIFNQD*I*NIATKVHLFNFYQRTIDEF*DFIANPNFFRSRCFQLLYY*PKSIFRTL FLLFK >scf/ciona01/G126/seq_dir/hrs/G126P61635R.T0/G126P61635RA1.T0.seq_3 738 0 738 ABI RGH*NPPWWXF*CPXRIFNKSKYRLSAVNLEHLYSKCVILN*VSMHGCFVYPFTLVQLLF DQYKIGFLFII*NCNY*RSMVLKPRH*IILLPNIAAIQFILALS*LPPN*CLLCTLCID* CFDQNI*V*TSS*AYQDKPTFGLLSF*LLPQ*TVLSYFKHLKLSCYLILNSRSQMCCNRD SLLTFLIKIKFKISLLKCIYLISIKEQLTNSRILLLIPIFSGPDVFNSYIIDPSLFSEHC SYYLK >scf/ciona01/G126/seq_dir/hrs/G126P69648R.T0/G126P69648RD1.T0.seq_4 742 0 742 ABI LALS*LPPQ*CLLCTLCID*CFDQXYLGLNELLSLPRINQPFGLLSF*LLPQ*TVLSYFK HLKLSCYLILNSRSQMCCNRDSLLTFLIKIKFKISLLKCIYLISIKEQLTNSRILLLIPI FSGPDVFNSYIIDPSLFSEHCSYYFKAAINRANRKGGDL*NSTHLLYRGGLGLAGKQTTK QISTLIAFLSFP*GNINRKTCHKLTKYRKVF*VNPTTLTSYNIVFN*LVSNEE*VWNSTT WGFSVKA >scf/ciona01/G126/seq_dir/hrs/G126P69648R.T0/G126P69648RD1.T0.seq_5 742 0 742 ABI ISVKLITTPIVFVVHPLYRLVF*PXIFRFERALELTKNKPTLWTFKFLTFAPINRVILF* TS*VIVLSYFKQPKPNVLQS*QFAYIFNQD*I*NIATKVHLFNFYQRTIDEF*DFIANPN FFRSGCFQLLYY*PKSIFRTLFLLFQGRYK*S*SERG*FVKFYSFALSRWFRIGRKTDD* AN*HFNCFFKFSIR*YKQENLP*INQVQKSILG*PYNFN*L*HCF*LASFE*RIGLEFHH MGFQCQSX >scf/ciona01/G126/seq_dir/hrs/G126P69648R.T0/G126P69648RD1.T0.seq_6 742 0 742 ABI *R*VDYHPNSVCCAPFV*ISVLTKXI*V*TSS*AYQE*TNPLDF*VFNFCPNKPCYLILN ILSYRVILF*TAEAKCVAIVTVCLHF*SRLNLKYRY*SAFI*FLSKNN*RILGFYC*SQF FPVRMFSTLILLTQVYFQNIVPIISRPL*IELIGKGVICKILLICFIEVV*DWQENRRLS KLAL*LLF*VFHKVI*TGKLAIN*PSTEKYFRLTLQL*LAITLFLTS*FRMKNRFGIPPH GVSVSKL >scf/ciona01/G126/seq_dir/hrs/G126P68717F.T0/G126P68717FF6.T0.seq_1 703 0 703 ABI DLGTIHPPVVEKPPLNRANRKGVICKILLICFIEVV*DWQENRRLSKLAL*LLF*VFHKV I*TGKLAIN*PSTEKYFRLTLQL*LAITLFLTS*FSN*RTRL*IGLAARLFFILIYTYFT GVQIFCNA*PFAAV**SIAEYISCIKCFGKVELAASRNTIVSQLL*HFKV*NKIIFVPEL HQIVK*INLSILFKLHLRTLHKALSTLEICNIGNSVKNQLGTLLGISLGTLIVTX >scf/ciona01/G126/seq_dir/hrs/G126P68717F.T0/G126P68717FF6.T0.seq_2 703 0 703 ABI TWVQSTLLWWKNPL*IELIGRG*FVKFYSFALSRWFRIGRKTDD*AN*HFNCFFKFSIR* YKQENLP*INQVQKSILG*PYNFN*L*HCF*LASFRIEELGFESVWQQDCFLY*FIHTSR ACKYSAMHDRSPQCDRASPNTSAA*SASAK*N*LRLETRLFHSCCNISRCKIKSFLCQSY IK*SSRLICQYCLNYT*EHYTRL*APWKFVILVIVLKINWEHCLEFHWEH**SR >scf/ciona01/G126/seq_dir/hrs/G126P68717F.T0/G126P68717FF6.T0.seq_3 703 0 703 ABI LGYNPPSCGGKTPSK*S*SEGGDL*NSTHLLYRGGLGLAGKQTTKQISTLIAFLSFP*GN INRKTCHKLTKYRKVF*VNPTTLTSYNIVFN*LVFELKN*ALNRFGSKTVFYTDLYILHG RANILQCMTVRRSVIEHRRIHQLHKVLRQSRISCVSKHDCFTAVVTFQGVK*NHFCARVT SNSQVD*SVNTV*ITPKNTTQGFKHLGNL*YW**C*KSTGNTAWNFIGNTDSH >scf/ciona01/G126/seq_dir/hrs/G126P65559R.T0/G126P65559RC5.T0.seq_4 750 0 750 ABI FXVVK*NHFCARVTSXSQVD*FVNTV*ITPKNTTTRL*APWKFVILVIVLKINWEHCLEF HWEH**SRAHS*KSTFMN**SANKAHTP*PDIHVI*YHYRRAASNSWNDVIFSIFLKFGA ILSITRQNKYLF*NLSINVYVLVTDK*FSNLKRQ*FKWMVI*NVSNFNRKV*MEIIFPCL NVS*N*FEIFD*TSIKEMRE*TCSGNAEKQWAALMLSELSH*SFKVKASPAVTKQKCVAE SHHMEFQCQS >scf/ciona01/G126/seq_dir/hrs/G126P65559R.T0/G126P65559RC5.T0.seq_5 750 0 750 ABI XSCKIKSFLCQSYIX*SSRLICQYCLNYT*EHYHKALSTLEICNIGNSVKNQLGTLLGIS LGTLIVTRSQLKVNIYELIVCK*GAHTVTRYTRDLVSLPAGCFKQLE*CNLQYFFKVWCD FKHNPSE*IFILKSLHKCICTSNR*VI**FKKAVI*MDGDLKCIQFQ*KSMNGNYISVFK CFLELI*NFRLNKHQGNA*IDM*WKCGKTMGCIDVI*TLSLKF*GQSLPGRY*TKVRGGI XPHGVSVSKX >scf/ciona01/G126/seq_dir/hrs/G126P65559R.T0/G126P65559RC5.T0.seq_6 750 0 750 ABI SKL*NKIIFVPELHXIVK*INLSILFKLHLRTLPQGFKHLGNL*YW**C*KSTGNTAWNF IGNTDSHALTVKSQHL*IDSLQIRRTHRDQIYT*FSIITGGLLQTVGMM*SSVFF*SLVR F*A*PVRINIYFKISP*MYMY**QISDLVI*KGSDLNGW*FKMYPISIEKYEWKLYFRV* MFLRINLKFSIEQASRKCVNRHVVEMRKNNGLH*CYLNSLIEVLRSKPPRPLLNKSAWRN XTTWSFSVKV >scf/ciona01/G126/seq_dir/hrs/G126P612776R.T0/G126P612776RG4.T0.seq_1 718 0 718 ABI *APCGGINVNIFPCLNVS*N*FEIFD*TSIKEMRE*TCSGNAEKHGLH*CYLNSLIEVLR SKPPRPLLNK*SWRVLYNVGVEFLFACYLWILLFIEMNYMELRVRLAITKNYLYPCRFK* AIFLLHAAFKFFLLRWACALVKSNI*GSIISRFMLDMLLEHLLSWNIFISVALSVLTCAL WSVMRRCSKGGAGSFRTGYVCFSQW*SKRVLSHGQSSDYLAPHRRVTEAIARMFCMIKQX >scf/ciona01/G126/seq_dir/hrs/G126P612776R.T0/G126P612776RG4.T0.seq_2 718 0 718 ABI KLHVVELMSIYFRV*MFLRINLKFSIEQASRKCVNRHVVEMRKNMGCIDVI*TLSLKF*G QSLPGRY*TNSRGEFFIMSVSNFYLLVICGYCYL*R*TIWN*EFGLQ*RKITYILAGLNR PFFCCTRHLNFFYCVGRAR**KATFRVPSFQDLCWTCCWNIF*AGTSL*VWLYPC*HVRY GA*CDAAQKAGQVRFGQDMFVLVNGNRKECYHTGNRQITLRPTVGLPKP*PVCFA*LSS >scf/ciona01/G126/seq_dir/hrs/G126P612776R.T0/G126P612776RG4.T0.seq_3 718 0 718 ABI SSMWWN*CQYISVFKCFLELI*NFRLNKHQGNA*IDM*WKCGKTWAALMLSELSH*SFKV KASPAVTKQIVVASSL*CRCRISICLLFVDIAIYRDELYGIESSACNNEKLLISLQV*IG HFSVARGI*IFFIALGVRVSKKQHLGFHHFKIYVGHVAGTSFKLEHLYKCGFIRVDMCAM ERNATLLKRRGRFVSDRICLF*SMVIEKSVITRAIVRLPCAPPSGYRSHSPYVLHD*A >scf/ciona01/G126/seq_dir/hrs/G126P609532R.T0/G126P609532RA6.T0.seq_1 719 0 719 ABI KLHVVESCLLFVDIAIYRDELYGIESSACNNEKLLISLQV*IGHFSVARGI*IFFIALGV RVSKKQHLGFHHFKIYVGHVAGTSFKLEHLYKCGFIRVDMCAMERNATLLKRRGRFVSDR ICLF*SMVIEKSVITRAIVRLPCAHRRVTEAIAVCFA*LSSFFSCSRNLFNY*VQEMSAE FIAQTHLTIQ*PV*A*KMTYYPTVTIRSYNSMSGK**DKHTDYLRHNQTINRPRKIINRX >scf/ciona01/G126/seq_dir/hrs/G126P609532R.T0/G126P609532RA6.T0.seq_2 719 0 719 ABI SSMWWNLVCYLSILLFIEMNYMELRVRLAITKNYLYPCRFK*AIFLLHAAFKFFLLRWAC ALVKSNI*GSIISRFMLDMLLEHLLSWNIFISVALSVLTCALWSVMRRCSKGGAGSFRTG YVCFSQW*SKRVLSHGQSSDYLAPTVGLPKP*PYVLHD*AASLVAVETYSTIRFRKCPLS LLPRHT*LSSDQYKPER*RTTPX*LFGRTILCLGNDEISTPII*DIIRLLIDRGK**IEX >scf/ciona01/G126/seq_dir/hrs/G126P609532R.T0/G126P609532RA6.T0.seq_3 719 0 719 ABI APCGGILFVICRYCYL*R*TIWN*EFGLQ*RKITYILAGLNRPFFCCTRHLNFFYCVGRA R**KATFRVPSFQDLCWTCCWNIF*AGTSL*VWLYPC*HVRYGA*CDAAQKAGQVRFGQD MFVLVNGNRKECYHTGNRQITLRPPSGYRSHSRMFCMIKQLL*LQ*KPIQLLGSGNVR*V YCPDTLDYPVTSISLKDDVLPHXNYSVVQFYVWEMMR*AHRLFKT*SDY**TEENNKSX >scf/ciona01/G126/seq_dir/hrs/G126P601454F.T0/G126P601454FF12.T0.seq_1 712 0 712 ABI ALGYXXSVRGWKNLACAL*KLIRVPSFQDYVGHVAGTSFKLEHLYKCGFIRVDMCAMERN ATLLKRRGRFFSDRICLF*SMVIEKSVITRAIVRLPCAHRRVTEAIAVCFA*LSSFFSCS RNLFNYWVQEISAEFIAQTHLTIQ*PV*AER*RSTPRNYSVVQFYVWEMMR*AHRLFKT* SDY**TEENNKSSIISRIW*YLRKIFELIICVNISPVVSLSNLK*LFPISC*NNAAKX >scf/ciona01/G126/seq_dir/hrs/G126P601454F.T0/G126P601454FF12.T0.seq_2 712 0 712 ABI HLGTEXRSGGGKTSPARYKNSLGFHHFKIMLDM*LEHLLSWNIFISVALSVLTCALWSVM RRCSKGGAGSFRTGYVCFSQW*SKRVLSHGQSSDYLAPTVGLPKP*PYVLHD*AASLVAV ETYSTIGFRKSPLSLLPRHT*LSSDQYKPKDDVLPHVTIRSYNSMSGK**DKHTDYLRHN QTINRPRKIINRV*FPESGDTLEKYLN**FVSIFHQWYRCQI*NSYFRFLVRTMRPK >scf/ciona01/G126/seq_dir/hrs/G126P601454F.T0/G126P601454FF12.T0.seq_3 712 0 712 ABI TWVXNXGPGVEKPRLRVIKTH*GSIISRLCWTCSWNIF*AGTSL*VWLYPC*HVRYGA*C DAAQKAGQVLFGQDMFVLVNGNRKECYHTGNRQITLRPPSGYRSHSRMFCMIKQLL*LQ* KPIQLLGSGNLR*VYCPDTLDYPVTSISRKMTFYPT*LFGRTILCLGNDEISTPII*DII RLLIDRGK**IEYNFPNLVIP*KNI*TDNLCQYFTSGIAVKFEIVISDFLLEQCGQ >scf/ciona01/G126/seq_dir/hrs/G126P69344F.T0/G126P69344FB12.T0.seq file 7 663 ABI TGTGGTGGAAATCCGAGTGTTATCACACGGGCAATCGTCTATTACCTTGC GCCCACCGTCGGGTTACCGAAGCCATAGCCGTATGTTTTGCATGATTAAG CAGCTTCTTTAGTTGCAGTAGAAACCTATTCAACTATTAGGTTCAGGAAA TGTCCGCTGAGTTTATTGCCCAGACACACTTGACTATCCAGTGACCAGTA TAAGCCGAAAGATGACGTACTACCCCACGTAACTATTCGGTCGTACAATT CTATGTCTGGGAAATGATGAGATAAGCACACCGATTATTTAAGACATAAT CAGACTATTAATAGACCGAGGAAAATAATAAATCGAGTATAATATCCGTA ATCTGGTGATACCTTAGAAAAATATTTGAACTGATAATTTGTGTCAATAT TTCACCAGTGGTATCGCTGTCAAATTTGAAATAGTTATTTCCGATTTCTG TTTAGAACAATCCGGCGAAGACATTGCGTTCAGGGATCTACCTTCTCCGA GGGGATTACCCATAATCGGCAATGTTCACCAACTCACAACATCCCCGCAT GTAAAACTGTCGGAATGGGCGAAGGAGTTCGGAGATTTATTTCGAATCAA GATGGGATGCTTCGATACATTGGTCGTAACCGGATATGACAATATAAGGT ATAATGGCCTCAT >scf/ciona01/G126/seq_dir/hrs/G126P69344F.T0/G126P69344FB12.T0.seq_1 file 7 663 ABI CGGNPSVITRAIVYYLAPTVGLPKP*PYVLHD*AASLVAVETYSTIRFRKCPLSLLPRHT *LSSDQYKPKDDVLPHVTIRSYNSMSGK**DKHTDYLRHNQTINRPRKIINRV*YP*SGD TLEKYLN**FVSIFHQWYRCQI*NSYFRFLFRTIRRRHCVQGSTFSEGITHNRQCSPTHN IPACKTVGMGEGVRRFISNQDGMLRYIGRNRI*QYKV*WPH >scf/ciona01/G126/seq_dir/hrs/G126P69344F.T0/G126P69344FB12.T0.seq_2 file 7 663 ABI VVEIRVLSHGQSSITLRPPSGYRSHSRMFCMIKQLL*LQ*KPIQLLGSGNVR*VYCPDTL DYPVTSISRKMTYYPT*LFGRTILCLGNDEISTPII*DIIRLLIDRGK**IEYNIRNLVI P*KNI*TDNLCQYFTSGIAVKFEIVISDFCLEQSGEDIAFRD LPSPRGLPIIGNVHQLTT SPHVKLSEWAKEFGDLFRIKMGCFDTLVVTGYDNIR YNGL >scf/ciona01/G126/seq_dir/hrs/G126P69344F.T0/G126P69344FB12.T0.seq_3 file 7 663 ABI WWKSECYHTGNRLLPCAHRRVTEAIAVCFA*LSSFFSCSRNLFNY*VQEMSAEFIAQTHL TIQ*PV*AER*RTTPRNYSVVQFYVWEMMR*AHRLFKT*SDY**TEENNKSSIISVIW*Y LRKIFELIICVNISPVVSLSNLK*LFPISV*NNPAKTLRSGIYLLRGDYP*SAMFTNSQH PRM*NCRNGRRSSEIYFESRWDASIHWS*PDMTI*GIMAS >scf/ciona01/G126/seq_dir/hrs/G126P69344F.T0/G126P69344FB12.T0.seq 663 0 663 ABI Length = 663 Plus Strand HSPs: Score = 219 (77.1 bits), Expect = 8.7e-18, P = 8.7e-18 Identities = 39/58 (67%), Positives = 48/58 (82%), Frame = +2 Query: 1 LPYPRGLPIIGNIHQMGNFPHVKLTEWSKQFGDFYRIKMGRYDALVVNGHENIRRNCL 58 LP PRGLPIIGN+HQ+ PHVKL+EW+K+FGD +RIKMG +D LVV G++NIR N L Sbjct: 488 LPSPRGLPIIGNVHQLTTSPHVKLSEWAKEFGDLFRIKMGCFDTLVVTGYDNIRYNGL 661 >scf/ciona01/G126/seq_dir/hrs/G126P64092R.T0/G126P64092RD4.T0.seq file 5 743 ABI Length = 743 Minus Strand HSPs: Score = 142 (50.0 bits), Expect = 1.3e-16, Sum P(2) = 1.3e-16 Identities = 24/35 (68%), Positives = 31/35 (88%), Frame = -1 Query: 34 PHVKLTEWSKQFGDFYRIKMGRYDALVVNGHENIR 68 PHVKL+EW+K+FGD +RIKMG +D LVV G++NIR Sbjct: 614 PHVKLSEWAKEFGDLFRIKMGCFDTLVVTGYDNIR 510 Score = 83 (29.2 bits), Expect = 1.3e-16, Sum P(2) = 1.3e-16 Identities = 15/23 (65%), Positives = 18/23 (78%), Frame = -2 Query: 10 MTFWELPYPRGLPIIGNIHQMGN 32 + F +LP PRGLPIIGN+HQ N Sbjct: 688 IAFRDLPSPRGLPIIGNVHQXHN 620 >LQW279860.y1_1 GHEIESSSVPVHSRRIMARLQLSSYQFAAACCCGWAFTPEFLFDTFLRE*RESKLLGFVV AV*SRI*SLF*SGLI*ISVTCGWRSFLTHW*RIRGSMLLPLWVYMPLGKALNGKSSNPVV ANELSKLSAIH*KTS*PNGICFI*TLI*FLAGNNTRLMTFWELPYPRGLPIIGNIHQMGN FPHVKLTEWSKQFGDFYRIKMGRYDALVVNGHENIR*NGHVRFNHPQSYIRGNS*ADMRX >LQW279860.y1_2 DMR*NRARYQFTHAA*WQGCN*VLINLLPRVVAAGHLRRNFCLIRF*GSEGNQNYWVLWW LFKVEYEVCFKAG*FKFLSHVVGARF*LTGDEFEAPCCYHCGCTCPWARH*TVKAPTQWS LMSCPNCQPSIKKRLNQMASVSFKR*FNFWQVITRDL*RFGNYPIQGDYPSLGIFTRWGI SRT*N*QNGQNNSGIFIESRWGVMTRWL*MGTKTSGKMGTFGLITHKVTYVVTHKRT*GX >LQW279860.y1_3 T*DRIELGTSSLTPHNGKAAIKFLSICCRVLLRLGIYAGIFV*YVSKGVKGIKTTGFCGG CLKSNMKFVLKRVNLNFCHMWLALVSNSLVTNSRLHAATIVGVHALGQGTKR*KLQPSGR **VVQIVSHPLKNVLTKWHLFHLNVDLISGR**HETYDVLGTTLSKGITHHWEYSPDGEF PARETDRMVKTIRGFLSNQDGAL*RVGCKWARKHQVKWARSV*SPTKLHTW*LISGHEV >LQW228305.y1_1 KED*MSRSSGILSNQDGAL*RVGCKWARKHQVKWARSV*SPTKLHTW*LISGHEVYETEH RVITTVVAPTREDK*VTFIHSFSYHLAW**IIISKFI*IFSLTETASRKNPPRLLEDLPS KHPS*SKKDSVLVSVIIGIYL*LGSKHEVYKCTMCAWCKSRHPCYNSTVGMRCMNTPCVS GV*EDTHVIT*Q*A*GV*IHHVCLVYKKTPML*LDSEH*VYEYTMCVWCISRHPCYNLTV STRCMTML*PDSEHEVYEYIMCVWCIRRHPVITRK*TLGV*LLTCSGG*VNPCLTEITQG FIFKRSDNGKCNTPFLVKHLDPG*MRNESKRQSNPQKKTRKDRGRGX >LQW228305.y1_2 KRTK*AGPRGFYRIKMGRYDALVVNGHENIR*NGHVRFNHPQSYIRGNS*ADMRYMKQNT VL*QLSLPQHARINKLHSFIHLAIT*LGNKL*FLNLFKFFH*QKLPREKIRRVCWKTSLR NIQVDRRRTQY*FQ*L*VFTFD*AVSMRCINALCVPGVKVDTHVITRQWA*GV*IHHVCL VYKKTPML*LDSEHEVYEYTMCVWCIRRHPCYNSTVSIRCMNTPCVSGV*VDTHVIT*Q* ARGV*LCYNPTVSMRCMNTSCVSGV*EDTQL*LESEP*VFDYSRVPAVK*THV*LKSPKG LYLNEVTTVNVIPRFW*NTWTQGK*GTRAKDSLTRKKKPERIEEGE >LQW228305.y1_3 RGLNEPVLGDFIESRWGVMTRWL*MGTKTSGKMGTFGLITHKVTYVVTHKRT*GI*NRTP CYNNCRCPNTRG*ISYIHSFI*LSLSLVINYNF*IYLNFFTNRNCLAKKSAAFAGRPPFE TSKLIEEGLSISFSNYRYLPLIRQ*A*GV*MHYVCLV*K*TPML*LDSGHEVYEYTMCVW CIRRHPCYNLTVSMRCMNTPCVSGV*EDTHVITRQ*ALGV*IHHVCLVYK*TPML*LDSE HEVYDYVITRQ*A*GV*IHHVCLVYKKTPSYNSKVNLRCLITHVFRRLSKPMFN*NHPRV YI*TK*QR*M*YPVSGKTPGPRVNEEREQKTV*PAKKNPKG*RKG >LQW240272.y1_1 KGDITEPGPARFVYRLIVLLWRMIHLAVIM*LIYPIRGG*RQSL*HRCMNMI*NSPKTIT HKVTYVVTGRPKRARGL*NRTPVL*QLSLPRHARINKLHTW*LVSEHEVYETEHPC*RLS LSHHAGIHNLNNFNYIDFQGLVGDLHDTVIYSTTSVSSTICFGRSFTRQDPELKEFLRNF QSFDKAMGASQIINFWPFLKYFPVLGKSFRVISHNLYSRMGEDGTLF*SIYSYILVVNKE HSKNDKTCSVTFIDRCNCLKTIRI*ILEQRCHFPKX*MVTRR*IYMKDKYNGQQRKRARR DEKKEKKDQGKK*QEHKKKQRRNEKPX >LQW240272.y1_2 KEI*LSLVRRDLYIDLLFYFGG*FIWL**CNLFILYVAGNDSPYNTGA*I*YKILPKQ*P TK*HTW*LVGLSGHEVYETEHPCYNNCRCPVMRG*INYIRGNL*VSTRCMKQNTRVNDCR YPTTREYTT*TTLITLISRV**ATSTTR*YTAPPA*VPRFVSGEVLQGKTRS*KNFSEIF KVSTKPWARLRLSTFGHF*NTFRCWESPFG*FPIIYIVGWGKMGHFFNLYTRTFW**IKN IQRMIKLVL*LS*TVVIV*KRSGFKY*SKGVIFPSXKW*QGGEFT*RTNITGNSANGHGE TRKKKKRTRGKNSKNTKKNKEEMKNH >LQW240272.y1_3 RRYN*AWSGEICI*TYCFTLADDSFGCNNVTYLSYTWRVTTVLITQVHEYDIKFSQNNNP QSNIRGNW*A*AGTRFMKQNTRVITTVVAPSCEDK*ITYVVTCK*ARGV*NRTPVLTTVV IPPRGNTQLKQL*LH*FPGFSRRPPRHGDIQHHQREFHDLFRAKFYKARPGVERISQKFS KFRQSHGRVSDYQLLAIFKILSGAGKVLSGNFP*FI**DGGRWDTFLIYILVHFGSK*RT FKE**NLFCDFHRPL*LFKNDQDLNIRAKVSFSQAXNGDKEVNLHEGQI*RATAQTGTAR REKRKKGPGEKIARTQKKTKKK*KT blast hit from opposite end of DEV12172.x1 = >SEQUENCE 88 197-251 MID REGION 37% TO 2B6 Length = 56 Plus Strand HSPs: Score = 175 (61.6 bits), Expect = 4.3e-16, P = 4.3e-16 Identities = 32/35 (91%), Positives = 34/35 (97%), Frame = +3 Query: 72 KNPELKEFLRNVQSFDKAMGASQIINFWPFLKYFP 176 ++PELKEFLRN QSFDKAMGASQIINFWPFLKYFP Sbjct: 22 QDPELKEFLRNFQSFDKAMGASQIINFWPFLKYFP 56 Score = 65 (22.9 bits), Expect = 0.00056, P = 0.00056 Identities = 18/47 (38%), Positives = 22/47 (46%), Frame = +1 Query: 22 STQRESTICFGRSFTRARTRS*KNFSEMFKVSTKPWARLRLSTFGHF 162 +T STICFGRSFTR K F F+ K ++ F F Sbjct: 6 TTSVSSTICFGRSFTRQDPEL-KEFLRNFQSFDKAMGASQIINFWPF 51 GCiWno834_j23.b1 from opposite end of seq downstream of I-helix YNLLLIQADRDTRVWENPE QFEPERFLARDPTTGGARVVASETSKILNWGAGKRRCPGAELSRHELFIYIANLVKLCYI EQAVEGIEPAIPWPCTPGISTKPKAFRVKVTQR* >GCiWno38_g15.b1_1 LYVVYVGTTLGHLRAXNMRDLADCLWAQSNQVNSNGTAPRHTANGATDELKPRHAMNGAN GNGMTHHNTNGDVTHSNGINGEPPTKINRQLTDQQRRIAYGASDAFGAGFDTISAMITWS IFYMAVFPEHQRKVICIK*LSTYISSHYVNGDLILASNNIVGRGKMGHPTILFSRTIL** TKNIQVILKLYPHDSHRPLLIV*NTIRIICAKXCPILPHPYYNRIMTY*IRERWDIXSYI FTYHLVVNKEYSKNIKPYLHNP*TGCNCLNTINTI*ILYVAQIEKNRPLERHVXLRIRX >GCiWno38_g15.b1_2 FTLSMLEQHWDTYVPXI*ETWQIVCGPKATRLTAMARRHATQQMAPQTS*SHATQ*MVPT VMV*HITIRMVTSHIATGLTGNPLPR*TVN*RINSAV*RMAQATHSAQVSTL*AL*SRGR FSTWPFFLNTNER*FALNDYLRIFPHIMLMAT*F*LRII**VGGRWDTLPFCFLVPFCSK QRTYK*F*NYILTTLIDLC*LFKTRSG*YVLXGVRSYPTLTIIE**HTRSGKDGTXFHIF SRTIW**TRNIQKI*NRIFTIHKLVVIV*IR*TRYKSYMSPRSRRIDR*NVMFXYVYG >GCiWno38_g15.b1_3 LRCLCWNNTGTLTCPQYERLGRLSVGPKQPG*QQWHGATPHSKWRHRRVEATPRNEWCQR *WYDTSQYEW*RHT*QRD*RGTPYQDKPSTNGSTAPYSVWRKRRIRRRFRHYKRYDHVVD FLHGRFS*TPTKGNLH*MIIYVYFLTLC*WRLDFSFE*YSRSGEDGTPYHSVFSYHFVVN KEHTSNSKTISSRLS*TFVNCLKHDQDNMC*XVSDLTPPLL*SNNDILDQGKMGHXFIYF HVPFGSKQGIFKKYKTVSSQSINWL*LFKYDKHDINLICRPDREESTVRTSCXITYT >LQW199164.x1_3 RKEEIFSIYFHVPFASKQGIFKKI*NRIFTNPINCC*LFKIR*NTI*NHYMSSQ IREEID RLETSMFSLRHHGDVCP YTQAWLYEVLRHISVSPLLVPHYTVKQVEVNGTMIPAGVVVMY NVANVSKYECM*LIYPCSQ*KSL*HGCSVSYTLCLLKSYHVCNLFILAWRGNHRRYNTGV LFHKTRTCLRVNTYVTYLSSHGGATTVVITHVF**YK*TLSIYAFKIVVSNRKYIYSRTI YKLLLIQLTEISSWENPNN*A*RIGRNTTGGTMVSERKLLGRKGCEHYQQRILTEVDHEG NNRYRAHRNRGER*IPKN >GCiWno777_c20.g1_1 SFSSDPR*RMSYTQAWLYEVLRHISVSPLLVPHYTVKQVEVNGTMIPAGVVVLFNVANVS KYECM*LIYPCSQ*KSL*HGCSVSYTLCPLTS*MYVTYLSSHGGATTVVITRVFCFIHLI PAYKLPRM*LIYPRMEGQRQSL*HTCSVYLNNHCFYTFLR**FSN*WVFLTAELIYNLLL IQADRDTRVWENPEQFEPERFLARDPTTGGARVVASETSKILNWGAGKRRCPGAELSRHE LFIYIAKPGKVMVHPTGSGRESNPRSLGLYPKNFNQNKKLSEFK*RTVDFGGHGVGTQPS ISKKKKTFKX >GCiWno832_l19.b1 TTTCTACACCTTGTGCCTGCTTACAAGTTACCACGTATGTAACTTATTTATCCTCGCATGGAGGGGCAACGACAGTCGTT ATAACACGGGTGTTCTGTTTCATACACCTCATACCTGCTTACAAGTTACCACGTATGTAACTTATTTATCCTCGCATGGA GGGGCAACGACAGTCGTTATAACACACGTGTTCTGTTTATTTAAATAACCATTGTTTTTATACGTTTTTAAGATAGTAGT TCTCAAACTGTTTGTTTTTTTTAACAGCAGAACTTATATATAACTTATTACTCATACAGGCTGACAGAGATACTCGAGTT TGGGAAAACCCCGAACAATTTGAGCCTGAGCGATTTCTGGCACGAGATCCAACCACTGGGGGCGCAAGAGTGGTTGCAAG TGAAACGTCGAAGATTTTAAATTGGGGGGCGGGAAAGAGGCGTTGTCCCGGGGCTGAGTTATCCAGACACGAACTATTTA TTTACAATGCAAACCTGGTAAAGTTATGTTACATCGAACAGGCAGTGGAGGGAATCGAACCCGCGATCCCTTGGCCTTGT ACCCCAGGAATTTCAACCAAACCAAAAGCTTTCCGAGTCAAAGTAACGCGGCGTTGATTTTGGGGTCACGGTGTGGGACC ACAGCAAGTATTTCAAAGAAAAATAAACATTTTAGAAAATCTTCACGAAAGAAATCCATTACAAGCTAAAGATAAACTTC GTANACGACGCAGACAGCGCCAGTGGCGCAAACGACGTCGATGGCGCAAGTGACGCGAATGACGCAAATGAGAGGATGTA TTTGNTAAACCCACTATAAATCAATAAAAATGACGAAACAANCGACCAGAAACACAAACGGCTTN >GCiWno832_l19.b1_1 FLHLVPAYKLPRM*LIYPRMEGQRQSL*HGCSVSYTSYLLTSYHVCNLFILAWRGNDSRY NTRVLFI*ITIVFIRF*DSSSQTVCFF*QQNLYITYYSYRLTEILEFGKTPNNLSLSDFW HEIQPLGAQEWLQVKRRRF*IGGRERGVVPGLSYPDTNYLFTMQTW*SYVTSNRQWRESN PRSLGLVPQEFQPNQKLSESK*RGVDFGVTVWDHSKYFKEK*TF*KIFTKEIHYKLKINF VXDADSASGANDVDGASDANDANERMYLXNPL*INKNDETXDQKHKRLX >GCiWno832_l19.b1_2 FYTLCLLTSYHVCNLFILAWRGNDSRYNTGVLFHTPHTCLQVTTYVTYLSSHGGATTVVI THVFCLFK*PLFLYVFKIVVLKLFVFFNSRTYI*LITHTG*QRYSSLGKPRTI*A*AISG TRSNHWGRKSGCK*NVEDFKLGGGKEALSRG*VIQTRTIYLQCKPGKVMLHRTGSGGNRT RDPLALYPRNFNQTKSFPSQSNAALILGSRCGTTASISKKNKHFRKSSRKKSITS*R*TS XTTQTAPVAQTTSMAQVTRMTQMRGCIX*THYKSIKMTKQXTRNTNGX >GCiWno832_l19.b1_3 STPCACLQVTTYVTYLSSHGGATTVVITRVFCFIHLIPAYKLPRM*LIYPRMEGQRQSL* HTCSVYLNNHCFYTFLR**FSNCLFFLT AELIYNLLLIQADRDTRVWENPEQFEPERFLA RDPTTGGARVVASETSKILNWGAGKRRCPGAELSRH ELFIYNANLVKLCYIEQAVEGIEP AIPWPCTPGISTKPKAFRVKVTRR* FWGHGVGPQQVFQRKINILENLHERNPLQAKDKLR XRRRQRQWRKRRRWRK*RE*RK*EDVFXKPTINQ*K*RNXRPETQTA >sequence 41, 77 60% to savignyi ortholog B 57% to ortholog A no ESTs MLRIFAFASQISMETLLTSAAILTCVLFVVYDTWWRFLGTSGTLRGRN GFPVFGCFPLLGKNKERVFMNWSRTSYGPIYYARLGASRVLVLNGYEAVREALVLRPQ 297 298 AFAGRCKTELMKLLYEGQHGIMQLDHGPMWKAQRKFGQNALGSLGMGKRSLQ (0) agtt (1?) QQIVNEFNCLSSTLEXELLANGSKGAYLDEMLWLYAVTNISLLIFNESFDPDNEK (2) RERFLYLLMYVPFLKNLPLVRQQLNVTIQGRKTKLAKFKQFVENHRQSRDPDDPRDFIDCYLNTMDSKSANDS (2) FTEKQLLYFMNDLFIAGTETSSNTNSWALLLLLKNPEVMKRLRDEIDSLGREPTL (0) EDEYKMPYTRAVMQEIFRYRPALPCNI IPRKTTTSIELNGHSIPAGMPVIANLWSVHHDPVTWAPDPE TFRPERHLNRDGEFMTSDHVMPFSVGLRSCIGRNLARNELFIFLTSILRRF NLEFADGCYVDDMTGESGLLLHPPSYKVKGSLRA* LQW253687.x1 exon 1 LGI470.x1 exon 1 LQW158767.y1 exon 1 LQW148467.y1 exon 1 DEV30421. y1 exon 1 LQW151162.y1 exon 1 LQW230635.y1 exon 2 probably some errors at 5 prime end exon boundary not right LQW221856.x1 exon 3 .y1 = 3 prime UTR LQW148467.x1 exons 3, 4 LQW253687.y1 exons 4, 5 I-helix to k-helix DEV30421. x1 exon 5 extreme C-term GCiWno669_a04.b1 >GCiWno669_a04.b1_1 RTFAHQHCTSYKAGRIFLIFNTLYTNQAIACLKPFLSSQEDEYKMPYTRAVMQEIFRYRP ALPCNI IPRKTTTSIELNGHSIPAGMPVIANLWSVHHDPVTWAPDPETFRPERHLNRDGE FMTSDHVMPFSVGLRSCIGRNLARNELFIFLTSILRRFNLEFADGCYVDDMTGESGLLLH PPSYKVKGSLRA* Savignyi ortholog A of seq 41 74% to savignyi ortholog A of seq 41 Contiguity verified, not a hybrid. 5 exons 34% to 2R1 fugu 34% to 2C9 MLYLSLFSSNFSIEVVLTCFCLFLLLVYNVRVRHGGTSGTLPGKDGFPIVGCFPMLGKHKE RVLMKWSTSSLGPMFYIRLGTSKVLVLNGYNAIKEALEQKPLPIAGRVESKFVKMLYDGD HGLIQLDYGPMWKEQRKFGQTTLGGLGMGKRSFQ (0) SKIRDEFNCLAATLESELSINGPKGVNFTSMLRLYAANITSSLVFNQTFDSTW (2) RERFLIQMMYMPWLKYLPIVWKQLALSKRCRRDKVKIFQALVDKHRKSRDPNDPRDFVDCYLNVMEKKQGKNS (2) SFTEKQLLYYIVDLFLAGTETSANTNAWAILLVLKNPQVKAKLRSELEAFGKSPTL (0) EDEAKMPYTRAVMQEVFRYRTSARLNIVARRTT SDLELNGYKVPANMPVIANLWSVHHDPLTWAPDPETFRPERHLDGDGNFIPNDHVMPFSV GARSCIGKNLAKNEVFIFITSIFSQFDLELADGCHVDNMDGDSGMLLHPPEYRVKGSIRV* G126P600443R.T0/G126P600443RE8.T0.seq 739 (10) exon 1 G126P617143R.T0/G126P617143RC7.T0.seq 754 (37) exon 1 intron 1 G126P607643R.T0/G126P607643RF1.T0.seq 740 (25) exon 1 intron 1 G126P68887F.T0/G126P68887FA2.T0.seq 731 (13) intron 1 exon 2 G126P66829F.T0/G126P66829FG5.T0.seq 731 (03) exon 2 G126P65769F.T0/G126P65769FF8.T0.seq 695 (05) exon 3 G126P68321F.T0/G126P68321FH4.T0.seq 752 (07) exon 3 G126P66700R.T0/G126P66700RF7.T0.seq 731 (04) intron 3 exon 4 G126P64123F.T0/G126P64123FG2.T0.seq 710 (00) exons 4, 5 G126P65425R.T0/G126P65425RC9.T0.seq 728 (03) exon 5 G126P69591R.T0/G126P69591RH9.T0.seq 748 (09) exon 5 Savignyi ortholog B of seq 41 this gene is verified and is not a hybrid 74% to savignyi ortholog A of seq 41 5 exons 35% to 2C18, 33% to 2R1 fugu 1 MLFSSYLTFNFFIESLLAGLCLFLLLVYDVFIRLR 35 36 GTSGTLPGKDGFPLVGCFPMLGKHKERMLMKWSSSGLGPVFYARLGASRVLVLNGYDVIK 95 96 EALLQRPLAMAGRVESDLIQELYDGKHGLIQLDHGPLWKEQRKFGQTTLGGLGMGKRSFE 155 (0) 156 SKIVDEFNCFATTLENELNMNEPKGVNLTRMLRLYAANVISSLIFNQTFEISC 208 (2) 209 RERFLILLMYVPGLKNLPIVRQQLAITTRTRLDKVKIFRTLVEEHRKSRDPNEPRDFIDCYLNVLAKNKGENS (2) SFTEKQLLYYIADLFLAGTETSATTNAWALLLVLKNPEVKRKLRAELDALGKQPTL (0) EDECRMPYTRAVMQEVFRFRPAVPFNI IARKTTSELELKGYKIPAGMPVIANLWSVHH DPVTWAPDPEIFRPGRHLDDDGNFVPSNHVIPFSVGARSCIGRNLAKNELFVFITSVLRR FDLELADGCHVGDISGDSGMLLHPPKYKVKGFG* G126P64785F.T0/G126P64785FC9.T0.seq 733 (00) exon 1* G126P64912F.T0/G126P64912FD2.T0.seq 730 (01) exons 1, 2* G126P66934F.T0/G126P66934FE3.T0.seq 743 (04) exons 1, 2* G126P64442F.T0/G126P64442FD9.T0.seq 765 (01) exons 1, 2* G126P63980F.T0/G126P63980FH9.T0.seq 686 (01) exons 2, 3* G126P605501F.T0/G126P605501FH8.T0.seq 690 (17) exons 3, 4* G126P613445F.T0/G126P613445FB9.T0.seq 757 (30) exons 3, 4* G126P601014R.T0/G126P601014RH9.T0.seq 1019 (08) exon 4* G126P65053R.T0/G126P65053RF5.T0.seq 709 (02) exon 4* G126P604759R.T0/G126P604759RC1.T0.seq 977 (18) exon 4* G126P66827R.T0/G126P66827RA10.T0.seq 689 (03) exon 5* G126P608906F.T0/G126P608906FH11.T0.seq 724 (29) exon 5* Savignyi ortholog C of seq 41 RERFLILLMYVPGVKKLPFVRAQLAITTRTRLDKVKFSRPFGEKHRKSRGPNEPRDFHDCYLNVLAKIKGK (10) 209 RERFLILLMYMPGLKNLPIVRQQLAVTTRTRRNKIKIFQTLVEEHRKSRDPNEPRDFIDCYLNVLEGKKEENR 281 SFSEKQLLYYIADLYMAGTETSANTNSWALLLVLKNPEVKKKLKAELDALGKQPAL 338 EDECRMPYTRAVMQEVFRFRSALPFNIIARKTTSELKLNGYKIPAGMPVIANLWSVHH 395 396 DSVTWAPDPEIFRPERHLDDDGNFVPSNHVIPFSVGARSCIGRNLAKNELFVFITSILRR 455 456 FDLELADGCHVGDISGDSGMLLHPPKYKVKGSVLM* 490 G126P63984R.T0/G126P63984RE6.T0.seq 728 (00) exon 5 G126P66741R.T0/G126P66741RC12.T0.seq 744 (07) exon 3 G126P611715F.T0/G126P611715FD5.T0.seq 675 (24) exon 5 >scf/ciona01/G126/seq_dir/hrs/G126P64123F.T0/G126P64123FG2.T0.seq 710 0 710 ABI Length = 710 Plus Strand HSPs: Score = 191 (67.2 bits), Expect = 3.8e-25, Sum P(2) = 3.8e-25 Identities = 33/56 (58%), Positives = 48/56 (85%), Frame = +2 Query: 43 SFTEKQLLYFMNDLFIAGTETSSNTNSWALLLLLKNPEVMKRLRDEIDSLGREPTL 98 + +E QLLY++ DLF+AGTETS+NTN+WA+LL+LKNP+V +LR E+++ G+ PTL Sbjct: 47 ALSENQLLYYIVDLFLAGTETSANTNAWAILLVLKNPQVKAKLRSELEAFGKSPTL 214 Score = 112 (39.4 bits), Expect = 3.8e-25, Sum P(2) = 3.8e-25 Identities = 21/27 (77%), Positives = 23/27 (85%), Frame = +2 Query: 99 EDEYKMPYTRAVMQEIFRYRPALPCNI 125 EDE KMPYTRAVMQE+FRYR + P NI Sbjct: 560 EDEAKMPYTRAVMQEVFRYRTSAPLNI 640 EDEAKMPYTRAVMQEVFRYRTSAPLNIVARRTTSDLELKGYKVPANMPVI >scf/ciona01/G126/seq_dir/hrs/G126P66700R.T0/G126P66700RF7.T0.seq 731 0 731 ABI Length = 731 Plus Strand HSPs: Score = 177 (62.3 bits), Expect = 4.4e-16, Sum P(2) = 4.4e-16 Identities = 34/41 (82%), Positives = 39/41 (95%), Frame = +3 Query: 43 SALSENQLLYYIVDLFLAGTETSANTNAWAILLVLKNPQVK 83 S+ +E QLLYYIVDLFLAGTETSANTNAWAILLVLKNP+++ Sbjct: 597 SSFTEKQLLYYIVDLFLAGTETSANTNAWAILLVLKNPRLR 719 Score = 39 (13.7 bits), Expect = 4.4e-16, Sum P(2) = 4.4e-16 Identities = 8/8 (100%), Positives = 8/8 (100%), Frame = +2 Query: 80 PQVKAKLR 87 PQVKAKLR Sbjct: 707 PQVKAKLR 730 >scf/ciona01/G126/seq_dir/hrs/G126P66700R.T0/G126P66700RF7.T0.seq 731 0 731 ABI GAGCTCCATGTGGTGGAATTCCGTGTTTTTTTGACCACTCAAACCAGTGT TTAACATTTCCGCACTAGTATTGTTGTTAATCAAAATCTCAGGATTAGAT CGGACAATTTGTTCTACATATTAACAAACTTATTTGTTTGCATCATTATT GTACCCCATGCTAACCTGTTGTATAGTTTTCTTTCTAGTTTCGACAAGAA ATTTAACTGGCGTTGCTTAAAACCTGTGGTTTATTAGGTTAAAACTAAGG TATAAGGATTATCTCAATATCTTAGACAGAACACCGCATAACCTCTGACA ATCCAAATTTGTTTACTCTGTTTTATGGCAATAAGCGAGTATTATAAGTC TTTCTCTGCTTTCACCACAACTCATGAAACACCATCCTAGTTGCTATTAT ATTCTATCCAAGATTATTACAGGGGGTGTTTATAAACTGAAAAATTCCTT TGTTTTTATTTGCGATGTATAAGGTACGCATTTTATTATTTTGTGCAGTA ACAAATCAAGCAACAAAGTAGTTTGCTTTAATTTCAATTTAACGTGACTG ATTTTAATTTCAATGTTATTGTGTTTGTATTGTTTAATTGACTTTTAGCA GCTTTACGGAGAAACAGCTGTTGTATTACATTGTTGATTTGTTTCTGGCG GGAACTGAAACTTCGGCTAATACGAACGCCTGGGCGATATTGCTTGTGCT TAAAAACCCCAGGTTAAGGCAAAGTTAAGAA >_1 ELHVVEFRVFLTTQTSV*HFRTSIVVNQNLRIRSDNLFYILTNLFVCIIIVPHANLLYSF LSSFDKKFNWRCLKPVVY*VKTKV*GLSQYLRQNTA*PLTIQICLLCFMAISEYYKSFSA FTTTHETPS*LLLYSIQDYYRGCL*TEKFLCFYLRCIRYAFYYFVQ*QIKQQSSLL*FQF NVTDFNFNVIVFVLFN*LLAALRRNSCCITLLICFWRELKLRLIRTPGRYCLCLKTPG*G KVKX >_2 SSMWWNSVFF*PLKPVFNISALVLLLIKISGLDRTICSTY*QTYLFASLLYPMLTCCIVF FLVSTRNLTGVA*NLWFIRLKLRYKDYLNILDRTPHNL*QSKFVYSVLWQ*ASIISLSLL SPQLMKHHPSCYYILSKIITGGVYKLKNSFVFICDV*GTHFIILCSNKSSNKVVCFNFNL T*LILISMLLCLYCLIDF*QLYGETAVVLHC*FVSGGN*NFG*YERLGDIACA*KPQVKA KLRX >_3 APCGGIPCFFDHSNQCLTFPH*YCC*SKSQD*IGQFVLHINKLICLHHYCTPC*PVV*FS F*FRQEI*LALLKTCGLLG*N*GIRIISIS*TEHRITSDNPNLFTLFYGNKRVL*VFLCF HHNS*NTILVAIIFYPRLLQGVFIN*KIPLFLFAMYKVRILLFCAVTNQATK*FALISI* RD*F*FQCYCVCIV*LTFSSFTEKQLLYYIVDLFLAGTETSANTNAWAILLVLKNPRLRQ S*E >scf/ciona01/G126/seq_dir/hrs/G126P600144F.T0/G126P600144FG4.T0.seq 742 0 742 ABI Length = 742 Plus Strand HSPs: Score = 225 (79.2 bits), Expect = 1.8e-18, P = 1.8e-18 Identities = 47/53 (88%), Positives = 49/53 (92%), Frame = +2 Query: 9 VFLTTQTSV*HFRTSIVVNQNLRIRSDNLFYILTNLFVCIII-VPHANLLYSF 60 +F +TSV*HFRTSIVVNQNLRIRSDNLFYILTNLFVCIII VPHANLLYSF Sbjct: 410 IF*PLKTSV*HFRTSIVVNQNLRIRSDNLFYILTNLFVCIIIIVPHANLLYSF 568 >scf/ciona01/G126/seq_dir/hrs/G126P600144F.T0/G126P600144FG4.T0.seq 742 0 742 ABI CGGAGATTGAATCTCGCCCTGTGGTGGAATTCTTTATTCTTTGCTATTTT TTTCTTTATCATTGCACAAAAATAGCAAAAGATAAACTAAACAAAGTGTA ACAAAAAATCTAAACTCATATTCTTCTCAGGCGTGAAAGATTCCTGATCC AAATGATGTACATGCCTTGGTTAAAGTACTTGCCCATTGTTTGGAAACAG TTGGAGCTTTCGAAACGCTGCAGAAGAGACAAAGTTAAGATTTTCCAGGC ACTGGTTGACAAGCACCGTAAGTCACGTGACCCCAATGATCCGCGGGATT TTGTTGACTGCTATTTAAACGTGATGGAGAAAAAGCAAGGGAAAAACAGG TAACTAATGCACACTAATGGGCTTAAGTTGTAGGTTCACAGCGTGGACGA AATGGCGTGATTTTTTGACCACTCAAAACCAGTGTTTAACATTTCCGCAC TAGTATTGTTGTTAATCAAAATCTCAGGATTAGATCGGACAATTTGTTCT ACATATTAACAAACTTATTTGTTTGCATCATTATTATTGTACCCCATGCT AACCTGTTGTATAGTTTTCTTTCTAGTTTCGACAAGAAATTTAACTGGCG TTGCTTAAAACCTGTGGTTTATTAGGTTAAAACTAATTTATAAGGATTAT CTTAATATCTTATACAGAACACCGCATTAGCTCTGGCAATCCAAATTTGT TTACTCCGTTTTATGGCGATAAACGAGTATTATAAGTCATTC >_1 RRLNLALWWNSLFFAIFFFIIAQK*QKIN*TKCNKKSKLIFFSGVKDS*SK*CTCLG*ST CPLFGNSWSFRNAAEETKLRFSRHWLTSTVSHVTPMIRGILLTAI*T*WRKSKGKTGN*C TLMGLSCRFTAWTKWRDFLTTQNQCLTFPH*YCC*SKSQD*IGQFVLHINKLICLHHYYC TPC*PVV*FSF*FRQEI*LALLKTCGLLG*N*FIRIILISYTEHRISSGNPNLFTPFYGD KRVL*VIX >_2 GD*ISPCGGILYSLLFFSLSLHKNSKR*TKQSVTKNLNSYSSQA*KIPDPNDVHALVKVL AHCLETVGAFETLQKRQS*DFPGTG*QAP*VT*PQ*SAGFC*LLFKRDGEKAREKQVTNA H*WA*VVGSQRGRNGVIF*PLKTSV*HFRTSIVVNQNLRIRSDNLFYILTNLFVCIIIIV PHANLLYSFLSSFDKKFNWRCLKPVVY*VKTNL*GLS*YLIQNTALALAIQICLLRFMAI NEYYKSF >_3 EIESRPVVEFFILCYFFLYHCTKIAKDKLNKV*QKI*THILLRRERFLIQMMYMPWLKYL PIVWKQLELSKRCRRDKVKIFQALVDKHRKSRDPNDPRDFVDCYLNVMEKKQGKNR*LMH TNGLKL*VHSVDEMA*FFDHSKPVFNISALVLLLIKISGLDRTICSTY*QTYLFASLLLY PMLTCCIVFFLVSTRNLTGVA*NLWFIRLKLIYKDYLNILYRTPH*LWQSKFVYSVLWR* TSIISH >scf/ciona01/G126/seq_dir/hrs/G126P69549R.T0/G126P69549RE7.T0.seq 732 0 732 ABI Length = 732 Minus Strand HSPs: Score = 584 (205.6 bits), Expect = 1.5e-58, Sum P(2) = 1.5e-58 Identities = 110/110 (100%), Positives = 110/110 (100%), Frame = -1 Query: 11 FILCYFFLYHCTKIAKDKLNKV*QKI*THILLRRERFLIQMMYMPWLKYLPIVWKQLELS 70 FILCYFFLYHCTKIAKDKLNKV*QKI*THILLRRERFLIQMMYMPWLKYLPIVWKQLELS Sbjct: 474 FILCYFFLYHCTKIAKDKLNKV*QKI*THILLRRERFLIQMMYMPWLKYLPIVWKQLELS 295 Query: 71 KRCRRDKVKIFQALVDKHRKSRDPNDPRDFVDCYLNVMEKKQGKNR*LMH 120 KRCRRDKVKIFQALVDKHRKSRDPNDPRDFVDCYLNVMEKKQGKNR*LMH Sbjct: 294 KRCRRDKVKIFQALVDKHRKSRDPNDPRDFVDCYLNVMEKKQGKNR*LMH 145 >scf/ciona01/G126/seq_dir/hrs/G126P69549R.T0/G126P69549RE7.T0.seq 732 0 732 ABI NTATCTTGACACTGAAACTCCATGTGGTGNGATTCTTTTGNTTAACAACA ATACTAGTGCGGAAATGTTAAACACTGGTTTTGAGTGGTCAAAAAATCAC GCCATTTCGTCCACGCTGTGAACCTACAACTTAAGCCCATTAGTGTGCAT TAGTTACCTGTTTTTCCCTTGCTTTTTCTCCATCACGTTTAAATAGCAGT CAACAAAATCCCGCGGATCATTGGGGTCACGTGACTTACGGTGCTTGTCA ACCAGTGCCTGGAAAATCTTAACTTTGTCTCTTCTGCAGCGTTTCGAAAG CTCCAACTGTTTCCAAACAATGGGCAAGTACTTTAACCAAGGCATGTACA TCATTTGGATCAGGAATCTTTCACGCCTGAGAAGAATATGAGTTTAGATT TTTTGTTACACTTTGTTTAGTTTATCTTTTGCTATTTTTGTGCAATGATA AAGAAAAAAATAGCAAAGAATAAAAATATAAAATAGACGGCAAAACTACA GTAATAAATATACAAATATATAAAGATGGTATGACAAAGGAAAATAAACG TCCGGCCCGTTGGTCTACGTTTTAAAGTGCGTCGCCTTTCAATCGAAAGG TTGCAGGTGCGAAACTGGTCGCTAGCCAGTCGGTTGTGTCATTGGGCAAG CCACTTTACGGACATTGCCTGAACCCAGCGGATAAATGGTTTCTACCAAA TTAAAGTAACGTGTCTATCACATACAACACAC >_4 VCCM**TRYFNLVETIYPLGSGNVRKVACPMTQPTG*RPVSHLQPFD*KATHFKT*TNGP DVYFPLSYHLYIFVYLLL*FCRLFYIFILCYFFLYHCTKIAKDKLNKV*QKI*THILLRR ERFLIQMMYMPWLKYLPIVWKQLELSKRCRRDKVKIFQALVDKHRKSRDPNDPRDFVDCY LNVMEKKQGKNR*LMHTNGLKL*VHSVDEMA*FFDHSKPVFNISALVLLLXKRIXPHGVS VSRX >_5 VLYVIDTLL*FGRNHLSAGFRQCP*SGLPNDTTDWLATSFAPATFRLKGDAL*NVDQRAG RLFSFVIPSLYICIFITVVLPSILYFYSLLFFSLSLHKNSKR*TKQSVTKNLNSYSSQA* KIPDPNDVHALVKVLAHCLETVGAFETLQKRQS*DFPGTG*QAP*VT*PQ*SAGFC*LLF KRDGEKAREKQVTNAH*WA*VVGSQRGRNGVIF*PLKTSV*HFRTSIVVXQKNXTTWSFS VKIX >_6 CVVCDRHVTLIW*KPFIRWVQAMSVKWLAQ*HNRLASDQFRTCNLSIERRRTLKRRPTGR TFIFLCHTIFIYLYIYYCSFAVYFIFLFFAIFFFIIAQK*QKIN*TKCNKKSKLIFFSGV KDS*SK*CTCLG*STCPLFGNSWSFRNAAEETKLRFSRHWLTSTVSHVTPMIRGILLTAI *T*WRKSKGKTGN*CTLMGLSCRFTAWTKWRDFLTTQNQCLTFPH*YCC*XKESHHMEFQ CQDX >_4 DLKSVDR*WYRIQPLVIRQINSRPSSGYRSDCSVLYVIDTLL*FGRNHLSAGFRQCP*SG LPNDTTDWLATSFAPATFRLKGDALKR*TNGPDVYFPLSYHLYIFVYLLL*FCRLFYIFI LCYFFLYHCTKIAKDKLNKV*QKI*THILLRRERFLIQMMYMPWLKYLPIVWKQLELSKR CRRDKVKIFQALVDKHRKSRDPNDPRDFVDCYLNVMEKKQGKNR*LMHTNGLKV*NXHXQ KRMXSVXKVS >_5 RS*VSR*VVVSNPAAGYTSDQLAPIVGLPERLQCVVCDRHVTLIW*KPFIRWVQAMSVKW LAQ*HNRLASDQFRTCNLSIERRRT*TLDQRAGRLFSFVIPSLYICIFITVVLPSILYFY SLLFFSLSLHKNSKR*TKQSVTKNLNSYSSQA*KIPDPNDVHALVKVLAHCLETVGAFET LQKRQS*DFPGTG*QAP*VT*PQ*SAGFC*LLFKRDGEKAREKQVTNAH*WA*GVEXPPT KTXXFSXQSVX >_6 EILSQSIGSGIESSRWLYVRSTRAHRRVTGAIAVCCM**TRYFNLVETIYPLGSGNVRKV ACPMTQPTG*RPVSHLQPFD*KATHLNVRPTGRTFIFLCHTIFIYLYIYYCSFAVYFIFL FFAIFFFIIAQK*QKIN*TKCNKKSKLIFFSGVKDS*SK*CTCLG*STCPLFGNSWSFRN AAEETKLRFSRHWLTSTVSHVTPMIRGILLTAI*T*WRKSKGKTGN*CTLMGLRCRIXTX KNX*XQXPKCL >_1 SFRYCISPCGGIPQLTPQ*ICCFLNRFIENIRLNPW*KNALTQATGKRGVLSPVVLII*P NSSKRFVCLVSPIG*ITGRK*KSC*LKTLLQLVSCVVVRRT*LESSKLN*PNSLIIKTFG DLKSVDRLWYRIKPLVIRQITSRLSSGYRSYCGVLYMIDTFLQFGRTHLSAGFKQCP*SA LPNDTTNWLATSFAPATFRLKGDALXTLDQRARAFIFLCHTIFI*LYIYYCSXAXYFIXL FFAIXFFIX >_2 AFATVSRPVVEFHSSLHSRYVVF*IDL*KTYA*ILGRKMH*HKRLASEGF*AQLF*LYDQ TLQKDSFASLVQSVK*LVESKKVVN*KPSSS*SVVSL*EELSLNPVS*TDRIA*SLRPLE ILSQSIGCGIESSRWLYVRSPRAYRRVTGAIAVCCI**TRSFNLVEPIYPLVSSNVRKVP CPMTQPTG*RPVSHLQPFD*KATHXKR*TNGPGRLFSFVIPSLYSCIFTTVVXPXILYXY SLLXXSLSX >_3 LSLLYLALWWNSTAHSTVDMLFFK*IYRKHTLKSLVEKCINTSDWQARGFKPSCSDYMTK LFKKIRLPR*SNRLNNWSKVKKLLIKNPPPASQLCRCEKNLA*IQ*VKLTE*PNH*DLWR S*VSR*VVVSNQAAGYTSDHLAPIVGLPELLRCVVYDRHVPSIW*NPFIRWFQAMSVKCL AQ*HNQLASDQFRTCNLSIERRRTXNVRPTGPGVYFPLSYHLYIAVYLLL*XCRLFYIXI LCYXFLYQ >_1 NLDTETPCGGILTFCHTTVLTRV*LFFHTRGDQHKHPTVN*YISNYFSPKFEMSSTVLQR PWKAN*VSTDQRE*ISLPCYGFTLQI*PHP*FSTKHLTVLGLRTLFHSSLHSRYVVF*ID L*KTYA*ILGRKMH*HKRLASEGF*AQLF*LYDQTLQKDSFASLVQSVK*LVESKKVVN* KPSSS*SVVSL*EELSLNPVS*TDRIA*SLRPLEILSQSIGCGIESSRWLYVRSPRAX >_2 TWTLKLHVVXF*PFATRPY*RVCSYFFTPAGTNISTLPSINTYRIISVQNSR*VQLSCSD LGKRTKYQRTKGSEFHFHATALRCKYNLIPSFQPNI*QYLV*GRYSTAHSTVDMLFFK*I YRKHTLKSLVEKCINTSDWQARGFKPSCSDYMTKLFKKIRLPR*SNRLNNWSKVKKLLIK NPPPASQLCRCEKNLA*IQ*VKLTE*PNH*DLWRS*VSR*VVVSNQAAGYTSDHLAP >_3 LGH*NSMWWXSNLLPHDRTNACVVIFSHPRGPT*APYRQLIHIELFQSKIRDEFNCLAAT LESELSINGPKGVNFTSMLRLYAANITSSLVFNQTFDSTWFEDAIPQLTPQ*ICCFLNRF IENIRLNPW*KNALTQATGKRGVLSPVVLII*PNSSKRFVCLVSPIG*ITGRK*KSC*LK TLLQLVSCVVVRRT*LESSKLN*PNSLIIKTFGDLKSVDRLWYRIKPLVIRQITSR >_1 IFAXLYPPFLWXDSYSLTTRIIL*RSMISK*FLSIDRMIKTSK*KV*LFLV*LDTMDAV* TQWLTC*TKIE*MSQSYLTHYNSFTNQIAVIILRPGL*FFELG*SSNP**ALC*DGFSIY NIRYMYIGLVNHFATQPY*RVCSYFSTHAGTNMSTLPSINT*RIISVQNSR*VQLSCSDL GKRTKYQRTKGE*ISLPCYGFTLQI*SHP*FSTKHLTVLWF*XTLFHSSLHSDNVWFF*I DL*X >_2 SLRYCILRSCGXIHIALPLELFYNVP*SPSSSFR*IV*LKQANKRFSCSWSS*TQWTLSE PSG*RVELKLNKCRNHI*HTTIASLTKLL*LF*DRVCNFLNWVDLLTHNRPFAKTGFLYI IYGICISASLTILPHNRINACVVIFPHTRGQT*APYRQLIHSELFQSKIRDEFNCLAATL ESELSINGPKGSEFHFHATALRCKYNLIPSFQPNI*QYFGFXGRYSTAHSTVIMFGFFK* IYRX >_3 LCXTVSSVPVVXFI*PYH*NYSITFHDLQVVPFDRSYD*NKQIKGLVVLGLARHNGRCLN PVVNVLN*N*INVAIIFNTLQ*LH*PNCCDYFKTGSVIF*IGLIF*PIIGPLLRRVFYI* YTVYVYRPR*PFCHTTVLTRV*LFFHTRGDKHEHPTVN*YIANYFSPKFEMSSTVLQRPW KAN*VSTDQRGVNFTSMLRLYAANIISSLVFNQTFDSTLVLXDAIPQLTPQ**CLVFLNR FIE >scf/ciona01/G126/seq_dir/hrs/G126P64785F.T0/G126P64785FC9.T0.seq 733 0 733 ABI Length = 733 Minus Strand HSPs: Realted exon Score = 155 (54.6 bits), Expect = 4.8e-11, P = 4.8e-11 Identities = 30/39 (76%), Positives = 33/39 (84%), Frame = -3 Query: 14 SKIRDEFNCLAATLESELSINGPKGVNFTSMLRLYAANI 52 SKI DEFNCLA TLE+EL +NGPKGV T MLRLYAAN+ Sbjct: 170 SKIVDEFNCLATTLETELKMNGPKGVTLTHMLRLYAANV 54 >scf/ciona01/G126/seq_dir/hrs/G126P64123F.T0/G126P64123FG2.T0.seq 710 0 710 ABI GACTGCGGGTATGAAATCTNCTTTCTGTGGTGGAATATCCCTTTTAGCGC TTTCGGAGAATCAGCTGTTGTATTACATCGTTGATTTGTTTCTGGCGGGA ACGGAGACTTCGGCTAATACGAACGCCTGGGCGATATTGCTTGTGCTTAA AAATCCCCAGGTTAAGGCAAAGTTAAGATCAGAGTTGGAGGCCTTTGGAA AGTCCCCGACCTTGGTACGTTTAAATGGGATTTTTAACTCTTTTTGTTTA CTAACCTATAAATCTGGAAAAAAGTTATTACACAACCTGTAGTTATAACA TGCAGCCTTTTAACCTATGTACAATATTAAACGAGGCCGACTGTCCCTAA ACTAGGACCAAAGCGGATGTTGTCAGTTACACAAATTGCTACGTTAATTA AGCTGTTTGCACAAAAAATCTGACGCTCCTGCGATTTCTTAAAAAAATTA GATCCTATTCTATGTTTTATATGGATATATAGGTTTTATGTGGGTTACAC TCATTGTATATATACGTACTTTAATAGAACAAAAATAAAATTGCAATCAT TACAATCAGGAGGACGAAGCAAAAATGCCTTACACAAGAGCTGTGATGCA AGAAGTTTTTCGCTACAGAACATCCGCCCCTTTAAATATTGTTGCAAGAA GAACGACAAGCGACCTTGAATTGAAGGGTTACAAGGTACCAGCTAATATG CCGGTAATTG >_1 DCGYEIXFLWWNIPFSAFGESAVVLHR*FVSGGNGDFG*YERLGDIACA*KSPG*GKVKI RVGGLWKVPDLGTFKWDF*LFLFTNL*IWKKVITQPVVITCSLLTYVQY*TRPTVPKLGP KRMLSVTQIATLIKLFAQKI*RSCDFLKKLDPILCFIWIYRFYVGYTHCIYTYFNRTKIK LQSLQSGGRSKNALHKSCDARSFSLQNIRPFKYCCKKNDKRP*IEGLQGTS*YAGNX >_2 TAGMKSXFCGGISLLALSENQLLYYIVDLFLAGTETSANTNAWAILLVLKNPQVKAKLRS ELEAFGKSPTLVRLNGIFNSFCLLTYKSGKKLLHNL*L*HAAF*PMYNIKRGRLSLN*DQ SGCCQLHKLLR*LSCLHKKSDAPAIS*KN*ILFYVLYGYIGFMWVTLIVYIRTLIEQK*N CNHYNQEDEAKMPYTRAVMQEVFRYRTSAPLNIVARRTTSDLELKGYKVPANMPVIX >_3 LRV*NLLSVVEYPF*RFRRISCCITSLICFWRERRLRLIRTPGRYCLCLKIPRLRQS*DQ SWRPLESPRPWYV*MGFLTLFVY*PINLEKSYYTTCSYNMQPFNLCTILNEADCP*TRTK ADVVSYTNCYVN*AVCTKNLTLLRFLKKIRSYSMFYMDI*VLCGLHSLYIYVL**NKNKI AIITIRRTKQKCLTQEL*CKKFFATEHPPL*ILLQEERQATLN*RVTRYQLICR*L >scf/ciona01/G126/seq_dir/hrs/G126P69591R.T0/G126P69591RH9.T0.seq 748 0 748 ABI Length = 748 Minus Strand HSPs: Score = 248 (87.3 bits), Expect = 6.7e-21, P = 6.7e-21 Identities = 49/50 (98%), Positives = 49/50 (98%), Frame = -3 Query: 1 EDEAKMPYTRAVMQEVFRYRTSAPLNIVARRTTSDLELKGYKVPANMPVI 50 EDEAKMPYTRAVMQEVFRYRTSAPLNIVARRTTSDLEL GYKVPANMPVI Sbjct: 665 EDEAKMPYTRAVMQEVFRYRTSAPLNIVARRTTSDLELNGYKVPANMPVI 516 >scf/ciona01/G126/seq_dir/hrs/G126P69591R.T0/G126P69591RH9.T0.seq 748 0 748 ABI AGACTTGAGGCTGAAAACCCACTCTTGTGGNAATTCTATAATACCATACC ATTTTATTTATTATTTAGCAAGTTATATTGCGATTATTCAAATAAATACA GCTTGGAATTCAATAAGTATAACACATTGTTCTTTTTATAATATAACGAA GCAATAAAATGCTCTCGTGGCCGTTGTAATATACAGCAAAATTATAACAC TTATTACACACGAATAGAACCCTTCACTCTATATTCTGGTGGGTGCAGCA ACATGCCGCTATCTCCATCCATATTATCAACGTGGCAACCATCTGCTAGT TCTAGGTCAAATTGACTAAAAATTGAAGTTATGAAAATAAACACTTCGTT TTTAGCGAGGTTCTTTCCAATGCATGATCTTGCGCCCACCGAGAACGGCA TCACGTGATCGTTTGGTATGAAATTCCCATCGCCATCCAGATGTCGTTCA GGTCTGAATGTTTCTGGGTCTGGTGCCCATGTCAATGGGTCGTGATGTAC CGACCACAGGTTTGCAATTACCGGCATATTAGCTGGTACCTTGTAACCGT TCAATTCAAGGTCGCTTGTCGTTCTTCTTGCAACAATATTTAAAGGGGCG GATGTTCTGTAGCGAAAAACTTCTTGCATCACAGCTCTTGTGTAAGGCAT TTTTGCTTCGTCCTCCTGATTGTAATGATTGCAATNNTATTTTTGTTCTA TTAAAGTACGTATATATACAATGAGTGTAACCCACATAAAACCTATAN >_4 YRFYVGYTHCIYTYFNRTKIXLQSLQSGGRSKNALHKSCDARSFSLQNIRPFKYCCKKND KRP*IERLQGTS*YAGNCKPVVGTSRPIDMGTRPRNIQT*TTSGWRWEFHTKRSRDAVLG GRKIMHWKEPR*KRSVYFHNFNF*SI*PRTSRWLPR**YGWR*RHVAAPTRI*SEGFYSC VISVIILLYITTATRAFYCFVIL*KEQCVILIEFQAVFI*IIAI*LAK**IKWYGIIEXP QEWVFSLKS >_5 X*VLCGLHSLYIYVL**NKNXIAIITIRRTKQKCLTQEL*CKKFFATEHPPL*ILLQEER QATLN*TVTRYQLICR*LQTCGRYITTH*HGHQTQKHSDLNDIWMAMGISYQTIT*CRSR WAQDHALERTSLKTKCLFS*LQFLVNLT*N*QMVATLIIWMEIAACCCTHQNIE*RVLFV CNKCYNFAVYYNGHESILLLRYIIKRTMCYTY*IPSCIYLNNRNITC*IINKMVWYYRIX TRVGFQPQVX >_6 IGFMWVTLIVYIRTLIEQKXXCNHYNQ EDEAKMPYTRAVMQEVFRYRTSAPLNIVARRTT SDLELNGYKVPANMPVIANLWSVHHDPLTWAPDPETFRPERHLDGDGNFIPNDHVMPFSV GARSCIGKNLAKNEVFIFITSIFSQFDLELADGCHVDNMDGDSGMLLHPPEYRVKGSIRV **VL*FCCILQRPREHFIASLYYKKNNVLYLLNSKLYLFE*SQYNLLNNK*NGMVL*NXH KSGFSASSL Related gene in FID exon may be identical with poor seq quality LQW221856.x1 LQW221856.x1.phd.1 LQW221856.y1 11:19:58 2001 TEMPLATE: LQW221856 DIRECTION: fwd Length = 930 Score = 108 bits (247), Expect = 1e-23 Identities = 35/42 (83%), Positives = 35/42 (83%) Frame = +1 Query: 1 RKPTLAKFKQFGENHRQSRDPDDPPDFIDCNQKTMDSKSAND 42 RK LAKFKQF ENHRQSRDPDDP DFIDC TMDSKSAND Sbjct: 364 RKTKLAKFKQFVENHRQSRDPDDPRDFIDCYLNTMDSKSAND 489 >LQW221856.x1 >lcl|LQW221856.x1 CHROMAT_FILE: LQW221856.x1 PHD_FILE: LQW221856.x1.phd.1 CHEM: term DYE: ET TIME: Mon Aug 27 11:19:58 2001 TEMPLATE: LQW221856 DIRECTION: fwd NTACACGGGTTCGAAGCTGTAATAGACCTATTTTGATGATATTTTTTTTAACATAATGAACCCATGCAGGTTGTCCAAGT TGTCAGCCATCCATTTACAAAAAACAAACAATAAATAAATATCCCCCTTCTCGGTAACTCGTAAGTTACATATACGCGGT AGCTCGTAAGCAAGCACGATATGTATAAAACAGAACACCGGTGTTATGACGACTGACGTTGCCCGGTATGTGAGGATAAA CAAGTTATACCTTTTTTTAATCAATGTTTCAGACGCGAGAGATTCCTGTACCTTCTCATGTACGTTCCGTTTCTGAAGAA TCTGCCGTTGGTTCGACAACAGCTCAATGTTACCATACAAGGACGAAAAACCAAACTTGCAAAGTTCAAACAATTTGTTG AAAATCATCGACAATCACGTGACCCGGACGACCCCCGTGACTTTATAGACTGTTACCTAAATACAATGGACAGTAAATCG GCTAACGACAGGTTGGTTGCTTGTGTTTTTATTTATTCTATATTACAGTAAGGGCACATCACATACAAAACCCGTTGTGG TAAAGACATCTTGCTAAATCGGGTATAACTTGTACTTACATTCCTAATCTTACTGTAAGACTTATACTATAAGGGCGACG TTTTTTGGCGTAGCACGATTGAGACCTTATGGTGTAGTAGACTTAAATGCTTGCGTCTACTGATTTCTTTATAGTGAGCT GTATCGGCCCTAGCTTGATCCTGTGTACTTAGCCGGTTGACTATGCCCAATCGTCTAAATATCCACCGGCCATCTTGAGT GATCTAACTGTTCGTACCAGTCCGAAACAGCCTTTTTGGAGCTGTTGGGGGCGGATTCCCAAGTGGGCTGGTGGGAACGC GCGAGGTGGGAAATCCGGGACCGTGGTTACGCGCCAAGTCGTGTGTGGGA >_1 XHGFEAVIDLF**YFF*HNEPMQVVQVVSHPFTKNKQ*INIPLLGNS*VTYTR*LVSKHD MYKTEHRCYDD*RCPVCEDKQVIPFFNQCFRRERFLYLLMYVPFLKNLPLVRQQLNVTIQ GRKTKLAKFKQFVENHRQSRDPDDPRDFIDCYLNTMDSKSANDRLVACVFIYSILQ*GHI TYKTRCGKDILLNRV*LVLTFLILL*DLYYKGDVFWRSTIETLWCSRLKCLRLLISL**A VSALA*SCVLSRLTMPNRLNIHRPS*VI*LFVPVRNSLFGAVGGGFPSGLVGTREVGNPG PWLRAKSCVG >_2 YTGSKL**TYFDDIFFNIMNPCRLSKLSAIHLQKTNNK*ISPFSVTRKLHIRGSS*ASTI CIKQNTGVMTTDVARYVRINKLYLFLINVSDARDSCTFSCTFRF*RICRWFDNSSMLPYK DEKPNLQSSNNLLKIIDNHVTRTTPVTL*TVT*IQWTVNRLTTGWLLVFLFILYYSKGTS HTKPVVVKTSC*IGYNLYLHS*SYCKTYTIRATFFGVARLRPYGVVDLNACVY*FLYSEL YRP*LDPVYLAG*LCPIV*ISTGHLE*SNCSYQSETAFLELLGADSQVGWWERARWEIRD RGYAPSRVW >_3 TRVRSCNRPILMIFFLT**THAGCPSCQPSIYKKQTINKYPPSR*LVSYIYAVARKQARY V*NRTPVL*RLTLPGM*G*TSYTFF*SMFQTREIPVPSHVRSVSEESAVGSTTAQCYHTR TKNQTCKVQTIC*KSSTIT*PGRPP*LYRLLPKYNGQ*IG*RQVGCLCFYLFYITVRAHH IQNPLW*RHLAKSGITCTYIPNLTVRLIL*GRRFLA*HD*DLMV**T*MLASTDFFIVSC IGPSLILCT*PVDYAQSSKYPPAILSDLTVRTSPKQPFWSCWGRIPKWAGGNARGGKSGT VVTRQVVCG >LQW221856.y1 >lcl|LQW221856.y1 CHROMAT_FILE: LQW221856.y1 PHD_FILE: LQW221856.y1.phd.1 CHEM: term DYE: ET TIME: Mon Aug 27 11:20:28 2001 TEMPLATE: LQW221856 DIRECTION: rev AGATTGAATGAGCCGGTACCAACGCCGATCCAACTACGCTGGTCTTACATCTGCCTGTAATGCGTTAACGATCCAGTGGC AAAAGCAATCAACGGAAAACTGTGTCCTCGCTCCCCGGGGGGTCGTTAAAGCTGTGGTCGAAGACGGGGAGAAACAAGGA CAACCCTTCAAGCTTACGTTGTTTCGCTACATTGGGTTGTATTCCTTGTGTCTTGGACGAGACAATCTTTTCCACCTCTA TCCTTGATCGTGGAACCCTCACTTGGCTCCTGTCTAATTAATAATTAACGCCTTTGCTGACTGTAAGGTGCTTTGTCGTT ATCTACGACTATAATTCGGGTGTTGCAGCAAGGTAAAGGCGTGATCAAAATTGCCTTTGCTTGCTACTTTAAGATTGTTA TCATTTGGAAATCCGAGATTTCAATCTCCAGAATTTATTGAGACTTTGAAGACTAATAGTAAATTTTGGCAAATACTATT ACGACACCGTTTTTTTTTTCCATAATATATGCGCGTACTTGAGCAAGAACCACCTGTGACGTAACGGAATAAATTTAATG AAGATAATTCGAAACGGGTATCATTGTAAACAGAAAAATTGATATTATTAGATTTAGCTTATAGTACAGGCTATCTGTGT ACGCCGATTATACATTTTGACCACAGTTAATAATTTATAGGGAAGTACAATTTTTTTTCTAGTGTTTTCGGTGTCTGTAC ATTTAACATGGTTTCACAAATAAACAAGATCTTATAATTGCAGGCTGTAATATAGCTGGGTGTGCAGTAGTATTCAAGCA GTGTATATGTATTGCACATTTCCCCTAATTAATATTCATCAAATTAAAGCGATTGTATCTACCGGTAAGGATCCTAACCA AGCCCTTTAAAATTGGATACCCGGTGAAATAACGGGTTCACAAAGTTAAGTAAAAAAACGGTATCTCGCAGGGAAGCTTT CGG >_1 RLNEPVPTPIQLRWSYICL*CVNDPVAKAINGKLCPRSPGGR*SCGRRRGETRTTLQAYV VSLHWVVFLVSWTRQSFPPLSLIVEPSLGSCLINN*RLC*L*GALSLSTTIIRVLQQGKG VIKIAFACYFKIVIIWKSEISISRIY*DFED***ILANTITTPFFFSIIYART*ARTTCD VTE*I**R*FETGIIVNRKIDIIRFSL*YRLSVYADYTF*PQLIIYREVQFFF*CFRCLY I*HGFTNKQDLIIAGCNIAGCAVVFKQCICIAHFP*LIFIKLKRLYLPVRILTKPFKIGY PVK*RVHKVK*KNGISQGSFR >_2 D*MSRYQRRSNYAGLTSACNALTIQWQKQSTENCVLAPRGVVKAVVEDGEKQGQPFKLTL FRYIGLYSLCLGRDNLFHLYP*SWNPHLAPV*LIINAFADCKVLCRYLRL*FGCCSKVKA *SKLPLLATLRLLSFGNPRFQSPEFIETLKTNSKFWQILLRHRFFFP*YMRVLEQEPPVT *RNKFNEDNSKRVSL*TEKLILLDLAYSTGYLCTPIIHFDHS**FIGKYNFFSSVFGVCT FNMVSQINKIL*LQAVI*LGVQ*YSSSVYVLHISPN*YSSN*SDCIYR*GS*PSPLKLDT R*NNGFTKLSKKTVSRREAF >_3 IE*AGTNADPTTLVLHLPVMR*RSSGKSNQRKTVSSLPGGSLKLWSKTGRNKDNPSSLRC FATLGCIPCVLDETIFSTSILDRGTLTWLLSN**LTPLLTVRCFVVIYDYNSGVAAR*RR DQNCLCLLL*DCYHLEIRDFNLQNLLRL*RLIVNFGKYYYDTVFFFHNICAYLSKNHL*R NGINLMKIIRNGYHCKQKN*YY*I*LIVQAICVRRLYILTTVNNL*GSTIFFLVFSVSVH LTWFHK*TRSYNCRL*YSWVCSSIQAVYMYCTFPLINIHQIKAIVSTGKDPNQAL*NWIP GEITGSQS*VKKRYLAGKLS >_4 PKASLRDTVFLLNFVNPLFHRVSNFKGLG*DPYR*IQSL*FDEY*LGEMCNTYTLLEYYC TPSYITACNYKILFICETMLNVQTPKTLEKKLYFPINY*LWSKCIIGVHR*PVL*AKSNN INFSVYNDTRFELSSLNLFRYVTGGSCSSTRIYYGKKKRCRNSICQNLLLVFKVSINSGD *NLGFPNDNNLKVASKGNFDHAFTLLQHPNYSRR*RQSTLQSAKALIIN*TGAK*GFHDQ G*RWKRLSRPRHKEYNPM*RNNVSLKGCPCFSPSSTTALTTPRGARTQFSVDCFCHWIVN ALQADVRPA*LDRRWYRLIQS >_5 ESFPARYRFFT*LCEPVISPGIQF*RAWLGSLPVDTIALI**ILIRGNVQYIYTA*ILLH TQLYYSLQL*DLVYL*NHVKCTDTENTRKKIVLPYKLLTVVKMYNRRTQIACTIS*I**Y QFFCLQ*YPFRIIFIKFIPLRHRWFLLKYAHILWKKKTVS**YLPKFTISLQSLNKFWRL KSRISK**QS*SSKQRQF*SRLYLAATPEL*S*ITTKHLTVSKGVNY*LDRSQVRVPRSR IEVEKIVSSKTQGIQPNVAKQRKLEGLSLFLPVFDHSFNDPPGSEDTVFR*LLLPLDR*R ITGRCKTSVVGSALVPAHSIX >_6 RKLPCEIPFFYLTL*TRYFTGYPILKGLVRILTGRYNRFNLMNIN*GKCAIHIHCLNTTA HPAILQPAIIRSCLFVKPC*MYRHRKH*KKNCTSL*IINCGQNV*SAYTDSLYYKLNLII SIFLFTMIPVSNYLH*IYSVTSQVVLAQVRAYIMEKKNGVVIVFAKIYY*SSKSQ*ILEI EISDFQMITILK*QAKAILITPLPCCNTRIIVVDNDKAPYSQQRR*LLIRQEPSEGSTIK DRGGKDCLVQDTRNTTQCSETT*A*RVVLVSPRLRPQL*RPPGERGHSFPLIAFATGSLT HYRQM*DQRSWIGVGTGSFNL LQW230635.x1 for walking toward C-term LQW230635.x1.phd.1 LQW230635.y1 11:19:26 2001 TEMPLATE: LQW230635 DIRECTION: fwd Length = 900 Score = 177 bits (410), Expect = 3e-44 Identities = 56/60 (93%), Positives = 56/60 (93%) Frame = -1 Query: 1 TPSYITACNYKILFICETMLNVQTPKTLEKKLYFPINY*LWSKCIIGVHR*PVL*AKSNN 60 TPSYIT CNYKILFICET L VQ PKTLEKKLYFPINY*LWSKCIIGVHR*PVL*AKSNN Sbjct: 399 TPSYITPCNYKILFICETILIVQIPKTLEKKLYFPINY*LWSKCIIGVHR*PVL*AKSNN 220 >LQW230635.x1 >lcl|LQW230635.x1 CHROMAT_FILE: LQW230635.x1 PHD_FILE: LQW230635.x1.phd.1 CHEM: term DYE: ET TIME: Mon Aug 27 11:19:26 2001 TEMPLATE: LQW230635 DIRECTION: fwd TGCTGTAAGATTGTTATCATTTGGAAATCCGAGATTTCAATCTCCAGAATGTATTGAGACTTTGAAGACTAATAGTAAAT TTTGGCAAATACTATTACGACACCGTTTTTTTTTTCCATAATATATGCGCGTACTTGAGCAAGAACCACCTGTGACGTAA CGGAATAAATTTAATGAAGATAATTCGAAACGGGTATCATTGTAAACAGAAAAAATGATATTATTAGATTTAGCTTATAG TACAGGCTATCTGTGTACGCCGATTATACATTTTGACCACAGTTAATAATTTATAGGGAAGTACAATTTTTTTTCTAGTG TTTTTGGTATCTGTACAATTAAAATGGTTTCACAAATAAACAAGATCTTATAATTGCAGGGTGTTATATAGCTTGGTGTG CAGTAGTATTCAAGCAGTGTATATGTATTGCAAATAATCAAATAAATAATAATTTAATCAAACTACAGCCGATTGTATCT TACTTGTTATAGTAATCTAAATCCAAACACCTATTAAAATAATTGAATAACCAGCTGCGATATACAAGCGGTGTACGAAG AAAAGCTTAAATAAATAAAATAATCGTATATGCATCTGCAATTGGAAAAGTCCATGTCTCTGGGCATATGTCCAACGTGG GTAACTACGCCCGAAGTGAACCCTCACTTATAAGGTGGTGGTTGAAGTACAAACACTTCACCGTCAATCTTCGGTTAAAA CCACAGGGAACCTAATGAACCCCTTAAATGACTCGGACTGAAGGTCTCCCGCAATGGACAGGTGACCGCCGATAGAGGGC CGGGCGTCGCTAAACCCCAGGGAAGTACCGAAATTGGCGGCACAGGGAGTATACATGTGAGAAGGTTAGAACGGCGCAGA ATGAGCGACACAGGACCGAG >_4 LGPVSLILRRSNLLTCILPVPPISVLPWGLATPGPLSAVTCPLRETFSPSHLRGSLGSLW F*PKIDGEVFVLQPPPYK*GFTSGVVTHVGHMPRDMDFSNCRCIYDYFIYLSFSSYTACI SQLVIQLF**VFGFRLL*QVRYNRL*FD*IIIYLIICNTYTLLEYYCTPSYITPCNYKIL FICETILIVQIPKTLEKKLYFPINY*LWSKCIIGVHR*PVL*AKSNNIIFSVYNDTRFEL SSLNLFRYVTGGSCSSTRIYYGKKKRCRNSICQNLLLVFKVSIHSGD*NLGFPNDNNLTA >_5 RSCVAHSAPF*PSHMYTPCAANFGTSLGFSDARPSIGGHLSIAGDLQSESFKGFIRFPVV LTED*R*SVCTSTTTL*VRVHFGRSYPRWTYAQRHGLFQLQMHIRLFYLFKLFFVHRLYI AAGYSIILIGVWI*ITITSKIQSAVV*LNYYLFDYLQYIYTA*ILLHTKLYNTLQL*DLV YL*NHFNCTDTKNTRKKIVLPYKLLTVVKMYNRRTQIACTIS*I**YHFFCLQ*YPFRII FIKFIPLRHRWFLLKYAHILWKKKTVS**YLPKFTISLQSLNTFWRLKSRISK**QSYSX >_6 SVLCRSFCAVLTFSHVYSLCRQFRYFPGV*RRPALYRRSPVHCGRPSVRVI*GVH*VPCG FNRRLTVKCLYFNHHLISEGSLRA*LPTLDICPETWTFPIADAYTIILFI*AFLRTPLVY RSWLFNYFNRCLDLDYYNK*DTIGCSLIKLLFI*LFAIHIHCLNTTAHQAI*HPAIIRSC LFVKPF*LYRYQKH*KKNCTSL*IINCGQNV*SAYTDSLYYKLNLIISFFLFTMIPVSNY LH*IYSVTSQVVLAQVRAYIMEKKNGVVIVFAKIYY*SSKSQYILEIEISDFQMITILQX >LQW230635.y1 >lcl|LQW230635.y1 CHROMAT_FILE: LQW230635.y1 PHD_FILE: LQW230635.y1.phd.1 CHEM: term DYE: ET TIME: Mon Aug 27 11:19:55 2001 TEMPLATE: LQW230635 DIRECTION: rev GGCGGACACAGGTGTATATGCAACAGAACACTGGATGTTATAGCGACTGTCGCTTGCCGCCGTATGAGAATAAATAAGTT ACATTCATCCACTCCACAGTTCAACAAATCGTTAATGAGTTCAACTGCCTTTCTTCTACGCTCGAGATAAGAACTTTTAG CCAACGGTTCCAAGGGTGCCTATCTTGATGAAATGCTATGGTTGTATGCGGTAACCAATATATCCCTGCTTATATTTAAC GAAAGCTTTGACCCTGATAATGAGAAGTGGTTTGGGGCAATGAGAGAGAATATCAGGTCACACACGGCAAGGTAACTTTG TTCTCGCTATATAGCCCAAAGATACGGGTTCGAAGCTGTAATATACCTATTTTGATGATATTTTTTTTAACATAATGAAC CCATGCAGGTTGTCCAAGTTGTCAGCCATCCATTTACAAAAAACAAACAATAAATAAATATCCCCCTTCTCGGTAACTCG TAAGTTACATATACGCGGTAGCTCGTAAGCAAGCACGATATGTATAAAACAGAACACCGGTGTTATGACGACTGACGTTG CCCGGTATGTGAGGATAAACAAGTTATACCTTTTTTTAATCAATGTTCCAGACGCGAGAGATTCTGTACCTTTCTCATGT ACGTTCCATTTCTGAAGATCTGCCGTTGGTTCGAAACAGCTCCATGTACCATACAGGTCGAAAAACAATTGCAAGCTCAA CATTGTTGAATCGTGAGATCAGTGACCGATACCCCTGATTTTGATGTCCTAATAGGCAGAAAGGTAAAAGTGGGCGGGTT AATATCAATAAAGGGCGACAAACCTGTGAAATCCAGGGAAGGCACCAAAAGGGACACAGAGAGGTGACACAGTGAAAGCG GCTAAAGCCATAAAGACCAA >_1 GGHRCICNRTLDVIATVACRRMRINKLHSSTPQFNKSLMSSTAFLLRSR*ELLANGSKGA YLDEMLWLYAVTNISLLIFNESFDPDNEKWFGAMRENIRSHTAR*LCSRYIAQRYGFEAV IYLF**YFF*HNEPMQVVQVVSHPFTKNKQ*INIPLLGNS*VTYTR*LVSKHDMYKTEHR CYDD*RCPVCEDKQVIPFFNQCSRRERFCTFLMYVPFLKICRWFETAPCTIQVEKQLQAQ HC*IVRSVTDTPDFDVLIGRKVKVGGLISIKGDKPVKSREGTKRDTER*HSESG*SHKDQ >_2 ADTGVYATEHWML*RLSLAAV*E*ISYIHPLHSSTNR**VQLPFFYARDKNF*PTVPRVP ILMKCYGCMR*PIYPCLYLTKALTLIMRSGLGQ*ERISGHTRQGNFVLAI*PKDTGSKL* YTYFDDIFFNIMNPCRLSKLSAIHLQKTNNK*ISPFSVTRKLHIRGSS*ASTICIKQNTG VMTTDVARYVRINKLYLFLINVPDARDSVPFSCTFHF*RSAVGSKQLHVPYRSKNNCKLN IVES*DQ*PIPLILMS**AER*KWAG*YQ*RATNL*NPGKAPKGTQRGDTVKAAKAIKT >_3 RTQVYMQQNTGCYSDCRLPPYENK*VTFIHSTVQQIVNEFNCLSSTLEIRTFSQRFQGCL S**NAMVVCGNQYIPAYI*RKL*P***EVVWGNEREYQVTHGKVTLFSLYSPKIRVRSCN IPILMIFFLT**THAGCPSCQPSIYKKQTINKYPPSR*LVSYIYAVARKQARYV*NRTPV L*RLTLPGM*G*TSYTFF*SMFQTREILYLSHVRSISEDLPLVRNSSMYHTGRKTIASST LLNREISDRYP*F*CPNRQKGKSGRVNINKGRQTCEIQGRHQKGHREVTQ*KRLKP*RP >_4 LVFMALAAFTVSPLCVPFGAFPGFHRFVALY*Y*PAHFYLSAY*DIKIRGIGH*SHDSTM LSLQLFFDLYGTWSCFEPTADLQKWNVHEKGTESLASGTLIKKRYNLFILTYRATSVVIT PVFCFIHIVLAYELPRICNLRVTEKGDIYLLFVFCKWMADNLDNLHGFIMLKKISSK*VY YSFEPVSLGYIARTKLPCRV*PDILSHCPKPLLIIRVKAFVKYKQGYIGYRIQP*HFIKI GTLGTVG*KFLSRA*KKGS*TH*RFVELWSG*M*LIYSHTAASDSRYNIQCSVAYTPVSA >_5 GLYGFSRFHCVTSLCPFWCLPWISQVCRPLLILTRPLLPFCLLGHQNQGYRSLISRFNNV ELAIVFRPVWYMELFRTNGRSSEMERT*ERYRISRVWNID*KKV*LVYPHIPGNVSRHNT GVLFYTYRACLRATAYM*LTSYREGGYLFIVCFL*MDG*QLGQPAWVHYVKKNIIKIGIL QLRTRIFGLYSENKVTLPCVT*YSLSLPQTTSHYQGQSFR*I*AGIYWLPHTTIAFHQDR HPWNRWLKVLISSVEERQLNSLTIC*TVEWMNVTYLFSYGGKRQSL*HPVFCCIYTCVRX >_6 WSLWL*PLSLCHLSVSLLVPSLDFTGLSPFIDINPPTFTFLPIRTSKSGVSVTDLTIQQC *ACNCFSTCMVHGAVSNQRQIFRNGTYMRKVQNLSRLEH*LKKGITCLSSHTGQRQSS*H RCSVLYISCLLTSYRVYVTYELPRRGIFIYCLFFVNGWLTTWTTCMGSLC*KKYHQNRYI TASNPYLWAI*REQSYLAVCDLIFSLIAPNHFSLSGSKLSLNISRDILVTAYNHSISSR* APLEPLAKSSYLERRRKAVELINDLLNCGVDECNLFILIRRQATVAITSSVLLHIHLCPP LQW158767.y1 LQW158767.y1.phd.1 LQW158767.x1 13:05:56 2001 TEMPLATE: LQW158767 DIRECTION: rev Length = 866 Score = 329 bits (766), Expect = 1e-89 Identities = 99/99 (100%), Positives = 99/99 (100%) Frame = -3 Query: 1 GFPVFGCFPLLGKNKERVFMNWSRTSYGPIYYARLGASRVLVLNGYEAVREALVLRPQAF 60 GFPVFGCFPLLGKNKERVFMNWSRTSYGPIYYARLGASRVLVLNGYEAVREALVLRPQAF Sbjct: 489 GFPVFGCFPLLGKNKERVFMNWSRTSYGPIYYARLGASRVLVLNGYEAVREALVLRPQAF 310 Query: 61 AGRCKTELMKLLYEGQHGIMQLDHGPMWKAQRKFGQNAL 99 AGRCKTELMKLLYEGQHGIMQLDHGPMWKAQRKFGQNAL Sbjct: 309 AGRCKTELMKLLYEGQHGIMQLDHGPMWKAQRKFGQNAL 193 >LQW158767.y1 >lcl|LQW158767.y1 CHROMAT_FILE: LQW158767.y1 PHD_FILE: LQW158767.y1.phd.1 CHEM: term DYE: ET TIME: Wed Aug 22 13:05:56 2001 TEMPLATE: LQW158767 DIRECTION: rev TAAGTCGGTACCTACACTTCGTGTCGCTTGCAGTTTTGTTGCACGTACAATTCGTACCTGTTTACGAGTTAGCGTATATA TAACTTAATAAGTAATAAATGTAAGAATTTGTGCATTGGAAAACTGGGTAATATATACATGACCACAATGCGTAAATACC TGAAGACTTCGCTTTCCCATGCCTAAGCTTCCAAGAGCATTTTGTCCGAACTTACGCTGTGCTTTCCACATAGGTCCATG ATCAAGCTGCATTATACCATGCTGGCCTTCGTACAGTAACTTCATCAACTCAGTTTTACAACGACCCGCAAAAGCCTGTG GTCTCAAGACAAGAGCTTCTCTAACAGCTTCGTAGCCGTTTAAAACCAAGACCCTTGAGGCGCCAAGACGCGCGTAGTAG ATGGGCCCATAACTGGTGCGAGACCAATTCATAAAGACTCGTTCTTTGTTCTTCCCTAGTAAGGGAAAACACCCAAATAC AGGGAATCCATTACGACCCCGTAGCGTGCCACTGGTACCCAAGAATCGCCACCATGTATCATACACTACGAATAGAACGC AAGTCAAAATAGCTGCGCTTGTCAGCAAAGTTTCCATAGAGATTTGTGAAGCGAAAGCAAATATTCGAAGCATGTTTGGA GTTATTTTCCTGCAAATCTAAAAATATGTGAATAAATAAAAACGTATTAGTTAGACATGATCTAAATCCAGGTTCTCAGC AAGGGACTCACTCATACAGAAATGAATATAACTCCTTACTTAATCGGTTATTACGATTACAATTTTGAATTACTTTGCCC TTTGGGCACTTTAACCATTGGTATCTATATTGTATCCTCATATTTACTAAAAAGTTTTTTTTTACC >_4 *KKTF**I*GYNIDTNG*SAQRAK*FKIVIVITD*VRSYIHFCMSESLAENLDLDHV*LI RFYLFTYF*ICRKITPNMLRIFAFASQISMETLLTSAAILTCVLFVVYDTWWRFLGTSGT LRGRNGFPVFGCFPLLGKNKERVFMNWSRTSYGPIYYARLGASRVLVLNGYEAVREALVL RPQAFAGRCKTELMKLLYEGQHGIMQLDHGPMWKAQRKFGQNAL GSLGMGKRSLQVFTHC GHVYITQFSNAQILTFITY*VIYTLTRKQVRIVRATKLQATRSVGTDL >_5 VKKNFLVNMRIQYRYQWLKCPKGKVIQNCNRNNRLSKELYSFLYE*VPC*EPGFRSCLTN TFLFIHIFLDLQENNSKHASNICFRFTNLYGNFADKRSYFDLRSIRSV*YMVAILGYQWH ATGS*WIPCIWVFSLTREEQRTSLYELVSHQLWAHLLRASWRLKGLGFKRLRSC*RSSCL ETTGFCGSL*N*VDEVTVRRPAWYNAA*SWTYVESTA*VRTKCSWKLRHGKAKSSGIYAL WSCIYYPVFQCTNSYIYYLLSYIYANS*TGTNCTCNKTASDTKCRYRLX >_6 GKKKLFSKYEDTI*IPMVKVPKGQSNSKL*S**PIK*GVIFISV*VSPLLRTWI*IMSN* YVFIYSHIFRFAGK*LQTCFEYLLSLHKSLWKLC*QAQLF*LAFYS*CMIHGGDSWVPVA RYGVVMDSLYLGVFPY*GRTKNESL*IGLAPVMGPSTTRVLAPQGSWF*TATKLLEKLLS *DHRLLRVVVKLS**SYCTKASMV*CSLIMDLCGKHSVSSDKMLLEA*AWESEVFRYLRI VVMYILPSFPMHKFLHLLLIKLYIR*LVNRYELYVQQNCKRHEV*VPTX >LQW158767.x1 >lcl|LQW158767.x1 CHROMAT_FILE: LQW158767.x1 PHD_FILE: LQW158767.x1.phd.1 CHEM: term DYE: ET TIME: Wed Aug 22 13:04:55 2001 TEMPLATE: LQW158767 DIRECTION: fwd TAGAAACGGCAGGCAGCTTTTCCAGATAGACTTTGTTAATTGATTTACCCGAACATTTTCGTGTTATGTTACGAGAGTAT ATAGGCAACAATAAAGGGCGCGTCTTTGAACTTATTGCACAGTTTTCACCTGCAACACATTTGATAAACAACTAAAACGA CTCAATAACAAGAATTTAGTTTAGCCCAATCTAAAACTTATTGAACTTGCGTTTTAACAGATAAACATGATAAAAATTTA ACAACTGGATGTCTGATTTAACATCACTATGGTTTTAGTCAAGGTCAAGGTCACTTTTTTTAAATCTCCTTTTACCTGTA CCCATTCGATAATGGGCGAAACTAATGTGAAAGTTTGATTCGAAAGTATTCTCTTGGCCCAACAATGTGCGCGGCAAAGA CGATTATTGTTGTTAATTAATAAAACAGTGTTAAACTGCTACAACATGTTTTTACTGGCTGAAAAAAAGCATAATTAAAA GATGCTCATTTTAAATGCACGCTGAAAAAAATATTAAAACCCCTAAAATTTTGTTGCTTGCAAGTTTAAATCATCAATCC CGTATCATATAGTTCAATATAATAGACTAAAATATTTTGTTCTGTCTGATTTTGTTCCATAAATGTAGTTTATGAAAAAT GAGATATAAACATAAGGAAATATTCAGGTGTCAATATGGCTTTAATTTGGGATTAAAAAAACAATAACTAATGTTTAAAT TTACCGGGCAAGAACTATAGCACAGATGTTGCATTTCGTTGGGTAACCACAGTTGCGAATACTGGTATAAAAATTTTCAT TTCTCTAAAAAATTCCAAAAACTTGTCTA LQW253687.x1 LQW253687.x1.phd.1 LQW253687.y1 12:14:26 2001 TEMPLATE: LQW253687 DIRECTION: fwd Length = 917 Score = 329 bits (766), Expect = 1e-89 Identities = 99/99 (100%), Positives = 99/99 (100%) Frame = +1 Query: 1 GFPVFGCFPLLGKNKERVFMNWSRTSYGPIYYARLGASRVLVLNGYEAVREALVLRPQAF 60 GFPVFGCFPLLGKNKERVFMNWSRTSYGPIYYARLGASRVLVLNGYEAVREALVLRPQAF Sbjct: 124 GFPVFGCFPLLGKNKERVFMNWSRTSYGPIYYARLGASRVLVLNGYEAVREALVLRPQAF 303 Query: 61 AGRCKTELMKLLYEGQHGIMQLDHGPMWKAQRKFGQNAL 99 AGRCKTELMKLLYEGQHGIMQLDHGPMWKAQRKFGQNAL Sbjct: 304 AGRCKTELMKLLYEGQHGIMQLDHGPMWKAQRKFGQNAL 420 >LQW253687.x1 >lcl|LQW253687.x1 CHROMAT_FILE: LQW253687.x1 PHD_FILE: LQW253687.x1.phd.1 CHEM: term DYE: ET TIME: Fri Aug 31 12:14:26 2001 TEMPLATE: LQW253687 DIRECTION: fwd GGAGGCAAGAGGAGAAGGCACGCAGCTGCTGACAGCGCAGCTATTTTGACTTGCGTTCTATTCGTAGTGTATGATACATG GTGGCGATTCTTGGGTACCAGTGGCACGCTACGGGGTCGTAATGGATTCCCTGTATTTGGGTGTTTTCCCTTACTAGGGA AGAACAAAGAACGAGTCTTTATGAATTGGTCTCGCACCAGTTATGGGCCCATCTACTACGCGCGTCTTGGCGCCTCAAGG GTCTTGGTTTTAAACGGCTACGAAGCTGTTAGAGAAGCTCTTGTCTTGAGACCACAGGCTTTTGCGGGTCGTTGTAAAAC TGAGTTGATGAAGTTACTGTACGAAGGCCAGCATGGTATAATGCAGCTTGATCATGGACCTATGTGGAAAGCACAGCGTA AGTTCGGACAAAATGCTCTTGGAAGCTTAGGCATGGGAAAGCGAAGTCTTCAGGTATTTACGCATTGTGGTCATGTATAT ATTACCCAGTTTTCCAATGCACAAATTCTTACATTTATTACTTATTAAGTTATATATACGCTAACTCGTAAACAGGTACG AATTGTACGTGCAACAAAACTGCAAGCGGACACAAGGTGTATAATGCAACAGAACACTGGTGTTATAGCGACTGTCGTTG CCGCCGTATGAGACTAATCAGTTACATTCATCCACTCCACAGTCAAAATCGTTAATGAGTTAACTGACTTTTTTTAGGCT CGAGAGACTTTTACCACGGTCCAAGGTGCTATTTGATGAATGTAGGTGTATGCGGCAAGGAAAACCGGTAAATTAAGAAG TTGAGCGATAAAGAATGGTGGGACGAAAAAATCGGCCACCCGCAGAAGGGGCCGATAGCCAGACGGTCAAGAGAACAAGG AAATTGGAGAAACCGCGGTAAGGGCCCTAGAGAAAAG >_1 GGKRRRHAAADSAAILTCVLFVVYDTWWRFLGTSGTLRGRNGFPVFGCFPLLGKNKERVF MNWSRTSYGPIYYARLGASRVLVLNGYEAVREALVLRPQAFAGRCKTELMKLLYEGQHGI MQLDHGPMWKAQRKFGQNALGSLGMGKRSLQVFTHCGHVYITQFSNAQILTFITY*VIYT LTRKQVRIVRATKLQADTRCIMQQNTGVIATVVAAV*D*SVTFIHSTVKIVNELTDFF*A RETFTTVQGAI**M*VYAARKTGKLRS*AIKNGGTKKSATRRRGR*PDGQENKEIGETAV RALEKX >_2 EARGEGTQLLTAQLF*LAFYS*CMIHGGDSWVPVARYGVVMDSLYLGVFPY*GRTKNESL *IGLAPVMGPSTTRVLAPQGSWF*TATKLLEKLLS*DHRLLRVVVKLS**SYCTKASMV* CSLIMDLCGKHSVSSDKMLLEA*AWESEVFRYLRIVVMYILPSFPMHKFLHLLLIKLYIR *LVNRYELYVQQNCKRTQGV*CNRTLVL*RLSLPPYETNQLHSSTPQSKSLMS*LTFFRL ERLLPRSKVLFDECRCMRQGKPVN*EVER*RMVGRKNRPPAEGADSQTVKRTRKLEKPR* GP*RKX >_3 RQEEKARSC*QRSYFDLRSIRSV*YMVAILGYQWHATGS*WIPCIWVFSLTREEQRTSLY ELVSHQLWAHLLRASWRLKGLGFKRLRSC*RSSCLETTGFCGSL*N*VDEVTVRRPAWYN AA*SWTYVESTA*VRTKCSWKLRHGKAKSSGIYALWSCIYYPVFQCTNSYIYYLLSYIYA NS*TGTNCTCNKTASGHKVYNATEHWCYSDCRCRRMRLISYIHPLHSQNR**VN*LFLGS RDFYHGPRCYLMNVGVCGKENR*IKKLSDKEWWDEKIGHPQKGPIARRSREQGNWRNRGK GPREK >LQW253687.y1 >lcl|LQW253687.y1 CHROMAT_FILE: LQW253687.y1 PHD_FILE: LQW253687.y1.phd.1 CHEM: term DYE: ET TIME: Fri Aug 31 12:14:38 2001 TEMPLATE: LQW253687 DIRECTION: rev CTAGCCCTGGACCGGGTATATATTGCAAGGTAGAGCAGGACGGTAACGGAATATCTCCTGCATAACAGCTCGTGTGTATG GCATCTTATACTCGTCTTCCTGAGATGAGAGGAACAGTTTTAAGCAGGCTATAGCTTGGTTCGTATATAAGGTGTTAAAG ATCAAAATTATTAACTTTGGCATTCTATAACTGCAGTGTTATGTGCAAAGTTTGACTTTAACCCAGAGGTTCCTTATGAG TTATCTAAACTGTCAGTCCTACAAATCCAATACAGTTATCCACAAATTTACAAACATTCATTCATTTGTTCCTTCACCTA TTCTTCATCTATCCACTTACCAGGGTAGGTTCCCTCCCAAGAGAATCAATCTCATCCCTCAACCTTTTCATGACTTCAGG ATTTTTCAGCAGAAGCAAAAGCGCCCAACTATTTGTGTTGGATGAAGTCTCAGTGCCAGCAATAAACAAGTCGTTCATGA AATATAGGAGTTGTTTTTCTGTGAAACTGATGAAACGGAATCAAGTTTATGATTGCACTCTTAAAGATTGGGCAGGTGTG AATATTTTTAGACTGAGTTGGGGCAGTAGGTCAAACCGGGCCTAAGTACTACAGGTATCATAGCTTAGGGGCGAATAGCA GCTCACTTATTAAGAATATTAGCAGACGCAAGCATTTTAAGTCTACTACAGCATAGGTTCTCAATCGTGCTACGCCAAAA AACGTCGGCCTTATAGAATAAGTTACAGTAAGATTATGAATGTAAGTACAAGTTATTACCAATTTAGCAAGATGTCTTTA CACAGGGGGTTTGTATGTGATGTTGCCTTATGTAATATACATTAATTAAAAACAAGCAACAACTGTTTTAACGAATTATG TCATGAATTAGGACAACAAAAAGACAGGGGAACAGGCAGGAATTCAAATTCACAATGTTGAATGAATTGTTCACTTTTGA AATGGTTTGAA >_4 QTISKVNNSFNIVNLNSCLFPCLFVVLIHDIIR*NSCCLFLINVYYIRQHHIQTPCVKTS C*IGNNLYLHS*SYCNLFYKADVFWRSTIENLCCSRLKMLASANILNK*AAIRP*AMIPV VLRPGLTYCPNSV*KYSHLPNL*ECNHKLDSVSSVSQKNNSYIS*TTCLLLALRLHPTQI VGRFCFC*KILKS*KG*GMRLILLGGNLPW*VDR*RIGEGTNE*MFVNLWITVLDL*D*Q FR*LIRNLWVKVKLCT*HCSYRMPKLIILIFNTLYTNQAIACLKLFLSSQEDEYKMPYTR AVMQEIFRYRPALPCNIYPVQG* >_5 SNHFKSEQFIQHCEFEFLPVPLSFCCPNS*HNSLKQLLLVFN*CILHKATSHTNPLCKDI LLNW**LVLTFIILL*LIL*GRRFLA*HD*EPML**T*NACVC*YS**VSCYSPLSYDTC ST*ARFDLLPQLSLKIFTPAQSLRVQS*T*FRFISFTEKQLLYFMNDLFIAGTETSSNTN SWALLLLLKNPEVMKRLRDEIDSLGREPTLVSG*MKNR*RNK*MNVCKFVDNCIGFVGLT V*ITHKEPLG*SQTLHITLQL*NAKVNNFDL*HLIYEPSYSLLKTVPLISGRRV*DAIHT SCYAGDIPLPSCSTLQYIPGPGLX >_6 FKPFQK*TIHSTL*I*IPACSPVFLLS*FMT*FVKTVVACF*LMYIT*GNITYKPPV*RH LAKLVITCTYIHNLTVTYSIRPTFFGVARLRTYAVVDLKCLRLLIFLISELLFAPKL*YL *YLGPV*PTAPTQSKNIHTCPIFKSAIINLIPFHQFHRKTTPIFHERLVYCWH*DFIQHK *LGAFASAEKS*SHEKVEG*D*FSWEGTYPGKWIDEE*VKEQMNECL*ICG*LYWICRTD SLDNS*GTSGLKSNFAHNTAVIECQS**F*SLTPYIRTKL*PA*NCSSHLRKTSIRCHTH ELLCRRYSVTVLLYLAIYTRSRAX DEV30421.y1 CHEM: term DYE: ET TIME: Wed Mar 21 15:37:12 2001 TEMPLATE: DEV30421 DIRECTION: rev Length = 408 Score = 199 bits (461), Expect = 1e-50 Identities = 71/117 (60%), Positives = 73/117 (61%), Gaps = 20/117 (17%) Frame = +2 Query: 3 PVFGCFPLLGKNKERVFMNWSRTSY-------------GPIYYARLGAS--RVLV----- 42 PVFGCFP Y P+ +G S RVL Sbjct: 29 PVFGCFP-----------------Y*GRTKNESL*IGLAPV----MGPSTTRVLAPQGSG 145 Query: 43 LNGYEAVREALVLRPQAFAGRCKTELMKLLYEGQHGIMQLDHGPMWKAQRKFGQNAL 99 LNGYEAVREALVLRPQAFAGRCKTELMKLLYEGQHGIMQLDHGPMWKAQRKFGQNAL Sbjct: 146 LNGYEAVREALVLRPQAFAGRCKTELMKLLYEGQHGIMQLDHGPMWKAQRKFGQNAL 316 LQW148467.y1 LQW148467.y1.phd.1 LQW148467.x1 12:21:30 2001 TEMPLATE: LQW148467 DIRECTION: rev Length = 995 Score = 123 bits (282), Expect = 1e-27 Identities = 43/53 (81%), Positives = 44/53 (82%), Gaps = 2/53 (3%) Frame = +3 Query: 1 GFPVFGCFPLLGKNKERVFMNWSRTSYGPIYYARLGASRVLV--LNGYEAVRE 51 GFPVFGCFPLLGKNKERVFMNWSRTSYGPIY ARL ASRV V L + VRE Sbjct: 627 GFPVFGCFPLLGKNKERVFMNWSRTSYGPIY*ARLXASRVWV*RL---QSVRE 776 LQW148467.x1 LQW148467.x1.phd.1 LQW148467.y1 12:20:32 2001 TEMPLATE: LQW148467 DIRECTION: fwd Length = 1020 Score = 489 bits (1143), Expect(3) = e-143 Identities = 164/167 (98%), Positives = 164/167 (98%) Frame = -2 Query: 77 LIL*GRRFLA*HD*EPML**T*NACVC*YS**VSCYSPLSYDTCST*ARFDLLPQLSLKI 136 LIL*GRRFLA*HD*EPM **T*NACV *YS**VSCYSPLSYDTC T*ARFDLLPQLSLKI Sbjct: 503 LIL*GRRFLA*HD*EPMV**T*NACVY*YS**VSCYSPLSYDTCGT*ARFDLLPQLSLKI 324 Query: 137 FTPAQSLRVQS*T*FRFISFTEKQLLYFMNDLFIAGTETSSNTNSWALLLLLKNPEVMKR 196 FTPAQSLRVQS*T*FRFISFTEKQLLYFMNDLFIAGTETSSNTNSWALLLLLKNPEVMKR Sbjct: 323 FTPAQSLRVQS*T*FRFISFTEKQLLYFMNDLFIAGTETSSNTNSWALLLLLKNPEVMKR 144 Query: 197 LRDEIDSLGREPTLVSG*MKNR*RNK*MNVCKFVDNCIGFVGLTV*I 243 LRDEIDSLGREPTLVSG*MKNR*RNK*MNVCKFVDNCIGFVGLTV*I Sbjct: 143 LRDEIDSLGREPTLVSG*MKNR*RNK*MNVCKFVDNCIGFVGLTV*I 3 Score = 39.7 bits (86), Expect(3) = e-143 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 58 KDILLNW**LVLTFIILL* 76 KDILLN *LVLTF ILL* Sbjct: 562 KDILLNRV*LVLTFLILL* 506 Score = 23.9 bits (49), Expect(3) = e-143 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 4/22 (18%) Frame = -1 Query: 38 LLVFN*C--ILH--KATSHTNP 55 LLVF IL K TSHT P Sbjct: 627 LLVF---LFILYYSKGTSHTKP 571 >LQW148467.x1 >lcl|LQW148467.x1 CHROMAT_FILE: LQW148467.x1 PHD_FILE: LQW148467.x1.phd.1 CHEM: term DYE: ET TIME: Wed Aug 22 12:20:32 2001 TEMPLATE: LQW148467 DIRECTION: fwd GGTATCTAAACTGTCAGCCCTACAAATCCAATACAGTTATCCACAAATTTACAAACATTCATTCATTTGTTCCTTCACCT ATTTTTCATCTATCCACTTACCAGGGTAGGTTCCCTCCCAAGAGAATCAATCTCATCCCTCAACCTTTTCATGACTTCAG GATTTTTCAGCAGAAGCAAAAGCGCCCAACTATTTGTGTTGGATGAAGTCTCAGTGCCAGCAATAAACAAGTCGTTCATG AAATATAGGAGTTGTTTTTCTGTGAAACTGATGAAACGGAATCAAGTTTATGATTGCACTCTTAAAGATTGGGCAGGTGT GAATATTTTTAGACTGAGTTGGGGCAGTAGGTCAAACCGGGCCTAAGTACCACAGGTATCATAGCTTAGGGGCGAATAGC AGCTCACTTATTAAGAATATCAGTAGACGCAAGCATTTTAAGTCTACTACACCATAGGTTCTCAATCGTGCTACGCCAAA AAACGTCGCCCTTATAGTATAAGTCTTACAGTAAGATTAGGAATGTAAGTACAAGTTATACCCGATTTAGCAAGATGTCT TTACCACAACGGGTTTTGTATGTGATGTGCCCTTACTGTAATATAGAATAAATAAAAACACAAGCAACCAACCTGTCGTT AGCCGATTTACTGTCCATTGTTTTTTGGTTACAGTCTATAAAGTCCGGGGGGTCGTCCGGGTCACGTGATTGTCGATGAT TTTCACCAAATTGTTTGAACTTTGCCAGTGTGGGTTTTCGTCGTGGGTGGGTACCTTGAGCTGTTGTCGAACCCCGCGGG ATCTCTGAAAGGGACGTCATGAGAAGGCAACGAACGTCGCGTTGGATATGCTGCAACAGCGTGCTGGTGTCCTCATACGG GAGGCGGGCCAAGCCGGGCGTGTAACATGGTGGTCACACGTCAGATTCAACCGCGGGGAGGATTTGGTGAGAGGCAGGAC GCGCGCTTAGACACAATTGCGTGGCGCTTCCTCCTCCTTCCTGGTTCCGACTTCGTGGTT HRQSRDPDDPPDFIDCNQKTMDSKSANDR >_4 NHEVGTRKEEEAPRNCV*ARVLPLTKSSPRLNLTCDHHVTRPAWPASRMRTPARCCSISN ATFVAFS*RPFQRSRGVRQQLKVPTHDENPHWQSSNNLVKIIDNHVTRTTPRTL*TVTKK QWTVNRLTTGWLLVFLFILYYSKGTSHTKPVVVKTSC*IGYNLYLHS*SYCKTYTIRATF FGVARLRTYGVVDLKCLRLLIFLISELLFAPKL*YLWYLGPV*PTAPTQSKNIHTCPIFK SAIINLIPFHQFHRKTTPIFHERLVYCWH*DFIQHK*LGAFASAEKS*SHEKVEG*D*FS WEGTYPGKWIDEK*VKEQMNECL*ICG*LYWICRADSLDT >_5 PRSRNQEGGGSATQLCLSARPASHQILPAVESDV*PPCYTPGLARLPYEDTSTLLQHIQR DVRCLLMTSLSEIPRGSTTAQGTHPRRKPTLAKFKQFGENHRQSRDPDDPPDFIDCNQKT MDSKSANDRLVACVFIYSILQ*GHITYKTRCGKDILLNRV*LVLTFLILL*DLYYKGDVF WRSTIENLWCSRLKMLASTDILNK*AAIRP*AMIPVVLRPGLTYCPNSV*KYSHLPNL*E CNHKLDSVSSVSQKNNSYIS*TTCLLLALRLHPTQIVGRFCFC*KILKS*KG*GMRLILL GGNLPW*VDR*KIGEGTNE*MFVNLWITVLDL*G*QFRYX >_6 TTKSEPGRRRKRHAIVSKRASCLSPNPPRG*I*RVTTMLHARLGPPPV*GHQHAVAAYPT RRSLPSHDVPFRDPAGFDNSSRYPPTTKTHTGKVQTIW*KSSTIT*PGRPPGLYRL*PKN NGQ*IG*RQVGCLCFYLFYITVRAHHIQNPLW*RHLAKSGITCTYIPNLTVRLIL*GRRF LA*HD*EPMV**T*NACVY*YS**VSCYSPLSYDTCGT*ARFDLLPQLSLKIFTPAQSLR VQS*T*FRFISFTEKQLLYFMNDLFIAGTETSSNTNSWALLLLLKNPEVMKRLRDEIDSL GREPTLVSG*MKNR*RNK*MNVCKFVDNCIGFVGLTV*IP >_1 from a related gene XHGFEAVIDLF**YFF*HNEPMQVVQVVSHPFTKNKQ*INIPLLGNS*VTYTR*LVSKHD MYKTEHRCYDD*RCPVCEDKQVIPFFNQCFRRERFLYLLMYVPFLKNLPLVRQQLNVTIQ GRKTKLAKFKQFVENHRQSRDPDDPRDFIDCYLNTMDSKSANDRLVACVFIYSILQ*GHI TYKTRCGKDILLNRV*LVLTFLILL*DLYYKGDVFWRSTIETLWCSRLKCLRLLISL**A >_2 YTGSKL**TYFDDIFFNIMNPCRLSKLSAIHLQKTNNK*ISPFSVTRKLHIRGSS*ASTI CIKQNTGVMTTDVARYVRINKLYLFLINVSDARDSCTFSCTFRF*RICRWFDNSSMLPYK DEKPNLQSSNNLLKIIDNHVTRTTPVTL*TVT*IQWTVNRLTTGWLLVFLFILYYSKGTS >_3 TRVRSCNRPILMIFFLT**THAGCPSCQPSIYKKQTINKYPPSR*LVSYIYAVARKQARY V*NRTPVL*RLTLPGM*G*TSYTFF*SMFQTREIPVPSHVRSVSEESAVGSTTAQCYHTR TKNQTCKVQTIC*KSSTIT*PGRPP*LYRLLPKYNGQ*IG*RQVGCLCFYLFYITVRAHH >sequence 231 new seq like seq 33 is this 43? no it is a new seq FYRKEIKEPKNNFNVNEPKDYVDAFLIEMKKHSLEDSWFH (0?) EEALLICVADLFVAGIETSTGTVMWGMTVLINYPEIQEKLHKEIVNAT (1?) GETPPNLDQMDELPLIQAFIQELYRYMTLAPLSLQHETTKDADIGGYCIPKETL (0?) VLTNIYAVHHDSNIWKNPSEFNIYRHIDKEGKFILSKKVIPF (?) GIGCRSCLGDKLARNEVFLLLANIIKGFEILPDPESKELPDYKDGVNGFLYVPYDYKLVAKPRIVNE* >GCiWno162_l04.b1 CHROMAT_FILE: GCiWno162_l04.b1 PHD_FILE: GCiWno162_l04.b1.phd.1 CHEM: term DYE: big TIME: Fri Sep 28 15:14:21 2001 TEMPLATE: GCiWno162_l04 DIRECTION: fwd Length = 917 Score = 70.6 bits (170), Expect = 3e-12 Identities = 34/48 (70%), Positives = 40/48 (82%), Gaps = 1/48 (2%) Frame = -1 Query: 1 DESLMVCVADLFLAGQTTSTSTIMWGWW-LILYPEIQEKLHKEIANAT 47 +E+L++CVADLF+AG TST T+MWG LI YPEIQEKLHKEI NAT Sbjct: 593 EEALLICVADLFVAGIETSTGTVMWGMTVLINYPEIQEKLHKEIVNAT 450 >GCiWno162_l04.b1_4 DXWVSLFSSKVFCDLKCFVL*KRFYRKEIKEPKNNFNVNEPKDYVDAFLIEMKKHSLEDS WFHVSCTIFTIIFYGDLYCFKVTFVLHRLLRTEYDKMSPKTV*NFISGRSSFDLCG*LVC CWNRNEYRHSNVGDDCAY*LSGDTRETS*RNSQCNRCVK*SLVSFL*QTYSGETPPNLDQ MDELPLIQAFIQELYRYMTLAPLSLQHETTKDADIGGYCIPKETL VCLLYS*DILC*TYL ISLNFISGVNKHLCRPSRFEYLEESERVQHLSSHRQRREVHSFQESDSV*NEDRQ*FSCR QGMNR >GCiWno162_l04.b1_5 *PXG*SFQ*QSVL*FKMFCFIKKILPERDKRTQE*L*CE*TKGLCRCFPY*DEKALS*RF MVSCKLYYFHNHFLWRPVLF*GHIRTTPVVKN*I*QDVA*NCLKLYFRKKLF*FVWLTCL LLE*KRVQAQ*CGG*LCLLTIRRYKRNFIKK*SMQQVC*VKSCFISLTNLLR*NTAKLGP NG*TSTDPSFYSRTLPLHDSCATVSSTRNYKRCGYWRILYPQRDIGMSAIFLRYTVLNIS YFIKFHIRC*QTFMPSITIRISGRIRASSTFIVTSTKKGSSFFPRK*FRLE*GSSVVFLQ ARYEPX >GCiWno162_l04.b1_6 LTXGLVFSVAKCFVI*NVLFYKKDFTGKR*KNPRITLM*MNQRIMSMLSLLR*KSTLLKI HGFM*VVLFSQSFFMETCTVLRSHSYYTGC*ELNMTRCRLKLFETLFQ EEALLICVADLF VAGIETSTGTVMWGMTVLINYPEIQEKLHKEIVNATG VLSEVLFHFFNKLTQVKHRQTWT KWMNFH*SKLLFKNFTAT*LLRHCLFNTKLQKMRILADTVSPKRHWYVCYILKIYCVKHI LFH*ISYQVLTNIYAVHHDSNIWKNPSEFNIYRHIDKEGKFILSKKVIPFRMRIVSSFPA GKV*TX >cibd084l24 Length = 722 Score = 167 bits (418), Expect = 6e-41 Identities = 79/105 (75%), Positives = 86/105 (81%) Frame = +1 Query: 1 VLTNIYAVHHDSNIWKNPSEFNIYRHIDKEGKFILSKKVIPFGIGCRSCLGEKLARIEIF 60 VLTNIYAVHHDSNIWKNPSEFNIYRHIDKEGKFILSKKVIPFGIGCRSCLG+KLAR E+F Sbjct: 40 VLTNIYAVHHDSNIWKNPSEFNIYRHIDKEGKFILSKKVIPFGIGCRSCLGDKLARNEVF 219 Query: 61 LFLANIIKRFKVLPDPESQDLPPMDDGITXXXXXXXXXKAVVLPR 105 L LANIIK F++LPDPES++LP DG+ K V PR Sbjct: 220 LLLANIIKGFEILPDPESKELPDYKDGVNGFLYVPYDYKLVAKPR 354 >sequence 43 1 accession 42% to 1A1 seq 43 shares an exact run with seq 24 in the heme peptide region, but ESTs support both sequences. MFAKLFGWWGSSWVTTCLLGLLTLVILVYYYWWKLPHPRYPPGVRGIPVMGALPLLGKFA HKVIMRWSHDKYGPVMSVRFGPSDSVVLNDYESVYEALVKQGPAFLTRPNIELINSYSNG YGFGFAEGNKKYMEVRHFTLKALRGFGIGGRVMEERVSEVAQDLVQSLQELDGKPTNFR MIVGTTVSNVIASIVLGKKFHPKDEDFQRHVQLIFD (?) SFGDEETAXXILVLMYFPLLRHIPPFKNAXXXXXXXHFKQL DFCRKEILEHKKNLDENEPGDYIDAFLVEMKKHSPQDSWFH EESLIVCVVDLFFAGTDTSTSTVMWAMVALLNFPEIQEKLHKEIANAT (1?) seq 57 DESLMVCVADLFLAGQTTSTSTIMWGWWLILYPEIXXXXXXXXXXXXX GEALPSLNHRDDLPLLQAFIQEV YRCMTLVPLGVQHQTTKDVEISGYCIPKDTVVFTNIDAVHHDPNIWKNPSEFNIYRHIDK DGKFIPSKKVIPFGIGCRSCLGEKLARIEIFLFLANIIKRFKVLPDPESQDLPPMDDGIT GFGFFPFPFKAVVLPRKNEEIPE* LQW201878.x1 from a similar gene to seq 7 but not same gene LQW57065.x1 exon with GEALP up to PKDTV overlaps rcicl015b02 rcicl015b02 EST that covers from YRCM to end >GCiWno35_e01.b1 CHROMAT_FILE: GCiWno35_e01.b1 PHD_FILE: GCiWno35_e01.b1.phd.1 CHEM: term DYE: big TIME: Sat Sep 1 10:03:45 2001 TEMPLATE: GCiWno35_e01 DIRECTION: fwd Length = 809 Score = 70.6 bits (170), Expect = 3e-12 Identities = 34/48 (70%), Positives = 40/48 (82%), Gaps = 1/48 (2%) Frame = +3 Query: 1 DESLMVCVADLFLAGQTTSTSTIMWGWW-LILYPEIQEKLHKEIANAT 47 +E+L++CVADLF+AG TST T+MWG LI YPEIQEKLHKEI NAT Sbjct: 171 EEALLICVADLFVAGIETSTGTVMWGMTVLINYPEIQEKLHKEIVNAT 314 >GCiWno108_j02.b1 CHROMAT_FILE: GCiWno108_j02.b1 PHD_FILE: GCiWno108_j02.b1.phd.1 CHEM: term DYE: big TIME: Tue Sep 11 22:24:29 2001 TEMPLATE: GCiWno108_j02 DIRECTION: fwd Length = 922 Score = 70.6 bits (170), Expect = 3e-12 Identities = 34/48 (70%), Positives = 40/48 (82%), Gaps = 1/48 (2%) Frame = +1 Query: 1 DESLMVCVADLFLAGQTTSTSTIMWGWW-LILYPEIQEKLHKEIANAT 47 +E+L++CVADLF+AG TST T+MWG LI YPEIQEKLHKEI NAT Sbjct: 301 EEALLICVADLFVAGIETSTGTVMWGMTVLINYPEIQEKLHKEIVNAT 444 LQW192891.x1 LQW192891.x1.phd.1 LQW192891.y1 11:54:27 2001 TEMPLATE: LQW192891 DIRECTION: fwd Length = 974 Score = 71.0 bits (171), Expect = 2e-12 Identities = 34/35 (97%), Positives = 35/35 (99%) Frame = +1 Query: 26 FGIGGRVMEERVSEVAQDLVQSLQELDGKPTNFRM 60 FGIGGRVMEERVSEVAQDLVQSLQELDGKPTNFR+ Sbjct: 214 FGIGGRVMEERVSEVAQDLVQSLQELDGKPTNFRV 318 Score = 69.5 bits (167), Expect = 7e-12 Identities = 33/35 (94%), Positives = 34/35 (96%) Frame = +2 Query: 59 RMIVGTTVSNVIASIVLGKKFHPKDEDFQRHXQLI 93 +MIVGTTVSNVIASIVLGKKFHPKDEDFQRH QLI Sbjct: 485 QMIVGTTVSNVIASIVLGKKFHPKDEDFQRHVQLI 589 >LQW192891.x1_1 NSSCMR**DWDLGLNWPITPTLYMHILFYMGEVVQ*GISWNSGFIPEVPLPRD*SQC*VI IT*IFHICCCRFGIGGRVMEERVSEVAQDLVQSLQELDGKPTNFRVGGYYGSFV*AYIHI IMNVMNKITSVVKIYKLM*FMHSHLAVQLHKL*IDSYYYHATDDCRNNSFKRNREHRPRE EVSSKRRRLSTPCTTNL*QVEHKHNINKCILF*R*FEILINCFILLLCSVLVTKKLQLHS SIDVFPLLRHIHHSRTLQEVVDFIQQL*VCNYCIILQQTLSQYAPYYYKSLNRSVS*VRC VTHYGR*RIERLMWTTVDLGSSLFX >LQW192891.x1_2 TAAACVDETGI*A*IGPSPQHCICIFYSIWVRSYSEAYHGTLDSYQRSHYPEIEASAK*L *LKYFIFVVAGLGLEVV*WRSECQRLRKILFNLFKNWMENQQTLGWADIMVHLFRLTYI* **ML*IKLLQSLKYIN*CDLCILT*QCNCTSYRLTVIIIMPQMIVGTTVSNVIASIVLGK KFHPKDEDFQRHVQLIFDRLNINII*INVFYFSGNLKY*SIVLYYFYVQFW*RRNCSYIL VLMYFHCYVIFTIQERCKKLSISFNNCESVITVSYYSKRCHNTRLTIINHLIGPLVR*DV *RTMADEGLKG*CGQQLTLDPLYLX >LQW192891.x1_3 QQLHALMRLGFRPELAHHPNIVYAYSILYG*GRTVRHIMELWIHTRGPITQRLKPVLSDY NLNISYLLLQVWDWRSCNGGASVRGCARSCSISSRIGWKTNKL*GGRILWFICLGLHTYN NECYE*NYFSR*NI*INVIYAFSPSSATAQVID*QLLLSCHR*LSEQQFQT*SRASSSGR SFIQKTKTFNAMYN*SLTG*T*T*YK*MYFILAVI*NTNQLFYITFMFSFGDEETAVTF* Y*CISIVTSYSPFKNAARSCRFHSTIVSL*LLYHITANVVTIRALLL*IT**VR*LGKMC NALWQMKD*KADVDNS*PWILSIX LQW243246.y1 LQW243246.y1.phd.1 LQW243246.x1 11:28:15 2001 TEMPLATE: LQW243246 DIRECTION: rev Length = 1014 Score = 41.4 bits (95), Expect = 0.001 Identities = 17/24 (70%), Positives = 20/24 (82%) Frame = +1 Query: 11 VLAMMYFPLLRHIPPFKNAWDQTL 34 +L +MYFPLLRHIPPFKNA + L Sbjct: 58 ILVLMYFPLLRHIPPFKNACKKLL 129 >LQW243246.y1_1 RLLTWSSFMSVW*RRNAVTILVLMYFPLLRHIPPFKNACKKLLMFISNN*VSSVN*LVIN ILQEKHD*FTK*TAAF*LFSF*IHPFL*MRFPLISYYG*TKHLVGFNSATF*IFVAKRFW NTRRTLMRTNPGITLMLFLWR*RNIHLKIHGFM*VGRYLKFLFYMDKVARNASKPDIQAR IVLSPQHPGCHNPLVTTVFVLCLCLAQEPLNQYQALNPIPGWHTKTNHSLRWTRIYTESR TLTKLNDYLYXNSRTNHSWSAWLIYFWPDRHEHST*CGGGGLYYPRSEKSSEYITRSGMI TPDVSXFRYSVRVKLRKQGTNRALRKSPGPSKGQVKSI >LQW243246.y1_2 DY*PGPHLCQFGDEEMQLPF*Y*CIFHCYVIFHHSRTPARSC*CSFQTIR*VLLINW**I FYRKNMIDSQNKQQPFNYFHFKFILFYK*GSPLLVIMDKLNIWLDLTLLLFRFLSQRDFG TQEEP**ERTRGLH*CFSCGDEETFTSRFMVSCKLGDTLSSCSIWIRWQGMLASQTFRPE LSYHPNTQDATTR**PLCLCYACVLLKNL*ISIKH*IPYLVGTQKPTIHCAGQEYIQKAE L*QN*TTIFTXIPGRITHGLRG*SISGRTDTSTVHNVGVVAYTIQDQRNHQNTSPVVV*L PRTCLSSDTRSE*NYGSRARIVR*EKARVPVRARSSR >LQW243246.y1_3 TTDLVLIYVSLVTKKCSYHSSIDVFSIVTSYSTIQERLQEVVDVHFKQLGEFC*LTGNKY FTGKT*LIHKINSSLLTIFILNSSFFINEVPPY*LLWIN*TFGWI*LCYFLDFCRKEILE HKKNLDENEPGDYIDAFLVEMKKHSPQDSWFHVSWEIP*VPVLYG*GGKEC*QARHSGQN CPITPTPRMPQPVSDHCVCAMLVSCSRTFKSVSSIESHTWLAHKNQPFIALDKNIYRKQN FNKIKRLSLQXFQDESLMVCVADLFLAGQTRAQYIMWGWWLILSKIREIIRIHHP*WYDY PGRVXVQILGPSKTTEAGHESCAKKKPGSQ*GPGQVD >rcicl015b02 Length = 682 Score = 70.6 bits (170), Expect = 1e-11 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 1/40 (2%) Frame = -2 Query: 53 YRCMTLVPLGVQHQTTKDVEISGYCIPKDTVV-SNILSKH 91 YRCMT VPLGVQHQTTKDVEISGYCIPKDTVV +NI + H Sbjct: 681 YRCMTXVPLGVQHQTTKDVEISGYCIPKDTVVFTNIDAVH 562 >cicl015b02_3 LINSYSNGYGFGFAEGNKKYMEVRHFTLKALRGFGIGGRVMEERVSEVAQDLVQSLQELD GKPTNFRMIVGTTVSNVIASIXLGKKXHPKDEDFQRHXQLI >cieg084m15 Length = 602 Score = 173 bits (435), Expect = 5e-43 Identities = 86/88 (97%), Positives = 86/88 (97%) Frame = +1 Query: 1 LINSYSNGYGFGFAEGNKKYMEVRHFTLKALRGFGIGGRVMEERVSEVAQDLVQSLQELD 60 LINSYSNGYGFGFAEGNKKYMEVRHFTLKALRGFGIGGRVMEERVSEVAQDLVQSLQELD Sbjct: 337 LINSYSNGYGFGFAEGNKKYMEVRHFTLKALRGFGIGGRVMEERVSEVAQDLVQSLQELD 516 Query: 61 GKPTNFRMIVGTTVSNVIASIXLGKKXH 88 GKPTNFRMIVGTTVSNVIASI LGKK H Sbjct: 517 GKPTNFRMIVGTTVSNVIASIVLGKKFH 600 >cieg084m15_1 MFAKLFGWWGSSWVTTCLLGLLTLVILVYYYWWKLPHPRYPPGVRGIPVMGALPLLGKFA HKVIMRWSHDKYGPVMSVRFGPSDSVVLNDYESVYEALVKQGPAFLTRPNIELINSYSNG YGFGFAEGNKKYMEVRHFTLKALRGFGIGGRVMEERVSEVAQDLVQSLQELDGKPTNFRM IVGTTVSNVIASIVLGKKFHP LQW57065.x1 >rcicl015b02 Length = 682 Score = 62.5 bits (149), Expect = 8e-10 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 20 YRCMTLVPLGVQHQTTKDVEISGYCIPK 47 YRCMT VPLGVQHQTTKDVEISGYCIPK Sbjct: 681 YRCMTXVPLGVQHQTTKDVEISGYCIPK 598 >rcicl015b02 TTTAGTGCATATGCGGTAGCAGATGAACAACAAAGCAATTAGTAATAAATGAGGTTAGTAAAATAATACTGGGATGCATA GGCGACAACGTTGAGGTGGCAGGGTGGGCAAGTCTACACTAAAAATATTTGCACTGCGTTAATCAGTAAACATTATAAGC AGAAAGTTAGATTTGGGGAATATCCCCTTCCCTTGGTTTAAATGTTTTGGGGTTGCTTGGTTGTTCTTGTACCTTTCTGT TTAAAGTAGTTATTCAGGAATTTCTTCATTTTTCCGTGGAAGGACGACAGCTTTGAAGGGAAACGGGAAGAAACCGAACC CAGTGATCCCGTCGTCCATTGGAGGAAGATCTTGGCTCTCAGGATCAGGGAGGACCTTGAACCTCTTGATAATGTTGGCA AGGAAGAGGAAGATCTCAATCCTCGCCAACTTTTCACCAAGACACGATCTGCATCCGATTCCAAACGGGATCACTTTCTT GGAAGGAATGAACTTCCCGTCTTTATCGATGTGACGATAAATGTTAAACTCGCTCGGATTCTTCCAGATATTTGGATCGT GGTGAACGGCATCAATGTTTGTGAAAACCACAGTATCTTTAGGGATACAATAACCACTAATCTCTACATCCTTAGTAGTT TGGTGCTGAACACCCAATGGTACGANGGTCATGCATCGATAA YRCMTXVPLGVQHQTTKDVEISGYCIPKDTVVFTNIDAVHHDPNIWKNPSEFNIYRHIDK DGKFIPSKKVIPFGIGCRSCLGEKLARIEIFLFLANIIKRFKVLPDPESQDLPPMDDGIT GFGFFPFPFKAVVLPRKNEEIPE* >sequence 44 4 accessions very similar to seq 2, 3 54% to 2U1 probably = seq 2 with three errors corrected below DLFVAGTETTTSTLRWSILCMIHNPEKQEKLRKEICDVIGE DRVPAMNDKAQMPYTCAFMQEVFRYRTLVPLSVVHMTNQDVVLNGYTIPKG LQW133624.x1 one diff DEV25023.x1 LWG1219.x1 LQW214090.x1 >sequence 46, 54 33% to CYP1A MMITAAILLDAGRSFAVPVAFTAVSVLTLYVCLRKRQGIPPGPTAWPLVGNL FSMGRQSHLILESMRKTYGDVFSVYFGSTLVVVVNGKAVEECLSTHSAR (2) YSMRPELHTAQYILEGKSFAFSHIAVSKHKRYRTLAVAVVKQLVNGGGEKTDVAV KHGLQNGTRHSSIEERIFMEAACMCDKLLETSDSPDLKDEILKVITKEL (2) LSEYELDEISRVVENLRNSNEAIMLVNFIPAVRMLWRNGLQKYIQLTQSLNR (2) FFERCIRNRKAQLATVSNGHTEDNGVRLTNGVDCTVKFWQKLKNDPQYEESRVMKV (0) VADLFGARVDTMTVALAWMIVYWSTYQAAQERAQKEIDHFVKNEKRLPR (2) YSERNQLPYTMALIMEVERHCSFVPFTLPHAPAQDTMLNGYLIPKGTMMLISMRSINHDTAVWDSPAQFR (2) PERFLLDQSGGFNSALAEQVMLFGAGRRRCAGEALGRMQIFLYSVLFLRKCTFRR SDKDGHVLPESLAGISLIPQTMCVSISRREADGSKNTEP* GCiWno803_g11.g1 spans intron 1 at HSAR and YSMR minus strand GCiWno355_f02.b1 spans intron 2 at KELC and ELDE minus strand LQW254516.x1 spans intron 3 at SLNR and FFER plus strand GCiWno455_p01.g1 spans intron 4 at VMKV and VADL plus strand GCiWno455_p01.b1 spans intron 5 at RLPR and YSER GCiWno1042_f22.b1 spans intron 6 at PAQF and PERF LQW107672.y1 LQW148739.x1 LQW157952.y1 LQW167870.y1 LQW235181.y1 LQW254516.y1 3 DIFFS LQW270907.y1 LQW73664.x2 LQW91169.x1 PKG TO WXXP cibd040f23 cibd039h22 GCiWno736_g02.g1 Note seq variability in exon 2 but not in other exons >GCiWno455_p01.b1_4 SXNSQEKRXXHXXMSLAXTPXLMKKE*KARKNVYMSL*YPR*LTCSALEWTR*PLPSHE* LSIGPLXKRHKKGHRRKLTTS*KTXNVYRGKGLYSCXFNIYGYYK*RIIHLEH*PLGTVF ETQCYHHRGCIYSFAHKVT*II*LCFQRKRNVNEIRHPC*NF*SSRPPFFIPLKMVLKIT LLKQLRKWNQ*QND**ANSIHLFIYSLMECR YSERNQLPYTMALIMEVERHCSFVPFTLP HAPAQDTMLNGYLIPKGTMMLISMRSINHDTAVWDSPAQFR*VRMI*QM*SVTM*HVLSY PTLLE >GCiWno455_p01.b1_5 XQ*PRKEMXPXXXVSCXYPXPYEERIKSSQKRLYVAMIPQVADLFGARVDTMTVALA*MI VYWSTXQAAQERAQKEIDHFVKNEXRLPR* RFIFLXI*YIWLL*MTYYTPGTLTIGYRVR DSMLPPQRVYIQLRTQSYIDYITLFSKKTQCE*N*TPVLKLLKLPASFFHSLENGIKDHI VKTTEKMESIAKRLISEFHTFIYLFINGMQVLRKKSTPVHNGPYNGS*KTL*FRTIYPAT RPCARHDAKWIFNPERHNDVNQHAVN*PRYCSVGLACSIPVS*NDITDVVGNYVTCSILP HSTRX >GCiWno455_p01.b1_6 LPIAKKRDXXMXXCLLLXPXXL*RKNKKLAKTFICRYDTPGS*LVRR*SGHDDRCPRMND CLLVHXPSGTRKGTEGN*PLREKRXTFTEVKVYIPVXLIYMVIINDVLYTWNINHWVPCS RLNVTTTEGVYTASHTKLHRLYNFVFKENAM*MKLDTRVKTFKAPGLLFSFP*KWY*RSH C*NN*ENGINSKTINKRIPYIYLFIH*WNAGTPKEINSRTQWPL*WKLKDIVVSYHLPCH TPLRKTRC*MDI*SRKAQ*C*SACGQLTTILQCGTRLLNSGKLE*YNRCSR*LCNMFYLT PLY*X >GCiWno455_p01.b1 CTCTAGTAGAGTGGGGTAAGATAGAACATGTTACATAGTTACCGACTACATCTGTTATATCATTCTAACTTACCGGAATT GAGCAGGCGAGTCCCACACTGCAGTATCGTGGTTAATTGACCGCATGCTGATTAACATCATTGTGCCTTTCGGGATTAAA TATCCATTTAGCATCGTGTCTTGCGCAGGGGCGTGTGGCAGGGTAAATGGTACGAAACTACAATGTCTTTCAACTTCCAT TATAAGGGCCATTGTGTACGGGAGTTGATTTCTTTCGGAGTACCTGCATTCCATTAATGAATAAATAAATAAATGTATGG AATTCGCTTATTAATCGTTTTGCTATTGATTCCATTTTCTCAGTTGTTTTAACAATGTGATCTTTAATACCATTTTCAAG GGAATGAAAAAAGGAGGCCGGGAGCTTTAAAAGTTTTAACACGGGTGTCTAATTTCATTCACATTGCGTTTTCTTTGAAA ACAAAGTTATATAATCTATGTAACTTTGTGTGCGAAGCTGTATATACACCCTCTGTGGTGGTAACATTGAGTCTCGAACA CGGTACCCAATGGTTAATGTTCCAGGTGTATAATACGTCATTTATAATAACCATATATATTAAATNTACAGGAATATAAA CCTTTACCTCGGTAAACGTTNTTCGTTTTTCACGAAGTGGTCAATTTCCTTCTGTGCCCTTTCTTGTGCCGCTTGGNTAG TGGACCAATAGACAATCATTCATGCGAGGGCAACGGTCATCGTGTCCACTCTAGCGCCGAACAAGTCAGCTACCTGGGGT ATCATAGCGACATATAAACGTTTTTGCGAGCTTTTTATTCTTTCTTCATAAGGNTNGGGGTANAAGCAAGAGACATNGNT NCATGGNTNCATCTCTTTTCTTGGCTATTGGNAGA >GCiWno455_p01.g1 ATTGAATGTTCTTTGTTTACAACCAAATGGAAAGAGAAAACTAAACGAAAAGGTGTCCCATCTTCCCCCACCCTACTATA CATAAAACGCTTCATTGATCCCTTTTTTTCTGGAACTTAAAAAAAAGGCAAAAAAATGTCATAGAAACAGTTGTGAATAG TTTTCTTAACTCTCTGTAAAGGTTTTTCGAACGTTGTATACGAAATCGGAAAGCGCAACTCGCAACGGTTTCGAACGGAC ATACCGAAGATAATGGTGTCCGGCTTACCAACGGTGTTGACTGTACTGTGAAGTTTTGGCAAAAACTAAAGAACGATCCA CAATACGAAGAAAGCAGAGTCATGAAAGTGGTAAAAAATTTTAAATATTTTAATCTAGTCGATTGTCCGTCATATGTAAA GGTTTGAACGTTTGGGCATTGATTGCATTTTTGCAATGAAAACATATAGTTATCAAAATGCCACGCCGGTCAGCAAAAGG ACACAGGAAACACGTTATATTCGTCTTTCGTTTGCCTCTTATTAATACTTTCACGTTTGACATTATAGGCCTTACTGCGG TATAAGATGGGATACCGTTAGCTACTTTATTTCCTAGTGGTGTTTTTATAACATTTAACAAAGCCTTTTTACAGTCTCGG GTCTATGGTTATATTTATTCGTAATTATTTTTTATTTACTACCAAATAAGACAAGAAAAGAGAATGAAACAATGAAACAA TGTCTCTTTGCTTTTACCCAACCCTATGATAGAAAGAATAAAAAGCTCGCAAAACGTTTATATGTCGCTATGATTACCAN GTAGCTGACTTGNNTCGCGCTAGAGTGGACACGATGACCGTTGCCCTCGCATGGATGAATGTCTATTGGTCCACTTACCN AGCGCNACAGAAAGGCACAN >GCiWno455_p01.g1_1 IECSLFTTKWKEKTKRKGVPSSPTLLYIKRFIDPFFSGT*KKGKKMS*KQL*IVFLTLCK GFSNVVYEIGKRNSQRFRTDIPKIMVSGLPTVLTVL*SFGKN*RTIHNTKKAES*KW*KI LNILI*SIVRHM*RFERLGIDCIFAMKTYSYQNATPVSKRTQETRYIRLSFASY*YFHV* HYRPYCGIRWDTVSYFIS*WCFYNI*QSLFTVSGLWLYLFVIIFYLLPNKTRKENETMKQ CLFAFTQPYDRKNKKLAKRLYVAMITX*LTXXALEWTR*PLPSHG*MSIGPLTXRXRKAX >GCiWno455_p01.g1_2 LNVLCLQPNGKRKLNEKVSHLPPPYYT*NASLIPFFLELKKKAKKCHRNSCE*FS*LSVK VFRTLYTKSESATRNGFERTYRR*WCPAYQRC*LYCEVLAKTKERSTIRRKQSHESGKKF *IF*SSRLSVICKGLNVWALIAFLQ*KHIVIKMPRRSAKGHRKHVIFVFRLPLINTFTFD IIGLTAV*DGIPLATLFPSGVFITFNKAFLQSRVYGYIYS*LFFIYYQIRQEKRMKQ*NN VSLLLPNPMIERIKSSQNVYMSL*LPXS*LXSR*SGHDDRCPRMDECLLVHLPSATERH >GCiWno455_p01.g1_3 *MFFVYNQMEREN*TKRCPIFPHPTIHKTLH*SLFFWNLKKRQKNVIETVVNSFLNSL*R FFERCIRNRKAQLATVSNGHTEDNGVRLTNGVDCTVKFWQKLKNDPQYEESRVMKVVKNF KYFNLVDCPSYVKV*TFGH*LHFCNENI*LSKCHAGQQKDTGNTLYSSFVCLLLILSRLT L*ALLRYKMGYR*LLYFLVVFL*HLTKPFYSLGSMVIFIRNYFLFTTK*DKKRE*NNETM SLCFYPTL**KE*KARKTFICRYDYXVADLXRARVDTMTVALAWMNVYWSTYXAXQKGT LQW254516.x1 LQW254516.x1.phd.1 LQW254516.y1 11:53:22 2001 TEMPLATE: LQW254516 DIRECTION: fwd Length = 999 Score = 65.6 bits (157), Expect = 6e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 22 AIMLVNFIPAVRMLWRNGLQKYIQLTQSLNR 52 AIMLVNFIPAVRMLWRNGLQKYIQLTQSLNR Sbjct: 36 AIMLVNFIPAVRMLWRNGLQKYIQLTQSLNR 128 Query: 1 FFERCIRNRKAQLATVSNGHTEDNGVRLTNGVDCTVKFWQKLKNDPQYEESRVMKV 56 FFERCIRNRKAQLATVSNGHTEDNGV LTNGVDCTVKFWQKLKNDPQYEESRVMKV Sbjct: 412 FFERCIRNRKAQLATVSNGHTEDNGVWLTNGVDCTVKFWQKLKNDPQYEESRVMKV 579 >LQW254516.x1 >lcl|LQW254516.x1 CHROMAT_FILE: LQW254516.x1 PHD_FILE: LQW254516.x1.phd.1 CHEM: term DYE: ET TIME: Mon Aug 27 11:53:22 2001 TEMPLATE: LQW254516 DIRECTION: fwd CAGAAGAAACGGCAGTGCAGCTGCATGCGGTATAGGCGATTATGTTAGTCAATTTTATCCCAGCGGTCCGAATGCTCTGG AGAAATGGATTACAAAAATATATTCAGTTAACCCAATCGTTAAACAGGTTGGTCTCACTAACTTAGATCTTGCGTAGCGT TTCTTAATATTTTAGTCCTAAAACCTAGTTACCATTATTTTAAAACTGTGGGCCCCTGTGTAAGAAGCCATGTAGTAAAT TGTTAAAAAATAAGATTTAATTTGCCATTGGTTTATTGCCGTTCCTGGTTCCCCATATATTAAACGTTTTCTTGATCCCT TTCTGAACTCATAGGCAAAGAAACTGTCATAGAAACAGTTGTGAATAGCTTTTCTTTATAGTTTACAACCCCAAAAAACT CTCTGTAAAGGTTTTTCGAACGTTGTATACGAAATCGGAAAGCGCAACTCGCAACGGTTTCGAACGGACATACCGAAGAC AATGGTGTCTGGCTTACCAACGGTGTTGACTGTACTGTGAAGTTTTGGCAAAAACTAAAGAACGATCCACAATACGAAGA AAGCAGAGTCATGAAAGTGGTAAAAAAATTTAAATATTTTAATCTAGTCGATTGTCCGTCATATGTAAAGGTTTGAACGT TTGGGCATTGATTGCATTTTTGCAATGAAAACATATAGTTATCAAAATGCCACGCCGGTCAGCAAAAGGACACAGGAAAC ACGTTATCTTCGTCTTTCGTTTGCCTCTTATTAATACTTTCACGTATAACATTATAGGCCCTACTGCGGTATACGACTGG ATCCCGTAGCTACTTATTCCCTGTGGTGTTTTATACCTTAAAAGCCTTTAAAGCCGGGTTAAGGATCAAATGACAATTAT ATGCTACAAGAAGAAGAATGACATAACATTCTTTGTTCGCCCTATAAAGAAGGTGAGATTTTTAATACAGATATAGATGA AGAACCTATGAGTCCTCCCAAGAAACTTCAACCTGATTT >GCiWno355_f02.b1_4 KYSLKRTDN*TGPILPGLIIILYYADIPCVLSFTRHSIYWKGRALHSHI*QYQNTNDTAR *L*LWLNNLSTAVARKQTLQSNMVCRMERGIALSKKESLWKLLACAKNC*RHQTSLT*KT KY*RL*QKNCAARQRTCCWEIRKHFANHNYTI**GGGDRTPISSIFSSHLVVNKEKLLKY KTRSSKTVVNGLKHD*DIGIVCVKGVPSSPTLLYE*YNE*GVLINRLSEYELDEISRVVE NLRNSNEAIMLVNFIPAV*MLWRNGLPKYTLVSLIVRQ*RMIVPYVLPANSL*ST >GCiWno355_f02.b1_5 IFFKED*QLNWSHLTRANYHFVLCRYSMRPELHTAQYILEGKSFAFSHIAVSKHKRYRTL AVAVVKQLVNGGGEKTDVAVKHGLQNGTRHSSIEERIFMEAACMCEKLLETSDKPDLKNE ILKVITKELCRSAADMLLGNT*AFCKS*LYYIIGWGR*DTYFFYFLVPFGSKQRKVTEI* NQILKDRC*WFKTRLGYWDSMC*RCPIFPHPTI*II**IRCFD*QAVRV*T**NFSCGRK LA*FK*GDYVSQFYPSGLNALEKWITKIYSGFPDRQTVTHDRAVRFTGKQPMIHX >GCiWno355_f02.b1_6 NIL*RGLTIELVPSYPG*LSFCIMQIFHAS*ASHGTVYIGREELCILTYSSIKTQTIPHV SCSCG*TTCQRRWRENRRCSQTWSAEWNAA*LYRRKNLYGSCLHVRKTVRDIRQA*PEKR NTEGYNKRTVPLGSGHAAGKYVSILQIITILYNRVGEIGHLFLLFSRPIW**TKKSY*NI KPDPQRPLLMV*NTIRILG*YVLKVSHLPPPYYMNNIMNKVF*LTGCPSMNLMKFLVW*K TCVIQMRRLC*SILSQRSECSGEMDYQNILWFP*SSDSDA*SCRTFYRQTAYDPX >GCiWno355_f02.b1 TGTGGATCATAGGCTGTTTGCCGGTAAAACGTACGGCACGATCATGCGTCACTGTCTGACGATCAGGGAAACCAGAGTAT ATTTTGGTAATCCATTTCTCCAGAGCATTCAGACCGCTGGGATAAAATTGACTAACATAATCGCCTCATTTGAATTACGC AAGTTTTCTACCACACGAGAAATTTCATCAAGTTCATACTCGGACAGCCTGTTAATCAAAACACCTTATTCATTATATTA TTCATATAGTAGGGTGGGGGAAGATGGGACACCTTTAACACATACTATCCCAATATCCTAATCGTGTTTTAAACCATTAA CAACGGTCTTTGAGGATCTGGTTTTATATTTCAGTAACTTTTCTTTGTTTACTACCAAATGGGACGAGAAAATAGAAGAA ATAGGTGTCCTATCTCCCCCACCCTATTATATAGTATAGTTATGATTTGCAAAATGCTTACGTATTTCCCAGCAGCATGT CCGCTGCCGAGCGGCACAGTTCTTTTGTTATAACCTTCAGTATTTCGTTTTTCAGGTCAGGCTTGTCTGATGTCTCTAAC AGTTTTTCGCACATGCAAGCAGCTTCCATAAAGATTCTTTCTTCGATAGAGCTATGCCGCGTTCCATTCTGCAGACCATG TTTGACTGCAACGTCTGTTTTCTCGCCACCGCCGTTGACAAGTTGTTTAACCACAGCTACAGCTAACGTGCGGTATCGTT TGTGTTTTGATACTGCTATATGTGAGAATGCAAAGCTCTTCCCTTCCAATATATACTGTGCCGTGTGAAGCTCAGGACGC ATGGAATATCTGCATAATACAAAATGATAATTAGCCCGGGTAAGATGGGACCAGTTCAATTGTCAGTCCTCTTTAAAGAA TATTT >GCiWno803_g11.g1_4 KIRSRFL*HSLLFLF*RCMCAYEKDRASSPVPQPGHWSAICSLWVDKATSY*RACGKPTA TCSQSTLAQL*WSLSMVKRLRNACQHILQGNKLWELQNLFAIY*CRTVG*DVITLT*NRR FPNRVFNN*RRSFRVCYINL*IFFKED*QFDLSHLTPAYYTFFIMQIFHAS*ASHGTVYI GREELCILTYSSIKTQTIPHVSCSCG*TTCQRRWRENRRCSQTWSAEWNAA*LYRRKNLY GSCLHVR*TVRDIRQA*PERRNTEGHNKRTVPLGSGVRAE >GCiWno803_g11.g1_5 EDPFAVPVAFTAVSVLTLYVCLRKRQGILXGPTAWPLVGNLFSMGRQSHLILESMRKTYG DVFSVYFGSTLVVVVNGKAVEECLSTHSAR *QIMGTTKPIRNLLMSHCGVRCNNFNIKSQ IP*SCF*QLTTLF*SLLYKFVNIL*RGLTI*LVPSYPGLLYIFYYADIPCVLSFTRHSIY WKGRALHSHI*QYQNTNDTAR*L*LWLNNLSTAVARKQTLQSNMVCRMERGIALSKKESL WKLLACAINC*RHQTSLT*KTKY*RS*QKNCAARQRGPS*X >GCiWno803_g11.g1_6 *RSVRGSCSIHCCFCSDAVCVPTKKTGHPXRSHSLAIGRQFVLYGSTKPPHIREHAENLR RRVLSLLWLNFSGRCQW*SG*GMPVNTFCKVTNYGNYKTYSQFTNVALWGKM**L*HKIA DSLIVFLTINDALLESVI*ICKYSLKRTDNLTCPILPRPIIHFLLCR YSMRPELHTAQYI LEGKSFAFSHIAVSKHKRYRTLAVAVVKQLVNGGGEKTDVAVKHGLQNGTRHSSIEERIF MEAACMCDKLLETSDKPDLKDEILKVITKELCRSAAGSELX >GCiWno803_g11.g1 TTCAGCTCGGACCCCGCTGCCGAGCGGCACAGTTCTTTTGTTATGACCTTCAGTATTTCGTCTTTCAGGTCAGGCTTGTC TGATGTCTCTAACAGTTTATCGCACATGCAAGCAGCTTCCATAAAGATTCTTTCTTCGATAGAGCTATGCCGCGTTCCAT TCTGCAGACCATGTTTGACTGCAACGTCTGTTTTCTCGCCACCGCCGTTGACAAGTTGTTTAACCACAGCTACAGCTAAC GTGCGGTATCGTTTGTGTTTTGATACTGCTATATGTGAGAATGCAAAGCTCTTCCCTTCCAATATATACTGTGCCGTGTG AAGCTCAGGACGCATGGAATATCTGCATAATAAAAAATGTATAATAGGCCGGGGTAAGATGGGACAAGTCAAATTGTCAG TCCTCTTTAAAGAATATTTACAAATTTATATAACAGACTCTAAAAGAGCGTCGTTAATTGTTAAAAACACGATTAGGGAA TCTGCGATTTTATGTTAAAGTTATTACATCTTACCCCACAGTGCGACATTAGTAAATTGCGAATAGGTTTTGTAGTTCCC ATAATTTGTTACCTTGCAGAATGTGTTGACAGGCATTCCTCAACCGCTTTACCATTGACAACGACCACTAAAGTTGAGCC AAAGTAGACTGAGAACACGTCGCCGTAGGTTTTCCGCATGCTCTCTAATATGAGGTGGCTTTGTCGACCCATAGAGAACA AATTGCCGACCAATGGCCAGGCTGTGGGACCGGNGAGGATGCCCTGTCTTTTTCGTAGGCACACATACAGCGTCAGAACA GAAACAGCAGTGAATGCTACAGGAACCGCGAACGGATCTTCA >cibd045a01 Length = 664 Score = 55.8 bits (132), Expect(2) = 1e-10 Identities = 25/26 (96%), Positives = 26/26 (99%) Frame = +2 Query: 12 LQNGTRHSSIEERIFMEAACMCDKLL 37 LQNGTRHSSIEERIFMEAACMC+KLL Sbjct: 587 LQNGTRHSSIEERIFMEAACMCEKLL 664 Score = 27.8 bits (60), Expect(2) = 1e-10 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 1 WRENRRCSQT 10 WRENRRCSQT Sbjct: 553 WRENRRCSQT 582 >cibd045a01 GGGAATGTTGCGCAAAGCACAGACGGGAAACTGTACTGTGACGTCATTACTTCCCCAGAGCAAACACTGATCGGAATTGC AAACAGAATTATTGCCGCTTGCTGTCTGCATGATGATCACCGCCGCAATTTTGCTCGACGCTGGAAGATCGTTCGCGGTT CCTGTAGCATTCACTGCTGTTTCTGTTCTGACGCTGTATGTGTGCCTACGAAAAAGACAGGGCATCCCTCCCGGTCCCAC AGCCTGGCCATTGGTCGGCAATTTGTTCTCTATGGGTCGACAAAGCCACCTCATATTAGAGAGCATGCGGAAAACCTACG GCGACGTGTTCTCAGTCTACTTTGGCTCAACTTTAGTGGTCGTTGTCAATGGTAAAGCGGTTGAGGAATGCCTGTCAACA CATTCTGCAAGATATTCCATGCGTCCTGAGCTTCACACGGCACAGTATATATTGGAAGGGAAGAGCTTTGCATTCTCACA TATAGCAGTATCAAAACACAAACGATACCGCACGTTAGCTGTAGCTGTGGTTAAACAACTTGTCAACGGCGGTGGCGAGA AAACAGACGTTGCAGTCAAACATGGTCTGCAGAATGGAACGCGGCATAGCTCTATCGAAGAAAGAATCTTTATGGAAGCT GCTTGCATGTGCGAAAAACTGTTA MMITAAILLDAGRSFAVPVAFTAV SVLTLYVCLRKRQGIPPGPTAWPLVGNLFSMGRQSHLILESMRKTYGDVFSVYFGSTLVV VVNGKAVEECLSTHSARYSMRPELHTAQYILEGKSFAFSHIAVSKHKRYRTLAVAVVKQL VNGGGEKTDVAVKHGLQNGTRHSSIEERIFMEAACMCEKLL >_1 GNVAQSTDGKLYCDVITSPEQTLIGIANRIIAACCLHDDHRRNFARRWKIVRGSCSIHCC FCSDAVCVPTKKTGHPSRSHSLAIGRQFVLYGSTKPPHIREHAENLRRRVLSLLWLNFSG RCQW*SG*GMPVNTFCKIFHAS*ASHGTVYIGREELCILTYSSIKTQTIPHVSCSCG*TT CQRRWRENRRCSQTWSAEWNAA*LYRRKNLYGSCLHVRKTVX >_2 GMLRKAQTGNCTVTSLLPQSKH*SELQTELLPLAVCMMITAAILLDAGRSFAVPVAFTAV SVLTLYVCLRKRQGIPPGPTAWPLVGNLFSMGRQSHLILESMRKTYGDVFSVYFGSTLVV VVNGKAVEECLSTHSARYSMRPELHTAQYILEGKSFAFSHIAVSKHKRYRTLAVAVVKQL VNGGGEKTDVAVKHGLQNGTRHSSIEERIFMEAACMCEKLL >_3 ECCAKHRRETVL*RHYFPRANTDRNCKQNYCRLLSA**SPPQFCSTLEDRSRFL*HSLLF LF*RCMCAYEKDRASLPVPQPGHWSAICSLWVDKATSY*RACGKPTATCSQSTLAQL*WS LSMVKRLRNACQHILQDIPCVLSFTRHSIYWKGRALHSHI*QYQNTNDTAR*L*LWLNNL STAVARKQTLQSNMVCRMERGIALSKKESLWKLLACAKNC >GCiWno736_g02.b1 AGTCAGTGTGCATGAAATTTAACGCGTCAGATCAATCAACATAGCTTTCATGTGTCGTTGTCACAAGTCCTATCACCTCA TGCACTTCGAAAGAAAGCGCTCATTCTCTTGTAACTTGACTCAAGTATGACACGCCAGGCGACGCCATTCGGGGCTAATA TTTCGACATTCCTCTTAGGCGTTACGGCTGAGCAGTCACGACCTTTCTGAGTTCATCGGCCGAGAGACTGAAGGAACGAA CGATTATTTGCCCCTGTAAAGGCACATAGGTGTGAGGCGGCCGCAAAGCTTTACTCTACATTTATCATAGTAGACGAGTT ATAGACAGATCGTATAAATGGCTGCGTCAGCCTACGTTGTTTTTGCAAGCAGCTAAACGTTCAGGCCGATTTATTGCCAA AGCAAACCCTTAACACAGGAGAGTACAACGGGCAAATGTGGCGAGACAAGCAAACAAAGTCGTAAATTTAAACTTTAACA GTCACTGTTGCGCTTGTAAACTTTATGAGTTGTCAGGTACCATTTGTAATATGCGAAGGTAGAATGAAGCGACTGTATAT CGGTGTAGGCAACCACATCAGAAGGGTTTTGCCCGAGGTATTGTAGGCGATACAAAAGATAGACTAACACGGGATAATGA CAGTAAATACATTAACTCACGTCTCGTGCAATGTTTATTATTATGTTAGTTTATTTTCGGATGCATTCGCTTAGTCTGAG CATAATACAGCTGTTTATGTATTATTTATGTACACCACAGGGGTATACGCATAGAATGTTGCGCAAAGCACAGACGGGGA ACTGTACTGTGACGTCATTACTTCCCCAGAGTAACACTGATCGGAATTGCAACAGAATAAN >GCiWno736_g02.g1 TCAGCTCGGACCCTCCCATCTTCTCCAACCCTACTATATATAGGGGAACCAAAAATGGCAAGAAATTAATGGCAAATTAA ACCTTGTTTTTTAAACATGGATGAGTAAACACAATTTACTACATGGCTTCTTACACAGGGGCCCACAGTTTTAAAATAAT GGTAACTAGGTTTTAGGACTAAAATATTAAGAAACGCTACGCAAGATCTAAGTTAGTGAGACCAACCTGTTTAACGATTG AGTTAACTGAATATATTTTTGTAATCCATTTCTCCAGAGCATTCGGACCGCTGGGATAAAATTGACTAACATAATCGCCT CATTTGAATTACGCAAGTTTTCTACCACACGAGAAATTTCGTCAAGTTCATACTCGGACAGCCTGTTAATAAGAACACAT TATTCATTATATTATTCATATAGTAGGGTAGGGAAGGACCGGACACCTTTAACACATACTATCCCAATATCCTAATCGTG TTTTAAACAATTAACAACGGTCTTTGAGGGTCTGGTTTTATATTTCATTAAATTTTATTTGTTTACTACCAAATGGGACG AAAAAATAGAAGAAATAGGTGTCCCATCTCCCCTACCCTATTATATAGTATAGTTATGATTTGCAAAATGCTTACGTATT TCCCAGCAGCATGTCCGCTGCCGAGCGGCACAGTTCTTTTGTTATGACCTTCAGTATTTCGTCTTTCAGGTCAGGCGAGT CTGATGTCTCTAACAGTTTATCGCACATGCAAGCAGCTTCCATAAAGATTCTTTCTTCGATAGAGCTATGCCGCGTTCCA TTCTGCAGACATGTTTGACTGCATCGCCTGTTTTCTCGCCACCGCCGNTGACAGTTGTTTACCACAGCTACAGCTACGTG CGGNATCGTTTGTGTCTGATA >_4 IRHKRXRT*L*LW*TTVXGGGEKTGDAVKHVCRMERGIALSKKESLWKLLACAINC*RHQ TRLT*KTKY*RS*QKNCAARQRTCCWEIRKHFANHNYTI**GRGDGTPISSIFSSHLVVN K*NLMKYKTRPSKTVVNCLKHD*DIGIVCVKGVRSFPTLLYE*YNE*CVLINRLSEYELD EISRVVENLRNSNEAIMLVNFIPAVRMLWRNGLQKYIQLTQSLNRLVSLT*ILRSVS*YF SPKT*LPLF*NCGPLCKKPCSKLCLLIHV*KTRFNLPLISCHFWFPYI**GWRRWEGPS* >_5 YQTQTXPHVAVAVVNNCXRRWRENRRCSQTCLQNGTRHSSIEERIFMEAACMCDKLLETS DSPDLKDEILKVITKELCRSAADMLLGNT*AFCKS*LYYIIG*GRWDTYFFYFFVPFGSK QIKFNEI*NQTLKDRC*LFKTRLGYWDSMC*RCPVLPYPTI*II**IMCSY*QAVRV*T* RNFSCGRKLA*FK*GDYVSQFYPSGPNALEKWITKIYSVNSIVKQVGLTNLDLA*RFLIF *S*NLVTIILKLWAPV*EAM**IVFTHPCLKNKV*FAINFLPFLVPLYIVGLEKMGGSEL X >_6 SDTNDXARSCSCGKQLSXAVARKQAMQSNMSAEWNAA*LYRRKNLYGSCLHVR*TVRDIR LA*PERRNTEGHNKRTVPLGSGHAAGKYVSILQIITILYNRVGEMGHLFLLFFRPIW**T NKI**NIKPDPQRPLLIV*NTIRILG*YVLKVSGPSLPYYMNNIMNNVFLLTGCPSMNLT KFLVW*KTCVIQMRRLC*SILSQRSECSGEMDYKNIFS*LNR*TGWSH*LRSCVAFLNIL VLKPSYHYFKTVGPCVRSHVVNCVYSSMFKKQGLICH*FLAIFGSPIYSRVGEDGRVRAX >citb005f11 Length = 393 Score = 58.2 bits (138), Expect = 5e-09 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 1 LRNSNEAIMLVNFIPAVRMLWRNGLQK 27 LRNSNEAIMLVNFIPAVRMLWRNGLQK Sbjct: 308 LRNSNEAIMLVNFIPAVRMLWRNGLQK 388 >citb005f11 TTCGGCACGAGGGCATTTTGCAAATCATAACTATACTATATAATAGGGTGGGGGAGATAGGACACCTATTTCTTCTATTT TCTCGTCCCATTTGGTAGTAAACAAAGAAAAGTTACTGAAATATAAAACCAGATCCTCAAAGACCGTTGTTAATGGTTTA AAACACGATTAGGATATTGGGATAGTATGTGTTAAAGGTGTCCCATCTTCCCCCACCCTACTATATGAATAATATAATGA ATAAGGTGTTTTGATTAACAGGCTGTCCGAGTATGAACTTGATGAAATTTCTCGTGTGGTAGAAAACTTGCGTAATTCAA ATGAGGCGATTATGTTAGTCAATTTTATCCCAGCGGTCCGAATGCTCTGGAGAAATGGATTACAAAAAAAAAA >_1 FGTRAFCKS*LYYIIGWGR*DTYFFYFLVPFGSKQRKVTEI*NQILKDRC*WFKTRLGYW DSMC*RCPIFPHPTI*II**IRCFD*QAVRV*T**NFSCGRKLA*FK*GDYVSQFYPSGP NALEKWITKKK >_2 SARGHFANHNYTI**GGGDRTPISSIFSSHLVVNKEKLLKYKTRSSKTVVNGLKHD*DIG IVCVKGVPSSPTLLYE*YNE*GVLINRLSEYELDEISRVVENLRNSNEAIMLVNFIPAVR MLWRNGLQKK >_3 RHEGILQIITILYNRVGEIGHLFLLFSRPIW**TKKSY*NIKPDPQRPLLMV*NTIRILG *YVLKVSHLPPPYYMNNIMNKVF*LTGCPSMNLMKFLVW*KTCVIQMRRLC*SILSQRSE CSGEMDYKKK >rcitb005f11 Length = 354 Score = 38.3 bits (87), Expect = 0.005 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 1 LRNSNEAIMLVNFIPAVRM 19 LRNSNEAIMLVNF PAVRM Sbjct: 58 LRNSNEAIMLVNFXPAVRM 2 >rcitb005f11 GCATTCGGACCGCTGGGNTAAAATTGACTAACATAATCGCCTCATTTGAATTACGCAAGTTTTCTACCACACGAGAAATT TCATCAAGTTCATACTCGGACAGCCTGTTAATCAAAACACCTTATTCATTATATTATTCATATAGTAGGGTGGGGGAAGA TGGGACACCTTTAACACATACTATCCCAATATCCTAATCGTGTTTTAAACCATTAACAACGGTCTTTGAGGATCTGGTTT TATATTTCAGTAACTTTTCTTTGTTTACTACCAAATGGGACGAGAAAATAGAAGAAATAGGTGTCCTATCTCCCCCACCC TATTATATAGTATAGTTATGATTTGCAAAATGCC >cibd040f23 Length = 716 Score = 103 bits (255), Expect = 1e-22 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = +3 Query: 1 VADLFGARVDTMTVALAWMIVYWSTYQAAQERAQKEIDHFVKNEKRLPR 49 VADLFGARVDTMTVALAWMIVYWSTYQAAQERAQKEIDHFVKNEKRLPR Sbjct: 282 VADLFGARVDTMTVALAWMIVYWSTYQAAQERAQKEIDHFVKNEKRLPR 428 >cibd040f23 ACTTGCGTAATTCAAATGAGGCGATTATGTTAGTCAATTTTATCCCAGCGGTCCGAATGCTCTGGAGAAATGGATTACAA AAATATATTCAGTTAACCCAATCGTTAAACAGGTTTTTCGAACGTTGTATACGAAATCGGAAAGCGCAACTCGCAACGGT TTCGAACGGACATACCGAAGACAATGGTGTCCGGCTTACCAACGGTGTTGACTGTACTGTGAAGTTTTGGCAAAAACTAA AGAACGATCCACAATACGAAGAAAGCAGAGTCATGAAAGTGGTAGCTGACTTGTTCGGCGCTAGAGTGGACACGATGACC GTTGCCCTCGCATGGATGATTGTCTATTGGTCCACTTACCAGGCGGCACAAGAAAGGGCACAGAAGGAAATTGACCACTT CGTGAAAAACGAAAAACGTTTACCGAGGTACTCCGAAAGAAATCAACTCCCGTACACAATGGCCCTTATAATGGAAGTTG AAAGACATTGTAGTTTCGTACCATTTACCCTGCCACACGCCCCTGTGCAAGACACGATGCTAAATGGATATTTAATCCCG AAAGGCACAATGATGTTAATCAGCATGCGGTCAATTAACCACGATACTGCAGTGTGGGACTCGCCTGCTCAATTCCGACC TGAAAGATTCCTTTTGGATCAGTCTGGAGATTTTAACAGCGCATTGGCGGAACAAGTTATGCTGTTTGGTGCTGGG >cibd040f23_3 LRNSNEAIMLVNFIPAVRMLWRNGLQKYIQLTQSLNRFFERCIRNRKAQLATVSNGHTED NGVRLTNGVDCTVKFWQKLKNDPQYEESRVMKV VADLFGARVDTMTVALAWMIVYWSTYQ AAQERAQKEIDHFVKNEKRLPRYSERNQLPYTMALIMEVERHCSFVPFTLPHAPVQDTML NGYLIPKGTMMLISMRSINHDTAVWDSPAQFRPERFLLDQSGDFNSALAEQVMLFGAG >cibd039h22 Length = 689 Score = 103 bits (255), Expect = 1e-22 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = +3 Query: 1 VADLFGARVDTMTVALAWMIVYWSTYQAAQERAQKEIDHFVKNEKRLPR 49 VADLFGARVDTMTVALAWMIVYWSTYQAAQERAQKEIDHFVKNEKRLPR Sbjct: 282 VADLFGARVDTMTVALAWMIVYWSTYQAAQERAQKEIDHFVKNEKRLPR 428 >GCiWno613_n09.b1 GGATCCCCATATAGTATGGCCAGAAAATCACAAAATAAAGAAAAAGGCAGCAGTTTCCCGCATGACAAAAAATGGCAAAA ACTAAAAGGTCCTGATGTTATTTAGAATCAACTACTTGGATAACTAACACTGTCGCGAAAAGCGTGACCGCTACAGCCAC ATCTTCATCACGGCTCGGTGTTTTTAGAACCGTCGGCCTCCCGCCGTGAGATGGACACGCACATAGTTTGAGGGATTAAC GAAATTCCGGCCAAGGATTCGGGCAAAACGTGGCCATCCTTGTCGCTGCGTCGAAACGTACATTTTCTTAGGAATAGGAC CGAGTAAAGAAATATCTGCATACGTCCTAATGCCTCCCCTGCGCACCGTCGCCTCCCAGCACCAAACAGCATAACTTGTT CCGCCAATGCGCTGTTAAAACCTCCAGACTGATCCAAAAGGAATCTTTCAGGTCTACAAGTTATTCCACGTTTGAAGTAC ATAATGGGTAAGTACATAGACGATGCAAGAAAGAGAGAAGAAATCCAGAGATGTATGCTAGAGTTCACCCAATCCATTAC CCCCAGCATATTCTATATTACCCCCGCAGCCCATTAGTCCGGAGATTAAGCTGGAAGTTGTCCCATTACCCCAGCATAAC CTATTCTGTATGGGCGAGGCCCTACACAGCGCGACACGCAATATGTCCTGACATTGGGCCGAAGTTGTCTCATTACCCAA GCATAACCTATTCTATATTGGCGAGGTTCTATATGGTTCGACACGCCTAAGATTCAGGTCAGAGTTGACACTATACCCTA NACACACCTAAAACACTATTACGTTAAATCTTCCTATAGTAGTATATCCTCTAGTAGAGTGGGGTAAGATAGAACATGTT ACATAGTTAC >_4 NYVTCSILPHSTRGYTTIGRFNVIVF*VCXGYSVNSDLNLRRVEPYRTSPI*NRLCLGNE TTSAQCQDILRVALCRASPIQNRLCWGNGTTSSLISGLMGCGGNIEYAGGNGLGEL*HTS LDFFSLSCIVYVLTHYVLQTWNNL*T*KIPFGSVWRF*QRIGGTSYAVWCWEATVRRGGI RTYADISLLGPIPKKMYVSTQRQGWPRFARILGRNFVNPSNYVRVHLTAGGRRF*KHRAV MKMWL*RSRFSRQC*LSK*LILNNIRTF*FLPFFVMRETAAFFFIL*FSGHTIWGS >_5 *LCNMFYLTPLY*RIYYYRKI*RNSVLGVXRV*CQL*PES*ACRTI*NLANIE*VMLG** DNFGPMSGHIACRAV*GLAHTE*VMLG*WDNFQLNLRTNGLRG*YRICWG*WIG*TLAYI SGFLLSFLHRLCTYPLCTSNVE*LVDLKDSFWISLEVLTAHWRNKLCCLVLGGDGAQGRH *DVCRYFFTRSYS*ENVRFDAATRMATFCPNPWPEFR*SLKLCACPSHGGRPTVLKTPSR DEDVAVAVTLFATVLVIQVVDSK*HQDLLVFAIFCHAGNCCLFLYFVIFWPYYMGIX >_6 VTM*HVLSYPTLLEDILL*EDLT**CFRCV*GIVSTLT*ILGVSNHIEPRQYRIGYAWVM RQLRPNVRTYCVSRCVGPRPYRIGYAGVMGQLPA*SPD*WAAGVI*NMLGVMDWVNSSIH LWISSLFLASSMYLPIMYFKRGITCRPERFLLDQSGGFNSALAEQVMLFGAGRRRCAGEA LGRMQIFLYSVLFLRKCTFRRSDKDGHVLPESLAGISLIPQTMCVSISRREADGSKNTEP **RCGCSGHAFRDSVSYPSS*F*ITSGPFSFCHFLSCGKLLPFSLFCDFLAILYGDP >GCiWno613_n09.g1 TCGGACCCCATTTAGGCCTTACTGCGGTATAGATGGGATACCGTTAGCTACTTTATTTCCTAGTGGTGTTTTTATAACAT TTAACAAAGCCTTTTTACAGTCTCGGGTCTATGGTTATATTTATTCGTAATTATTTTTTATTTACTACCAAATAAGACAA GAAAAGAGAATGAAACAATGAAACAATGTCTCTTTGCTTTTACCCAACCCTATGATAGAAAGAATAAAAAGCTCGCAAAA CGTTTATATGTCGCTATGATTACCAGGTAGCTGACTTGTTCGGCGCTAGAGTGGACACGATGACCGTTGCCCTCGCATGG ATGATTGTCTATTGGTCCACTTACCAAGCGGCACAAGAAAGGGCACAGAAGGAAATTGACCACTTCGTGAAAAACGAAAA ACGTTTACCGAGGTAAAGGTTTATATTCCTGTAAATTTAATATATATGGTTATTATAAATGACGTATTATACACCTGGAA CATTAACCATTGGGTACCGTGTTCGAGACTCAATGTTACCACCACAGAGGGTGTATATACAGCTTCGCACACAAAGTTAC ATAGATTATATAACTTTGTTTTCAAAGAAAACGCAATGTGAATGAAATTAGACACCCGTGTTAAAACTTTTAAAGCTCCC GGCCTCCTTTTTTCATTCCCTTGAAAATGGTATTAAAGATCACATTGTTAAAACAACTGAGAAAATGGAATCAATAGCAA AACGATTAATAAGCGAATTCCATACATTTATTTATTTATTCATTAATGGAATGCAGGTACTCCGAAAGAAATCAACTCCC GTACACAATGGCCCTTATNATGGGAGNTGAAAGACATTNGTAGTTTCGTACCATTTACCCCTGCC >_1 SDPI*ALLRYRWDTVSYFIS*WCFYNI*QSLFTVSGLWLYLFVIIFYLLPNKTRKENETM KQCLFAFTQPYDRKNKKLAKRLYVAMITR*LTCSALEWTR*PLPSHG*LSIGPLTKRHKK GHRRKLTTS*KTKNVYRGKGLYSCKFNIYGYYK*RIIHLEH*PLGTVFETQCYHHRGCIY SFAHKVT*II*LCFQRKRNVNEIRHPC*NF*SSRPPFFIPLKMVLKITLLKQLRKWNQ*Q ND**ANSIHLFIYSLMECRYSERNQLPYTMALXMGXERHX*FRTIYPCX >_2 RTPFRPYCGIDGIPLATLFPSGVFITFNKAFLQSRVYGYIYS*LFFIYYQIRQEKRMKQ* NNVSLLLPNPMIERIKSSQNVYMSL*LPGS*LVRR*SGHDDRCPRMDDCLLVHLPSGTRK GTEGN*PLREKRKTFTEVKVYIPVNLIYMVIINDVLYTWNINHWVPCSRLNVTTTEGVYT ASHTKLHRLYNFVFKENAM*MKLDTRVKTFKAPGLLFSFP*KWY*RSHC*NN*ENGINSK TINKRIPYIYLFIH*WNAGTPKEINSRTQWPLXWEXKDIXSFVPFTPA >_3 GPHLGLTAV*MGYR*LLYFLVVFL*HLTKPFYSLGSMVIFIRNYFLFTTK*DKKRE*NNE TMSLCFYPTL**KE*KARKTFICRYDYQ VADLFGARVDTMTVALAWMIVYWSTYQAAQER AQKEIDHFVKNEKRLPR*RFIFL*I*YIWLL*MTYYTPGTLTIGYRVRDSMLPPQRVYIQ LRTQSYIDYITLFSKKTQCE*N*TPVLKLLKLPASFFHSLENGIKDHIVKTTEKMESIAK RLISEFHTFIYLFINGMQVLRKKSTPVHNGPYXGX*KTXVVSYHLPL >sequence 48 1 accession 485 to 2R1 VSVNLWAVHNDPNTWEEPSMFKPERHLDESGHFVQSKHVIPFSVGPRHCVGEQLARMEVFIYLVSMVQKF EFLPDRNANELPDIEKGSNGPAFVPQMFDIVAKVI LQW214701.x2 DEV4898.x1 PERF rcilv059c22 >rcilv059c22 Length = 752 Score = 209 bits (526), Expect = 1e-53 Identities = 98/105 (93%), Positives = 100/105 (94%) Frame = -3 Query: 1 VSVNLWAVHNDPNTWEEPSMFKPERHLDESGHFVQSKHVIPFSVGPRHCVGEQLARMEVF 60 VSVNLWAVHNDPNTWE PSMFKPERHLDESGHFVQSKHVIPFSVGPRHCVGEQLARMEVF Sbjct: 705 VSVNLWAVHNDPNTWEXPSMFKPERHLDESGHFVQSKHVIPFSVGPRHCVGEQLARMEVF 526 Query: 61 IYLVSMVQKFEFLPDPDVTELPDIEQGSNGPAFVPQMLDIVAKVI 105 IYLVSMVQKFEFLPD + ELPDIE+GSNGPAFVPQM DIVAKVI Sbjct: 525 IYLVSMVQKFEFLPDRNANELPDIEKGSNGPAFVPQMFDIVAKVI 391 >sequence 49, 67 opp end of clone is seq 67 join together MLVQILTATFWTLIP NSFGDLLIYAILVLTIVIYVKSLKRDKEWLALPGPIPW PLVGNA PFLGAEPHKKLLELSL KYGPVYRLKMGGIKTVVLCNAEVVRSALIKQREAFSGRPKFSSYKAVS AGESVVFNDEET LPP WRSH KSKIVRHMHKYTTSIRTRDKVTDLINTECMMMVTELDRISRSKCVNPENVIRM ALANVMCAVCFGNRFEYDNE (0) EFQKLLSMNTEFGAVIELGPIIDAMPWIK (0) VIPKFKKAIADYLKINLQLDTWSRHR (2) VDGVLKTFDNDDVTNVVASMTSEVLEKKSAGESREITESETKTIAALSADILGA GQHTTSTTFFWVINLLLCFPKVLNKLTEEVRSKLGNRLPTLEDRTSLPYMDAVLTE VLRFSSPLSSTIPHSTLKDVKLAGHTIKRGTMVIISQYAVNHDPQNWKNPENFDPERFLTK NEGGEIIFNESLSEKVLAFSIGERKCPGSQLSRMLLFLATTLLVQVSDLSADLERPPT AAAEYGLILRPKHLSIKLTLREHWQRRDSIRA* >CYP1B1 Scaffold_1553 complete gene Scaffold_11030 Scaffold_10662 54% TO 1B1 human 51% to 1B1 mouse AL024920.1 AL015454.1 cosmid 077P23 80% to CYP1B from pleuronectes platessa FC:C013F14aE4 LGU7740.y1 FC:C077P23aC12 AL015446.1 077P23 FC:C077P23aD8 2460 MKVIQEEVSPEAGALLLACATLLVSLQLWRWRRRRPGGCPPGPRAWPIIGNAAQLGHAPHL 2278 2277 YFTRMAQRFGNVFQIKLGSRTVVVLNGDAIKQALVRKGLEFAGRPDFTSFKYISNGHSL 2101 2100 AFGTVTDWWKSHRRVAQSTVRMFSTGNLQTKKTFERHLTCEVRELLHLFLGKTKELQYFQ 1921 1920 PMNYLVVSTANVISAVCFGKRYSYEDEEFQQVVGRNDQFTRTVGAGSIVDVMPWL 1756 1755 QYFPNPVKSIFDNFKRLNKEFSDFIRDK VTEHRKSIRPSSVRDMTDAFIVSLDKLSE 1585 1584 KTGVPLWKDYVIPTVGDVFG ASQDTLSTALQWIFLVLVR 1468 (2) 294 YPDMQQRLQEEVDLVVGRQRLPCIEDQQQLPWVMAFIYEVMRFTSFVPLTIPHSTTTDTT 115 114 IMGYTIPKNTIIFINQWSINHDPTIWSHPET 13 FDPNRFLNPSGSLNKDLTSRMLIFSMGKRRCIGEELSKLHLFLFTALIGHQCHITDDPA KPTTMDYNYGLTLKPRGFYVALTLRGDMRLLDEAASRPPAEEPGRGPLADP* >CYP1C1 Scaffold_3008b no introns complete gene LGS269180.x1 Length = 510 38-163 = Scaffold_11497 48% to 1B1 no introns 10253 MALDTEFGVKSSSITREWSGQVQPALVASFLFLFCLEACLWVRNLRHKRRL 10100 PGPFAWPVVGNAMQLGQMPHITFAKLAKKYGNVYQIRLGCSNI 9972 9971 VVLNGDQAIHQALIEHSTEFAGRPNFVSFQMISGGRSLTFTNYSKQWKVHRKLAQSSLRA 9792 9791 FSSANKQTKIAFEQHVTAEANELVQAFLRYSTDGRYFDPAHEFTVAAANVMCALCFGKRY 9612 9611 GHDDHEFRCLLKKLNKFGETVGAGSLVDVMPWLQSFPNPVRSLYENFKSLNEEFFNFV 9438 9437 KNKVQEHRESFDPNVTRDMSDAMINVIEERKDGTLSKEFAEATITDLIGAGQDTVS 9270 9269 TVLQWIVLLLVKHPDKQAKLHELMDKVVGQDRLPTTEDRSSLAYLDAFIYETMRFTSFVP 9090 9089 VTIPHSTTSDVTIEGLRIPKDTVVFINQWSVNHDPLKWKDPHVFDPSRFLNENGDLNKDL 8910 8909 TSGVMIFSSGKRRCIGSQIAKVEVFLFAAILLHQCSFESDPSDPLTLDCSYGLTLKP 8739 LRCFVSAKPRGKLLGLVSPA* 8676 >GCiWno101_g19.b1 CHROMAT_FILE: GCiWno101_g19.b1 PHD_FILE: GCiWno101_g19.b1.phd.1 CHEM: term DYE: big TIME: Wed Sep 5 06:47:37 2001 TEMPLATE: GCiWno101_g19 DIRECTION: fwd Length = 932 Score = 62.8 bits (150), Expect = 6e-10 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 34 EFQKLLSMNTEFGAVIELGPIIDAMPWIK 62 EFQKLLSMNTEFGAVIELGPIIDAMPWIK Sbjct: 752 EFQKLLSMNTEFGAVIELGPIIDAMPWIK 666 >GCiWno549_a17.g1 CHROMAT_FILE: GCiWno549_a17.g1 PHD_FILE: GCiWno549_a17.g1.phd.1 CHEM: term DYE: big TIME: Mon Oct 22 10:59:33 2001 TEMPLATE: GCiWno549_a17 DIRECTION: rev Length = 927 Score = 62.8 bits (150), Expect = 8e-10 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 1 EFQKLLSMNTEFGAVIELGPIIDAMPWIK 29 EFQKLLSMNTEFGAVIELGPIIDAMPWIK Sbjct: 12 EFQKLLSMNTEFGAVIELGPIIDAMPWIK 98 >GCiWno549_a17.g1_1 YFSRNSKSY*V*TQNLAPL*NWDR*LMQCRGSR*KLIYNNCFNPGNRYVLPNCQANLK*K LQN**NTHPSQSYTYVVLVSEHEMHETEQPCYNDPSRDDK*LKFTCI*FLILYYAKALCF SQSTVE*NLFILS*RRHNSI*NTGVLFPPRII*LCG*LDA*QQNRVV*TSSNWCQQHSFF TRNVFDLTCPDHVSRVQHIAAKHHKQEVFSVSQTLRMFYILEIL*KPAFVIPTCQICLLK RNA*VNHELTCVTERXNKYQI**GGGKI*HXFLFSFTAL*XVVNKEYSKLLNRILTTSIA RC*LFKTGS >GCiWno549_a17.g1_2 IFPGIPKAIEYEHRIWRRYRTGTDN*CNAVDQGKN*YITIVLIQGTVTCCQIVKQI*NEN YKTNKTLIHHKAIRTWYW*ASTRCMKQNNRVITTHPAMINN*NSHVFNS*YFIMPRPCVF PSQRLNEIYLFSHSGATTVFKTRVFCFHRVLFDFVDN*MRNSRTGWFEPVLTGVSNIRSS HAMSLI*LAQITCLGFNISLRNTTNKKFSRYRKLLECFTFWRYYKSLRL*SLPVRYAC*S ETHKSTMS*HVSQNVXINTKYSRVGERYDMXFFSLLPPYXW**TKSIQNY*TVSLRLPSX VVNCLKQD >GCiWno549_a17.g1_3 FFQEFQKLLSMNTEFGAVIELGPIIDAMPWIKVKTNI*QLF*SREPLRVAKLSSKFKMKI TKLIKHSSITKLYVRGTGKRARDA*NRTTVL*RPIPR**ITKIHMYLILNTLLCQGLVFF PVNG*MKFIYSLIAAPQQYLKHGCSVSTAYYLTLWIIRCVTAEPGGLNQF*LVSATFVLH TQCL*SNLPRSRV*GSTYRCETPQTRSFLGIANS*NVLHSGDIIKACVCNPYLSDMLAKA KRISQP*VNMCHRTSK*IPNIVGWGKDMTXFSFLFYRPIXGSKQRVFKIIKPYPYDFHRX LLIV*NRI >GCiWno755_d15.g1_1 SSSDPCVKENQSGRNXVLTGCQQXFVLHTQCL*SNLPRSRV*GSTYRCKTPQTRSLLGIA NS*NVLHSGDVIKACVCNPYLSDMLAIVY*RVNA*VNHELTCVTERQNKYQI**GGERYD MFSFSFTAL*LVVNKEYSKIINRILTTSIGRC*LFKTRSGYLDIMC*RCPIPPTLLYIFT LKEILWQLFVT*S*RSNVSLISKKNLFQHLPGTYRKRKCINFFL*VIPKFKKAIADYLKI TCNWTLGQDISNMDGKSTKNKL*KTYNGH**YKCLKVFYMDGRFYYFFSCQT*SRLTGCL S >GCiWno755_d15.g1_2 RARTHA*KRTRAGGTQF*LGVSXHSFFTRNVFDLTCPDRVSRVQHIAAKHHKQEVCSVSQ TLRMFYILEML*KPAFVIPTCQICLRLFIEG*THKSTMS*HVSQNVKINTKYSRVGKDMT CFLSLLPPYSW**TKSIQKL*TVSLRLPSAVVNCLKQDQDIWILCARGVPSPPPYFIFSR *KRSYGNYLLHDLKGLTFR*FRRKIYFNTYLALTEKENV*TFFCKSFRNSRKPLPII*KS LATGHLVKT*VIWTAKVRKTNYKRLITDTDSINV*KFFIWMEDFTIFFPAKHEVV*PVVC >GCiWno755_d15.g1_3 ELGPMRKREPEREEXSSNWVSAXIRSSHAMSLI*LAQIACLGFNISLQNTTNKKFARYRK LLECFTFWRCYKSLRL*SLPVRYACDCLLKGKRISQP*VNMCHRTSK*IPNIVGWGKI*H VFFLFYRPIVGSKQRVFKNYKPYPYDFHRPLLIV*NKIRIFGYYVLEVSHPPHPTLYFHV KRDLMAIICYMILKV*RFVNFEEKSISTLTWHLQKKKMYKLFFVSHSEIQESHCRLFENH LQLDTWSRHK*YGRQKYEKQTIKDL*RTLIV*MFESFLYGWKILLFFFLPNMKSFNRLFV >GCiWno564_h05.g1_1 NVKIIQYSGVGKIYMFSFSFTAL*LVVTRVSKYKPYPYDFHRPLLIV*NKIRIFGYYVLE VSHPPHPTLYFHVKRDLMAIICYMILKV*RFVNFEEKSISTLTWHLQKKKMYKLFFVGHS EIQESHCRLFENQLATGHLVKT*VNMDGKSYEKRNYNRLIT*HMIV*MFGKLFYNE*KNL TYLFSRGRAMTVVITRLFCFIHLVPAFTSYHVYNFFADRRHYHLEKLLLRI*CNNLL*ES MGVLXTFDNDDVTNVVASMTSEVLEKSQREKSRK*PXARQXRLLLFHRNTWGGXAXXVQT XFDTI*X >GCiWno564_h05.g1_2 T*K*SNIVGWERYTCFLSLLPPYSW**QEFQNINRILTTSIGRC*LFKTRSGYLDIMC*R CPIPPTLLYIFTLKEILWQLFVT*S*RSNVSLISKKNLFQHLPGTYRKRKCINFFL*VIP KFKKAIADYLKINLQLDTWSRHR*IWTAKVTKNETIIDLLRDT**YKCLESYFIMNERI* LIYFHVAEQ*QSL*HGCSVSYTLCLLLRVTTYITFLLIADITI*KSYYCAYNAIIYFKSR WGFLXHSTMMTSQM**LR*RQKCSRKVSGRNQGNNRXRDXNDCCSFTEILGAG*LXXYKL XSIQFE >GCiWno564_h05.g1_3 RKNNPI*WGGKDIHVFFLFYRPIVGSNKSFKI*TVSLRLPSAVVNCLKQDQDIWILCARG VPSPPPYFIFSR*KRSYGNYLLHDLKGLTFR*FRRKIYFNTYLALTEKENV*TFFCRSFR NSRKPLPII*KSTCNWTLGQDIGKYGRQKLRKTKL**TYYVTHDSINVWKVIL**MKEFN LFIFTWQSNDSRYNTVVLFHTPCACFYELPRI*LFC*SPTLPFRKVTIAHIMQ*FTLRVD GGSXNIRQ**RHKCSSFDDVRSAREKSAGEIKEITXSETXTIAALSQKYLGRXSXXCTNL XRYNL >GCiWno564_h05.g1 AACGTAAAAATAATCCAATATAGTGGGGTGGGAAAGATATACATGTTTTCTTTCTCTTTTACCGCCCTATAGTTGGTAGT AACAAGAGTTTCAAAATATAAACCGTATCCTTACGACTTCCATCGGCCGTTGTTAATTGTTTAAAACAAGATCAGGATAT TTGGATATTATGTGCTAGAGGTGTCCCATCCCCCCCACCCTACTTTATATTTTCACGTTAAAAGAGATCTTATGGCAATT ATTTGTTACATGATCTTAAAGGTCTAACGTTTCGTTAATTTCGAAGAAAAATCTATTTCAACACTTACCTGGCACTTACA GAAAAAGAAAATGTATAAACTTTTTTTTGTAGGTCATTCCGAAATTCAAGAAAGCCATTGCCGATTATTTGAAAATCAAC TTGCAACTGGACACTTGGTCAAGACATAGGTAAATATGGACGGCAAAAGTTACGAAAAACGAAACTATAATAGACTTATT ACGTGACACATGATAGTATAAATGTTTGGAAAGTTATTTTATAATGAATGAAAGAATTTAACTTATTTATTTTCACGTGG CAGAGCAATGACAGTCGTTATAACACGGTTGTTCTGTTTCATACACCTTGTGCCTGCTTTTACGAGTTACCACGTATATA ACTTTTTTGCTGATCGCCGACATTACCATTTAGAAAAGTTACTATTGCGCATATAATGCAATAATTTACTTTAAGAGTCG ATGGGGGTTCTTANAACATTCGACAATGATGACGTCACAAATGTAGTAGCTTCGATGACGTCAGAAGTGCTCGAGAAAAG TCAGCGGGAGAAATCAAGGAAATAACCGANAGCGAGACAANAACGATTGCTGCTCTTTCACAGAAATACTTGGGGCGGGN TAGCTGNTGNTGTACAAACTTGNTTCGATACAATTTGAA >GCiWno624_m24.g1_1 this seq has the next P450 exon TWFRHR*IWTAKVTKNETIIDLLRDT**YKCLESYFIMNERI*LIYFHVAEQ*QSL*HGC SVSYTLCLLLRVTTYITFLLIADITI*KSYYCAYNAIIYFKSRWGS*NIRQ**RHKCSSF DDVRGAREKVSGRIKGNNRKRDKNDCCSFSRYTWGG*AVVGTNFVSITILNE*MNECNLL ILTWIQRQSL*HRCIKW*L*KLFTKKVIYRLGNS*AGCV*NRIPVLITVLAPPREDK*LN SFIHGSHSRIRTHLASEYRAESETXPAGRQIR*QNDKRLTKAVILKAQSLISKRQ*TYLL INKSPTLPVX >GCiWno624_m24.g1_2 LGSDIGKYGRQKLRKTKL**TYYVTHDSINVWKVIL**MKEFNLFIFTWQSNDSRYNTVV LFHTPCACFYELPRI*LFC*SPTLPFRKVTIAHIMQ*FTLRVDGVLKTFDNDDVTNVVAS MTSEVLEKKSAGESREITESETKTIAALSADILGAGRLLLVQTLFRLQF*MNE*MNVTCL S*RGFNDSRYNTGV*NGSSKNYSPKRLYIDLVTRKPDVYETEYPC**LSLPPHVRINS*I HSSMVATVGFELTSPPNTALSPKRXQQADKYGDKTINVLPKQ*S*RHKV*SPSDNKRTY* STRARRFPFX >GCiWno624_m24.g1_3 LVQT*VNMDGKSYEKRNYNRLIT*HMIV*MFGKLFYNE*KNLTYLFSRGRAMTVVITRLF CFIHLVPAFTSYHVYNFFADRRHYHLEKLLLRI*CNNLL*ESMGFLKHSTMMTSQM**LR *RQRCSRKSQRENQGK*PKARQKRLLLFQQIYLGRVGCCWYKLCFDYNFE*MNE*M*LAY PDVDSTTVVITPVYKMVALKIIHQKGYI*TW*LVSRMCMKQNTRVNNCPCPPT*G*IVKF IHPW*PQ*DSNSPRLRIPR*VRNXTSRQTNTVTKR*TSYQSSNPKGTKFNLQATINVPTD QQEPDASRF >LQW222340.x1_4 VTPVRYGNGGRGRNGGRWVVGTAVDTVERYW*P*GWILAKVNVRVI**YCGGNMGQGCNL LLHGRGRDGGTVCGTAI**AGHGIRDEGGMCVIILRALYSGSALVRWTLCVEVRCPC*SG PGHKDKEVNCRLVYAFEVRA*VTKRKLIIELVYEMGPHFIVFARPILGKNKEYSEN*SCA CF*IALFSRNSKSY*V*TQNLAPL*NWDR*LMQCRGSR*KLIYNNCFNPGNRYVLPNCQA NLNMNNYKTNKTLIHKAIRTW*GSSRATKPHAAALP >LQW222340.x1_5 HSGEVWEWR*GT*WGPVGGGDGCGYG*EVLVAVRLDFS*SERKGYIIVLWG*YGPRM*FA LARKGTRRGNGMWNGDLMSWTWNSR*GGDVRDYIKSVVQR*CTCEVDIVRRSALPMLKWA WP*G*RS*LPVSLCI*SACLGHEAKVNYRVGV*NGSTFHCICSSYFGKKQRIFRELIMCL FLNSSIFQEFQKLLSMNTEFGAVIELGPIIDAMPWIKVKTNI*QLF*SREPLRVAKLSSK FKYE*LQN**NTHPQSYTYVVGIL*SD*TACSCTAX >LQW222340.x1_6 SLR*GMGMAVGDVMGAGGWWGRLWIRLRGIGSRKAGF*LK*T*GLYNSTVGVIWAKDVIC SCTEGDATGERYVERRFDELDMEFAMRGGCA*LY*ERCTAVVHL*GGHCA*KCAAHVEVG LAIRIKKLIAG*FMHLKCVPRSRSES*L*SWCMKWVHISLYLLVLFWEKTKNIQRINHVL VFK*LYFPGIPKAIKYEHRIWRRYRTGTDN*CNAVDQGKN*YITIVLIQGTVTCCQIVKQ I*I*IITKLIKHSSTKLYVRGRDPLERLNRMQLHCR >GCiWno101_g19.b1_4 SLFPFSYPFKSSXSRSES*L*VDI*NGPHFILFLVLFGKKTKNIQRINHVLVXK*FYFPG IPKAIEYEHRIWRRYRTGTDN*CNAVDQGKN*YIPIVLIQGTVTCCQIVKQI*NENYKTN IKLIHKAIRTWYW*ASTRCMKQNNRVITTHPAMINN*NSHVFNS*YFIMPRPCVFPSQRL NEIYLFSHSGATTVFKTRVFCFHRVFAYALFDFVDN*MRKSRTRAGGTSSNWCQQHSFFT RNVFDLTCPDRVSRVQHIAAKHHKQEVCSVSQTLRMFYILEML*KPALLIHACQI*P*SC RRFPANSYIH >GCiWno101_g19.b1_5 KFISV*LSI*VVLXTKRKLIIS*YIKWSTFHSISRPIWEKNKEYSEN*SCAGFXIVLFPR NSKSY*V*TQNLAPL*NWDR*LMQCRGSR*KLIYTNCFNPGNRYVLPNCQANLK*KLQN* YKTHPQSYTYVVLVSEHEMHETEQPCYNDPSRDDK*LKFTCI*FLILYYAKALCFSQSTV E*NLFILS*RRHNSI*NTGVLFPPRIRLRVI*LCG*LDA*KQNQSGRNQF*LVSATFVLH TQCL*SNLPRSRV*GSTYRCKTPQTRSLLGIANS*NVLHSGDVIKACVVDPCMSDMTMIV PSFSGKQLYPX >GCiWno101_g19.b1_6 KVYFRLVIHLSRPXHEAKVNYKLIYKMVHISFYFSSYLGKKQRIFRELIMCWFXNSSISQ EFQKLLSMNTEFGAVIELGPIIDAMPWIK VKTNIYQLF*SREPLRVAKLSSKFKMKITKL I*NSSTKLYVRGTGKRARDA*NRTTVL*RPIPR**ITKIHMYLILNTLLCQGLVFFPVNG *MKFIYSLIAAPQQYLKHGCSVSTAYSPTRYLTLWIIRCVKAEPEREEPVLTGVSNIRSS HAMSLI*LAQIACLGFNISLQNTTNKKFARYRKLLECFTFWRCYKSLRC*SMHVRYDHDR AVVFRQTAIST >GCiWno101_g19.b1 GTGGATATAGCTGTTTGCCGGAAAACGACGGCACGATCATGGTCATATCTGACATGCATGGATCAACAACGCAGGCTTTT ATAACATCTCCAGAATGTAAAACATTCTAAGAGTTTGCGATACCGAGCAAACTTCTTGTTTGTGGTGTTTTGCAGCGATA TGTTGAACCCTAGACACGCGATCTGGGCAAGTTAGATCAAAGACATTGCGTGTGAAGAACGAATGTTGCTGACACCAGTT AGAACTGGTTCCTCCCGCTCTGGTTCTGCTTTTACGCATCTAATTATCCACAAAGTCAAATAACGCGTAGGCGAATACGC GGTGGAAACAGAACACCCGTGTTTTAAATACTGTTGTGGCGCCGCTATGAGAGAATAAATAAATTTCATTCAACCGTTGA CTGGGAAAAACACAAGGCCTTGGCATAATAAAGTATTAAGAATTAAATACATGTGAATTTTAGTTATTTATCATCGCGGG ATGGGTCGTTATAACACGGTTGTTCTGTTTCATGCATCTCGTGCTCGCTTACCAGTACCACGTACGTATAGCTTTGTGGA TGAGTTTTATATTAGTTTTGTAATTTTCATTTTAAATTTGCTTGACAATTTGGCAACACGTAACGGTTCCCTGGATTAAA ACAATTGGTATATATTAGTTTTTACCTTGATCCACGGCATTGCATCAATTATCGGTCCCAGTTCTATAACGGCGCCAAAT TCTGTGTTCATACTCAATAGCTTTTGGAATTCCTGGGAAATAGAACTATTTNAAAACCAGCACATGATTAATTCTCTGAA TATTCTTTGTTTTTTTCCCAAATAGGACGAGAAATAGAATGAAATGTGGACCATTTTATATATCAACTTATAATTAACTT TCGCTTCGTGANCAGGACGACTTAAATGGATAACTAAACGGAAATAAACTTT >GCiWno755_d15.g1_1 SSSDPCVKENQSGRNXVLTGCQQXFVLHTQCL*SNLPRSRV*GSTYRCKTPQTRSLLGIA NS*NVLHSGDVIKACVCNPYLSDMLAIVY*RVNA*VNHELTCVTERQNKYQI**GGERYD MFSFSFTAL*LVVNKEYSKIINRILTTSIGRC*LFKTRSGYLDIMC*RCPIPPTLLYIFT LKEILWQLFVT*S*RSNVSLISKKNLFQHLPGTYRKRKCINFFL*VIPKFKKAIADYLKI TCNWTLGQDISNMDGKSTKNKL*KTYNGH**YKCLKVFYMDGRFYYFFSCQT*SRLTGCL S >GCiWno755_d15.g1_2 RARTHA*KRTRAGGTQF*LGVSXHSFFTRNVFDLTCPDRVSRVQHIAAKHHKQEVCSVSQ TLRMFYILEML*KPAFVIPTCQICLRLFIEG*THKSTMS*HVSQNVKINTKYSRVGKDMT CFLSLLPPYSW**TKSIQKL*TVSLRLPSAVVNCLKQDQDIWILCARGVPSPPPYFIFSR *KRSYGNYLLHDLKGLTFR*FRRKIYFNTYLALTEKENV*TFFCKSFRNSRKPLPII*KS LATGHLVKT*VIWTAKVRKTNYKRLITDTDSINV*KFFIWMEDFTIFFPAKHEVV*PVVC >GCiWno755_d15.g1_3 ELGPMRKREPEREEXSSNWVSAXIRSSHAMSLI*LAQIACLGFNISLQNTTNKKFARYRK LLECFTFWRCYKSLRL*SLPVRYACDCLLKGKRISQP*VNMCHRTSK*IPNIVGWGKI*H VFFLFYRPIVGSKQRVFKNYKPYPYDFHRPLLIV*NKIRIFGYYVLEVSHPPHPTLYFHV KRDLMAIICYMILKV*RFVNFEEKSISTLTWHLQKKKMYKLFFVSHSEIQESHCRLFENH LQLDTWSRHK*YGRQKYEKQTIKDL*RTLIV*MFESFLYGWKILLFFFLPNMKSFNRLFV Opposite end of this clone = seq 67 join together for now >GCiWno755_d15.b1_4 KKLRIFFILCRNMVSXCHCHQPESLGC*TTINSFP*MMLPIFL*RSGAKTVVFKHRWYVS YMP*RFTSYHTYMVVEIF*KYFCKDFKFLFLRRFGGFRRLYPALYHILR*KTSN*QATPL REALWLSLVNTL*TTTRKIGKIRKILTQSDF*RKTKAVKLSSTKVYQKRFSHFRLGSVNV PEVNCHECYYFWPLHCWFKSVIYLPISSAHRRRRRSMV*FYDQNTYP*N*H*ESTGNVVT QFAHNTAFFTSVPTFDALKILYDFVKIHK*KNEKRYTKHHRSLYER*LTYMQVLLP*SAI I* >GCiWno755_d15.b1_5 KIKDFFYFVQEHG*XLPLPPT*KFGLLNDH*FISMNDVTYFSIA*RGKDSGI*AQVVCFI HAVTLYKLPHIYGSRDFLKIFL*RF*ISIST*VWRFSSPLSSTIPHSTLKDVKLAGHTIK RGTMVIISQYAVNHDPQNWKNPENFDPERFLTKNEGGEIIFNESLSEKVLAFSIGERKCP GSQLSRMLLFLATTLLVQVSDLSADLERPPTAAAEYGLILRPKHLSIKLTLREHWQRRDS IRA*HSIFYKCTNI*CTENLIRFCENTQMKK*KKVHKTPQITL*TLTYLYASIITIECNY IX >GCiWno755_d15.b1_6 KN*GFFLFCAGTWLVXAIATNLKVWVVKRPLIHFHE*CYLFFYSVAGQRQWYLSTGGMFH TCRDALQVTTHIW**RFFKNIFVKILNFYFYVGLAVFVAFIQHYTTFYVKRRQTSRPHH* ERHYGYH*SIRCKPRPAKLEKSGKF*PRAISNEKRRR*NYLQRKFIRKGSRIFDWGA*MS RKSIVTNVTIFGHYTAGSSQ*FICRSRAPTDGGGGVWFNFTTKTLIHKIDTKRALATS*L NSRITQHFLQVYQHLMH*KSYTIL*KYTNEKMKKGTQNTTDHFMNVNLPICKYYYHRVQL YX >GCiWno564_h05.g1 CHROMAT_FILE: GCiWno564_h05.g1 PHD_FILE: GCiWno564_h05.g1.phd.1 CHEM: term DYE: big TIME: Wed Oct 24 10:40:01 2001 TEMPLATE: GCiWno564_h05 DIRECTION: rev Length = 919 Score = 118 bits (293), Expect = 3e-26 Identities = 58/61 (95%), Positives = 58/61 (95%), Gaps = 1/61 (1%) Frame = +1 Query: 1 KRDLMAIICYMILKV-RFVNFEEKSISTLTWHLQKKKMYKLFFVSHSEIQESHCRLFENH 59 KRDLMAIICYMILKV RFVNFEEKSISTLTWHLQKKKMYKLFFV HSEIQESHCRLFEN Sbjct: 220 KRDLMAIICYMILKV*RFVNFEEKSISTLTWHLQKKKMYKLFFVGHSEIQESHCRLFENQ 399 Query: 60 L 60 L Sbjct: 400 L 402 >GCiWno564_h05.g1_1 NVKIIQYSGVGKIYMFSFSFTAL*LVVTRVSKYKPYPYDFHRPLLIV*NKIRIFGYYVLE VSHPPHPTLYFHVKRDLMAIICYMILKV*RFVNFEEKSISTLTWHLQKKKMYKLFFVGHS EIQESHCRLFENQLATGHLVKT*VNMDGKSYEKRNYNRLIT*HMIV*MFGKLFYNE*KNL TYLFSRGRAMTVVITRLFCFIHLVPAFTSYHVYNFFADRRHYHLEKLLLRI*CNNLL*ES MGVLXTFDNDDVTNVVASMTSEVLEKSQREKSRK*PXARQXRLLLFHRNTWGGXAXXVQT XFDTI*X >GCiWno564_h05.g1_2 T*K*SNIVGWERYTCFLSLLPPYSW**QEFQNINRILTTSIGRC*LFKTRSGYLDIMC*R CPIPPTLLYIFTLKEILWQLFVT*S*RSNVSLISKKNLFQHLPGTYRKRKCINFFL*VIP KFKKAIADYLKINLQLDTWSRHR*IWTAKVTKNETIIDLLRDT**YKCLESYFIMNERI* LIYFHVAEQ*QSL*HGCSVSYTLCLLLRVTTYITFLLIADITI*KSYYCAYNAIIYFKSR WGFLXHSTMMTSQM**LR*RQKCSRKVSGRNQGNNRXRDXNDCCSFTEILGAG*LXXYKL XSIQFE >GCiWno564_h05.g1_3 RKNNPI*WGGKDIHVFFLFYRPIVGSNKSFKI*TVSLRLPSAVVNCLKQDQDIWILCARG VPSPPPYFIFSR*KRSYGNYLLHDLKGLTFR*FRRKIYFNTYLALTEKENV*TFFCRSFR NSRKPLPII*KSTCNWTLGQDIGKYGRQKLRKTKL**TYYVTHDSINVWKVIL**MKEFN LFIFTWQSNDSRYNTVVLFHTPCACFYELPRI*LFC*SPTLPFRKVTIAHIMQ*FTLRVD GGSXNIRQ**RHKCSSFDDVRSAREKSAGEIKEITXSETXTIAALSQKYLGRXSXXCTNL XRYNL >GCiWno624_m24.g1 CHROMAT_FILE: GCiWno624_m24.g1 PHD_FILE: GCiWno624_m24.g1.phd.1 CHEM: term DYE: big TIME: Mon Oct 29 11:17:19 2001 TEMPLATE: GCiWno624_m24 DIRECTION: rev Length = 929 Score = 120 bits (299), Expect(2) = 1e-36 Identities = 61/64 (95%), Positives = 61/64 (95%), Gaps = 2/64 (3%) Frame = +3 Query: 1 TYLFSRGRAMTVVITRLFCFIHLVPAFTSYHVYNFFADRRHYHLEKLLLRI-CNNLL-ES 58 TYLFSRGRAMTVVITRLFCFIHLVPAFTSYHVYNFFADRRHYHLEKLLLRI CNNLL ES Sbjct: 129 TYLFSRGRAMTVVITRLFCFIHLVPAFTSYHVYNFFADRRHYHLEKLLLRI*CNNLL*ES 308 Query: 59 MGVL 62 MG L Sbjct: 309 MGFL 320 Score = 52.7 bits (124), Expect(2) = 1e-36 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 60 GVLXTFDNDDVTNVVASMTSEVLEKSQREKSRK 92 GVL TFDNDDVTNVVASMTSEVLEK +SR+ Sbjct: 311 GVLKTFDNDDVTNVVASMTSEVLEKKSAGESRE 409 >GCiWno624_m24.g1_1 TWFRHR*IWTAKVTKNETIIDLLRDT**YKCLESYFIMNERI*LIYFHVAEQ*QSL*HGC SVSYTLCLLLRVTTYITFLLIADITI*KSYYCAYNAIIYFKSRWGS*NIRQ**RHKCSSF DDVRGAREKVSGRIKGNNRKRDKNDCCSFSRYTWGG*AVVGTNFVSITILNE*MNECNLL ILTWIQRQSL*HRCIKW*L*KLFTKKVIYRLGNS*AGCV*NRIPVLITVLAPPREDK*LN SFIHGSHSRIRTHLASEYRAESETXPAGRQIR*QNDKRLTKAVILKAQSLISKRQ*TYLL INKSPTLPVX >GCiWno624_m24.g1_2 LGSDIGKYGRQKLRKTKL**TYYVTHDSINVWKVIL**MKEFNLFIFTWQSNDSRYNTVV LFHTPCACFYELPRI*LFC*SPTLPFRKVTIAHIMQ*FTL RVDGVLKTFDNDDVTNVVAS MTSEVLEKKSAGESREITESETKTIAALSADILGAGRLLLVQTLFRLQF *MNE*MNVTCL S*RGFNDSRYNTGV*NGSSKNYSPKRLYIDLVTRKPDVYETEYPC**LSLPPHVRINS*I HSSMVATVGFELTSPPNTALSPKRXQQADKYGDKTINVLPKQ*S*RHKV*SPSDNKRTY* STRARRFPFX >GCiWno624_m24.g1_3 LVQT*VNMDGKSYEKRNYNRLIT*HMIV*MFGKLFYNE*KNLTYLFSRGRAMTVVITRLF CFIHLVPAFTSYHVYNFFADRRHYHLEKLLLRI*CNNLL*ESMGFLKHSTMMTSQM**LR *RQRCSRKSQRENQGK*PKARQKRLLLFQQIYLGRVGCCWYKLCFDYNFE*MNE*M*LAY PDVDSTTVVITPVYKMVALKIIHQKGYI*TW*LVSRMCMKQNTRVNNCPCPPT*G*IVKF IHPW*PQ*DSNSPRLRIPR*VRNXTSRQTNTVTKR*TSYQSSNPKGTKFNLQATINVPTD QQEPDASRF >scf/ciona01/G126/seq_dir/hrs/G126P64527F.T0/G126P64527FE7.T0.seq 714 0 714 ABI Length = 714 Plus Strand HSPs: Score = 105 (37.0 bits), Expect = 2.8e-05, P = 2.8e-05 Identities = 25/51 (49%), Positives = 31/51 (60%), Frame = +3 Query: 17 ELGPIIDAMPWIKFTLRVDGVLKTFDNDDVTNVVASMTSEVLEKKSAGESR 67 ++ P D + F RV +LK FD DDV+NVV+SMTSEVLE K R Sbjct: 561 KINPRFDHNIILHF-FRVREILKNFDKDDVSNVVSSMTSEVLESKEDDSKR 710 GCiWno874_c22.b1 CHROMAT_FILE: GCiWno874_c22.b1 PHD_FILE: GCiWno874_c22.b1.phd.1 CHEM: term DYE: big TIME: Mon Dec 10 12:35:27 2001 TEMPLATE: GCiWno874_c22 DIRECTION: fwd Length = 880 Score = 92.4 bits (226), Expect = 7e-19 Identities = 53/66 (80%), Positives = 54/66 (81%), Gaps = 4/66 (6%) Frame = +2 Query: 1 IHPWPQ--DSNSPRLRIPR-VRNXTSRQTNTVTKR-TSYQSSNPKGTKFNLQATINVPTD 56 IHPW Q DSNSPRLRIPR VRN TSRQTNT KR TS QSSN K TKFNLQATINVPTD Sbjct: 44 IHPW*QQ*DSNSPRLRIPR*VRNETSRQTNT*QKR*TSNQSSNLKATKFNLQATINVPTD 223 Query: 57 QQEPDA 62 QQ+P A Sbjct: 224 QQKPHA 241 >GCiWno874_c22.b1_1 NCPCPPTLRINS*IHSSMVATVGFELTSPPNTALSPKRNQQADKYVTKTINV*PKQ*SKS HKV*SPSDNKRTY*STEAARSRLNFHFPKKLAIYG*LPVLLVNKFVL*SYATKSRLR*CV YSNSAFWFRFTEFSMITAFRFNLVCLLKCKVRKLRCLLSFANKFLTFYYYKS*SVFFYIY FYSRPTHNFYNFFLGHKFTPMFSKSPQ*THGRSPEQTRKQTSNLGGSKLPILRGRGTDRG RKLNDCIYFRCRHMCYCLPXAPAWEVWVXNTTIYFIYHDCMLLIFLIA*RGQDX >GCiWno874_c22.b1_2 TVLAPQR*G*IVKFIHPW*QQ*DSNSPRLRIPR*VRNETSRQTNT*QKR*TSNQSSNLKA TKFNLQATINVPTDQQKPHAHV*ISIFQKN*QSTVNCLFCL*TSLCYKVMLPKADCGDVY ILILHFGSDLLSFQ**QRLDLILSAY*NAKYENSGVYYPLLISFLHSIIINLNLCFFIFI FIPGQHTTSTTFFWVINLLLCFPKVLNKLTEEVRSKLGNRLPTLEDRNSLSYVDAVLTEV EN*TIVFTFVADTCVTACHXHQPGRYGXVTRPFTSFTMTACYLFFL*RSGGKT >GCiWno874_c22.b1_3 LSLPPNAEDK*LNSFIHGSNSRIRTHLASEYRAESETKPAGRQIRDKNDKRLTKAVI*KP QSLISKRQ*TYLLINRSRTLTFKFPFSKKTSNLRLIACFACKQVCVIKLCYQKPTAVMCI F*FCILVQIY*VFNDNSV*I*SCLLIKMQSTKTQVFTILC**VSYILLL*ILICVFLYLF LFQANTQLLQLFSGS*IYSYVFQKSSINSRKKSGANSETDFQPWRIETPYLTWTRY*QR* KIKRLYLLSLQTHVLLPAIXTSLGGMGX*HDHLLHLP*LHATYFSYSVAGAR >GCiWno755_d15.g1 CHROMAT_FILE: GCiWno755_d15.g1 PHD_FILE: GCiWno755_d15.g1.phd.1 CHEM: term DYE: big TIME: Mon Dec 3 10:31:34 2001 TEMPLATE: GCiWno755_d15 DIRECTION: rev Length = 903 Score = 100 bits (247), Expect = 3e-21 Identities = 52/59 (88%), Positives = 53/59 (89%), Gaps = 2/59 (3%) Frame = +3 Query: 1 HAMSLI-LAQIACLGFNISLQNTTNKKFARYRKLLECFTFWRCYKSLRC-SMHVRYDHD 57 HAMSLI LAQIACLGFNISLQNTTNKKFARYRKLLECFTFWRCYKSLR S+ VRY D Sbjct: 84 HAMSLI*LAQIACLGFNISLQNTTNKKFARYRKLLECFTFWRCYKSLRL*SLPVRYACD 260 LQW54206.x1 >GCiWno620_b04.b1 CHROMAT_FILE: GCiWno620_b04.b1 PHD_FILE: GCiWno620_b04.b1.phd.1 CHEM: term DYE: big TIME: Wed Oct 24 13:08:23 2001 TEMPLATE: GCiWno620_b04 DIRECTION: fwd Length = 915 Score = 121 bits (300), Expect = 1e-27 Identities = 59/59 (100%), Positives = 59/59 (100%) Frame = +2 Query: 9 VGNAPFLGAEPHKKLLELSLKYGPVYRLKMGGIKTVVLCNAEVVRSALIKQREAFSGRP 67 VGNAPFLGAEPHKKLLELSLKYGPVYRLKMGGIKTVVLCNAEVVRSALIKQREAFSGRP Sbjct: 2 VGNAPFLGAEPHKKLLELSLKYGPVYRLKMGGIKTVVLCNAEVVRSALIKQREAFSGRP 178 >GCiWno620_b04.b1_2 VGNAPFLGAEPHKKLLELSLKYGPVYRLKMGGIKTVVLCNAEVVRSALIKQREAFSGRPK FSSYKAVSAGESVVFNDEETLPPWRSHKSKIVRHMHKYTTSIRTRDKVTDLINTECMMMV TELDRISRSKCVNPENVIRMALANVMCAVCFGNRFEYDNEVFLALILYLAKVNVS* >GCiWno497_m11.b1 CHROMAT_FILE: GCiWno497_m11.b1 PHD_FILE: GCiWno497_m11.b1.phd.1 CHEM: term DYE: big TIME: Tue Oct 16 11:17:48 2001 TEMPLATE: GCiWno497_m11 DIRECTION: fwd Length = 890 Score = 141 bits (353), Expect = 9e-34 Identities = 67/67 (100%), Positives = 67/67 (100%) Frame = +3 Query: 1 PGPIPWPLVGNAPFLGAEPHKKLLELSLKYGPVYRLKMGGIKTVVLCNAEVVRSALIKQR 60 PGPIPWPLVGNAPFLGAEPHKKLLELSLKYGPVYRLKMGGIKTVVLCNAEVVRSALIKQR Sbjct: 279 PGPIPWPLVGNAPFLGAEPHKKLLELSLKYGPVYRLKMGGIKTVVLCNAEVVRSALIKQR 458 Query: 61 EAFSGRP 67 EAFSGRP Sbjct: 459 EAFSGRP 479 >GCiWno768_a24.g1 CHROMAT_FILE: GCiWno768_a24.g1 PHD_FILE: GCiWno768_a24.g1.phd.1 CHEM: term DYE: big TIME: Mon Dec 3 11:37:20 2001 TEMPLATE: GCiWno768_a24 DIRECTION: rev Length = 930 Score = 189 bits (476), Expect = 7e-48 Identities = 91/92 (98%), Positives = 91/92 (98%) Frame = -1 Query: 2 PPWRSHKSKIVRHMHKYTTSIRTRDKVTDLINTECMMMVTELDRISRSKCVNPENVIRMA 61 P WRSHKSKIVRHMHKYTTSIRTRDKVTDLINTECMMMVTELDRISRSKCVNPENVIRMA Sbjct: 783 PLWRSHKSKIVRHMHKYTTSIRTRDKVTDLINTECMMMVTELDRISRSKCVNPENVIRMA 604 Query: 62 LANVMCAVCFGNRFEYDNEVFLALILYLAKVN 93 LANVMCAVCFGNRFEYDNEVFLALILYLAKVN Sbjct: 603 LANVMCAVCFGNRFEYDNEVFLALILYLAKVN 508 >GCiWno768_a24.g1_4 LKR*YFATQEL*DRH*LSKERLSGQAKFLFLQASFSCEKRSLQRRRNPYPLWRSHKSKIV RHMHKYTTSIRTRDKVTDLINTECMMMVTELDRISRSKCVNPENVIRMALANVMCAVCFG NRFEYDNEVFLALILYLAKVNVS*IYSTVG*YGPRCICSSRN*TTKTY*TRFIAYINSNK FYIFIILKRCTAVVTFRLHFRRSRSHIKWPGYKIKKLISV*FII*VVLCHEAKVNYKLVY KMVHISFYFSSYFGKKQRIFRELIMCLFLNSSIFQEFQKLLSMNTEFGAVIELGPIIDAM PWIKVGYRAE >GCiWno768_a24.g1_5 KTVVLCNAGVVRSPLIKQGEAFRXGQISLPTSQFQLRKA*SSTTKKPLPPLAFA*VKDSP PHAQIHDFYSYSGQSHRSYKHRVYDDGH*TGSHI*IQMRQPRKCYTNGFSERNVRRVFWE PL*IR*RGISSLNTVFSKS*RKLNI*YCGVIWAKVYLLFTKLNHKNVLNTIYSLHKFQ*V LYLHYIKALYSGSHF*VTFS*KPLPY*VAWL*DKEVNFRLVYHLSRPMSRSES*L*VGV* NGPHFILFLVLFWKKTKNIQRINHVLVFK*FYFPGIPKAIEYEHRIWRRYRTGTDN*CNA VDQGRVPS*X >GCiWno768_a24.g1_6 *NGSTLQRRSCKIATD*ARRGFQXRPNFSSYKPVSAAKSVVFNDEETLTPFGVRISQR*S ATCTNTRLLFVLGTKSQIL*TQSV**WSLNWIAYLDPNASTQKMLYEWL*RT*CAPCVLG TALNTITRYF*P*YCI*QKLT*VKYIVLWGNMGQGVFALHEIKPQKRIKHDL*LT*IPIS FISSLY*SVVQR*SLLGYIFVEAAPILSGLAIR*RS*FPFSLSFKSSYVTKRKLIISWCI KWSTFHSISRPILEKNKEYSEN*SCACF*IVLFSRNSKSY*V*TQNLAPL*NWDR*LMQC RGSR*GTELX >sequence 51, 219, 223 31% to 2J2 MYDVIIVCVISAIAVVAASWLKQNGSKKFPPGSRGLPFLGSVPFVLGSLERTLA VWGWQNYGPVFFFTRGNTRTVVLNTYEAASEGFVKQGNH LSGRFIDANHNELFADYSPQWQEQRKLRVKTLKGFGKVNTEEIMTSECKKMICRIRETKGSF EAGYYLAVPTFNIVKSIIYGE RFENKMNLIIYTFIFVAGEPSEGMNKQDEVNLSKVLADPVYKAGNGFMEFMAGMFPQIRS SVAYERMLEKKGKERVRQVKE KMTGSKKLIEGMLQNLQDWETGEVYNNQQLSCYLTDLFMAGTDTMATTVHWSLVFLAQNP QVQEKMAAEVKSVAGNDVITTSMMDSMPYTRAVMHESSRLRPVFPLSLRHQATSDVTVKD YVIPTGTSVVANLWAIQNDPKWWKQPSEFRPERHVTEDGGFTKSEKIVPFSVGPRYCLGS QIAIYQQFIFLTNLVRGFRFRFDQAKVEPDLTGLMTSVLAPVNVHLVAEER* LQW176098.y1 PERF TO HEME LQW141848.y1 LQW173645.y1 KYG TO MID GCiWno24_f15.g1 GCiWno25_f15.g1 GCiWno733_a17.b1 GCiWno733_a17.g1 cigd048i16 cibd062g13 rcibd062g13 rcigd048i16 GCiWno542_i05.g1 GCiWno667_e24.g1 >GCiWno542_i05.g1 TTCGAGCTCGGTACCCTTCCCTTGCTATCGTTGGCTCGCAACGCGACAATAAACAAGTTACGCGTTTATTGATCTATTCA TTATTTTACACCCTGTACACTTACATTACAGGGAGGCGCTTTTTGTTAATAAATAAATAAAATGCTTATTTTTTTGTTTC AGATTGATTTGCTAGAATTTGTTTTGTCATAATTAATCATGTATGACGTCATAATAGTTTGCGTCATATCCGCAATAGCT GTTGTCGCAGCAAGCTGGCTGAAACAAAATGGGTCAAAGAAGTTTCCCCCGGGGTCAAGGGGGTTACCCTTTCTCGGGAG TGTACCCTTCGTTCTGGGTAGCCTAGAGCGCACCCTAGCGGTTTGGGGGTGGCAAAACTACGGCCCCGTTTTCTTCTTTA CTCGGGGGAATACCCGCACAGTCGTGCTCAACACTTACGAAGCTGCAAGCGAAGGGTTCGTGAAACAGGGGAACCACCTG TCGGGGAGATTCATCGACGCCAACCACAACGAACTGTTCGCGGATTATTCTCCACAGTGGCAGGAACAGCGGAAACTTCG CGTTAAAACGCTCAAAGGGTTCGGGAAAGTGAATACAGAAGAGATTATGACGTCAGAATGCAAGAAAATGATTTGTAGAA TACGGGAAACAAAGGGATCGTTCGAGGCGGGTTACTATCTCGCTGTACCAACGTTTAATATCGTAAAGAGCATTATTTAC GGTGAGTGGNGATTTCGTATTATATTGATATATCTTTGGCTTTCCCACTAATGTAGTGTAATATATGTGATTTGGGTGGT AGACCGCCCCACACGTATCAAAGGGATATCCGTTTCGATGCACGACACTACTACACGCGTGNTACAAATAGCATAAATAG ATGCGTTACGCGAGAATANATAGGTCTCATTCATTCGCTTTGAGATAAGATGAAATTGGATATTATACGTTTT >GCiWno542_i05.g1_1 FELGTLPLLSLARNATINKLRVY*SIHYFTPCTLTLQGGAFC**INKMLIFLFQIDLLEF VLS*LIMYDVIIVCVISAIAVVAASWLKQNGSKKFPPGSRGLPFLGSVPFVLGSLERTLA VWGWQNYGPVFFFTRGNTRTVVLNTYEAASEGFVKQGNHLSGRFIDANHNELFADYSPQW QEQRKLRVKTLKGFGKVNTEEIMTSECKKMICRIRETKGSFEAGYYLAVPTFNIVKSIIY GEWXFRIILIYLWLSH*CSVIYVIWVVDRPTRIKGISVSMHDTTTRVXQIA*IDALRENX *VSFIRFEIR*NWILYVX >GCiWno542_i05.g1_2 SSSVPFPCYRWLATRQ*TSYAFIDLFIILHPVHLHYREALFVNK*IKCLFFCFRLIC*NL FCHN*SCMTS**FASYPQ*LLSQQAG*NKMGQRSFPRGQGGYPFSGVYPSFWVA*SAP*R FGGGKTTAPFSSLLGGIPAQSCSTLTKLQAKGS*NRGTTCRGDSSTPTTTNCSRIILHSG RNSGNFALKRSKGSGK*IQKRL*RQNARK*FVEYGKQRDRSRRVTISLYQRLIS*RALFT VSGDFVLY*YIFGFPTNVV*YM*FGW*TAPHVSKGYPFRCTTLLHAXYK*HK*MRYARIX RSHSFALR*DEIGYYTFX >GCiWno542_i05.g1_3 RARYPSLAIVGSQRDNKQVTRLLIYSLFYTLYTYITGRRFLLINK*NAYFFVSD*FARIC FVIINHV*RHNSLRHIRNSCCRSKLAETKWVKEVSPGVKGVTLSRECTLRSG*PRAHPSG LGVAKLRPRFLLYSGEYPHSRAQHLRSCKRRVRETGEPPVGEIHRRQPQRTVRGLFSTVA GTAETSR*NAQRVRESEYRRDYDVRMQENDL*NTGNKGIVRGGLLSRCTNV*YRKEHYLR *VXISYYIDISLAFPLM*CNICDLGGRPPHTYQRDIRFDARHYYTRXTNSINRCVTREXI GLIHSL*DKMKLDIIRF >GCiWno596_h18.g1 CHROMAT_FILE: GCiWno596_h18.g1 PHD_FILE: GCiWno596_h18.g1.phd.1 CHEM: term DYE: big TIME: Thu Oct 25 11:54:00 2001 TEMPLATE: GCiWno596_h18 DIRECTION: rev Length = 898 Score = 163 bits (408), Expect = 3e-40 Identities = 80/81 (98%), Positives = 81/81 (99%) Frame = -2 Query: 1 RFENKMNLIIYTFIFVAGEPSEGMNKQDEVNLSKVLADPVYKAGNGFMEFMAGMFPQIRS 60 RFENKMNLIIYTFIFVAGEPSEGMNKQDEVNLSKVLADPVYKAGNGFMEFMAGMFPQIRS Sbjct: 285 RFENKMNLIIYTFIFVAGEPSEGMNKQDEVNLSKVLADPVYKAGNGFMEFMAGMFPQIRS 106 Query: 61 SVAYERMLEKKGKERVRQVKE 81 SVAYERMLEKKGKERVRQVK+ Sbjct: 105 SVAYERMLEKKGKERVRQVKK 43 >GCiWno596_h18.g1 ATTCTGCGCATCCCTTCGATAATTTTTTGCTCCCTGTCATTTTTTCTTTACTTGCCGGACTCTCTCCTTTCCCTTCTTCT CCAGCATTCTCTCGTATGCAACCGATGACCGAATTTGTGGGAACATACCAGCCATGAACTCCATAAAACCATTACCAGCT TTATAAACGGGATCTGCCAATACCTTTGACAGATTTACTTCATCTTGTTTGTTCATACCTTCAGAAGGCTCTCCTGCAAC GAAGATAAACGTATAAATTATCAAATTCATCTTATTCTCAAAGCGAATGAATGAGACCTATCTATTCTCGCGTAACGCAT CTATTTATGCTATTTGTAACACGCGTGTAGTAGTGTCGTGCATCGAAACCGATATCCTTTGATTACGTTGTGGGCGGTCT AACCACCAAATCACATATATTACACTACATTAGTGGGAAAGCCAAAGATATATCAATATAATACGAAATCCCCACTCACC GTAAATAATGCTCTTTACGATATTAAACGTTGGTACAGCGAGATAGTAACCCGCCTCGAACGATCCCTTTGTTTCCCGTA TTCTACAAATCATTTTCTTGCATTCTGACGTCATAATCTCTTCTGTATTCACTTTCCCGAACCCTTTGAGCGTTTTAACG CGAAGTTTCCGCTGTTCCTGCCACTGTGGAGAATAATCCGCGAACAGNTCGTTGTGGTTGGCGTCGATGAATCTCCCCGA CAGTTTTTCCCCTGGTCACGAACCCTTCGCTGCAGCTTCGTAATGGTGGACACGACTGTGCGGGTTTCCCCCGAGTAAAG AAGAAACGGGCCGTAATTTTTCCACCCCAAACCGTTAGGTGCCCTCTAGGCTCCCAGACCAAGGGTCACTTCCGAAAAAG GTACCCCTTGGCCCCGGG >_4 PGPRGTFFGSDPWSGSLEGT*RFGVEKLRPVSSLLGGNPHSRVHHYEAAAKGS*PGEKLS GRFIDANHNXLFADYSPQWQEQRKLRVKTLKGFGKVNTEEIMTSECKKMICRIRETKGSF EAGYYLAVPTFNIVKSIIYGEWGFRIILIYLWLSH*CSVIYVIWWLDRPQRNQRISVSMH DTTTRVLQIA*IDALRENR*VSFIRFENKMNLIIYTFIFVAGEPSEGMNKQDEVNLSKVL ADPVYKAGNGFMEFMAGMFPQIRSSVAYERMLEKKGKERVRQVKKK*QGAKNYRRDAQN >_5 PGAKGYLFRK*PLVWEPRGHLTVWGGKITARFFFTRGKPAQSCPPLRSCSEGFVTRGKTV GEIHRRQPQRXVRGLFSTVAGTAETSR*NAQRVRESEYRRDYDVRMQENDL*NTGNKGIV RGGLLSRCTNV*YRKEHYLR*VGISYYIDISLAFPLM*CNICDLVVRPPTT*SKDIGFDA RHYYTRVTNSINRCVTRE*IGLIHSL*E*DEFDNLYVYLRCRRAF*RYEQTR*SKSVKGI GRSRL*SW*WFYGVHGWYVPTNSVIGCIRENAGEEGKGESPASKEKMTGSKKLSKGCAEX >_6 RGQGVPFSEVTLGLGA*RAPNGLGWKNYGPFLLYSGETRTVVSTITKLQRRVRDQGKNCR GDSSTPTTTXCSRIILHSGRNSGNFALKRSKGSGK*IQKRL*RQNARK*FVEYGKQRDRS RRVTISLYQRLIS*RALFTVSGDFVLY*YIFGFPTNVV*YM*FGG*TAHNVIKGYRFRCT TLLHACYK*HK*MRYARIDRSHSFALRIR*I**FIRLSSLQESLLKV*TNKMK*ICQRYW QIPFIKLVMVLWSSWLVCSHKFGHRLHTRECWRRRERRESGK*RKNDREQKIIEGMRRX >rcigd048i16 TTCGCTTTGAGAATAAGATGAATTTGATAATTTATACGTTTATCTTCGTTGCAGGAGAGCCTTCTGAAGGTATGAACAAA CAAGATGAAGTAAATCTGTCAAAGGTATTGGCAGATCCCGTTTATAAGGCTGGTAATGGTTTTATGGAGTTCATGGCTGG TATGTTCCCACAAATTCGGTCATCGGTTGCATACGAGAGAATGCTGGAGAAGAAGGGAAAGGAGAGAGTCCGGCAAGTGA AAGAAAAAATGACAGGGAGCAAAAAATTGATCGAAGGGATGCTGCAGAACCTTCAGGATTGGGAGACCGGCGAAGTTTAC AACAATCAACAGCTCTCTTGTTACTTGACCGACCTATTTATGGCGGGAACCGATACCATGGCAACCACGGTTCATTGGTC GCTTGTATTTCTCGCCCAAAATCCTCAAGTTCAAGAAAAAATGGCGGCAGAGGTGAAAAGTGTAGCCGGCAATGACGTCA TCACTACGTCAATGATGGATTCTATGCCATACACAAGAGCTGTCATGCATGAATCGTCACGTCTGAGGCCGGTGTTTCCC CTTTCGTTACGTCATCAAGCCACAAGTGACGTCACGGTTAAAGATTACGTCATACCAACCGGTACGAGCGTAGTAGCCAA CTTGTGGGCAATACAGAACGACCCAAAATGGTGGAAGCAGCCGTCAGAATTCCGTCCGGAGCGACACGTCACAGAGGATG GGGGATTCACCAAAAGCGAGAAGATCGTGCCGTTTTCTACCTGCAGCCCGGGGG RFENKMNLIIYTFIFVAGEPSEGMNKQDEVNLSKVLADPVYKAGNGFMEFMAGMFPQIRS SVAYERMLEKKGKERVRQVKE KMTGSKKLIEGMLQNLQDWETGEVYNNQQLSCYLTDLFM AGTDTMATTVHWSLVFLAQNPQVQEKMAAEVKSVAGNDVITTSMMDSMPYTRAVMHESSR LRPVFPLSLRHQATSDVTVKDYVIPTGTSVVANLWAIQNDPKWWKQPSEFRPERHVTEDG GFTKSEKIVPFSTCSPG >GCiWno733_a17.b1 GAAAAATGACAGGGAGCAAAAAATTGATCGAAGGGATGCTGCAGAATCTTCAGGATTGGGAAACCGGCGAAGTTTACAAC AATCAACAGCTCTCTTGTTACTTGACCGACCTATTTATGGCGGGAACCGATACCATGGCAACCACGGTTCATTGGTCGCT TGTATTTCTCGCCCAAAATCCTCAAGTTCAAGAAAAAATGGCGGCAGAGGTGAAAAGTGTAGCTGGCAATGACGTCATCA CTACGTCAATGATGGATTCTATGCCATACACAAGAGCTGTCATGCATGAATCGTCACGTCTGAGGCCGGTGTTTCCCCTT TCGTTACGTCATCAAGCCACAAGTGACGTCACGGTTAAAGATTACGTCATACCAACCGGTACGAGCGTAGTAGCCAACTT GTGGGCAATACAGAACGACCCAAAATGGTGGAAGCAGCCGTCAGAATTCCGTCCGGAGCGACACGTCACTGAGGATGGGG GATTCACCAAAAGCGAGAAGATCGTCCCGTTTTCTGTCGGGCCTCGATATTGCCTGGGAAGTCAGATAGCGATCTACCAG CAGTTTATATTCCTAACTAACCTAGTGCGGGGATTCCGGTTTCGGTTCGATCAAGCCAAGGTAGAACCGGATCTGACAGG TTTGATGACGTCAGTACTAGCACCTGTCAACGTTCACTTGGTGGCAGAGGAGCGCTAATTGTATTGACATAGAAACAATA TGTTATTGCACCGTACGATGATGACGTTTGTGAAAGATGGAACTTGTATTTAATTTGTGACAACTTGAAACTGTCCCACT TTTTACGTTACTTTGACCAGTGTGTAGATAACTGTCAATAAAATGCTCACCCATGTTTGGTCTTCTTTTAGGGGAATA >sequence 54 3 accessions 485 to 1A1 PPGPTAWPLVGNLFSMGRQSHLILESMRKTYGDVFSVYFGSTLVVVVNG LQW13645.x1 LQW155902.y1 LQW17980.x1 >sequence 230, 48, 56 formerly 55, 80 (top two lines 2 accessions 50% to 2U1 VKEHKATFDREDVRDFIDAFLKEAELSKEPSFNDTQLLHYLHDLFLGGTETTT 230 STLRWALLCLLHYPQTQTKLREEINEVIGDGKVSYSCKVDIPYTCAFIQELYRY 230 RTLLPLSLTHKTNEKAMLGEYTIPKSTIVSVNLWAVHNDPNTWEEPS 230 MFKPERHLDESGHFVQSKHVIPFSVGPRHCVGEQLARMEVFIYLVSMVQKF 230 EFLPDRNANELPDIEKGSNGPAFVPQMFDIVAKVI this part of the seq is now 13, 55, 80 NLWAVHNDPTVWNNPRQFKPERHIDDKGKYIQSNHVIPFSVGPRHCLGEQLARME 440 IFIFLVSMVQKFEF 398 LQW173304.x1 LQW173304.y1 LQW266291.y1 LQW274186.y1 2 DIFFS >GCiWno244_g09.b1 CHROMAT_FILE: GCiWno244_g09.b1 PHD_FILE: GCiWno244_g09.b1.phd.1 CHEM: term DYE: big TIME: Tue Oct 2 12:35:44 2001 TEMPLATE: GCiWno244_g09 DIRECTION: fwd Length = 928 Score = 117 bits (290), Expect = 6e-26 Identities = 55/58 (94%), Positives = 57/58 (97%) Frame = -2 Query: 1 DGKVSYSCKVDIPYTCAFIQELYRYRTLLPLSLTHKTNEKAMLGEYTIPKSTIVSLNL 58 DGKVSYSCKVD+PYTCAFIQELYRYRTLLPLSLTHKTNEKAMLGEYTIPKSTIVSL + Sbjct: 798 DGKVSYSCKVDMPYTCAFIQELYRYRTLLPLSLTHKTNEKAMLGEYTIPKSTIVSLTV 625 >GCiWno244_g09.b1 GTGGATATAGCTGTTTGCAGTAAAACGACTGACGATCTGGTCATACCTGTGGGGCAGCAAAAGCACGGNCCATTCGTAAC CTTTTTCAATATCAAGTAACTCATTAGCATTTCGGTCGGGAAGAAACTCAAACTTTTGTACCATCGAAACTAGGTAAATA AACACTTCCATTCGAGCTAGTTGTTCTCCAACGCAGTGTCTAGGCCCCACGGAAAACGGGATGACGTGTTTCGATTGAAC AAAATGCCCGCTTTCGTCCAGATGACGCTCAGGTTTAAACATGCTCGGTTCTTCCCATGTATTAGGATCGTTATGCACAG CCCATAGGTTAACAGAAACCTAAACAGAGAAAAAAATTGAAAATTTTGATTTCATTCAGTTTAGTAGTTTCTTTTTTGTT TATATATAGTGATGTGTGGAGAAAAAGAAACCTCTAGCACACAGTATTCCATATTTCCTTTATCGCCCTTTAAACAATTA CAACGCACTTTTAGAGTCACGAGAATACGGTTATACAATTCTGTGGTTATTCTTTGTTTACTATTGAATGTGACGAGGAG AAAAAAAAACAAAACAAAAGCGGCAAAATAAAGTTATTTAATGCTATAATAAGTCTACCTATAATACAGTTAGACTTACT ATAGTTGACTTGGGTATTGTGTATTCTCCCAGCATTGCTTTCTCGTTTGTCTTATGGGTAAGACTCAACGGCAGTAATGT TCTGTATCTGTAAAGTTCTTGTATGAAAGCACATGTGTATGGCATGTCAACCTTGCAACTGTAACTAACTTTTCCGTCGC CTGCGAACAAACATGAATGAATGAATGAATGAATGAAATCTACTTATTTATATCGCATGGGCGTGGCTTATTNATTGTCG CNAAGACATTCGTATACACGATGTNCTGTTTTTAACGCATCGTGCGTN >GCiWno244_g09.b1_4 THDALKTXHRVYECLXDNX*ATPMRYK*VDFIHSFIHSCLFAGDGKVSYSCKVDMPYTCA FIQELYRYRTLLPLSLTHKTNEKAMLGEYTIPKSTIVSLTVL*VDLL*H*ITLFCRFCFV FFSPRHIQ**TKNNHRIV*PYSRDSKSAL*LFKGR*RKYGILCARGFFFSTHHYI*TKKK LLN*MKSKFSIFFSV*VSVNLWAVHNDPNTWEEPSMFKPERHLDESGHFVQSKHVIPFSV GPRHCVGEQLARMEVFIYLVSMVQKFEFLPDRNANELLDIEKGYEWXVLLLPHRYDQIVS RFTANSYIH >GCiWno244_g09.b1_5 XARCVKNXTSCIRMSXRQXISHAHAI*ISRFHSFIHSFMFVRRRRKS*LQLQG*HAIHMC FHTRTLQIQNITAVESYP*DKRESNAGRIHNTQVNYSKSNCIIGRLIIALNNFILPLLFC FFFSSSHSIVNKE*PQNCITVFS*L*KCVVIV*RAIKEIWNTVC*RFLFLHTSLYINKKE TTKLNEIKIFNFFLCLGFC*PMGCA*RS*YMGRTEHV*T*ASSGRKRAFCSIETRHPVFR GA*TLRWRTTSSNGSVYLPSFDGTKV*VSSRPKC**VT*Y*KRLRMXRAFAAPQV*PDRQ SFYCKQLYPX >GCiWno244_g09.b1_6 RTMR*KQXIVYTNVXATXNKPRPCDINK*ISFIHSFIHVCSQATEKLVTVARLTCHTHVL SYKNFTDTEHYCR*VLPIRQTRKQCWENTQYPSQL**V*LYYR*TYYSIK*LYFAAFVLF FFLLVTFNSKQRITTELYNRILVTLKVRCNCLKGDKGNMEYCVLEVSFSPHITIYKQKRN Y*TE*NQNFQFFSLFRFLLTYGLCITILIHGKNRACLNLSVIWTKAGILFNRNTSSRFPW GLDTALENN*LEWKCLFT*FRWYKSLSFFPTEMLMSYLILKKVTNGPCFCCPTGMTRSSV VLLQTAIST >rcibd035o22 Length = 681 Score = 189 bits (474), Expect = 1e-47 Identities = 87/102 (85%), Positives = 92/102 (89%) Frame = -3 Query: 1 NLWAVHNDPTVWNNPRQFKPERHIDDKGKYIQSNHVIPFSVGPRHCLGEQLARMEIFIFL 60 NLWAVHNDPTVWNNPRQFKPERHIDDKGKYIQSNHVIPFSVGPRHCLGEQLARMEIFIFL Sbjct: 565 NLWAVHNDPTVWNNPRQFKPERHIDDKGKYIQSNHVIPFSVGPRHCLGEQLARMEIFIFL 386 Query: 61 VSMVQKFEFLPDRNANELPDIEKGSNGPAFVPQMFDIVAKVI 102 VSMVQKFEFLPD N +LP+++ G NG AFVP F +VAK I Sbjct: 385 VSMVQKFEFLPDPNKTDLPELDDGVNGVAFVPYPFKLVAKEI 260 >GCiWno617_o04.b1 CHROMAT_FILE: GCiWno617_o04.b1 PHD_FILE: GCiWno617_o04.b1.phd.1 CHEM: term DYE: big TIME: Mon Oct 29 10:53:49 2001 TEMPLATE: GCiWno617_o04 DIRECTION: fwd Length = 926 Score = 109 bits (270), Expect = 8e-24 Identities = 49/51 (96%), Positives = 51/51 (99%) Frame = +1 Query: 34 DTQLLHYLHDLFLGGTETTTSTLRWALLCLLHYPQTQTKLREEINEIIGRH 84 DTQLLHYLHDLFLGGTETTTSTLRWALLCLLHYPQTQTKLREEINE+IG+H Sbjct: 70 DTQLLHYLHDLFLGGTETTTSTLRWALLCLLHYPQTQTKLREEINEVIGKH 222 >GCiWno617_o04.b1 TCATACACAGACCATCTTANCCCAGCCCTTTGTTTTAAGCCTCCAACAATTATAATACATACGTTATAGGACACACAGCT TCTCCATTACCTACACGATCTGTTTCTTGGTGGAACTGAAACAACAACAAGTACGTTAAGATGGGCTCTCCTGTGTCTTC TGCATTATCCACAAACTCAAACAAAACTAAGAGAGGAAATAAATGAAGTCATAGGTAAGCATCTTATAGTTAAGGGTACT GTTGCCATTATAAGCGTGGTCTTGAGAAATATATTTAACTGCAATCACTCCAACCATCATGTGGTTATGAATTGTCTAAT CTAAGTTGTCGGCTATACATAAAAAAACTCAAAGTTGCATACGAACACGATGTGTTTAAAACAGAACATCGTGTTATAAC GATTGTCTTTGCGACAATAAATAAGCCACGCCATGCGATATAAATAAGTTAGATTCATTCATTCATTCATTCATTCATGT TTTGTTCGCAGGCGACGGAAAAGTTAGTTACAGTTGCAAGGTTGACATACCATACACATGTGCTTTCATACAAGAACTTT ACAGATACAGAACATTACTGCCGTTGAGTCTTACCCATAAGACAAACGAGAAAGCAATGCTGGGAGAATACACAATACCC AAGTCAACTATAGTAAGTCTAACTGTATTATANGTAGACTTATTATAGCATTAAATAACTTTATTTTGCCGCTTTTGTTT TGTTTTTTTTCTTCTCGTCACATTCAATTAGTAACAAAGAATAACCACAGAATTATATAACCGTATTCTCATGACTCTAA AAGTGCGTTGTAATTGTTCAAAAGCGATAAAGGAAATATGGGATACTGTGTGCTANGAGTATCCTTTTCTTCCCACATCA CCTTTTTAAAACAAAAAGAAACCTTTTANCTTAATGAAATCAAAAN >GCiWno617_o04.b1_1 SYTDHLXPALCFKPPTIIIHTL*DTQLLHYLHDLFLGGTETTTSTLRWALLCLLHYPQTQ TKLREEINEVIGKHLIVKGTVAIISVVLRNIFNCNHSNHHVVMNCLI*VVGYT*KNSKLH TNTMCLKQNIVL*RLSLRQ*ISHAMRYK*VRFIHSFIHSCFVRRRRKS*LQLQG*HTIHM CFHTRTLQIQNITAVESYP*DKRESNAGRIHNTQVNYSKSNCIIXRLIIALNNFILPLLF CFFSSRHIQLVTKNNHRII*PYSHDSKSAL*LFKSDKGNMGYCVLXVSFSSHITFLKQKE TFXLNEIKX >GCiWno617_o04.b1_2 HTQTILXQPFVLSLQQL*YIRYRTHSFSITYTICFLVELKQQQVR*DGLSCVFCIIHKLK QN*ERK*MKS*VSIL*LRVLLPL*AWS*EIYLTAITPTIMWL*IV*SKLSAIHKKTQSCI RTRCV*NRTSCYNDCLCDNK*ATPCDINKLDSFIHSFIHVLFAGD GKVSYSCKVDIPYTC AFIQELYRYRTLLPLSLTHKTNEKAMLGEYTIPKSTIVSL TVLXVDLL*H*ITLFCRFCF VFFLLVTFN**QRITTELYNRILMTLKVRCNCSKAIKEIWDTVCXEYPFLPTSPF*NKKK PFXLMKSKX >GCiWno617_o04.b1_3 IHRPSXPSPLF*ASNNYNTYVIGHTASPLPTRSVSWWN*NNNKYVKMGSPVSSALSTNSN KTKRGNK*SHR*ASYS*GYCCHYKRGLEKYI*LQSLQPSCGYELSNLSCRLYIKKLKVAY EHDVFKTEHRVITIVFATINKPRHAI*IS*IHSFIHSFMFCSQATEKLVTVARLTYHTHV LSYKNFTDTEHYCR*VLPIRQTRKQCWENTQYPSQL**V*LYYX*TYYSIK*LYFAAFVL FFFFSSHSISNKE*PQNYITVFS*L*KCVVIVQKR*RKYGILCAXSILFFPHHLFKTKRN LLX**NQX >sequence 56, 230 1 accession 47% to 2U1 C-term may be hybrid DRQLVHYVRELFKAGTETSTGTLRWAMLCLIHYPEAQTKIRSEIYDVLGKCS = seq 13? VSVNLWAVHNDPNTWDEPSKFKPERHLDEKGHYVQSKHVIPFSVGPRHCVGEQLARME VYIYLVSMVQKFEFLPDPDVTELPDIEQGSNGPAFVPQMLDIVAKVI* JWB1514.y1 >GCiWno408_i21.g1 CHROMAT_FILE: GCiWno408_i21.g1 PHD_FILE: GCiWno408_i21.g1.phd.1 CHEM: term DYE: big TIME: Wed Oct 10 12:50:32 2001 TEMPLATE: GCiWno408_i21 DIRECTION: rev Length = 900 Score = 103 bits (255), Expect = 6e-22 Identities = 48/52 (92%), Positives = 49/52 (93%) Frame = +2 Query: 1 DRQLVHYVRELFKAGTETSTGTLRWAMLCLIHYPEAQTKIRSEIYDVLGKCS 52 DRQLVHYVRELFKAGTETSTGTLRWAMLCLIHYP AQ KIR EI+DVLGKCS Sbjct: 326 DRQLVHYVRELFKAGTETSTGTLRWAMLCLIHYPGAQEKIRKEIFDVLGKCS 481 >GCiWno408_i21.g1_1 YVTL*V*YER*LLSPVLDKCSLRLDTSLRLYSTAR*DETPVGCGV*YH*SCFEQLTMVYI GVVRTRFYNSLNVICLLPNXGRENRMKRCPIFPTLLYSLKKLKFTYL*GPTACTLRT*TL QSWY*NFYGNS*MGDVVSHPLSWGTGENQERNI*RLR*V*LQYGVL*LQLKTINSTIK** YCLKKNVLKK*KS*TLNILDIANIVH**IKYYTLFFNIFSSK*IS*IK*KVFIYRSI*FV VF*K*CNVFFIFNRVLTP*RLFVFCSHANTTFFPALNESVTPNAIHLSGFHTRIGFGVSK >GCiWno408_i21.g1_2 M*LCRFNTSGSYLARCWTNAPCAWILHYVYIVLRDKMKHL*AVGYNITDRVLNN*QWSIL ES*GHGFIIL*MLFVYYQMXDEKIE*KGVPSSPPYYIA*RN*NSLIFKDRQLVHYVRELF KAGTETSTGTLRWAMLCLIHYPGAQEKIRKEIFDVLGKCSCNMEFCSCS*KQ*TAQ*NNN TA*KRMY*KSENRKP*IYLI*QILCINR*NITLCFLIFLVQSELARLNKKFLFTEVFNLS YSKNDATCFLSLTVF*PPDDFLYFARTPIPLFSQH*MNL*RRMPFTFPGSIQE*GSGFP >GCiWno408_i21.g1_3 CNFVGLIRAVVT*PGAGQMLLAPGYFITFI*YCEIR*NTCRLWGIISLIVF*TINNGLYW SREDTVL*FFECYLFTTKXXTRK*NEKVSHLPHPTI*PKETKIHLSLRTDSLYITYVNSS KLVLKLLRELLDGRCCVSSTILGHRRKSGKKYLTS*VSVVAIWSFVVAAKNNKQHNKIII LLEKECIKKVKIVNPKYT*YSKYCALIDKILHSVF*YF*FKVN*LD*IKSFYLPKYLICR ILKMMQRVFYL*PCFNPLTTFCILLARQYHFFPSIE*ICNAECHSPFRVPYKNRVRGFQ >GCiWno617_o04.g1 CHROMAT_FILE: GCiWno617_o04.g1 PHD_FILE: GCiWno617_o04.g1.phd.1 CHEM: term DYE: big TIME: Mon Oct 29 10:53:49 2001 TEMPLATE: GCiWno617_o04 DIRECTION: rev Length = 934 Score = 59.7 bits (142), Expect = 5e-09 Identities = 31/47 (65%), Positives = 34/47 (71%) Frame = -1 Query: 1 VYIYLVSMVQKFEFLPDPDVTELPDIETRFKWTSIRTPDVDIVAKVI 47 V+IYLVSMVQKFEFLPDP+ TELPDIE + DIVAKVI Sbjct: 625 VFIYLVSMVQKFEFLPDPNATELPDIEKGSNGPAFVPQMFDIVAKVI 485 JWB1514.y1 CHEM: term DYE: ET TIME: Wed Mar 21 17:13:31 2001 TEMPLATE: JWB1514 DIRECTION: rev Length = 657 Score = 176 bits (442), Expect = 6e-44 Identities = 79/85 (92%), Positives = 82/85 (95%) Frame = +3 Query: 1 VSVNLWAVHNDPNTWDEPSKFKPERHLDEKGHYVQSKHVIPFSVGPRHCVGEQLARMEVY 60 VSVNLWAVHNDPNTWDEPSKFKPERHLDEKGHYVQSKHVIPFSVGPRHCVGEQLARMEVY Sbjct: 300 VSVNLWAVHNDPNTWDEPSKFKPERHLDEKGHYVQSKHVIPFSVGPRHCVGEQLARMEVY 479 Query: 61 IYLVSMVQKFEFFPDPNEPDLPDVE 85 IYLVSMVQKFEF PDP+ +LPD+E Sbjct: 480 IYLVSMVQKFEFLPDPDVTELPDIE 554 >JWB1514.y1 >lcl|JWB1514.y1 CHROMAT_FILE: JWB1514.y1 PHD_FILE: JWB1514.y1.phd.1 CHEM: term DYE: ET TIME: Wed Mar 21 17:13:31 2001 TEMPLATE: JWB1514 DIRECTION: rev TATAGCATAACATAACTTCGTTGCCTCTTGTTATTATTTTCTGGGTCACATTCGATAGTAAACAAAGAATATTTACATAA TTATATAACCGTATGCTCAGCACGACTCTAAATGAACATAACCGTATCCTCACGACTCTAAAAGAACGTGTAATGTTTAA AGCACGACAAACAAAATATGGGATAATATGTGCTAAAGGCATCCATCTTACCCCACAACACCATTAACAAAACTGATTAG ATAAAACAGTAATTATGACACTGAATGTTACCAAAACTTCCAATTTTTTCTCTGTTTAGGTTTCTGTTAACTTGTGGGCT GTACATAACGATCCTAATACATGGGACGAACCGAGCAAGTTTAAACCTGAGCGTCATCTTGATGAAAAAGGACATTATGT TCAATCGAAACACGTCATCCCATTTTCGGTTGGGCCTAGACACTGTGTTGGAGAACAACTAGCTCGTATGGAAGTGTATA TTTACTTGGTTTCGATGGTTCAAAAGTTTGAGTTTCTTCCTGACCCAGATGTCACTGAATTGCCTGACATTGAAACAAGG TTCAAATGGACCAGCATTCGTACCCCAGATGTTGATATTGTTGCTAAAGTGATTTGATAATCACGTTTTCGATTGCTTTT TTTTCAACGAGTGTAGT >_1 YSIT*LRCLLLLFSGSHSIVNKEYLHNYITVCSARL*MNITVSSRL*KNV*CLKHDKQNM G*YVLKASILPHNTINKTD*IKQ*L*H*MLPKLPIFSLFRFLLTCGLYITILIHGTNRAS LNLSVILMKKDIMFNRNTSSHFRLGLDTVLENN*LVWKCIFTWFRWFKSLSFFLTQMSLN CLTLKQGSNGPAFVPQMLILLLK*FDNHVFDCFFFNECS >_2 IA*HNFVASCYYFLGHIR**TKNIYIII*PYAQHDSK*T*PYPHDSKRTCNV*STTNKIW DNMC*RHPSYPTTPLTKLIR*NSNYDTECYQNFQFFLCLGFC*LVGCT*RS*YMGRTEQV *T*ASS**KRTLCSIETRHPIFGWA*TLCWRTTSSYGSVYLLGFDGSKV*VSS*PRCH*I A*H*NKVQMDQHSYPRC*YCC*SDLIITFSIAFFSTSV >_3 *HNITSLPLVIIFWVTFDSKQRIFT*LYNRMLSTTLNEHNRILTTLKERVMFKARQTKYG IICAKGIHLTPQHH*QN*LDKTVIMTLNVTKTSNFFSV*VSVNLWAVHNDPNTWDEPSKF KPERHLDEKGHYVQSKHVIPFSVGPRHCVGEQLARMEVYIYLVSMVQKFEFLPDPDVTEL PDIETRFKWTSIRTPDVDIVAKVI**SRFRLLFFQRV* >JWB1514.x1 >lcl|JWB1514.x1 CHROMAT_FILE: JWB1514.x1 PHD_FILE: JWB1514.x1.phd.1 CHEM: term DYE: ET TIME: Wed Mar 21 17:11:39 2001 TEMPLATE: JWB1514 DIRECTION: fwd AGAATGTTATGGGGATACGTTGGTTGGGATGGCGGGGCAACGATTTAATTACGTTCTGCGTTTCGCGCGGCGGAAAGCGA AGTCGTTATAACACGGGTGTTCTACGTTTGTAACTTTGTAGATTTACGTTTATATATAGTAGTGTGGAGGAAGATGGGAC ACTTTTTTATTCCATTTTATCATACCATTTAGTAGTAATCAAATAACATTCAAAGAATTATAAAACCGTATCCTCACGAC TCCCATAGACCGTTGTTAATTGTCTAAAACACGTTCAGGATATTTAGATATTATGGTTAAAGGTGTCCCATCTCCCCCCA TCCTACTACATAGCATAAATAAATTTCACTTATCTTTTTAGGACCGACAGCTTGTACATTACGTACGTGAACTCTTCAAA GCTGGCACTGAAACTTCTACGGGAACTCTAAGATGGGCGATGCTGTGTCTCATCCACTATCCTGAAGCACAGACGAAAAT TAGAAGTGAAATATATGATGTCTTAGGTAAGTGTAGTTGCAGAACGTAGTTTCGTAGTTAAAGCTAAAAAACAATAAAAA ACTGAATAAAATAATGAAACTGCTTGAAAATTAACGTAATAAAAACAGTGAAAATCGTAAAGCCTATATATACTTGATAT AGTAAATATTGTGCATTAGATAAAAATATTACAGTATGTTTTTTTTAGTAATTTTAGTAATGTGATCACAGTGAATTAGC AAAATTAACAAATGTTTTTC >CIONA SAVIGNYI SEQUENCE 71% TO CIONA INTESTINALIS seq 2 70% TO SEQ 4 This sequence carefully checked for contigiuity between exons This sequence is not hybrid between multiple genes MLQRMLNEINVSTSFIFLTVFLGLYYWYRRPKNFPPGPRGIPFLGVLPFLGNYPERKMRK WSNKYGPVMSVRMGRQDWVVLGDHETIQQ (0) GLVKHGNAFSGRPSIATIDQITEGHGVLFIDYNDHWKRQRRFGLSTLRG (2) FGVGKRSMEDRITEEVAYLNDAIRTHDGKAFDIQ (0) SILSNAVSNNICSIVMGRRFDYDDERFKEIMGRLARG (2) FNDPEASFVLQILIFMPALINFPYFSRINGELMEDVRVI (1) PELLREIVEEHKASYEQDNHRDFIDAFLGEQKAENGAKTFT (0) DTQLLQYVRDLFVAGTETTTSTVRWSLLCLIHNPETQEKLRKEIFEVL (1) GPEKIPAFENKSKMPYTSAFIQEIYRYRTLVPLSVTHMTNEDAHISGYTIPKGTT (0) IAPNLWAVHNDPEEWDEPNKFKPERHLDAGGNFVQLKHVIPFSVGPRHCLGEQLARMEVF IFLVSLVQKFEFLPDPKATVLPDIENGASGAAYVPLPFKIVAKVV* >cibd042f04_3 = seq 75% identical to seq 57 but not same seq old 57 had two genes joined that were different. May join seq 64 MLPAFLGSLTSNYVTFCLTGVCTLVLFVYYYWWKLPHPRYPPGVRGIPVLGALPFLGKFAHKDI MRWSREKYGPIMSVRFGQKDSVVLNDYESIYEAMVKQGPAFRSRPTMKLITSYSNGYGFG FAEGHTKYMELRHFTFKILRGFGIGGRYLEDRISDHAQELVQDFKKLDGKATDVR MIVATTIGNVIASIVLGKKYHPKDKDFQRHLQLILNN FGNEETASYILCMMYFPSLRHIPPFKNAWKTFMDEHFEQL DFCRKEIEEHKNNLNVNDPKDFVDAFLVEMKKHSPEGSWFH (0?) EESLILCVIDLFFGGTETSTSTVMWAMVVLINFPQIQEK GCiWno45_h10.g1 GCiWno1043_m04.b1 >sequence 64 1 accession 39% to 2J2 Length = 211 Score = 157 (55.3 bits), Expect = 6.7e-15, P = 6.7e-15 Identities = 31/39 (79%), Positives = 32/39 (82%) Query: 42 EESLILCVMDLFFXGTXNSTSTVMWXXXXLINFPQIQEK 80 EESLILCV+DLFF GT STSTVMW LINFPQIQEK Sbjct: 1 EESLILCVIDLFFGGTETSTSTVMWAMVVLINFPQIQEK 39 >GCiWno474_c04.b1_1 ANACIACRVVLLEDXXLLAVINNIIG*KCE*IKKQLKHLIFPDDSCNHHWKCYREYCSWK EISSKR*RFPTSSPANT*QVSYITVVHNTIFITFIILGFKGINDDRALYYTSCLITSYHI C*FYLRVRGTACKTTFKLFLCLVLETKKLQAIFYV*CIFHHCVIFHHSRTPGRRLWMSIL NNWVGSCNQVFDGFKIFPSLLKVFAGKRLKNTRITLM*MIPKILSMLSLLK*RNTYLKVH GSMYVVIKSKCWSWN*DLLIRXR*NPKLFKQLF*EESLILCVNGLVFWVEPXTAQAQ*CG XRXVLINFPQIQRNX >GCiWno474_c04.b1_2 QMLALPAGSYS*RXXPF*PL*ITLLVENVNK*KNS*NI*FSQMIVATTIGNVIASIVLGK KYHPKDKDFQRHLQLILNKLVI*P*YIIPFL*LLLSSVLRASTTTVLCIIPHA*LRVITY ANFISELEALRARQRLNYFFV*FWKRRNCKLYSMYDVFSIIASYSTIQERLEDVYG*AF* TTGWVLVTKCLMGLKYFPLY*RFLPERD*RTQE*P*CE*SQRFCRCFPC*NEETLT*RFM VPCML*LSPNAGLGIKTC*LEXDEIRNCSNNYFRKNLSFFV*MDLFFGWNPEQHKHSNVG RGXSLSTFHRYRET >GCiWno474_c04.b1_3 KCLHCLQGRTLRGXXPFSRYK*HYWLKM*INKKTVKTSNFPR**LQPPLEMLSRVLFLER NIIQKIKISNVISS*YLTS*LYNRST*YHFYNFYYPRF*GHQRRPCFVLYLMPDYELSHM LILSPS*RHCVQDNV*IISLFSFGNEETASYILCMMYFPSLRHIPPFKNAWKTFMDEHFE QLGGFL*PSV*WV*NISLFIEGFCRKEIEEHKNNLNVNDPKDFVDAFLVEMKKHLPEGSW FHVCCD*VQMLVLELRPAD*XKMKSETVQTIILGRISHSLCEWTCFLGGTXNSTSTVMWX EGCPYQLSTDTEK >sequence 57, 104 55% to seq 66 MFSTLLGSLALNYISTCLLGIFTLGVCMYYYWWKFPHPRYPPGVRGIPVLGALPF LSKFAHKDITRWSREKYGPIMSVRAGQTDSIFLNDYESIYEAMIKQGPAFRSRPAMKLIT AYSNGYGLGFSESHKKHSDLRQFSLKTLRGFGIGGRQLEDRISDIAQELVQAFEMLDGKATDVK MIVGKTVGNVIASIVLGKKFHGDDKDFQRHINLIFDS (2?) FGDEETAKYVLAMMYFPSLRH IPPFKNAWDQTLKGHFEQL (1) DFCRKEIEELKKTLDVNDPRGYVDAFLIEMKKHSPEDSWFH (0) EESLIVCVVDLFFAGTDTSTSTVMWAMVALLNFPEIQEKLHKEIANAT (1?) QIYSGEALPSLDHRDELPLLNAFIQELYRHMTLGPFGVPHETTTDAYIGGYCIPKNTR (0) VITNIWAVHYDPNTWENPSEFNIYRHIDEDGKFVPSKKVIPFGIGCRSCLGEKLARLE VFHFLANIIKRFEILPDPESKELPDYRDGVNGFVYVPYRFKLVAKPRIDNK* LQW137034.y1 heme opposite end = seq 104 not same gene (gene cluster?) LQW234676.y1 LQW43927.y1 2 diffs LQW59428.x1 LQW199443.y1 DEV44236.x1 N-TERM LQW192054.y1 N-TERM LQW192054.x1 wxxp to heme SEQUENCE 104 N-TERM TO KYG 34% TO 1A1 MFSTLLGSLALNYISTCLLGIFTIGVCMYYYWWKFPHQRYPPGVRGIPVLGALPFLSKFAHKDITRWSREKYG PIMSVRAGQTDSIFLNDYESIYEV (1) ggt DEV56294.y1 LQW137034.x1 N-term opposite end = seq 57 not same gene (gene cluster?) LQW225107.y1 >cibd002l18 Length = 683 Score = 208 bits (525), Expect = 2e-53 Identities = 96/96 (100%), Positives = 96/96 (100%) Frame = +2 Query: 1 MFSTLLGSLALNYISTCLLGIFTIGVCMYYYWWKFPHQRYPPGVRGIPVLGALPFLSKFA 60 MFSTLLGSLALNYISTCLLGIFTIGVCMYYYWWKFPHQRYPPGVRGIPVLGALPFLSKFA Sbjct: 26 MFSTLLGSLALNYISTCLLGIFTIGVCMYYYWWKFPHQRYPPGVRGIPVLGALPFLSKFA 205 Query: 61 HKDITRWSREKYGPIMSVRAGQTDSIFLNDYESIYE 96 HKDITRWSREKYGPIMSVRAGQTDSIFLNDYESIYE Sbjct: 206 HKDITRWSREKYGPIMSVRAGQTDSIFLNDYESIYE 313 >cibd063p18 Length = 709 Score = 103 bits (255), Expect = 2e-22 Identities = 49/52 (94%), Positives = 50/52 (95%) Frame = +2 Query: 1 MIVATTIGNVIASIVLGKKFHGDDKDFQRHINLIFDSFGDEETAKYVLAMMY 52 MIV T+GNVIASIVLGKKFHGDDKDFQRHINLIFDSFGDEETAKYVLAMMY Sbjct: 554 MIVGKTVGNVIASIVLGKKFHGDDKDFQRHINLIFDSFGDEETAKYVLAMMY 709 >cibd063p18 TCGGCACGAGGGAAATATGTTTTCCACATTGTTGGGGTCGTTGGCCCTTAATTACATCAGTACCTGTTTGCTCGGGATTT TCACCCTTGGTGTTTGCATGTACTATTACTGGTGGAAGTTTCCCCACCCACGGTACCCACCTGGGGTGAGGGGAATACCC GTGTTGGGGGCTTTACCCTTCCTTAGTAAATTTGCGCACAAAGACATTACGCGGTGGTCACGTGAGAAGTATGGACCTAT AATGTCTGTGCGGGCCGGACAAACTGATTCGATATTTTTAAACGATTATGAATCCATTTATGAGGCTATGATCAAACAAG GTCCAGCATTTCGATCACGTCCAGCCATGAAATTGATCACCGCTTACTCAAACGGCTACGGGCTTGGTTTTTCAGAGTCC CACAAGAAACATTCGGATCTGCGGCAATTTTCATTAAAGACGTTACGTGGGTTTGGCATTGGGGGTCGACAGTTGGAAGA CCGCATCTCAGATATTGCACAGGAACTTGTTCAAGCCTTTGAAATGTTAGATGGAAAAGCAACGGACGTAAAGATGATTG TTGGAAAGACCGTTGGAAATGTTATCGCGAGTATTGTTCTCGGAAAAAAGTTTCATGGAGACGATAAAGACTTCCAGCGT CACATTAACCTCATATTTGACAGCTTTGGGGACGAAGAAACTGCGAAGTACGTTCTAGCTATGATGTAT RHEGNMFSTLLGSLALNYISTCLLGIFTLGVCMYYYWWKFPHPRYPPGVRGIPVLGALPF LSKFAHKDITRWSREKYGPIMSVRAGQTDSIFLNDYESIYEAMIKQGPAFRSRPAMKLIT AYSNGYGLGFSESHKKHSDLRQFSLKTLRGFGIGGRQLEDRISDIAQELVQAFEMLDGKA TDVK MIVGKTVGNVIASIVLGKKFHGDDKDFQRHINLIFDSFGDEETAKYVLAMMY >cibd039c06 Length = 705 Score = 108 bits (266), Expect(2) = 5e-41 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = +1 Query: 70 VLNAVFFKDFCRKEIEELKKTLDVNDPRGYVDAFLIEMKKHSPEDSWFH 118 VLNAVFFKDFCRKEIEELKKTLDVNDPRGYVDAFLIEMKKHSPEDSWFH Sbjct: 217 VLNAVFFKDFCRKEIEELKKTLDVNDPRGYVDAFLIEMKKHSPEDSWFH 363 >cibd039c06 GGAAAAAGTTTCATGGAGACGATAAAGACTTCCAGCGTCACATTAACCTCATATTTGACAGCTTTGGGGACGAAGAAACT GCGAAGTACGTTCTAGCTATGATGTATTTTCCATCATTGCGTCATATTCCACCATTTAAAAACGCTTGGGATCAGACTCT AAAGGGCCATTTTGAACAACTTGGTGAGTTCTTTTGAGTAACGGAATGTTTGATAAGTTTTAAACGCTGTTTTTTTTAAA GATTTTTGTCGGAAAGAGATTGAAGAACTGAAGAAGACCCTTGATGTAAATGATCCCAGAGGTTATGTCGATGCTTTCCT TATTGAGATGAAGAAACACTCTCCTGAAGACTCATGGTTCCATGAAGAATCTCTCATCGTTTGTGTGGTTGACCTATTTT TTGCTGGGACAGATACGAGCACAAGCACAGTAATGTGGGCGATGGTTGCCCTTCTAAACTTTCCAGAGATACAAGAGAAA CTTCATAAAGAAATAGCCAATGCAACAGGTGTGTTGGGTGAGTTCTTATTCCAATTCTTTAACAAATTTACTCAGGTGAA GCACTTCCAAGTTTGGACCACAGGGATGAACTTCCATTACTCAACGCTTTTATTCAAGAACTTTACCGCCACATGACCCT TGGACCCTTTGGTGTTCCGCACGAAACCACAACCGATGCGTACATTGGCGGATACTGTATCCCTA >_1 GKSFMETIKTSSVTLTSYLTALGTKKLRSTF*L*CIFHHCVIFHHLKTLGIRL*RAILNN LVSSFE*RNV**VLNAVFFKDFCRKEIEELKKTLDVNDPRGYVDAFLIEMKKHSPEDSWF HEESLIVCVVDLFFAGTDTSTSTVMWAMVALLNFPEIQEKLHKEIANATGVLGEFLFQFF NKFTQVKHFQVWTTGMNFHYSTLLFKNFTAT*PLDPLVFRTKPQPMRTLADTVSL >_2 EKVSWRR*RLPASH*PHI*QLWGRRNCEVRSSYDVFSIIASYSTI*KRLGSDSKGPF*TT W*VLLSNGMFDKF*TLFFLKIFVGKRLKN*RRPLM*MIPEVMSMLSLLR*RNTLLKTHGS MKNLSSFVWLTYFLLGQIRAQAQ*CGRWLPF*TFQRYKRNFIKK*PMQQVCWVSSYSNSL TNLLR*STSKFGPQG*TSITQRFYSRTLPPHDPWTLWCSARNHNRCVHWRILYP >_3 KKFHGDDKDFQRHINLIFDSFGDEETAKYVLAMMYFPSLRHIPPFKNAWDQTLKGHFEQL GEFF*VTECLISFKRCFF*RFLSERD*RTEEDP*CK*SQRLCRCFPY*DEETLS*RLMVP *RISHRLCG*PIFCWDRYEHKHSNVGDGCPSKLSRDTRETS*RNSQCNRCVG*VLIPIL* QIYSGEALPSLDHRDELPLLNAFIQELYRHMTLGPFGVPHETTTDAYIGGYCIP >rcibd039c06 TAAATGAACCGATAAAAGATACCGAAAACATAAATCAATTTATATAACGCCTAGTACAATTATATAGCCATGATACAGGT TATATTCTTTCAAAAAATTGTGCCGACCTTACAACAATACTGGCATCATCGCTGCTACCTTCAATTACTCCGTTTGTTCT CAAACAAAAAACAAGAAAGAGAGTAACAAAAAAACACGAATACGCGATATCTTAAACTTGCTATATGTTGTTTGGATTAA AATAGGCGGCATCATTCGGAAATACTGGTGATGCATTCGGAAATGTGTGTGACATCACAAATGAATGTTACATCACACAG AAAAACGGAAAAGGATCAATAATACATCTACATTTGTTAGAATAGTTTAATATCAGTGGCGGCTGGCGGATTTTGTATTC ACAGGAACATAATACACCGCCTGTGCTTTATATGAGGTTATAGTACATATGACGTCTATAACGTGACAGTATTATTTGTT GTCGATTCTCGGTTTAGCAACAAGTTTAAAGCGATAGGGGACATAAACAAAACCATTGACACCATCTCTATAGTCGGGAA GCTCCTTGCTCTCTGGATCAGGAAGGATCTCGAACCTCTTAATGATGTTGGCAAGGAAGTGGAAGACTTCAAGCCTTGCC AGCTTCTCACCAAGACACGATCTGCATCCGATTCCAAACGGGATCACTTTCTTCGAAGGAACGAACTTTCCGTCTTCGTC AATATGACGATAAATGTTGAACTCACT SEFNIYRHIDEDGKFVPSKKVIPFGIGCRSCLGEKLARLEVFHFLANIIKRFEILPDPES KELPDYRDGVNGFVYVPYRFKLVAKPRIDNK* ciad062j09 : 3'EST / 5'EST ciad099k01 : 3'EST / 5'EST cibd002l18 : 3'EST / 5'EST cibd004l10 : 3'EST / 5'EST cibd020g22 : 3'EST / 5'EST cibd022h14 : 3'EST / 5'EST cibd038c06 : 3'EST / 5'EST cibd038i10 : 3'EST / 5'EST cibd039c06 : 3'EST / 5'EST cibd063p18 : 3'EST / 5'EST cibd073g04 : 3'EST / 5'EST cibd078j24 : 3'EST / 5'EST cicl036p20 : 3'EST / 5'EST cicl048e11 : 3'EST / 5'EST cicl067e03 : 3'EST / 5'EST cicl093d07 : 3'EST / 5'EST cigd037i10 : 3'EST / 5'EST >DEV44236.x1 >lcl|DEV44236.x1 CHROMAT_FILE: DEV44236.x1 PHD_FILE: DEV44236.x1.phd.1 CHEM: term DYE: ET TIME: Wed Mar 21 15:15:16 2001 TEMPLATE: DEV44236 DIRECTION: fwd TTCGCTTACTTTAATCCTTGGTCGTGTCTGAAACGCTGGGCCTTGTTTGACCAAAGCCTATATGGCAAGTTTTTTGTTAC ATATAGTAGGATGGGGTAATACGGGACACCCTTAGCAAATAATACCCAAATATTCTGAACGTGTGTTAAATAATTAACAA CAGTCTATGGGAATCATGAGAATACGGATTTATATTTATTTGGATGTTCTTTGTTTACTGCCAAATGGGACAAGAACGAA AACGTGTCCCGTCTTCCCCTACCCGACTATAATCGTAATCCCGTCTTCCCCTAAACCAACCTCATAAATGGATTCATAAT CGTTCAAAACAACCGAATCCTTTTGCCCGAACCTCACAGACATTATAGGTCCATACTTCTCACGTGACCACCGCATGATC ACCTTATGCGCAGATTTACCGAGAAAGGGTAAAGCCCCCAACACGGGTATTCCCCTTACCCCAGGTGGGTACCGTGGGTG GGGCAACTTCCACCAGTAATAATACACAAACAAAACAAGGGTAAAAAACCCGGTTAAACAGAAAGTGACGTAATTAGAGG TCAACGACCCCAAAAATGCGGGAAGCATAATTTTGAATACTGTTG >DEV44236.x1_4 TVFKIMLPAFLGSLTSNYVTFCLTGFFTLVLFVYYYWWKLPHPRYPPGVRGIPVLGALPF LGKSAHKVIMRWSREKYGPIMSVRFGQKDSVVLNDYESIYEVGLGEDGITIIVG*GKTGH VFVLVPFGSKQRTSK*I*IRILMIPIDCC*LFNTRSEYLGIIC*GCPVLPHPTICNKKLA I*ALVKQGPAFQTRPRIKVSE >DEV44236.x1_5 NSIQNYASRIFGVVDL*LRHFLFNRVFYPCFVCVLLLVEVAPPTVPTWGKGNTRVGGFTL SR*ICA*GDHAVVT*EVWTYNVCEVRAKGFGCFERL*IHL*GWFRGRRDYDYSRVGEDGT RFRSCPIWQ*TKNIQININPYSHDSHRLLLII*HTFRIFGYYLLRVSRITPSYYM*QKTC HIGFGQTRPSVSDTTKD*SKRX >DEV44236.x1_6 QQYSKLCFPHFWGR*PLITSLSV*PGFLPLFCLCIITGGSCPTHGTHLG*GEYPCWGLYP FSVNLRIR*SCGGHVRSMDL*CL*GSGKRIRLF*TIMNPFMRLV*GKTGLRL*SGRGRRD TFSFLSHLAVNKEHPNKYKSVFS*FP*TVVNYLTHVQNIWVLFAKGVPYYPILLYVTKNL PYRLWSNKAQRFRHDQGLK*AX This walks down 428bp LQW259693.x1 LQW259693.x1.phd.1 LQW259693.y1 12:41:14 2001 TEMPLATE: LQW259693 DIRECTION: fwd Length = 991 Score = 177 bits (410), Expect = 2e-44 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = -3 Query: 1 TVVNYLTHVQNIWVLFAKGVPYYPILLYVTKNLPYRLWSNKAQRFRHDQGLK 52 TVVNYLTHVQNIWVLFAKGVPYYPILLYVTKNLPYRLWSNKAQRFRHDQGLK Sbjct: 584 TVVNYLTHVQNIWVLFAKGVPYYPILLYVTKNLPYRLWSNKAQRFRHDQGLK 429 >LQW259693.x1 >lcl|LQW259693.x1 CHROMAT_FILE: LQW259693.x1 PHD_FILE: LQW259693.x1.phd.1 CHEM: term DYE: ET TIME: Fri Aug 31 12:41:14 2001 TEMPLATE: LQW259693 DIRECTION: fwd GCGGCACCGATCCTCGAACGAGAGCGCGCAGTGCAGCTGNTGGGACTTCACTTTANCAATATAGAATAAAATGTGCATAT ACTATGTAGGGCTATAATGGGCTAATTCTGGTCTAATTCACCAGTTCCATGGCATTCCTTGCTGTGGGAATTTACTTTAN CAATATAGAATAAAATGTGCATATACTATGTTGGGCGAATTCTGGCATAAATCCCAGGTCCCATGGCATACCTTTCTGTG GGACTTTACCAATATAAAATAAAATGTGCATATGCTATGTTGGGCTATAATAGGCTAATTCTGGTAATTCCCAGACCACT TAAACACTCACCCACGTAATGCTTTTCCAGTAAAATGTCGAACCTGCATAAATTTCTTATGTCCCGCTGCAAAACCAAAC CCGTAGCCATTGCTGTGGGCTTCGATTACTTTAATCCTTGGTCGTGTCTGAAACGCTGGGCCTTGTTTGACCAAAGCCTA TATGGCAAGTTTTTTGTTACATATAGTAGGATGGGGTAATACGGGACACCCTTAGCAAATAATACCCAAATATTCTGAAC GTGTGTTAAATAATTAACAACAGTCTATGGGAATCATGAGAATACGGATTTATATTTATTTGGATGTTCTTTGTTTACTA CCAAATGGGACAAGAACGAAAACGTGTCCCGTCTTCACCTACCCGACTATAATCGTAATCCCGTCTTCCCCTTANCCANC TCATAAATGGATCATAATCGTTCANACAACGAATCCCTTCCCGAACTTAAGACTTATAGTCATACTCTCAGTGACACGNA TGATCACTATGGCAGATTACGAGAAGGTTAAGGCTAAACGGTATTCCTAACCAGTGTACGGGCTGGGCATTCACGCATAT ACAACACACGGTAACCGGTAAGATGGTTCTAGGCGACCATGTGCAATTTTTGGCAACGCTTGAAATACCACAAATCTTAG CGGATTTAGGAGAACATGCGGAATAGTAATG >_4 ITIPHVLLNPLRFVVFQALPKIAHGRLEPSYRLPCVVYA*MPSPYTG*EYRLALTFS*SA IVIXRVTESMTISLKFGKGFVV*TIMIHL*XG*GEDGITIIVG*VKTGHVFVLVPFGSKQ RTSK*I*IRILMIPIDCC*LFNTRSEYLGIIC*GCPVLPHPTICNKKLAI*ALVKQGPAF QTRPRIKVIEAHSNGYGFGFAAGHKKFMQVRHFTGKALRG*VFKWSGNYQN*PIIAQHSI CTFYFILVKSHRKVCHGTWDLCQNSPNIVYAHFILYX*SKFPQQGMPWNW*IRPELAHYS PT*YMHILFYIXKVKSXQLHCALSFEDRCR >_5 HYYSACSPKSAKICGISSVAKNCTWSPRTILPVTVCCICVNAQPVHWLGIPFSLNLLVIC HSDHXCH*EYDYKS*VREGIRCXNDYDPFMXWXRGRRDYDYSRVGEDGTRFRSCPIW**T KNIQININPYSHDSHRLLLII*HTFRIFGYYLLRVSRITPSYYM*QKTCHIGFGQTRPSV SDTTKD*SNRSPQQWLRVWFCSGT*EIYAGSTFYWKSITWVSV*VVWELPELAYYSPT*H MHILFYIGKVPQKGMPWDLGFMPEFAQHSICTFYSILXK*IPTARNAMELVN*TRISPL* PYIVYAHFILYX*SEVPXAALRALVRGSVPX >_6 LLFRMFS*IR*DLWYFKRCQKLHMVA*NHLTGYRVLYMRECPARTLVRNTV*P*PSRNLP **SXVSLRV*L*VLSSGRDSLXERL*SIYEXXKGKTGLRL*SGR*RRDTFSFLSHLVVNK EHPNKYKSVFS*FP*TVVNYLTHVQNIWVLFAKGVPYYPILLYVTKNLPYRLWSNKAQRF RHDQGLK*SKPTAMATGLVLQRDIRNLCRFDILLEKHYVGECLSGLGITRISLL*PNIAY AHFILYW*SPTERYAMGPGIYARIRPT*YMHILFYIXKVNSHSKECHGTGELDQN*PIIA LHSICTFYSILXK*SPXSCTARSRSRIGAA >_4 CFPY*DEETLS*RLMVPCKLGS*DFFSGT*ELYFNTFMYPNANTFIIALKWALDLYTLLR YHLKLFKLSFQEESLIVCVVDLFFAGTDTSTSTVMWAMVALLNFPEIQEKLHKEIANATG VLGEFLFQFFNKFTQVKHFQVWTTGMNFHYSTLLFKNFTAT*PLDPLVFRTKPQPMRTLA DTVSLKIQGYVQLHTLLSSVKHVMLMNFASGDNKHLGCALRA >_5 MLSLLR*RNTLLKTHGSM*VRKLRFFFRYLRTLF*YLYVS*CKHLYYSIKMGP*FIYASQ IPSETV*TFISGRISHRLCG*PIFCWDRYEHKHSNVGDGCPSKLSRDTRETS*RNSQCNR CVG*VLIPIL*QIYSGEALPSLDHRDELPLLNAFIQELYRHMTLGPFGVPHETTTDAYIG GYCIPKNTRVCTTTYSLIQC*TCHVDEFCIR**QTSGLCTTSX >_6 DAFLIEMKKHSPEDSWFHVS*EVKIFFQVLKNFILIPLCILMQTPLL*H*NGPLIYIRFS DTI*NCLNFHFRKNLSSFVWLTYFLLGQIRAQAQ*CGRWLPF*TFQRYKRNFIKK*PMQQ VCWVSSYSNSLTNLLR*STSKFGPQG*TSITQRFYSRTLPPHDPWTLWCSARNHNRCVHW RILYP*KYKGMYNYILSYPVLNMSC**ILHQVITNIWAVHYEL DEV37556.y1 CHEM: term DYE: ET TIME: Wed Mar 21 16:13:40 2001 TEMPLATE: DEV37556 DIRECTION: rev Length = 682 Score = 246 bits (571), Expect = 1e-64 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +1 Query: 1 ELYFNTFMYPNANTFIIALKWALDLYTLLRYHLKLFKLSFQEESLIVCVVDLFFAGTDTS 60 ELYFNTFMYPNANTFIIALKWALDLYTLLRYHLKLFKLSFQEESLIVCVVDLFFAGTDTS Sbjct: 463 ELYFNTFMYPNANTFIIALKWALDLYTLLRYHLKLFKLSFQEESLIVCVVDLFFAGTDTS 642 Query: 61 TSTVMWAMVALLN 73 TSTVMWAMVALLN Sbjct: 643 TSTVMWAMVALLN 681 >DEV37556.y1_1 YLRYSISYSIMCHHNNLNHNCC*DVYDAIAGYTFNNVSMFSFGDEETAKYVLAMMYFPSL RHIPPFKNAWDQTLKGHFEQLGEFF*VTECLISFKRCFF*RFLSERD*RTEEDP*CK*SQ RLCRCFPY*DEETLS*RLMVPCKLGS*DFFSGT*ELYFNTFMYPNANTFIIALKWALDLY TLLRYHLKLFKLSFQEESLIVCVVDLFFAGTDTS >DEV37556.y1_2 TYVTALATP*CVITIILTIIVVKMSMMLLRDTRLIMFQCLALGTKKLRSTF*L*CIFHHC VIFHHLKTLGIRL*RAILNNLVSSFE*RNV**VLNAVFFKDFCRKEIEELKKTLDVNDPR GYVDAFLIEMKKHSPEDSWFHVS*EVKIFFQVLKNFILIPLCILMQTPLL*H*NGPLIYI RFSDTI*NCLNFHFRKNLSSFVWLTYFLLGQIR >DEV37556.y1_3 LTLQH*LLHNVSSQ*S*P*LLLRCL*CYCGIHV**CFNV*LWGRRNCEVRSSYDVFSIIA SYSTI*KRLGSDSKGPF*TTW*VLLSNGMFDKF*TLFFLKIFVGKRLKN*RRPLM*MIPE VMSMLSLLR*RNTLLKTHGSM*VRKLRFFFRYLRTLF*YLYVS*CKHLYYSIKMGP*FIY ASQIPSETV*TFISGRISHRLCG*PIFCWDRYE This seq extends it back about 300 bp more LQW243792.x1 LQW243792.x1.phd.1 LQW243792.y1 12:04:53 2001 TEMPLATE: LQW243792 DIRECTION: fwd Length = 747 Score = 169 bits (390), Expect = 1e-41 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +2 Query: 11 MCHHNNLNHNCC*DVYDAIAGYTFNNVSMFSFGDEETAKYVLAMMYFPSL 60 MCHH NLNHNCC*DVYDAIAGYTFNNVSMFSFGDEETAKYVLAMMYFPSL Sbjct: 302 MCHHKNLNHNCC*DVYDAIAGYTFNNVSMFSFGDEETAKYVLAMMYFPSL 451 >LQW243792.x1 >lcl|LQW243792.x1 CHROMAT_FILE: LQW243792.x1 PHD_FILE: LQW243792.x1.phd.1 CHEM: term DYE: ET TIME: Mon Aug 27 12:04:53 2001 TEMPLATE: LQW243792 DIRECTION: fwd NGGCGCTTTGGGCAAACACCTGATATTTCACAGATGATTGTTGGAAAGACCGTTGGAAATGTTGTCGCGAGTATTGTTCT CGGGAAAAAGTTCATCGAGACGATAAAGACTTCCAGCGTCACATTAACCTCATATTTGACAGGTAAATCATAAGCATAGC CTATATATTAGCAATGTGTTTAATGAATGTAACTTAGTTTATGCTTGTGTGGGAGTCAACGACAGTTTGACACACTTTGT GCTTGCTTACGTTACAGCATTAGTTACTTTACTTCTGAGTTAGATACAGGCGTTTCACTCAATGTGTCATCACAAAAATC TTAACCATAATTGTTGTTAAGATGTCTATGATGCTATTGCGGGATACACGTTTAATAATGTTTCAATGTTTAGCTTTGGG GACGAAGAAACTGCGAAGTACGTTCTAGCTATGATGTATTTTCCATCATTGCGTCATATTCCACCATTTAAAAACGCTTG GGATCAGACTCTAAAGGGCCATTTTGAGCAACTTGGTGAGTTCTTTTGAGTAACCGAATGTTTGATGAGTTTTAAACGCT GTTTTTTTCAAGATTTTTGTCGGAAAGAGATTGAAGAACTGAAGAAGCACCTTGATGTGAATGATCCCAGAGGTTATGTC GATGCTTTCCTTATTGAGATGAAGAAACACTCTCCTGAAGACTCATGGTTCCATGCTAGTTAGGAAGTTAAGATTTTTTC AGGTACTTAGAACTTTTTTCATACCTT >LQW243792.x1_1 XRFGQTPDISQMIVGKTVGNVVASIVLGKKFIETIKTSSVTLTSYLTGKS*A*PIY*QCV **M*LSLCLCGSQRQFDTLCACLRYSISYFTSELDTGVSLNVSSQKS*P*LLLRCL*CYC GIHV**CFNV*LWGRRNCEVRSSYDVFSIIASYSTI*KRLGSDSKGPF*ATW*VLLSNRM FDEF*TLFFSRFLSERD*RTEEAP*CE*SQRLCRCFPY*DEETLS*RLMVPC*LGS*DFF RYLELFSYL >LQW243792.x1_2 GALGKHLIFHR*LLERPLEMLSRVLFSGKSSSRR*RLPASH*PHI*QVNHKHSLYISNVF NECNLVYACVGVNDSLTHFVLAYVTALVTLLLS*IQAFHSMCHHKNLNHNCC*DVYDAIA GYTFNNVSMFSFGDEETAKYVLAMMYFPSLRHIPPFKNAWDQTLKGHFEQLGEFF*VTEC LMSFKRCFFQDFCRKEIEELKKHLDVNDPRGYVDAFLIEMKKHSPEDSWFHAS*EVKIFS GT*NFFHT >LQW243792.x1_3 ALWANT*YFTDDCWKDRWKCCREYCSREKVHRDDKDFQRHINLIFDR*IISIAYILAMCL MNVT*FMLVWESTTV*HTLCLLTLQH*LLYF*VRYRRFTQCVITKILTIIVVKMSMMLLR DTRLIMFQCLALGTKKLRSTF*L*CIFHHCVIFHHLKTLGIRL*RAILSNLVSSFE*PNV **VLNAVFFKIFVGKRLKN*RSTLM*MIPEVMSMLSLLR*RNTLLKTHGSMLVRKLRFFQ VLRTFFIP >chromat_dir/hrs/G126P60609F.T0/G126P60609FE9.T0.scf Length = 755 Minus Strand HSPs: Score = 172 (60.5 bits), Expect = 7.4e-13, P = 7.4e-13 Identities = 31/44 (70%), Positives = 36/44 (81%), Frame = -1 Query: 6 FFKDFCRKEIEELKKTLDVNDPRGYVDAFLIEMKKHSPEDSWFH 49 FF DF RKEIEE +K LD N+P ++DAFLIEMKKHSP+ SWFH Sbjct: 275 FFPDFNRKEIEEHEKNLDENEPADFIDAFLIEMKKHSPDTSWFH 144 >chromat_dir/hrs/G126P60609F.T0/G126P60609FE9.T0.scf AGCATTGGCGTACTGAATCCATCGTCCTGTGGTGGAATCTTTAAAAGTAT TTTACCGTGGTATAACCGATGAGCATATACTAGTTCTTAGAATGTACAGC TTTTTTGTATTATGTTAAGTATTATGTTAGCATAATCGCTTACATGAAAC CAGGAAGTGTCGGGCGAATGTTTCTTCATCTCAATAAGAAAAGCATCGAT GAAATCTGCTGGTTCGTTTTCGTCCAGATTCTTTTCGTGCTCTTCGATCT CCTTGCGATTAAAATCTGGAAAAAACGAAAAAATATTTTTAAATGCTATA ACTTGAAGAAAATATGGAGCCAATTGTTTGAAATATAGTACAGTCCTACC TAGACTGATTAGCTTGATGGGTCATTGAACGGCTTATCCACCCAATGGTA TAGATTGGAAACTGGTCGCTATAGCTTGTAGGTTGTGTGATGGGCAAGGC ATTGAGCGCACATCGCCAACGAATGGGCTCTACTACAATTTAAGGAATGA CTTAATCATCTCCAGCAACCCGACGGTGAGTGTAAGGTAATCTGACGATT GCACGTATGATAACACCCTTTGCACTTTCCCATTCACCGGGATAAACATG AATATCCTATGAGCTTATAAGATGCATCGTATCCTTAGTATCTAAATTAA AGAGTTCGATTTTTTTGATTCGCCACTTTTTTCCTAACTATTTAAAACAT GCCTAACCGTAACTCCTGTGTACAAGCATAAAATTGTCCAACCTATAAGC CCTTG >chromat_dir/hrs/G126P60609F.T0/G126P60609FE9.T0.scf_4 RAYRLDNFMLVHRSYG*ACFK*LGKKWRIKKIELFNLDTKDTMHLISS*DIHVYPGEWES AKGVIIRAIVRLPYTHRRVAGDD*VIP*IVVEPIRWRCALNALPITQPTSYSDQFPIYTI GWISRSMTHQANQSR*DCTIFQTIGSIFSSSYSI*KYFFVFSRF*SQGDRRARKESGRKR TSRFHRCFSY*DEETFARHFLVSCKRLC*HNT*HNTKKLYILRTSICSSVIPR*NTFKDS TTGRWIQYANA >chromat_dir/hrs/G126P60609F.T0/G126P60609FE9.T0.scf_5 KGL*VGQFYACTQELRLGMF*IVRKKVANQKNRTL*FRY*GYDASYKLIGYSCLSR*MGK CKGCYHTCNRQITLHSPSGCWR*LSHSLNCSRAHSLAMCAQCLAHHTTYKL*RPVSNLYH WVDKPFNDPSS*SV*VGLYYISNNWLHIFFKL*HLKIFFRFFQILIARRSKSTKRIWTKT NQQISSMLFLLR*RNIRPTLPGFM*AIMLT*YLT*YKKAVHSKN*YMLIGYTTVKYF*RF HHRTMDSVRQCX >chromat_dir/hrs/G126P60609F.T0/G126P60609FE9.T0.scf_6 QGLIGWTILCLYTGVTVRHVLNS*EKSGESKKSNSLI*ILRIRCIL*AHRIFMFIPVNGK VQRVLSYVQSSDYLTLTVGLLEMIKSFLKL**SPFVGDVRSMPCPSHNLQAIATSFQSIP LGG*AVQ*PIKLISLGRTVLYFKQLAPYFLQVIAFKNIFSFFPDFNRKEIEEHEKNLDEN EPADFIDAFLIEMKKHSPDTSWFHVSDYANIILNIIQKSCTF*ELVYAHRLYHGKILLKI PPQDDGFSTPML >SEQUENCE 74, 39 60 SVQDIVGFFSDLFIAGTETLSSQLRWGFLIMMLNPECQENVRNEIHAVIG (1) NGRARLSDRYRMPYTCAVIQEIFRFRTLGALSLPRTNVVDVEIEGCKIPKGSK VILNTWAIHNDERNWENPQKFIPERHLDKDGNFINSKKVLPFSVGVRSCLGE QLARAEIFLFFVATLQQFE LKFDPNAQVPSLDDASNGVIFSPNPYTMIAERINEDRSNNNNNSKVI* LQW105435.x1 LQW186247.y1 LQW256880.x1 GCiWno748_p03.b1 GCiWno1016_m15.g1 GCiWno563_p14.b1 >GCiWno563_p14.b1_1 WDGYF*HIISHIS*LCF*QVTALF*SSQDALI*FCEFFCLLRIERYKRMKTSTLYNSVKF I*KPRNLQVILNTWAIHNDERNWENPQKFIPERHLDKDGNFINSKKVLPFSVGVRSCLGE QLARAEIFLFFVATLQQFGKMGHL*HITSKYPDRVLNN*QRSVEVLRIRFYNSLNVLCLL PNGTRK*NEKVSHLPHPTIP*IFVYII**NIHV*VTLL*TYK*HIIIIQKCFPQRKPLPF VLFKCI*TLPIPCSHISN*KLACXHLEVTF*AVLIKIGSGFHFLRKX >GCiWno563_p14.b1_2 GMDTFST*YPIFPNCAFNRSLRFFRVVRMR*YNFVNFFVYYESNGIRE*KRRLYTTV*NL YRNLVICRLF*TLGQSIMMKEIGRILRNSSQSDTWTKMEILSIRKRFCRLVLGFVHVSVN NLPAQKSFFSLSPLYNSLERWDTFST*HQNILIVF*TINNGLWKS*GYGFIIL*MFFVYY QMGRENRMKRCPIFPTLLYHEFSFI*SDEIFMCK*HYYELINNILL*FRSVFPSENLYLL FCLNVYKPYPSHAVI*AIRSSRVXIWK*RFKLC*LKSEVAFIFCVN >GCiWno563_p14.b1_3 GWILLAHNIPYFLTVLLTGHCAFLE*SGCVDIIL*IFLFTTNRTV*ENENVDFIQQCKIY IETS*FAGYFKHLGNP***KKLGESSEIHPRATLGQRWKFYQFEKGFAV*CWGSFMSR*T TCPRRNLSFLCRHFTTVWKDGTPLAHNIKIS*SCFKQLTTVCGSPEDTVL*FFKCSLFTT KWDEKIE*KGVPSSPPYYTMNFRLYNLMKYSCVSDIIMNL*ITYYYNSEVFSPAKTSTFC FV*MYINPTHPMQSYKQLEARVXSFGSDVLSCVN*NRKWLSFFA* >GCiWno748_p03.b1_4 YL*LTERPF*PIDTGRDSLSKTLXAVVPPPFVGIHKRTLGV*NRPPCLYCRFPANQGXSK LYSFIYKSLFRILSDSSPICSSLVQKPFLPNYDGVSLS*CLTRNAKKMLGMKYTLS*VIL SFFLTYKKQDTQHVI*VMLLFGPPCKDKEVTLI**KTYFIHNLCYNGG*LPPREVK*VLL IRYPILYTGGN GRARLSDRYRMPYTCAVIQEIFRFRTLGALSLPRTNVVDVEIEGCKIPK GSKVMVVLLSVCSRVGENGTPFQFIFSSHLVVNKEHSKSYKTVFSRLQ*NV >GCiWno748_p03.b1_5 LFVTDRAPILAHRHRSRLLEQDVXGSCPTPLCWYS*ANTRCLKQTTVFILSFSR*SRRXQ VIFLHL*VSVQDIVGFFSDLFIAGTETLSSQLRWGFLIMMLNPECQENVRNEIHAVIGNS IVFSYI*KTGHSACYISYAVIWPAMQG*RSNINLMKNLFYTQLVL*WWLIAATRG*ISSI DSIPDSIHRRKWKSAAFRSLPYALHMRGDSRNISFPNVGSFESSTNECC*R*D*RM*DSE RLEGNGCFIKCMQ*GGGKWDTFSVYFLVPFGSKQGTFKEL*NRILTAPIERX >GCiWno748_p03.b1_6 ICD*QSAHSSP*TQVETP*ARRXRQLSHPPLLVFISEH*VFETDHRVYTVVFPLIKEXAS YIPSFISLCSGYCRILLRFVHRWYRNPFFPTTMGFPYHDA*PGMPRKC*E*NTRCHR*FY RFFLHIKNRTLSMLYKLCCYLARHARIKK*H*FNEKPILYTTCVIMVVNCRHARLNKFY* FDTRFYTQEEMEERGFQIATVCLTHAR*FKKYFVSERWEL*VFHERMLLTLRLKDVRFRK ARR*WLFY*VYAVGWGKMGHLFSLFSRPIW**TRNIQRVIKPYSHGSNRTX >GCiWno748_p03.b1 AACGTTCTATTGGAGCCGTGAGAATACGGTTTTATAACTCTTTGAATGTTCCTTGTTTACTACCAAATGGGACGAGAAAA TAAACTGAAAAGGTGTCCCATTTTCCCCCACCCTACTGCATACACTTAATAAAACAACCATTACCTTCGAGCCTTTCGGA ATCTTACATCCTTCAATCTCAACGTCAACAACATTCGTTCGTGGAAGACTCAAAGCTCCCAACGTTCGGAAACGAAATAT TTCTTGAATCACCGCGCATGTGTAAGGCATACGGTAGCGATCTGAAAGCCGCGCTCTTCCATTTCCTCCTGTGTATAGAA TCGGGTATCGAATCAATAGAACTTATTTAACCTCGCGTGGCGGCAATTAACCACCATTATAACACAAGTTGTGTATAAAA TAGGTTTTTCATTAAATTAATGTTACTTCTTTATCCTTGCATGGCGGGCCAAATAACAGCATAACTTATATAACATGCTG AGTGTCCTGTTTTTTATATGTAAGAAAAAACGATAGAATTACCTATGACAGCGTGTATTTCATTCCTAACATTTTCTTGG CATTCCGGGTTAAGCATCATGATAAGGAAACCCCATCGTAGTTGGGAAGAAAGGGTTTCTGTACCAGCGATGAACAAATC GGAGAAGAATCCGACAATATCCTGAACAGAGACTTATAAATGAAGGAATATAACTTGCTNTCTCCTTGATTAGCGGGAAA ACGACAGTATAAACACGGTGGTCTGTTTCAAACACCTAGTGTTCGCTTATGAATACCAACAAAGGGGGGTGGGACAACTG CCGNTAACGTCTTGCTCAAGGAGTCTCGACCTGTGTCTATGGGCTAGAATGGGCGCTCTGTCAGTCACAAATAA sequence 39, 60 2 accessions 52% to 2R1 probably = seq 39 VILNTWAIHNDERNWENPQKFLPERHLDKQGNF INSKKVLPFSVGVRSCLGEQLARAEIFLFFVATLQQFE LKFDPNAQVPSLDDASNGVIFSPNPYTMIAERINEDRSNNNNNSKVI* LQW167430.x1 DEV14425.y1 GCiWno563_p14.b1 LQW263277.y1 rcilv084c12 >rcilv084c12 ATATGAAAGCGTTATGCGAAGGCGTATTTTAACTGTGCAGAAATTTGCAGCATTACAGTTCTACAAGATATCACGTTATT AAAAACACACACTCTGTCTAGCGTTGTGCTGGCTTACATTTTATATGATTTACACCTTAATAAAAAAATTCAGGATTCTT TGCTCAATACTGCCACCTTTTATGCTGGACATATAGGTCATCAGGCAGACTAGAAAAGTAATATTTGATCCTCACAAACC AACTAATTCTAATATAAAATAAACATGTCTACACAAACCAGCATGTATATAAAATCACGTCTAAGTTAGATGACTTTAGA ATTGTTATTATTGTTACTCCTATCTTCGTTTATGCGTTCGGCAATCATAGTATAAGGATTCGGGGAAAATATAACACCGT TGGATGCATCATCTAAGCTGGGGACTTGAGCGTTCGGATCAAATTTGAGCTCAAACTGTTGTAAAGTGGCGACAAAGAAA AAAAAGATTTCTGCTCGGGCAAGTTGTTCACCGAGACATGAACGAACCCCAACACTAAACGGCAAAACCTTTTTCGAATT GATAAAATTTCCATCTTTGTCCAAGTGTCGCTCTGGGATGAATTTCTGAGGATTCTCCCAATTTCTTTCATCATTATGAA TTGCCCAAGTGTTTAAAAT >GCiWno563_p14.b1 TGGGATGGATACTTTTAGCACATAATATCCCATATTTCCTAACTGTGCTTTTAACAGGTCACTGCGCTTTTTTAGAGTAG TCAGGATGCGTTGATATAATTTTGTGAATTTTTTTGTTTACTACGAATCGAACGGTATAAGAGAATGAAAACGTCGACTT TATACAACAGTGTAAAATTTATATAGAAACCTCGTAATTTGCAGGTTATTTTAAACACTTGGGCAATCCATAATGATGAA AGAAATTGGGAGAATCCTCAGAAATTCATCCCAGAGCGACACTTGGACAAAGATGGAAATTTTATCAATTCGAAAAAGGT TTTGCCGTTTAGTGTTGGGGTTCGTTCATGTCTCGGTGAACAACTTGCCCGCGCAGAAATCTTTCTTTTCTTTGTCGCCA CTTTACAACAGTTTGGAAAGATGGGACACCTTTAGCACATAACATCAAAATATCCTGATCGTGTTTTAAACAATTAACAA CGGTCTGTGGAAGTCCTGAGGATACGGTTTTATAATTCTTTAAATGTTCTTTGTTTACTACCAAATGGGACGAGAAAATA GAATGAAAAGGTGTCCCATCTTCCCCACCCTACTATACCATGAATTTTCGTTTATATAATCTGATGAAATATTCATGTGT AAGTGACATTATTATGAACTTATAAATAACATATTATTATAATTCAGAAGTGTTTTCCCCAGCGAAAACCTCTACCTTTT GTTTTGTTTAAATGTATATAAACCCTACCCATCCCATGCAGTCATATAAGCAATTAGAAGCTCGCGTGTTNTCATTTGGA AGTGACGTTTTAAGCTGTGTTAATTAAAATCGGAAGTGGCTTTCATTTTTTGCGTAAAC >_1 WDGYF*HIISHIS*LCF*QVTALF*SSQDALI*FCEFFCLLRIERYKRMKTSTLYNSVKF I*KPRNLQVILNTWAIHNDERNWENPQKFIPERHLDKDGNFINSKKVLPFSVGVRSCLGE QLARAEIFLFFVATLQQFGKMGHL*HITSKYPDRVLNN*QRSVEVLRIRFYNSLNVLCLL PNGTRK*NEKVSHLPHPTIP*IFVYII**NIHV*VTLL*TYK*HIIIIQKCFPQRKPLPF VLFKCI*TLPIPCSHISN*KLACXHLEVTF*AVLIKIGSGFHFLRKX >_2 GMDTFST*YPIFPNCAFNRSLRFFRVVRMR*YNFVNFFVYYESNGIRE*KRRLYTTV*NL YRNLVICRLF*TLGQSIMMKEIGRILRNSSQSDTWTKMEILSIRKRFCRLVLGFVHVSVN NLPAQKSFFSLSPLYNSLERWDTFST*HQNILIVF*TINNGLWKS*GYGFIIL*MFFVYY QMGRENRMKRCPIFPTLLYHEFSFI*SDEIFMCK*HYYELINNILL*FRSVFPSENLYLL FCLNVYKPYPSHAVI*AIRSSRVXIWK*RFKLC*LKSEVAFIFCVN >_3 GWILLAHNIPYFLTVLLTGHCAFLE*SGCVDIIL*IFLFTTNRTV*ENENVDFIQQCKIY IETS*FAGYFKHLGNP***KKLGESSEIHPRATLGQRWKFYQFEKGFAV*CWGSFMSR*T TCPRRNLSFLCRHFTTVWKDGTPLAHNIKIS*SCFKQLTTVCGSPEDTVL*FFKCSLFTT KWDEKIE*KGVPSSPPYYTMNFRLYNLMKYSCVSDIIMNL*ITYYYNSEVFSPAKTSTFC FV*MYINPTHPMQSYKQLEARVXSFGSDVLSCVN*NRKWLSFFA* >rcilv084c12 Length = 659 Score = 155 bits (389), Expect = 7e-38 Identities = 72/100 (72%), Positives = 85/100 (85%) Frame = -1 Query: 18 ILNTWAIHNDERNWENPQKFLPERHLDKQGNFINSKKVLPFSVGVRSCLGEQLARAEIFL 77 ILNTWAIHNDERNWENPQKF+PERHLDK GNFINSKKVLPFSVGVRSCLGEQLARAEIF Sbjct: 659 ILNTWAIHNDERNWENPQKFIPERHLDKDGNFINSKKVLPFSVGVRSCLGEQLARAEIFF 480 Query: 78 FFVATLQQFEILPDPGSKDLPPINEGGNSILHLPIHFKVV 117 FFVATLQQFE+ DP ++ +P +++ N ++ P + ++ Sbjct: 479 FFVATLQQFELKFDPNAQ-VPSLDDASNGVIFSPNPYTMI 363 >sequence 62, 83 8 accessions 42% to 2U1 MLPIICLSLFLIIFLCWKPLRKRSNYPPGCDGMPFLGCLPLLGVHPANTIMKWSKRYGDV 580 FYVKYAMQNVIMLNSFESIKEALVKQGHVFSG 676 EQLFHYVKELFLAGTDTTATTLRWAILLIHYHTDVHEKIHEEIDREASNPVKFEDMPN MPYTQAVIQEVFRSRPIANFGTMRKTTAVGKVGGYRIPKGSIVMPNIWAVHHNPQR WKDPHLFKPDRHIDQNGKFVKSEDIIPFNVGQRSCLGMQLAKMEIFIFLVRMMQRFNFK LATDKEKLDLNGQYIFLHYPPAFDVSVQLRS* DEV2193.y1 DEV2193.x1 LQW184127.y1 LQW184127.x1 LQW183756.y1 LQW52515.y1 DEV54251.x1 I-helix LQW223519.x1 HEME LQW131549.x1 >sequence 64 1 accession 39% to 2J2 EESLILCVIDLFFGGTETSTSTVMWAMVVLINFPQIQEKLHKEIVTAT (1) GEALPNLDHRNELPLFQAFIQELYRCMTLAPLGVQHQTTKDADIGGYCIPKDTV VLTNIHAVHHDPKIWKNPSEFNIYRHIDQDGKFIPSRKMIPFGIGCRSCLG 687 688 EKLARSEVFLLLANIIKRFEILPDPESKELPDYKDGINGFLYVPYDYKLVDKPRTVNI* LQW235454.x1 GCiWno478_k09.b1 GCiWno478_k09.b1_4 KHLSFFV*LTCFLVEPKQAQAQ*CGRWLSLSTFHRYKRNFIKR*SMQQVH*VHSYFISLT NLFR*STSKLGPQE*TSTFPSFYSRTLPMYDTCTTGCSTPNHKGCGYWRILYPKRYSGKC NLFQALLLSTNLILGVNKHSCCPPRSQNLEEPERV*YLSSHRPRREIHSFEKNDPVWNRM QILSW*EVGKE*SLPTPCQHXQEVRDPS*SREQGASRL*RWHQRIFICSL*L*TC**TEN R*YIIIRR*KRYI*RLPKRPIYTHLYSYPYFNSLT >GCiWno478_k09.b1_5 EASLILCVIDLFFGGTETSTSTVMWAMVVLINFPQIQEKLHKEIVNATGALSAFLFHIFN QLI*VKHFQTWTTGMNFHFSKLLFKNFTDV*HLHHWVFNTKPQRMRILADTVSQKIQW*V *LIPGTSFVNEFNTRC*QTFMLSTTIPKSGRTRASLIFIVTSTKTGNSFLREK*SRLESD ADPVLVRSWQGVKSSYSLPTXSRGSRSFLIQRARSFPTIKMASTDFYMFPMTINLLINRE PLIYNNKTLKTLHLTSAKTSYIYSPIFLSLF**PHX >GCiWno478_k09.b1_6 SISHSLCD*LVFWWNRNKHKHSNVGDGCPYQLSTDTRETS*RDSQCNRCIKCILISYL*P TYLGEALPNLDHRNELPLFQAFIQELYRCMTLAPLGVQHQTTKDADIGGYCIPKDTVVSV TYSRHFFCQRI*Y*VLTNIHAVHHDPKIWKNPSEFNIYRHIDQDGKFIPSRKMIPFGIGC RSCLGEKLARSEVFLLLANXIKRFEILPDPESKELPDYKDGINGFLYVPYDYKLVDKPRT VNI***DVENATFDVCQNVLYILTYIPIPILIASL >GCiWno478_k09.b1 AGTGAGGCTATTAAAATAGGGATAGGAATATAGGTGAGTATATATAGGACGTTTTGGCAGACGTCAAATGTAGCGTTTTC AACGTCTTATTATTATATATTAACGGTTCTCGGTTTATCAACAAGTTTATAGTCATAGGGAACATATAAAAATCCGTTGA TGCCATCTTTATAGTCGGGAAGCTCCTTGCTCTCTGGATCAGGAAGGATCTCGAACCTCTTGATNATGTTGGCAAGGAGT AGGAAGACTTCACTCCTTGCCAACTTCTCACCAAGACAGGATCTGCATCCGATTCCAAACGGGATCATTTTTCTCGAAGG AATGAATTTCCCGTCTTGGTCGATGTGACGATAAATATTAAACTCGCTCGGGTTCTTCCAGATTTTGGGATCGTGGTGGA CAGCATGAATGTTTGTTAACACCTAGTATTAAATTCGTTGACAAAAGAAGTGCCTGGAATAAGTTACACTTACCACTGTA TCTTTTGGGATACAGTATCCGCCAATATCCGCATCCTTTGTGGTTTGGTGTTGAACACCCAGTGGTGCAAGTGTCATACA TCGGTAAAGTTCTTGAATAAAAGCTTGGAAAAGTGGAAGTTCATTCCTGTGGTCCAAGTTTGGAAGTGCTTCACCTAAAT AAGTTGGTTAAAGATATGAAATAAGAATGCACTTAATGCACCTGTTGCATTGACTATCTCTTTATGAAGTTTCTCTTGTA TCTGTGGAAAGTTGATAAGGACAACCATCGCCCACATTACTGTGCTTGTGCTTGTTTCGGTTCCACCAAAAAACAAGTCA ATCACACAAAGAATGAGAGATGCTTC >scf/ciona01/G126/seq_dir/hrs/G126P64700R.T0/G126P64700RH12.T0.seq 727 0 727 ABI Length = 727 Minus Strand HSPs: Score = 268 (94.3 bits), Expect = 5.2e-23, P = 5.2e-23 Identities = 46/59 (77%), Positives = 52/59 (88%), Frame = -3 Query: 1 PPGPRGLPFIGPITSIRIHPEHAMMKWNQQYGPVCMVRFGFKDILLLGSYEAAHEALVK 59 PPGPRG+P +G IT + HPEHAMMKWNQQYGP+CMVR G KD+LLLGSYEAAHEAL+K Sbjct: 221 PPGPRGIPLLGAITQLGKHPEHAMMKWNQQYGPICMVRLGHKDVLLLGSYEAAHEALLK 45 >sequence 66, 75 1 accession 41% to 1A1 33% to 2C9 63% to seq 57 MFESFGYYFGESLTSNHVISGLIGVFTIVMCVYYYWWKFPHPRYPPGVRGVPIFGAIP FFGRYVQETLAKWSRSKYGPVMSARFGQDDAVVLNDFESIHE (0?) ALVKNIQHFNSRPSFYIVEQFTHGYGFGFADGHNKYLDVRNFSLSALRG (?) LGIGRRTMETRVSEVAQDLVKILEDLDQKPTDLK (0?) MMLGGTVANVLCSVVFGKTYDLSDPEYQYAVQCSFDC (2) FGDPENSEYLNFMFFYPKLRYIQPFKRALKKFIDVHLGLIAFNQKEINLHKERLDVN EPGDYIDAFLIEMKKHSPENSWFHETQLLHCLGDMFIAGTETTTNTILWALLALIHHPEI QEKLYQELLDNIGEQVLPSTDHRDKIPLFRAFTQEVYRFKTIVPLALQHRANKDVEIGGY VIPKGTKVFPNLHAVHHDPNIWKNPSEFNIYRHISKDGKFIPSKRVVAFGMGARSCLGEKLAITE VFLFLANIIKRFEILPDPESKELPILKDGVNSLLYVPYRFKVVVKPRIINE* LQW259643.y1 GCiWno768_b20.b1 GCiWno778_a23.b1 cits031a18 GCiWno57_n14.b1 LQW110746.y01 NEW LQW281021.y1 >GCiWno57_n14.b1 TTCGGGTCATAGACTGTTTGCCAGTAAAACGTACGGCACGATCATGGTTCATATCTGTGTCCAGTTAAACGACCGCCGTG CATGGTAACTCTGCTGTACCAGTTGCGCCTGTTACTTGGCCGTAAGTAAAACCTGGTTGTCGGCAGTTACAAGTAAAACC TGGTTGTCGGCACTACAGAGATTTGCGCTAATTACTACAGTAGGGAGATGTTCACGTGCGAAGATATTACTTTTACTACT TCTAATCGAGCAAGTCATCCTGATGACATTTCAAACTATATGTCTAACGTTTCAAAGCTGACCGCGGTAAAACTTAAATA GAAAGAGTTGATCATGCAAAAGCAATAGCTTTATAGAACCGACCATGTTATTAACAAAAACAGTTGAATCTGGAAACACT GGATTGAACTCAGCCTGGTCAGACCGAACAGCAGGTTCTGGAGTTCCGTTGCAGTATTCAATTACCAGTGTTGTACGTCT GGAATATGTTTTTAAAAGTGCGAAATTTTAAACTTGTGTTATCTTCCAGACAATATGTTTGAAAGTTTTGGTTATTATTT TGGTGAGTCGTTGACTTCGAATCATGTTATTTCCGGTTTAATCGGGGTTTTCACCATTGTTATGTGCGTGTATTATTACT GGTGGAAGTTTCCCCACCCACGGTACCCACCTGGGGTAAGAGGGGTTCCAATTTTTGGTGCTATCCCATTTTTTGGAAAG TACGTTCAAGAAACTTTGGCAAAGTGGTCACGTAGCAAGTATGGTCCAGTCATGTCTGCACGATTTGGTCAAGATGACGC TGNTGTGTTGAACGATTTTGAATCAATACACGAAGTAATCGACCTATTGATTAACAACTTTATAACTTTATTATCGATTG GTCTTGTACAGACCATGGTGTACCTAAGGATTTCACCTCACATTTTTAGGATCTN cits031a18 Length = 643 Score = 107 bits (265), Expect = 1e-23 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = +2 Query: 2 QALVKNIQHFNSRPSFYIVEQFTHGYGFGFADGHNKYLDVRNFSLSALRG 51 +ALVKNIQHFNSRPSFYIVEQFTHGYGFGFADGHNKYLDVRNFSLSALRG Sbjct: 308 EALVKNIQHFNSRPSFYIVEQFTHGYGFGFADGHNKYLDVRNFSLSALRG 457 >cits031a18 used related seq to get N-term part of this EST Length = 643 Score = 233 bits (587), Expect = 7e-61 Identities = 101/132 (76%), Positives = 116/132 (87%) Frame = +2 Query: 10 ITSCLTGVCTLVLFVYYYWWKLPHPRYPPGVRGIPVLGALPFLGKFAHKDIMRWSREKYG 69 + S L GV T+V+ VYYYWWK PHPRYPPGVRG+P+ GA+PF G++ + + +WSR KYG Sbjct: 62 VISGLIGVFTIVMCVYYYWWKFPHPRYPPGVRGVPIFGAIPFFGRYVQETLAKWSRSKYG 241 Query: 70 PIMSVRFGQKDSVVLNDYESIFQALVKNIQHFNSRPSFYIVEQFTHGYGFGFADGHNKYL 129 P+MS RFGQ D+VVLND+ESI +ALVKNIQHFNSRPSFYIVEQFTHGYGFGFADGHNKYL Sbjct: 242 PVMSARFGQDDAVVLNDFESIHEALVKNIQHFNSRPSFYIVEQFTHGYGFGFADGHNKYL 421 Query: 130 DVRNFSLSALRG 141 DVRNFSLSALRG Sbjct: 422 DVRNFSLSALRG 457 Related seq to help find N-term >cicl015b02 Length = 305 Score = 42.6 bits (98), Expect = 3e-04 Identities = 20/31 (64%), Positives = 25/31 (80%) Frame = +3 Query: 1 GRRTMETRVSEVAQDLVKILEDLDQKPTDLK 31 G R ME RVSEVAQDLV+ L++LD KPT+ + Sbjct: 111 GGRVMEERVSEVAQDLVQSLQELDGKPTNFR 203 >cicl015b02 AATTGATAAATTCTTACTCCAATGGTTACGGGTTTGGTTTTGCTGAAGGAAACAAGAAATACATGGAGGTTCGACATTTT ACACTAAAGGCATTACGTGGGTTTGGGATTGGAGGTCGTGTAATGGAGGAGCGAGTGTCAGAGGTTGCGCAAGATCTTGT TCAATCTCTTCAAGAATTGGATGGAAAACCAACAAACTTTAGGATGATTGTCGGAACAACAGTTTCAAACGTAATCGCGA GCATCGNCCTCGGGAAGAAGNTTCATCCAAAAGACGAAGACTTTCAACGCCATGNACAACTAATC >_3 LINSYSNGYGFGFAEGNKKYMEVRHFTLKALRGFGIGGRVMEERVSEVAQDLVQSLQELD GKPTNFRMIVGTTVSNVIASIXLGKKXHPKDEDFQRHXQLI Another related seq >cibd042f04 Length = 702 Score = 116 bits (288), Expect = 3e-26 Identities = 54/95 (56%), Positives = 71/95 (73%) Frame = +3 Query: 1 LINSYSNGYGFGFAEGNKKYMEVRHFTLKALRGLGIGRRTMETRVSEVAQDLVKILEDLD 60 LI SYSNGYGFGFAEG+ KYME+RHFT K LRG GIG R +E R+S+ AQ+LV+ + LD Sbjct: 327 LITSYSNGYGFGFAEGHTKYMELRHFTFKILRGFGIGGRYLEDRISDHAQELVQDFKKLD 506 Query: 61 QKPTDLKMMLGGTVANVLCSVVFGKTYDLSDPEYQ 95 K TD++M++ T+ NV+ S+V GK Y D ++Q Sbjct: 507 GKATDVRMIVATTIGNVIASIVLGKKYHPKDKDFQ 611 >rcibd042f04 CGATAATAATATACCACATATGTTGCTAAATAGGGTAAGTGAGGCTATTAAAATAGGGATAGGAATATAGGTGAGTATAT ATAGGACGTTTTGGCAGACGTCAAATGTAGCGTTTTCAACGTCTTAGTATTATATATTAACGGTTCTCGGTTTAGCAACA AGTTTATAGTCATAGGGAACATATAAAAATCCGTTGATGCCATCTTTATAGTCGGGAAGCTCCTTGCTCTCTGGATCAGG AAGGATCTCGAACCTCNTGGATGATGTTGGCAAGGAGTAGGAAGACTTCACTCCTTGCCAACTTCTCACCAAGACAGGAT CTGCATCCGATTCCAAACGGGATCATTTTTCTCGAAGGAATGAATTTCCCGTCTTGGTCGATGTGACGATAAATATTAAA CTCGCTCGGGTTCTTCCAGATTTTGGGATCGTGGTGGACAGCATGAATGTTTGTTAACACCACTGTATCTTTTGGGATAC AGTATCCGCCAATATCCGCATCCTTTGTGGTTTGGTGTTGAACACCCAGTGGTGCAAGTGTCATACATCGGTAAAGTTCT TGAATAAAAGCTTGGAAAAGTGGAAGTTCATTCCTGTGGTCCAAGTTTGGAAGTGCTTCACCTGTTGCATTGACTATCTC TTTATGAAGTTTCTCTTGTATCTGNGGAAAGTTGATAAGGACNACCATCNCCCACATTACTGNGCTT >cibd042f04 TATTTTTTGAGTCGTTTACCTCTAATTACATCACATCCTGCTTAACCGGGGTTTGTACCCTTGTTTTGTTCGTGTATTAC TACTGGTGGAAATTGCCCCACCCACGGTACCCACCTGGGGTGAGGGGAATACCCGTGTTGGGGGCTTTACCCTTTCTCGG TAAATTTGCGCACAAAGACATCATGCGGTGGTCACGTGAGAAGTATGGACCTATAATGTCTGTGAGGTTCGGGCAAAAGG ATTCGGTTGTTTTGAACGATTATGAATCTATTTACGAGGCTATGGTCAAACAAGGTCCAGCATTTCGGTCACGTCCAACC ATGAAACTGATTACCTCTTACTCGAATGGCTACGGGTTTGGTTTTGCTGAGGGACACACCAAATACATGGAACTCCGACA TTTTACATTCAAGATATTACGTGGGTTTGGAATTGGTGGTCGATATTTGGAGGACCGCATCTCAGATCATGCGCAAGAAC TTGTTCAAGATTTTAAAAAATTAGATGGAAAAGCAACTGACGTGAGGATGATAGTTGCAACCACCATTGGAAATGTTATC GCGAGTATTGTTCTTGGAAAGAAATATCATCCAAAAGATAAAGATTTCCAACGTCATCTCCAGCTAATACTTAACAATTT TGGAAACGAAGAAACTGCAAGCTATATTCTATGTATGATGTATTTTCCATCATTGCGTCATA >cibd042f04_3 = seq 57 FFESFTSNYITSCLTGVCTLVLFVYYYWWKLPHPRYPPGVRGIPVLGALPFLGKFAHKDI MRWSREKYGPIMSVRFGQKDSVVLNDYESI YEAMVKQGPAFRSRPTMKLITSYSNGYGFG FAEGHTKYMELRHFTFKILRGFGIGGRYLEDRISDHAQELVQDFKKLDGKATDVRMIVAT TIGNVIASIVLGKKYHPKDKDFQRHLQLILNNFGNEETASYILCMMYFPSLRH >GCiWno778_a23.b1 TCAGGGCTCGTTTAAAAGGTTGTATGTATCTCAGCTTCGGGTAGAAGAACATGAAGTTTAAATATTCTGAATTCTCTGGG TCTCCAAAGCTAAAAGATATTGGAAACAGATAAAGAAAGCAGAAAAACAATACCTATGTTAGAAGATCACTCATGATCGA AATTCGCTGAAAAAAGATCTCCCATCGCGATAATGCGGGTGCGTGAACCGCAATGTTTTCGGTATTCGAACTTTGATTGA TAGGGTATATCTGTTCAGTCACGGTATTTGCAAACTAGAACTTACCAGTCGAAACTGCATTGTACTGCATATTGATACTC AGGGTCACTTAGATCGTAAGTCTTTCCAAAAACTACGCTGCAGAGAACGTTTGCTACGGTTCCCCCCAGCATCATCTATA ACATAATATTATACAACCAGTTCAGTATGCAGCAATCGATGCAGGCAAAACAAACCTTTAGATCGGTCGGTTTTTGATCC AAATCTTCTAAAATTTTAACGAGATCCTGAGCCACCTCCGATACTCGAGTCTCCATCGTTCGCCGTCCAATCCAAGTCTA CATTAAGTGTATGGATACTCAATCTTTTTAATGTATGGCGGCATATTCAGACAACCAGTAAGGTACTATACTGGGTAGAA GCAACTGCCGTTTTGGTTTTTCAAGGGAACATACGCCTGCAATGGTTACGACGACCAGCTCACTATAGGGCCCGGGTATA AGATCCCGCCCAAACCACTGGCGCCTAAACGCCGGAAAGGGTGGGCCACCCATTCCTGCTTTCCGGGGGCAAGGGATGTT CCCACAAACAAATGCCAACAACAGTAATCCCGCTGGGTTTCGAACAAAAAAATGCTAAAAAGCAAGTTTGCAATAATTGG GCTTATTTTTAACCCCCGAATTCCCTAAGGTTTATATGGGAATTAACCTCCGAAGAGGGGAAACTAAGGTTCTAAAC >GCiWno778_a23.b1_4 V*NLSFPSSEVNSHINLREFGG*K*AQLLQTCFLAFFCSKPSGITVVGICLWEHPLPPES RNGWPTLSGV*APVVWAGSYTRAL**AGRRNHCRRMFP*KTKTAVASTQYSTLLVV*ICR HTLKRLSIHTLNVDLDWTANDGDSSIGGGSGSR*NFRRFGSKTDRSKGLFCLHRLLHTEL VV*YYVIDDAGGNRSKRSLQRSFWKDLRSK*P*VSICSTMQFRLVSSSLQIP*LNRYTLS IKVRIPKTLRFTHPHYRDGRSFFSEFRS*VIF*HRYCFSAFFICFQYLLALETQRIQNI* TSCSSTRS*DTYNLLNEP* >GCiWno778_a23.b1_5 LEP*FPLFGG*FPYKP*GIRGLKISPIIANLLFSIFLFETQRDYCCWHLFVGTSLAPGKQ EWVAHPFRRLGASGLGGILYPGPIVSWSS*PLQAYVPLKNQNGSCFYPV*YLTGCLNMPP YIKKIEYPYT*CRLGLDGERWRLEYRRWLRISLKF*KIWIKNRPI*RFVLPASIAAY*TG CIILCYR*CWGEP*QTFSAA*FLERLTI*VTLSINMQYNAVSTGKF*FANTVTEQIYPIN QSSNTENIAVHAPALSRWEIFFQRISIMSDLLT*VLFFCFLYLFPISFSFGDPENSEYLN FMFFYPKLRYIQPFKRALX >GCiWno778_a23.b1_6 FRTLVSPLRRLIPI*TLGNSGVKNKPNYCKLAF*HFFVRNPAGLLLLAFVCGNIPCPRKA GMGGPPFPAFRRQWFGRDLIPGPYSELVVVTIAGVCSLEKPKRQLLLPSIVPYWLSEYAA IH*KD*VSIHLM*TWIGRRTMETRVSEVAQDLVKILEDLDQKPTDLKVCFACIDCCILNW LYNIML*MMLGGTVANVLCSVVFGKTYDLSDPEYQYAVQCSFDW*VLVCKYRD*TDIPYQ SKFEYRKHCGSRTRIIAMGDLFSANFDHE*SSNIGIVFLLSLSVSNIF*LWRPREFRIFK LHVLLPEAEIHTTF*TSPX >GCiWno778_a23.g1 AACGATTCGAGCTCGGTACCCCTGNAAGTCAAAGATTCTTCCGAAACAGTTTCTATACCTGGATTAGAACGTTGTATTAG AAAACTCAAGTGAAATGCTAACCTTGTTACTGACTTCATAATTGTTAATCTATTTGCAGCTCACCACTCTTATAAGGCAC GTAGTAACAATACAGGCATCTTTTGTTGTTGTTCTTTGCCATGAATGCTTTTAGACATGAATGCCTTCAAAAACTAATTT CGTGAATGCTTTCAAAAACTAATTTCTTTGCCATGAATGCTTTCAAAAACTAATTTCAGCATTTACTTTTTAATCTTTTA GAGTTTAATGAAAACGCTTAACCCCAAAGGTACCTAACCTTAATTAGCCAAAAACTAAACCGATGAAACCGAAAGGTGAT TTATCACAATATGGTTTATACATCTAAGCTTAGTTAGAAACACTTCATAGAGTGCAAAAAAGTGCCAGCTTACGAGTTAC CAAGTATGTTACTTTGAGGTAAATTCTCACAGGGTTGGAGCAATTGCCGTTAAGTGTCTTACCAAGGACACATACGCTCA CAATGGTAGCAGCGTCGAGTCTTGAAGGCATTACCTCTGAGTTACAAGAAGACGCGCTATCCATTTGTTCTACCGCGGCG GACGATGATGGGTTACTATACTTTCTAATTATGTGGTTTAAAATCTTAAAACTTTTTCTACCATTTATGATACTATGGGA AGGATAGGGGGCACCATTTTTTTCTGCACAACAAAATTTTTGAAAATTCAAAAATTTATGCGGGATTCCCAAACGTTATT TGGAGGGGTGCAAAATTCCACTATAATTCTTAATCACAACCCACCTTATCTCCAAACCCGCGTTAAGCAACCGAATATCC TCCAAAATTTACCACCTTTTCGCCCCTACGCGTTGAAGTGCGGGAAAAAGGGACAAGGGTTTTTTTATTCCATTCCCGCC CGAATTTTCCCCCCCCCCCTCTTATAAACCCGC >ciht041o06 Length = 673 Score = 57.0 bits (135), Expect = 2e-08 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +3 Query: 60 FGDPENSEYLXFMFFYPKLRYIQPF 84 FGDPENSEYL FMFFYPKLRYIQPF Sbjct: 12 FGDPENSEYLNFMFFYPKLRYIQPF 86 >ciht041o06 GTTTCGACTGCTTTGGAGACCCAGAGAATTCAGAATATTTAAACTTCATGTTCTTCTACCCGAAGCTCAGATACATACAA CCTTTTAAAAGAGCCCTGAAGAAGTTTATTGATGTTCATCTTGGATTGATAGCATTCAACCAAAAAGAAATTAATCTTCA CAAGGAAAGATTGGATGTGAACGAACCTGGAGATTACATCGATGCTTTCCTTATTGAGATGAAGAAACACTCTCCTGAAA ATTCATGGTTCCATGAGACACAGCTTCTACATTGTTTAGGTGACATGTTTATTGCTGGAACAGAAACCACTACAAACACA ATACTCTGGGCTTTATTGGCGTTAATACACCATCCAGAGATACAAGAAAAGTTATATCAAGAACTACTTGATAACATTGG TGAACAAGTTCTTCCAAGTACCGATCACAGAGACAAAATCCCGCTCTTCCGTGCATTTACTCAAGAGGTTTATAGATTCA AAACAATTGTACCCCTTGCCCTCCAACATCGAGCTAATAAAGACGTAGAGATTGGTGGATACGTCATACCTAAAGGAACA AAGGTGTTTCCCAACCTCCATGCGGTTCACCACGATCCAAATATCTGGAAAAATCCGAGCGAGTTCAACATTTATCGTCA CATCAGCAAAGACGGGAAATTTATTCCTTCGAA >_3 FDCFGDPENSEYLNFMFFYPKLRYIQPFKRALKKFIDVHLGLIAFNQKEINLHKERLDVN EPGDYIDAFLIEMKKHSPENSWFHETQLLHCLGDMFIAGTETTTNTILWALLALIHHPEI QEKLYQELLDNIGEQVLPSTDHRDKIPLFRAFTQEVYRFKTIVPLALQHRANKDVEIGGY VIPKGTKVFPNLHAVHHDPNIWKNPSEFNIYRHISKDGKFIPS ciht041o06 Length = 673 Score = 159 bits (398), Expect = 6e-39 Identities = 75/79 (94%), Positives = 76/79 (95%), Gaps = 2/79 (2%) Frame = +3 Query: 5 QIPFFRAFTQEVYRFKTIVPLALQHRANKDVEIGGYVIPKG--VFPNLHAVHHDPNIWKN 62 +IP FRAFTQEVYRFKTIVPLALQHRANKDVEIGGYVIPKG VFPNLHAVHHDPNIWKN Sbjct: 435 KIPLFRAFTQEVYRFKTIVPLALQHRANKDVEIGGYVIPKGTKVFPNLHAVHHDPNIWKN 614 Query: 63 PSEFNIYRHISKDGKFIPS 81 PSEFNIYRHISKDGKFIPS Sbjct: 615 PSEFNIYRHISKDGKFIPS 671 >GCiWno768_b20.b1 AAAAAACCAACCNCCNCCCCNNNAACNACNAANANCAACACANNNNNNNGGTTAAAATAANGGCAGCTTGCTGCCTGCAG TCGATCTGAGGATCCCTAAGTACATTATTGGGTTTCATTGTATTTACAAGAATCATGGTTATAGGATTATAGCATGGCGC CGACCAGAGTAATATGTTTTTACAGTTACACGAAGAAAAGCATTTACAAGATTACAGATGAGTTCGATAACGTCAATCCG TTATTCGTTGATGATCCTCGGCTTTACAACAACTTTAAACCGGTATGGAACATATAGAAGACTGTTGACTCCATCTTTGA GAATAGGAAGCTCTTTGCTCTCGGGATCAGGGAGGATTTCGAATCTTTTGATAATGTTAGCAAGGAAGAGGAAGACTTCT GTGATCGCCAACTTTTCCCCAAGGCACGACCGAGCTCCCATACCGAACGCAACCACTCTCTTTGAAGGAATAAATTTCCC GTCTTTGCTGATGTGACGATAAATGTTGAACTCGCTCGGATTTTTCCAGATATTTGGATCGTGGTGAACCGCATGGAGGT TGGGAAACACCTGAAAGGATTAGAAGTATTTAAAACAAGAGCTGGACTAGTTTTATTAAATAGATATATAGAGTAACCTT TGTTCCTTTAGGTATGACGTATCCACCAATCTCTACGTCTTTATTAGCTCGATGTTGGAGGGCAAGGGGTACAATTGTTT TGAATCTATAAACCTCTTGAGTAAATGCACGGAAGAGCGGGATTTTGTCTCTGTGATCGGTACTTGGAAGAACTTGTTCA CCTTTGAAATTTATTTTAGGTTTAGAAATCTACTTAGTGTTTAAGTGTAGGAGGTACCAATGTTATCAAGTAGTTCTTGA TATAACTTTTCTGTATCTCTGGATGGGGAATAACGCCAATAAGCCCAAAGAATGGGTTTGAAAGGGTTCCGTTCAGCAAT AG >_4 IAERNPFKPILWAYWRYSPSRDTEKLYQELLDNIGTSYT*TLSRFLNLK*ISKVNKFFQV PITETKSRSSVHLLKRFIDSKQLYPLPSNIELIKT*RLVDTSYLKEQRLLYISI**N*SS SCFKYF*SFQVFPNLHAVHHDPNIWKNPSEFNIYRHISKDGKFIPSKRVVAFGMGARSCL GEKLAITEVFLFLANIIKRFEILPDPESKELPILKDGVNSLLYVPYRFKVVVKPRIINE* RIDVIELICNLVNAFLRVTVKTYYSGRRHAIIL*P*FL*IQ*NPIMYLGILRSTAGSKLP LF*PXXCVXXXXXXGGGWFF >_5 YC*TEPFQTHSLGLLALFPIQRYRKVISRTT**HWYLLHLNTK*ISKPKINFKGEQVLPS TDHRDKIPLFRAFTQEVYRFKTIVPLALQHRANKDVEIGGYVIPKGTKVTLYIYLIKLVQ LLF*ILLILSGVSQPPCGSPRSKYLEKSERVQHLSSHQQRREIYSFKESGCVRYGSSVVP WGKVGDHRSLPLPC*HYQKIRNPP*SREQRASYSQRWSQQSSICSIPV*SCCKAEDHQRI TD*RYRTHL*SCKCFSSCNCKNILLWSAPCYNPITMILVNTMKPNNVLRDPQIDCRQQAA XILTXXXCXXXXXXGXXLVFX >_6 LLLNGTLSNPFFGLIGVIPHPEIQKSYIKNYLITLVPPTLKH*VDF*T*NKFQR*TSSSK YRSQRQNPALPCIYSRGL*IQNNCTPCPPTSS**RRRDWWIRHT*RNKGYSIYLFNKTSP ALVLNTSNPFRCFPTSMRFTTIQISGKIRASSTFIVTSAKTGNLFLQREWLRSVWELGRA LGKSWRSQKSSSSLLTLSKDSKSSLIPRAKSFLFSKMESTVFYMFHTGLKLL*SRGSSTN NGLTLSNSSVIL*MLFFV*L*KHITLVGAML*SYNHDSCKYNETQ*CT*GSSDRLQAASC XYFNXXXVLXXVVXGXXVGFX >GCiWno768_b20.g1 CGGTACCCGTACGAAGCCCAACGCGACTAATGTTGTTGGCAGTTTTATTTGTGCGCAACACCTGGCCCCCACAAAGCAAG AATGTTTAGGTCATACATTTCCGACGCTTAGGCACAGTTGTTTGTGCGCGATCCTAACCCAGATCTTACTGGTTGTCTGA ATTGTCGGCCATACATTTAAAAGATTAAGTATTCATGTACTTGTAGACTTGGAATTGGACGGCGAACGATGGAGACTCGA GTATCGGAGGTGGCTCAGGATCTCGTTAAAATTTTAGAAGATTTGGATCAAAAACCGACCGATCTAAAGGTTTGTTTTGC CTGCATCGATTGCTGCATACTGATCTGGTTGTATAATGTTATGTTATAGATGATGCTGGGGGGAACCGTAGCAAACGTTC TCTGCAGCGTAGTTTTTGGAAAGACTTACGATCTAAGTGACCCTGAGTATCAATATGCAGTACAATGCAGTTTCGACTGG TAAGTTCTAGTTTGCAAATACCGTGACTGAACAGATATACCCTATCAATCAAAGTTCGAATACCGAAAACATTGCGGTTC ACGCACCCGCATTATCGCGATGGGAGATCTTTTTTCAGCGAATTTCGATCATGAGTGATCTTCTAACATAGGTATTGTTT TTCTGCTTTCTTTGACTGTTTCCAATATCTTTTAGCTTTGGAGACCCAGAGAATTCAGAATATTTANACTTCATGTTCTT CTACCCGAAGCTGAGATACATACAACCTTTTAAAGAGCCCTGAAGAAGTTTATTGATGTTCATCTTGGATTGATAGGTTA AATAATATGCTATGTTTGAGTGGTGGAATATANGCGCATGTCCACTCTANCAGGGTACACTGTGCAAATAT >GCiWno768_b20.g1_1 RYPYEAQRD*CCWQFYLCATPGPHKARMFRSYISDA*AQLFVRDPNPDLTGCLNCRPYI* KIKYSCTCRLGIGRRTMETRVSEVAQDLVKILEDLDQKPTDLKVCFACIDCCILIWLYNV ML*MMLGGTVANVLCSVVFGKTYDLSDPEYQYAVQCSFDW*VLVCKYRD*TDIPYQSKFE YRKHCGSRTRIIAMGDLFSANFDHE*SSNIGIVFLLSLTVSNIF*LWRPREFRIFXLHVL LPEAEIHTTF*RALKKFIDVHLGLIG*IICYV*VVEYXRMSTLXGYTVQIX >GCiWno768_b20.g1_2 GTRTKPNATNVVGSFICAQHLAPTKQECLGHTFPTLRHSCLCAILTQILLVV*IVGHTFK RLSIHVLVDLELDGERWRLEYRRWLRISLKF*KIWIKNRPI*RFVLPASIAAY*SGCIML CYR*CWGEP*QTFSAA*FLERLTI*VTLSINMQYNAVSTGKF*FANTVTEQIYPINQSSN TENIAVHAPALSRWEIFFQRISIMSDLLT*VLFFCFL*LFPISFS FGDPENSEYLXFMFF YPKLRYIQPF KEP*RSLLMFILD**VK*YAMFEWWNIXACPLXQGTLCKY >GCiWno768_b20.g1_3 VPVRSPTRLMLLAVLFVRNTWPPQSKNV*VIHFRRLGTVVCARS*PRSYWLSELSAIHLK D*VFMYL*TWNWTANDGDSSIGGGSGSR*NFRRFGSKTDRSKGLFCLHRLLHTDLVV*CY VIDDAGGNRSKRSLQRSFWKDLRSK*P*VSICSTMQFRLVSSSLQIP*LNRYTLSIKVRI PKTLRFTHPHYRDGRSFFSEFRS*VIF*HRYCFSAFFDCFQYLLALETQRIQNIXTSCSS TRS*DTYNLLKSPEEVY*CSSWIDRLNNMLCLSGGIXAHVHSXRVHCAN >sequence 67 1 accession 42% to 1B1 FTLRVDGVLKTFDNDDVTNVVASMTSEVLEKKSAGESREITESETKTIAALSADILGA (1?) GQHTTSTTFFWVINLLLCFPKVLNKLTEEVRSKLGNRLPTLEDRTSLPYMDAVLTE (?) based on savingyi ortholog match VLRFSSPLSSTIPHSTLKDVKLAGHTIKRGTMVIISQYAVNHDPQNWKNPENFDPERFLTK NEGGEIIFNESLSEKVLAFSIGERKCPGSQLSRMLLFLATTLLVQVSDLSADLERPPT AAAEYGLILRPKHLSIKLTLREHWQRRDSIRA* GCiWno293_n12.b1 GCiWno539_p21.b1 GCiWno609_a08.b1 GCiWno231_f21.g1 GCiWno874_c22.b1 GCiWno874_c22.g1 GCiWno755_d15.b1 GCiWno674_m24.b1 GCiWno624_m24.b1 GCiWno339_d23.b1 GCiWno42_n19.g1 GCiWno815_c16.g1 GCiWno665_k11.g1 LQW275808.x1 >scf/ciona01/G126/seq_dir/hrs/G126P604361R.T0/G126P604361RA8.T0.seq 743 file 17 0 743 ABI Length = 743 Minus Strand HSPs: Score = 133 (46.8 bits), Expect = 2.0e-08, P = 2.0e-08 Identities = 37/74 (50%), Positives = 46/74 (62%), Frame = -3 Query: 1 FTL-RVDGVLKTFDNDDVTNVVASMTSEVLEKK---------------SAGESREITESE 44 FT RV +LK FD DDVTNVV+SMTSEVLE K + E + +TESE Sbjct: 381 FTFFRVREILKKFDKDDVTNVVSSMTSEVLESKEDDSKRLTESDSKRLTESE*KRLTESE 202 Query: 45 TKTIAALSADILGA 58 +TI++L+ DILGA Sbjct: 201 IQTISSLAEDILGA 160 >scf/ciona01/G126/seq_dir/hrs/G126P64527F.T0/G126P64527FE7.T0.seq 714 0 714 ABI Length = 714 Plus Strand HSPs: Score = 104 (36.6 bits), Expect = 3.6e-05, P = 3.6e-05 Identities = 22/35 (62%), Positives = 25/35 (71%), Frame = +3 Query: 4 RVDGVLKTFDNDDVTNVVASMTSEVLEKKSAGESR 38 RV +LK FD DDV+NVV+SMTSEVLE K R Sbjct: 606 RVREILKNFDKDDVSNVVSSMTSEVLESKEDDSKR 710 runs off end >scf/ciona01/G126/seq_dir/hrs/G126P67079R.T0/G126P67079RD2.T0.seq 752 0 752 ABI Length = 752 Minus Strand HSPs: Score = 130 (45.8 bits), Expect = 4.5e-08, P = 4.5e-08 Identities = 29/48 (60%), Positives = 37/48 (77%), Frame = -2 Query: 1 FTL-RVDGVLKTFDNDDVTNVVASMTSEVLEKKSAGESREITESETKTI 48 FT RV +LK FD DDVTNVV+SMTSEVLE K +S+ +TES++K + Sbjct: 205 FTFFRVREILKKFDKDDVTNVVSSMTSEVLESKE-DDSKRLTESDSKRL 62 >GCiWno874_c22.b1_1 NCPCPPTLRINS*IHSSMVATVGFELTSPPNTALSPKRNQQADKYVTKTINV*PKQ*SKS HKV*SPSDNKRTY*STEAARSRLNFHFPKKLAIYG*LPVLLVNKFVL*SYATKSRLR*CV YSNSAFWFRFTEFSMITAFRFNLVCLLKCKVRKLRCLLSFANKFLTFYYYKS*SVFFYIY FYSRPTHNFYNFFLGHKFTPMFSKSPQ*THGRSPEQTRKQTSNLGGSKLPILRGRGTDRG RKLNDCIYFRCRHMCYCLPXAPAWEVWVXNTTIYFIYHDCMLLIFLIA*RGQDX >GCiWno874_c22.b1_2 TVLAPQR*G*IVKFIHPW*QQ*DSNSPRLRIPR*VRNETSRQTNT*QKR*TSNQSSNLKA TKFNLQATINVPTDQQKPHAHV*ISIFQKN*QSTVNCLFCL*TSLCYKVMLPKADCGDVY ILILHFGSDLLSFQ**QRLDLILSAY*NAKYENSGVYYPLLISFLHSIIINLNLCFFIFI FIPGQHTTSTTFFWVINLLLCFPKVLNKLTEEVRSKLGNRLPTLEDRNSLSYVDAVLTEV EN*TIVFTFVADTCVTACHXHQPGRYGXVTRPFTSFTMTACYLFFL*RSGGKT >GCiWno874_c22.b1_3 LSLPPNAEDK*LNSFIHGSNSRIRTHLASEYRAESETKPAGRQIRDKNDKRLTKAVI*KP QSLISKRQ*TYLLINRSRTLTFKFPFSKKTSNLRLIACFACKQVCVIKLCYQKPTAVMCI F*FCILVQIY*VFNDNSV*I*SCLLIKMQSTKTQVFTILC**VSYILLL*ILICVFLYLF LFQANTQLLQLFSGS*IYSYVFQKSSINSRKKSGANSETDFQPWRIETPYLTWTRY*QR* KIKRLYLLSLQTHVLLPAIXTSLGGMGX*HDHLLHLP*LHATYFSYSVAGAR Walk 1 >GCiWno624_m24.g1_1 TWFRHR*IWTAKVTKNETIIDLLRDT**YKCLESYFIMNERI*LIYFHVAEQ*QSL*HGC SVSYTLCLLLRVTTYITFLLIADITI*KSYYCAYNAIIYFKSRWGS*NIRQ**RHKCSSF DDVRGAREKVSGRIKGNNRKRDKNDCCSFSRYTWGG*AVVGTNFVSITILNE*MNECNLL ILTWIQRQSL*HRCIKW*L*KLFTKKVIYRLGNS*AGCV*NRIPVLITVLAPPREDK*LN SFIHGSHSRIRTHLASEYRAESETXPAGRQIR*QNDKRLTKAVILKAQSLISKRQ*TYLL INKSPTLPVX >GCiWno624_m24.g1_2 LGSDIGKYGRQKLRKTKL**TYYVTHDSINVWKVIL**MKEFNLFIFTWQSNDSRYNTVV LFHTPCACFYELPRI*LFC*SPTLPFRKVTIAHIMQ*FTLRVDGVLKTFDNDDVTNVVAS MTSEVLEKKSAGESREITESETKTIAALSADILGAGRLLLVQTLFRLQF*MNE*MNVTCL S*RGFNDSRYNTGV*NGSSKNYSPKRLYIDLVTRKPDVYETEYPC**LSLPPHVRINS*I HSSMVATVGFELTSPPNTALSPKRXQQADKYGDKTINVLPKQ*S*RHKV*SPSDNKRTY* STRARRFPFX >GCiWno624_m24.g1_3 LVQT*VNMDGKSYEKRNYNRLIT*HMIV*MFGKLFYNE*KNLTYLFSRGRAMTVVITRLF CFIHLVPAFTSYHVYNFFADRRHYHLEKLLLRI*CNNLL*ESMGFLKHSTMMTSQM**LR *RQRCSRKSQRENQGK*PKARQKRLLLFQQIYLGRVGCCWYKLCFDYNFE*MNE*M*LAY PDVDSTTVVITPVYKMVALKIIHQKGYI*TW*LVSRMCMKQNTRVNNCPCPPT*G*IVKF IHPW*PQ*DSNSPRLRIPR*VRNXTSRQTNTVTKR*TSYQSSNPKGTKFNLQATINVPTD QQEPDASRF >GCiWno539_p21.b1_1 *PRLRIPR*VRNETSRQTNT*QKR*TSNQSSNLKATKFNLQATINVPTDQQKPHAHV*IS IFQKN*QSTVNCLFCL*TSLCYKVMLPKADCGDVYILILHFGSDLLSFQ**QRLDLILSA Y*NAKYENSGVYYPLLISFLHSIIINLNLCFFIFIFIPGQHTTSTTFFWVINLLLCFPKV LNKLTEEVRSKLGNRLPTLEDRNSLSYVDAVLTEVEN*TIVFNFVAETCXSACHCHHLEV WXL*TNFNSFTMMDVLIFLIRSGAK >GCiWno539_p21.b1_2 DLASEYRAESETKPAGRQIRDKNDKRLTKAVI*KPQSLISKRQ*TYLLINRSRTLTFKFP FSKKTSNLRLIACFACKQVCVIKLCYQKPTAVMCIF*FCILVQIY*VFNDNSV*I*SCLL IKMQSTKTQVFTILC**VSYILLL*ILICVFLYLFLFQANTQLLQLFSGS*IYSYVFQKS SINSRKKSGANSETDFQPWRIETPYLTWTRY*QR*KIKRLYLISLQKHVVVPAIATTWKY GACKRTLIHLQ*WMYXFFLYVAGQ >GCiWno539_p21.b1_3 TSPPNTALSPKRNQQADKYVTKTINV*PKQ*SKSHKV*SPSDNKRTY*STEAARSRLNFH FPKKLAIYG*LPVLLVNKFVL*SYATKSRLR*CVYSNSAFWFRFTEFSMITAFRFNLVCL LKCKVRKLRCLLSFANKFLTFYYYKS*SVFFYIYFYSRPTHNFYNFFLGHKFTPMFSKSP Q*THGRSPEQTRKQTSNLGGSKLPILRGRGTDRGRKLNDCI*FRCRNMX*CLPLPPPGSM XLVNEL*FIYNDGCTXFSYT*RGK Ortholog 62% KDTNEVRSKIGERIPTLEDQADLPYVEAFLTE (?) VLRFASPLSSTIPHSTVKDTTLKGYKIKRNTMVIISQYSVNHDPKIWRNPEVFDPERFLTRD ENTNLLFNDALAEKVLSFSVGERKCPGSRMSQMVLFLATCLLVHTGTLYPNPDRPPSPVD DAQYGLILRPEYISMKFLLDKKWTNFGGNAVLNQKVNFIPFNSTPIPVDIAPIRVNFI* >scf/ciona01/G126/seq_dir/hrs/G126P69880F.T0/G126P69880FD5.T0.seq 765 0 765 ABI Length = 765 Plus Strand HSPs: Score = 210 (73.9 bits), Expect = 6.9e-17, P = 6.9e-17 Identities = 38/55 (69%), Positives = 47/55 (85%), Frame = +2 Query: 1 HTTSTTFFWVINLLLCFPKVLNKLTEEVRSKLGNRLPTLEDRTSLPYMDAVLTEV 55 intetinalis seq 67 HTTS TFFWVIN+LL +PKVL ++T EVRSK+G R+PTLED+ LPY++A LTEV Sbjct: 317 HTTSGTFFWVINILLFYPKVLQRITNEVRSKIGERIPTLEDQADLPYVEAFLTEV 481 >scf/ciona01/G126/seq_dir/hrs/G126P69880F.T0/G126P69880FD5.T0.seq_1 765 0 765 ABI SLRYEPRFVVGIHSHTDNRQITLRSPSGYQSYFSVLCMIQAFLLFGRTHQSTEFRQCALS SLPKDDQLDSDIVKPATL*SKGNAPNHHAIGQTNSFMTNFHAYRTTHNIRNVFLGDKYSS LLPESPSKDYE*SPE*DRRKNSDFGRPSRSSIR*SIFD*GIK*YLQLICRLKKGCIVLPI LPLIRQNNLVV*YVLLTERL*VQNWTLACRLCLWARHLTDIA*TQRNNGFYQIEGKCLSY TTRCNSSDSRTVGAG >scf/ciona01/G126/seq_dir/hrs/G126P69880F.T0/G126P69880FD5.T0.seq_2 765 0 765 ABI ACGMNLALWXEFIHTRTIVR*PCAHRRVTRATSVCCV*FRRFFYLVEPTNPLNLGNVR*V LCLKTTN*TATLSSPQPFSRKATHQTTMLSVRPTHL*PISTHTGQHTTSGTFFWVINILL FYPKVLQRITNEVRSKIGERIPTLEDQADLPYVEAFLTEV*NNIFS*SVG*KRVV*FCLF YL*SDRII*WFSTSF*LKGCRFKTGH*LVVYVCGQGT*QTLPKPSGIMGFTKLKESVYHI QHAAIAQIAGQWAQ >scf/ciona01/G126/seq_dir/hrs/G126P69880F.T0/G126P69880FD5.T0.seq_3 765 0 765 ABI PAV*TSLCGXNSFTHGQSSDNLALTVGLPELLQCVVYDSGVSSIW*NPPIH*I*AMCVKF FA*RRPIRQRHCQARNPLVERQRTKPPCYRSDQLIYDQFPRIQDNTQHQERFSG**IFFS STRKSFKGLRMKSGVRSEKEFRLWKTKPIFHTLKHF*LRYKIISSADL*VKKGLYSFAYF TSNPTE*SSGLVRPFN*KVVGSKLDTSLSFMSVGKALNRHCLNPAE*WVLPN*RKVSIIY NTLQ*LR*PDSGRR >scf/ciona01/G126/seq_dir/hrs/G126P603022F.T0/G126P603022FC12.T0.seq 726 0 726 ABI SEI*YLATGGGILQALKGNQKVIMTRLHCVRQLITTTRSRKTAGTFIGHVFLYIGKSVDE FTVALRLHCNKACQVTAF*CLGLVDSIDRLFRIIWHVDHTLSKPNQ*LCVV**QMWYFTD *DRIEY*CLSP*MGKGKGVNTRTIVR*PCAHRRVTRATSVCCV*FRRFFYLVEPTNPLNL GNVR*VLCLKTTN*TATLSSPQPFSRKATHQTHMLSVRPTHL*PISPHTGQHPHQERFSG *Y >scf/ciona01/G126/seq_dir/hrs/G126P603022F.T0/_2 RRSDISPLVVEFYKRLKAIRK*L*LDYIVCAN*SLPHGHGKPLARL*VTFFCI*ANQSTN LRWR*DYIAIKLAKLLHFDVWD*WIQLTVCLGLFGM*TIHCPNQTNDFVLFNNKCGILPI RIE*NINVYPREWEKARGLTHGQSSDNLALTVGLPELLQCVVYDSGVSSIW*NPPIH*I* AMCVKFFA*RRPIRQRHCQARNPLVERQRTKPTCYRSDQLIYDQFPPIQDNTHIRNVFLG D >scf/ciona01/G126/seq_dir/hrs/G126P603022F.T0/_3 GDLISRHWWWNSTSA*RQSESDYD*TTLCAPINHYHTVTENRWHVYRSRFFVYRQISRRI YGGVKITLQ*SLPSYCILMFGISGFN*PFV*DYLACRPYTVQTKPMTLCCLITNVVFYRL G*NRILMFIPVNGKRQGG*HTDNRQITLRSPSGYQSYFSVLCMIQAFLLFGRTHQSTEFR QCALSSLPKDDQLDSDIVKPATL*SKGNAPNPHAIGQTNSFMTNFPPYRTTPTSGTFFWV I >scf/ciona01/G126/seq_dir/hrs/G126P68147F.T0/G126P68147FG5.T0.seq 733 0 733 ABI Length = 733 Minus Strand HSPs: Score = 228 (80.3 bits), Expect = 8.8e-19, P = 8.8e-19 Identities = 45/47 (95%), Positives = 46/47 (97%), Frame = -2 Query: 14 QALKGNQKVIMTRLHCVRQLITTTRSRKTAGTFIGHVFLYIGKSVDE 60 +ALKGNQKV MTRLHCVRQLITTTRSRKTAGTFIGHVFLYIGKSVDE Sbjct: 282 KALKGNQKVKMTRLHCVRQLITTTRSRKTAGTFIGHVFLYIGKSVDE 142 >scf/ciona01/G126/seq_dir/hrs/G126P68147F.T0/_4 QVVCLLRLICVEIYMIGTLKMWHRCTGGVLIKVD*RTNINGRVFGNMAQMDRWCAYQGLF VWKYI*SAL*KCGTDVQVVCLSRLINVQI*RTIEMLHRLFCVQRSTVGIPVNK*HAYYFY LCTNVYGRDFGTLLTNFYAQFS*NWVVSTYKALKGNQKVKMTRLHCVRQLITTTRSRKTA GTFIGHVFLYIGKSVDEFTVALRLHCNKACQVTAF*CLGLVDSIDRLFRIMGFHXQEEGF IXPV >scf/ciona01/G126/seq_dir/hrs/G126P68147F.T0/_5 TGGVLIKVDLCGNIYDRHFENVAQMYRWCAYQG*LTYKYKWSGLWKYGTDGQVVCLSRFI CVEIYMIGTLKMWHRCTGGVLIKVD*RTNITYNRNVAQAFLCAKIYSRDPSKQVTCLLLL FVYKCIWSRLWNSAYEFLRTVFVELGCEYI*SA*RQSESEND*TTLCAPINHYHTVTENR WHVYRSRFFVYRQISRRIYGGVKITLQ*SLPSYCILMFGISGFN*PFV*DYGFPPTGRGV YXPSX >scf/ciona01/G126/seq_dir/hrs/G126P68147F.T0/_6 RWCAY*G*FVWKYI*SAL*KCGTDVQVVCLSRLINVQI*MVGSLEIWHRWTGGVLIKVYL CGNIYDRHFENVAQMYRWCAYQG*LTYKYNVQ*KCCTGFFVCKDLQSGSQ*TSNMLITFI CVQMYMVETLELCLRISTHSFRRTGL*VHIKRLKAIRK*K*LDYIVCAN*SLPHGHGKPL ARL*VTFFCI*ANQSTNLRWR*DYIAIKLAKLLHFDVWD*WIQLTVCLGLWVSTXRKRGL XPQS >GCiWno609_a08.b1 CHROMAT_FILE: GCiWno609_a08.b1 PHD_FILE: GCiWno609_a08.b1.phd.1 CHEM: term DYE: big TIME: Mon Oct 29 10:00:32 2001 TEMPLATE: GCiWno609_a08 DIRECTION: fwd Length = 875 Score = 47.3 bits (110), Expect = 3e-05 Identities = 21/32 (65%), Positives = 26/32 (80%) Frame = +2 Query: 1 KDTNEVRSKIGERIPTLEDQADLPYVEAFLTE 32 K T EVRSK+G R+PTLED+ LPY++A LTE Sbjct: 371 KLTEEVRSKLGNRLPTLEDRTSLPYMDAVLTE 466 best match to savignyi ortholog >scf/ciona01/G126/seq_dir/hrs/G126P65894F.T0/_4 PGITRNYXAYPINNSNVCSSDLYFRKGKV*F*LS*FFLLLCSSIYKQ*MYQIITREQGRP KKRALV*HVINRRGISSDGIQKVRMDSVEPVFGTSG*SPIRFLLFYRH*TF*GTCC**VR YKR*PVRKILNPITGYMAVL*LENFKV*TLIPFTGKFTFILNAISRSCVLRLLYPAPYHI PRQRTRHLKVTKSNEIRW*S*ASILSITIRKSGGIPKFLTPNGF*QEMRTRRNPPQGENQ >scf/ciona01/G126/seq_dir/hrs/G126P65894F.T0/_5 GDNTKLXCLSHK*QQCLFF*SVF*KGKSLVLVELVFFITLL*YL*TVNVPNHNT*TG*TE KTSTRLTRNQ*EGYKQRWDSKGSHGFGRTRFWNVGIITDPILAFLQTLDLLGNLLLVSTI QKITCS*NFESHHWLYGRIMIREF*SLNSDTIYW*IYFYTERHFQVLRFASPLSSTIPHS TTKDTTLKGYKIKRNTMVIISQYSVNHDPKIWRNPEVFDPERFLTRDENTKKSTTGRESX >scf/ciona01/G126/seq_dir/hrs/G126P65894F.T0/_6 RG*HEIXLPIP*ITAMSVLLICILEREKFSFS*VSFFYYFALVFINSKCTKS*HVNRVDR KNEHSFNT*SIGGV*AAMGFKRFAWIRSNPFLERRDNHRSDSCFFTDIRPFREPVVSKYD TKDNLFVKF*IPSLVIWPYYD*RILKFKL*YHLLVNLLLY*TPFPGPAFCVSSIQHHTTF HDKGHDT*RLQNQTKYDGNHKPVFCQSRSENLAESRSF*PRTVFNKR*EHEEIHHRARIX >scf/ciona01/G126/seq_dir/hrs/G126P69755F.T0/G126P69755FH8.T0.seq 752 0 752 ABI Length = 752 Plus Strand HSPs: Score = 264 (92.9 bits), Expect = 3.3e-28, Sum P(2) = 3.3e-28 Identities = 54/59 (91%), Positives = 54/59 (91%), Frame = +3 Query: 49 GITRNYXAYPINNSNVCSSDLYFRKGKV*F*LS*FFLLLCSSIYKQ*MYQIITREQGRP 107 GI N YPINNSNVCSSDLYFRKGKV*F*LS*FFLLLCSSIYKQ*MYQIITREQGRP Sbjct: 486 GINTNILPYPINNSNVCSSDLYFRKGKV*F*LS*FFLLLCSSIYKQ*MYQIITREQGRP 662 Score = 68 (23.9 bits), Expect = 3.3e-28, Sum P(2) = 3.3e-28 Identities = 13/32 (40%), Positives = 19/32 (59%), Frame = +1 Query: 16 KIENELNEVLDDYLPTLHDQESLPHTMAFINE 47 K NE+ + + +PTL DQ LP+ AF+ E Sbjct: 55 KDTNEVRSKIGERIPTLEDQADLPYVEAFLTE 150 >scf/ciona01/G126/seq_dir/hrs/G126P65113R.T0/G126P65113RH6.T0.seq 741 file 3 741 ABI Length = 741 Plus Strand HSPs: Score = 478 (168.3 bits), Expect = 2.8e-45, P = 2.8e-45 Identities = 89/143 (62%), Positives = 117/143 (81%), Frame = +3 Query: 2 RFSSPLSSTIPHSTLKDVKLAGHTIKRGTMVIISQYAVNHDPQNWKNPENFDPERFLTKN 61 RF+SPLSSTIPHST+KD L G+ IKR TMVIISQY+VNHDP+ W+NPE FDPERFLT++ Sbjct: 183 RFASPLSSTIPHSTVKDTTLKGYKIKRNTMVIISQYSVNHDPKIWRNPEVFDPERFLTRD 362 Query: 62 EGGEIIFNESLSEKVLAFSIGERKCPGSQLSRMLLFLATTLLVQVSDLSADLERPPTAA- 120 E ++FN++L+EKVL+FS+GERKCPGS++S+M+LFLAT LLV L + +RPP+ Sbjct: 363 ENTNLLFNDALAEKVLSFSVGERKCPGSRMSQMVLFLATCLLVHTGTLYPNPDRPPSPVD 542 Query: 121 -AEYGLILRPKHLSIKLTLREHW 142 A+YGLILRP+++S+K L + W Sbjct: 543 DAQYGLILRPEYISMKFLLDKKW 611 >LQW275808.x1_4 LHGADVVLSPRVVGISLLLLARDATFRVSSLALLRDIGVLFWATLLPLSPRGSGFEPT*F FTERWNFFLYLRGQPIVKEPGIVTNSPWPAYQLPHRDGSRDFLEYFLL*FDISIST*FFR FSSPLSSTIPHSTLKDVKLAGHTIKRGTMVIISQYAVNHDPQNWKNPENFDPERFLTKNE GGEIIFNESLSEKVLAFSIGERKCPGSQLSRMLLFLATTLLVQVSDLSADLERPPTAAAE YGLILRPKHLSIKLTLREHWQRRDSIRA*HSIFYKCTNI*CTENPIRFCENIT >LQW275808.x1_5 LARCRCCFVTTCCGYFFASIGTRCDLPGLLFSAAAGYRGFILGNAFAPLPPREWV*TDLI LHGEVELFSILTGTTHC*RTGDSYKQPVARLPVTTQRW**RFFRIFFVMI*YFYFYVVFP VFVAFIQHYTTFYVKRRQTSRPHH*ERHYGYH*SIRCKPRPAKLEKSGKF*PRAISNEKR RR*NYLQRKFIRKGSRIFDWGA*MSRKSIVTNVTIFGHYTAGSSQ*FICRSRAPTDGSGG VWFNFTTKTLIHKIDTKRALATS*LNSRITQHILQVYQHLMH*KSYTIL*KHHX >LQW275808.x1_6 SCTVPMLFCHHVLWVFLCFYWHAMRPSGSPL*RCCGISGFYFGQRFCPSPPAGVGLNRLD SSRRGGTFFYTYGDNPLLKNRG*LQTARGPLTSYHTEMVVEIF*NIFCYDLIFLFLRSFS GFRRLYPALYHILR*KTSN*QATPLREALWLSLVNTL*TTTRKIGKIRKILTQSDF*RKT KAVKLSSTKVYQKRFSHFRLGSVNVPEVNCHECYYFWPLHCWFKSVIYLPISSAHRRQRR SMV*FYDQNTYP*N*H*ESTGNVVTQFAHNTAYFTSVPTFDALKILYDFVKTSP >GCiWno755_d15.b1 TTATATAATTGCACTCTATGGTAATAATACTTGCATATAGGTAAGTTAACGTTCATAAAGTGATCTGTGGTGTTTTGTGT ACCTTTTTTCATTTTTTCATTTGTGTATTTTCACAAAATCGTATAAGATTTTCAGTGCATCAAATGTTGGTACACTTGTA AAAAATGCTGTGTTATGCGCGAATTGAGTCACGACGTTGCCAGTGCTCTCTTAGTGTCAATTTTATGGATAAGTGTTTTG GTCGTAAAATTAAACCATACTCCGCCGCCGCCGTCGGTGGGCGCTCGAGATCGGCAGATAAATCACTGACTTGAACCAGC AGTGTAGTGGCCAAAAATAGTAACATTCGTGACAATTGACTTCCGGGACATTTACGCTCCCCAATCGAAAATGCGAGAAC CTTTTCTGATAAACTTTCGTTGAAGATAATTTCACCGCCTTCGTTTTTCGTTAGAAATCGCTCTGGGTCAAAATTTTCCG GATTTTTCCAATTTTGCGGGTCGTGGTTTACAGCGTATTGACTAATGATAACCATAGTGCCTCTCTTAATGGTGTGGCCT GCTAGTTTGACGTCTTTTAACGTAGAATGTGGTATAGTGCTGGATAAAGGCGACGAAAACCGCCAAACCTACGTAGAAAT AGAAATTTAAAATCTTTACAAAAATATTTTTAAAAAATCTCTACTACCATATATGTGTGGTAACTTGTAAAGCGTCACGG CATGTATGAAACATACCACCTGTGCTTAAATACCACTGTCTTTGCCCCGCTACGCTATAGAAAAATAGGTAACATCATTC ATGGAAATGAATTAATGGTCGTTTAACAACCCAAACTTTCAGGTTGGTGGCAATGGCAANCACTAACCATGTTCCTGCAC AAAATAAAAAAAATCCTTAATTTTTT >_4 KKLRIFFILCRNMVSXCHCHQPESLGC*TTINSFP*MMLPIFL*RSGAKTVVFKHRWYVS YMP*RFTSYHTYMVVEIF*KYFCKDFKFLFLRRFGGFRRLYPALYHILR*KTSN*QATPL REALWLSLVNTL*TTTRKIGKIRKILTQSDF*RKTKAVKLSSTKVYQKRFSHFRLGSVNV PEVNCHECYYFWPLHCWFKSVIYLPISSAHRRRRRSMV*FYDQNTYP*N*H*ESTGNVVT QFAHNTAFFTSVPTFDALKILYDFVKIHK*KNEKRYTKHHRSLYER*LTYMQVLLP*SAI I* >_5 KIKDFFYFVQEHG*XLPLPPT*KFGLLNDH*FISMNDVTYFSIA*RGKDSGI*AQVVCFI HAVTLYKLPHIYGSRDFLKIFL*RF*ISIST*VWRFSSPLSSTIPHSTLKDVKLAGHTIK RGTMVIISQYAVNHDPQNWKNPENFDPERFLTKNEGGEIIFNESLSEKVLAFSIGERKCP GSQLSRMLLFLATTLLVQVSDLSADLERPPTAAAEYGLILRPKHLSIKLTLREHWQRRDS IRA*HSIFYKCTNI*CTENLIRFCENTQMKK*KKVHKTPQITL*TLTYLYASIITIECNY IX >_6 KN*GFFLFCAGTWLVXAIATNLKVWVVKRPLIHFHE*CYLFFYSVAGQRQWYLSTGGMFH TCRDALQVTTHIW**RFFKNIFVKILNFYFYVGLAVFVAFIQHYTTFYVKRRQTSRPHH* ERHYGYH*SIRCKPRPAKLEKSGKF*PRAISNEKRRR*NYLQRKFIRKGSRIFDWGA*MS RKSIVTNVTIFGHYTAGSSQ*FICRSRAPTDGGGGVWFNFTTKTLIHKIDTKRALATS*L NSRITQHFLQVYQHLMH*KSYTIL*KYTNEKMKKGTQNTTDHFMNVNLPICKYYYHRVQL YX >GCiWno674_m24.b1_4 YSRPPHNXYNFXWVIINSXVSKVPQ*THGRSPEQLXXQTSNLXDRNSLSYVDAVLTEVXN *TIVFNFVAETCVSACHCHQPGRYGFVKRTFNSFTMNDCNLFFL*RSGAKTVVIKHRWYV SYMP*PLTSYHTYIVVEIF*NIFCYDFIFLFLRRFCGFRRLYPALYHILR*KTSN*QATP LREALWLSLVNTL*TTTRKIGKIRKILTQSDF*RKTKAVKLSSTKVYQKRFSHFRLGSVN VPEVNCHECYYFWPLHCWFKSVIYLPISSAHRRRRRSMV*FYDQNTYP*N*H*E >GCiWno674_m24.b1_5 LFQATTQLXQLXLGHN*LXCFQSPSINSRKKSGATRKXDFQLXGSKLPILRGRGTDRGRX LNDCI*FRCRNMC*CLPLPPAWKVWVCKTNI*FIYNE*L*LIFLIA*RGKDSCYKAQVVC FIHAVTAYKLPHIYCSRDFLKYFLL*FYISIST*VLRFSSPLSSTIPHSTLKDVKLAGHT IKRGTMVIISQYAVNHDPQNWKNPENFDPERFLTKNEGGEIIFNESLSEKVLAFSIGERK CPGSQLSRMLLFLATTLLVQVSDLSADLERPPTAAAEYGLILRPKHLSIKLTLRX >GCiWno674_m24.b1_6 FIPGHHTTXTTXFGS*LTLMFPKSLNKLTEEVRSNSXXRLPTXRIETPYLTWTRY*QR*X IKRLYLISLQKHVLVPAIATSLEGMGL*NEHLIHLQ*MIVTYFSYSVAGQRQLL*STGGM FHTCRDRLQVTTHIL**RFFKIFFVMILYFYFYVGFAVFVAFIQHYTTFYVKRRQTSRPH H*ERHYGYH*SIRCKPRPAKLEKSGKF*PRAISNEKRRR*NYLQRKFIRKGSRIFDWGA* MSRKSIVTNVTIFGHYTAGSSQ*FICRSRAPTDGGGGVWFNFTTKTLIHKIDTKX >GCiWno874_c22.b1_1 NCPCPPTLRINS*IHSSMVATVGFELTSPPNTALSPKRNQQADKYVTKTINV*PKQ*SKS HKV*SPSDNKRTY*STEAARSRLNFHFPKKLAIYG*LPVLLVNKFVL*SYATKSRLR*CV YSNSAFWFRFTEFSMITAFRFNLVCLLKCKVRKLRCLLSFANKFLTFYYYKS*SVFFYIY FYSRPTHNFYNFFLGHKFTPMFSKSPQ*THGRSPEQTRKQTSNLGGSKLPILRGRGTDRG RKLNDCIYFRCRHMCYCLPXAPAWEVWVXNTTIYFIYHDCMLLIFLIA*RGQDX >GCiWno874_c22.b1_2 TVLAPQR*G*IVKFIHPW*QQ*DSNSPRLRIPR*VRNETSRQTNT*QKR*TSNQSSNLKA TKFNLQATINVPTDQQKPHAHV*ISIFQKN*QSTVNCLFCL*TSLCYKVMLPKADCGDVY ILILHFGSDLLSFQ**QRLDLILSAY*NAKYENSGVYYPLLISFLHSIIINLNLCFFIFI FIPGQHTTSTTFFWVINLLLCFPKVLNKLTEEVRSKLGNRLPTLEDRNSLSYVDAVLTEV EN*TIVFTFVADTCVTACHXHQPGRYGXVTRPFTSFTMTACYLFFL*RSGGKT >GCiWno874_c22.b1_3 LSLPPNAEDK*LNSFIHGSNSRIRTHLASEYRAESETKPAGRQIRDKNDKRLTKAVI*KP QSLISKRQ*TYLLINRSRTLTFKFPFSKKTSNLRLIACFACKQVCVIKLCYQKPTAVMCI F*FCILVQIY*VFNDNSV*I*SCLLIKMQSTKTQVFTILC**VSYILLL*ILICVFLYLF LFQANTQLLQLFSGS*IYSYVFQKSSINSRKKSGANSETDFQPWRIETPYLTWTRY*QR* KIKRLYLLSLQTHVLLPAIXTSLGGMGX*HDHLLHLP*LHATYFSYSVAGAR >sequence 68 2 accessions 44% to 2U1 GIQGQVTQMETVYSLTYEQLVAM (0) CRDLFMAGTDTTSSTTSWIILFLCRYPEVQRKMQEEADQVLGSNGEPKMALAEKMPYTR (2?) FFFQEINRIRPNVPLSVPHYSSKDTMV 116 MGYKIPKDTIVLTNIWGIHHDEKLWKNPYDFNPERHLDSNGKFIK 334 SSKVIQFNIGLRSCLGQQLANMELFLVTVSIFRQFSFSFNPGDKIDM 193 EGESVIALRPYSYRVI (?) DCYVPIFLLYFPTIHPGCWSEKGTHAWRVGLCPLCSCKLLSM* LQW19026.x1 DEV2228.y1 LQW213586.x1 cicl021m24 >LQW213586.x1_4 PXHTVRRKEGPRAPTVPLGSYNLQRAYFVWTTPAVPSRP*SEPEATRRIIAKGLMSTPET GRSERPDDCGEV*GIQGQVTQMETVYSLTYEQLVAMVSVGYGKKYVSARLANGFFELNYC KLYLSNKSYFHKYLGTYNISVQLFSQPPRGRQH*ALPVHKVK*ICYYCL*QILNALPFSV EISSWREPIQHHQQLLGSFSSSVDTRRFRGRCKKKRIKFLDQMENQRWHLLRRCLTRELL FR*KEFSSFVLVALLYA*KAMVYSMWRVENKDFSSRKLTGYAQMSHSLYLTIPLRIQWSW DTRFQRTPSY*LTSGEFTMMRNCGKTHTTLIQRGILT >LQW213586.x1_5 SSPHGKAEGGAASAHSAPWELQPPTRVLRVDHPSRTVTAVK*ARGHKAYNSQRAHVHTRN RQVRTTRRLW*SMRDSGTGDPNGNSILFDI*ATCGNGKCRLWKEICKCKTCKRFF*VKLL QALFV*QELFSQIFRYL*HIGTTIFSATKRKAALSLTSAQSKMNMLLLLITNIECFAFQC RDLFMAGTDTTSSTTSWIILFLCRYPEVQRKMQEEADQVLGSNGEPKMALAEKMPYTRAV IQVERVF*FCVSCITVCMKGNGV*HVAGRK*RFFFQEINRIRPNVPLSVPHYSSKDTMVM GYKIPKDTIVLTNIWGIHHDEKLWKNPYDFNPERHLDX >LQW213586.x1_6 LXTR*GGRRGRERPQCPLGATTSNARTSCGPPQPYRHGRKVSQRPQGV**PKGSCPHQKQ AGQNDQTTVVKYEGFRDR*PKWKQYTL*HMSNLWQW*V*VMERNM*VQDLQTVFLS*ITA SSICLTRVIFTNI*VPITYRYNYFLSHQEEGSTKPYQCTK*NEYATTAYNKY*MLCLSVS RSLHGGNRYNIINNFLDHSLPLSIPGGSEEDARRSGSSSWIKWRTKDGTC*EDALHASCY SGRKSFLVLC*LHYCMHERQWCIACGG*KIKIFLPGN*PDTPKCPTLCTSLFL*GYNGHG IQDSKGHHRTN*HLGNSP**ETVEKPIRL*SREAS*P >cicl021m24 Length = 596 Score = 197 bits (495), Expect = 6e-50 Identities = 92/92 (100%), Positives = 92/92 (100%) Frame = -2 Query: 1 MGYKIPKDTIVLTNIWGIHHDEKLWKNPYDFNPERHLDSNGKFIKSSKVIQFNIGLRSCL 60 MGYKIPKDTIVLTNIWGIHHDEKLWKNPYDFNPERHLDSNGKFIKSSKVIQFNIGLRSCL Sbjct: 559 MGYKIPKDTIVLTNIWGIHHDEKLWKNPYDFNPERHLDSNGKFIKSSKVIQFNIGLRSCL 380 Query: 61 GQQLANMELFLVTVSIFRQFSFSFNPGDKIDM 92 GQQLANMELFLVTVSIFRQFSFSFNPGDKIDM Sbjct: 379 GQQLANMELFLVTVSIFRQFSFSFNPGDKIDM 284 >cicl021m24 AAACTACAATGGNAGTATAGGGTACCAGCCACATATGAATGCCGGCACCAATGAACATGATGAACAGCAGCACAGNATAA AAGGACATATAATGCCACTGGGTAAGCTACATGGATAGAAGTTTGCAGCTACATAGAGGACATAGCCCAACTCTCCAAGC ATGAGTGCCTTTTTCACTCCAACAACCCGGATGAATAGTGGGGAAATAAAGAAGGAAGATAGGAACGTAACAATCAATTA CCCTGTATGAGTAAGGTCTTAAAGCAATTACGCTCTCACCTTCCATGTCTATCTTATCCCCTGGATTAAACGAGAAAGAA AATTGTCGGAAAATTGATACTGTGACCAAGAACAACTCCATGTTTGCCAGCTGTTGACCAAGGCAGCTTCGGAGACCGAT ATTAAACTGAATTACTTTGCTTGATTTAATAAACTTGCCATTTGAATCAAGATGCCTCTCTGGATTAAAGTCGTATGGGT TTTTCCACAGTTTCTCATCATGGTGAATTCCCCAGATGTTAGTTAGTACGATGGTGTCCTTTGGAATCTTGTATCCCATG ACCATTGTATCCTTAGAGGAATAGTGAGGTACAGAG SVPHYSSKDTMVMGYKIPKDTIVLTNIWGIHHDEKLWKNPYDFNPERHLDSNGKFIKSSK VIQFNIGLRSCLGQQLANMELFLVTVSIFRQFSFSFNPGDKIDMEGESVIALRPYSYRVI DCYVPIFLLYFPTIHPGCWSEKGTHAWRVGLCPLCSCKLLSM* >sequence 58, 70 2 accessions 45% to 2R1 KIQLYHLIRDIFVGGIDTTTATLGWGIICLLHYPECQIRIQEEIEDVIG NSEPDMTHQEHMPYLRAFVQEVHRYCTIAPFSIPHCVTEDCVLFGYHIPK STPVMSNIWRVHNDPKYWKNPEKFSP 199 ERHLDLEGRFVPSNRVLPFAVGHRRCVGEQMAKVGLFLFWASFLQKCE 238 IHIDSDFGLPSWKKEPSGTVRSPQEFTVKVRNRLQNN* LQW195444.x1 DEV32479.y1 LQW231798.y1 >_4 MPP*HLLKIFNWSHLLDINPVLFLNYSRTKFLLFL*PRKYM*AIHNCETYH*INTTK**N KLALGYYI**RVGDLWNIISRYPDRVF*KNNNSTIL*YIINKLTHVKNLHIGNSEPDMTH QEHMPYLRAFVQEVHRYCTIAPFSIPHCVTEDCVLFGFHIPKSTPVMSNIWRVHNDPKYW KNPEKFSPERHLDLEGRFVPFNRVLPFAVGHRRCVGEQMAKVGLFLFWASFLQKCEIHID SDFGLPSWKKEPSGTVRSPQEFTVKVRNRLQNN*TV*IRIKLTCCTNKSLLLSYILNKAC *YFLQIIWYSR*ALP >_5 NASLTSFEDFQLVPPLGY*SRPVS*LFPNQIFTFPIATKIHVSNPQL*NLPLD*YY*IVK QIGPRLLYIVACGGSLEHNIQIS*PCFLKK*QLYYTIIYNQQTYPR*ELAYR*FRTRYDT SRTHAVSSCFCTRSPQILHHSSVQYSPLRH*RLRSFWFPHTEVDTGDEQYMESPQRSEIL EKSGEIFP*TSLRFRRSIRSI*SCSAICCRP*TLRWRTNGKGWSVSILGFIFAEMRNSH* L*LWFT*LEERTFWNRAISTGVYSQSSKSFTE*LNSIDSYKVNLLYK*IITFIVYPK*SV LIFLTDYLV**VSTAX >_6 *CLPNIF*RFSIGPTSWILIPSCFLIIPEPNFYFSYSHENTCKQSTTVKLTIRLILLNSK TNWPSVIIYSSVWGIFGT*YPDILTVFFKKITTLLYYNI*STNLPTLRTCI*VIPNQI*H IKNTCRIFVLLYKKSTDIAP*LRSVFPTASLKTAFFLVSTYRSRHR**AIYGESTTIRNI GKIRRNFPLNVT*I*KVDSFHLIVFCHLLSAIDAALENKWQRLVCFYSGLHFCRNAKFTL TLTLVYLVGRKNLLEPCDLHRSLQSKFEIVYRITKQYRFV*S*LAVQINHYFYRIS*IKR VDISYRLFGIVGKHCP >GCiWno479_m09.b1 CHROMAT_FILE: GCiWno479_m09.b1 PHD_FILE: GCiWno479_m09.b1.phd.1 CHEM: term DYE: big TIME: Mon Oct 15 11:33:18 2001 TEMPLATE: GCiWno479_m09 DIRECTION: fwd Length = 888 Score = 236 bits (596), Expect(2) = 5e-66 Identities = 105/108 (97%), Positives = 107/108 (98%) Frame = +2 Query: 1 PDMTHQKHMPYLRAFVQEVHRYCTIAPFSIPHCVTEDCVLFGYHIPKSTPVVSNIWRVHN 60 PDMTHQKHMPYLRAFVQEVHRYCTIAPFSIPHCVTEDCVLFGYHIPKSTPV+SNIWRVHN Sbjct: 326 PDMTHQKHMPYLRAFVQEVHRYCTIAPFSIPHCVTEDCVLFGYHIPKSTPVMSNIWRVHN 505 Query: 61 DPKYWKNPEKFSPERHLDLEGRFVPSNRVLPFAVGQRRCVGEQMAKVG 108 DP+YWKNPEKFSPERHLDLEGRFVPSNRVLPFAVG RRCVGEQMAKVG Sbjct: 506 DPEYWKNPEKFSPERHLDLEGRFVPSNRVLPFAVGHRRCVGEQMAKVG 649 Score = 36.4 bits (82), Expect(2) = 5e-66 Identities = 14/16 (87%), Positives = 16/16 (99%) Frame = +3 Query: 106 KVGLFLFWASFLQKCE 121 ++GLFLFWASFLQKCE Sbjct: 642 RLGLFLFWASFLQKCE 689 >GCiWno479_m09.b1_1 MLSVHARIFFSVLVCVINPT*NIPIC*SILQKYVKKTLRIRMYIAYLYS*HKICPYGLFI L**GRGSLEHNIQIS*PCFKKNNNPLYYTITHNQQTYPR*ELAYR*FRTRYDTSKTHAVS SCFCTRSPQILHHSSVQYSPLRH*RLRSLWLPHTEVDTGDEQYMESPQRPGILEKSGEIF P*TSLRFRRSIRSI*SCSAVRCRP*TLRWRTNGKGWVCFYSGLHFCRNAKITLTLTLVYL VGRKNLSGTVRSXQEFTIKVRKSLQNN*TV*IRIKLLAVQINITFFIIPNLNVLIS >GCiWno479_m09.b1_2 CYRYTREYSLVF*SAL*IQHEIFQFAKAYYKNMLKKLYV*ECI*LIYIVNTKFAPTVYLY YSRVGDLWNIISKYPDRVLKKITTHSTIL*HIINKLTHVKNLHIGNSEPDMTHQKHMPYL RAFVQEVHRYCTIAPFSIPHCVTEDCVLFGYHIPKSTPVMSNIWRVHNDPEYWKNPEKFS PERHLDLEGRFVPSNRVLPFAVGHRRCVGEQMAKVGSVSILGFIFAEMRKSH*L*LWFT* LEERTFLEPCDLHRSLQSKFENRYRITKQYRFX*SYLLYK*TLLFLSYLT*TC*Y >GCiWno479_m09.b1_3 VIGTRENIL*CFSLRYKSNMKYSNLLKHITKIC*KNFTYKNVYSLFI*LTQNLPLRFIYI IVG*GIFGT*YPNILTVF*KK*QPTLLYYNT*STNLPTLRTCI*VIPNQI*HIKNTCRIF VLLYKKSTDIAP*LRSVFPTASLKTAFSLVTTYRSRHR**AIYGESTTTRNIGKIRRNFP LNVT*I*KVDSFHLIVFCRSLSAIDAALENKWQRLGLFLFWASFLQKCENHIDSDFGLPS WKKEPFWNRAIXTGVYNQSSKIVTE*LNSIDSXKVTCCTNKHYFFYHT*PKRADI >SEQUENCE 71 NEW 74% TO SEQ 29 39% TO 2C9 MLDILLSCIRAWFSTITLSIIV FYVTWHYWNKRTPGSPPGPRGFPFIGAITSIRKHPEHVMTKWNKEYGPVCMVRLGFKDVL VIGSYEAAHEAYVKSQDFLDRPSPFGLEILGGGYGLFPIAYGSFHQEQRRFGLNTLREHG MXTKVLESTILXYAXGACDRLETKMSAPVLLDQEVYIAVSSTIAHMXVGHNTMXDAXSFV I >GCiWno534_n18.g1 CHROMAT_FILE: GCiWno534_n18.g1 PHD_FILE: GCiWno534_n18.g1.phd.1 CHEM: term DYE: big TIME: Thu Oct 18 11:46:28 2001 TEMPLATE: GCiWno534_n18 DIRECTION: rev Length = 914 Score = 235 bits (593), Expect = 2e-61 Identities = 109/112 (97%), Positives = 110/112 (97%) Frame = +3 Query: 1 PPGPRGFPFIGAITSIRKHPEHVMTKWNKEYGPVCMVRLGFKDVLVIGSYEAAHEAYVKS 60 PPGPRGFPFIGAITSIRKHPEHVMTKWNKEYGPVCMVRLGFKDVLVIGSYEAAHEAYVKS Sbjct: 408 PPGPRGFPFIGAITSIRKHPEHVMTKWNKEYGPVCMVRLGFKDVLVIGSYEAAHEAYVKS 587 Query: 61 QDFLDRPSPFGLEILGGGYGLFPIAYGSFHQEQRRFGLNTLREHGMGRRVLE 112 QDFLDRPSPFGLEILGGGYGLFPIAYGSFHQEQRRFGLNTLREHGM +VLE Sbjct: 588 QDFLDRPSPFGLEILGGGYGLFPIAYGSFHQEQRRFGLNTLREHGMXTKVLE 743 >GCiWno534_n18.g1_3 WDNVVCISSRSV*TKKPKGQKPHIVYYM*IKRQTYAAL*GFYPCAIGSAFLKRYILYCYC AV*LSL*YLYS*NYYRSTYRAVVLYKYPKFELALIGIKMLDILLSCIRAWFSTITLSIIV FYVTWHYWNKRTPGSPPGPRGFPFIGAITSIRKHPEHVMTKWNKEYGPVCMVRLGFKDVL VIGSYEAAHEAYVKSQDFLDRPSPFGLEILGGGYGLFPIAYGSFHQEQRRFGLNTLREHG MXTKVLESTILXYAXGACDRLETKMSAPVLLDQEVYIAVSSTIAHMXVGHNTMXDAXSFV I*SY Opp end of clone = seq 34 >GCiWno534_n18.b1_4 EPSDRGISSTAF*TRWTNVNEKTRSRQQVKCSYR*F*LNADAHICTGSVSCFYRP*LTVS RLDAGITAVCVLWTTP*LKFNGLSNLNCQPCIISISLFFFSAETPSENHPPSKWQRSKQR *RR*RFQRED*SELGNLFVV**PTTRVHGE*ENIKGVATTLILSQLNVNLFLSVVVFQQL WLCRYIKVPTHFES*KL*AAIKYCGLMFTPIKFPV*INVSI*IYNLYPVAVKRYRSATFF LPEPTQRPLQLVGSSCSSANTRMYNGGCKKRLMT**GRMASRSWRSRKGCLSPEL*YR*R VRL >GCiWno534_n18.b1_5 GTVRSRDFIDSFLNEMDKRKRKNSKQATGKVFI*VILIKCRRPYMHR*RFLLL*TIANSI EARRWYNGGLCVMDNTXIKI*WAVESKLSAMYYFNIFVLLLRRNSVRKPPPFKMATE*AK ITTIKISKGRLIRTGKLIRRLVTNNSCPW*VREHKRCSDHAYSLPIKCKSVFKCSRVSTT VVVSLYKSSNPL*KLKTLSSYKILRIDVYTN*VPRLDQCIDINI*LIPRCCETVQVRDLF LAGTDTTSATTCWIILFLCKYPDVQRRMQKEIDDVIGENGIPKLALAERLPFTRAVIQVK G*IX >GCiWno534_n18.b1_6 NRQIEGFHRQLFERDGQT*TKKLEAGNR*SVHIGNFN*MPTPIYAQVAFLASIDHS*QYR GSTLV*RRFVCYGQHXN*NLMGCRI*TVSHVLFQYLCSSSPQKLRQKTTPLQNGNGVSKD NDDKDFKGKIDPNWETYSSFSDQQLVSMVSERT*KV*RPRLFSPN*M*ICF*V*SCFNNC GCVAI*KFQPTLKVENFKQL*NIAD*CLHQLSSPFRSMYRYKYITYTPLL*NGTGPRPFS CRNRHNVRYNLLDHLVPLQIPGCTTEDAKRD**RDRGEWHPEVGARGKVAFHQSCNTGKG LDX >SEQUENCE 72, 86 EFQLLVFLRDLFIAGTETTTSTLRWALLVLLHNPGVQDKLRNEIHKVLGQSTTVSMAHRESMPYTRAFIEEIYRY RTLTPLDLFHETSGELNISGYKIPKNTVIIPNLWAVHNDRDVWDEPS KFKPERHLDEKGNFVQSKHVIPFSVGPRHCLGEQLARMEIFIFLVSMVQKF GFLPDPNEPNLPEINHGVNATAFVAYPFNIVANQV DEV12038.x1 LQW190562.x1 I-HELIX GCiWno824_n04.b1 LQW242955.y2 = DLFHETSGELNI LQW47566.x1 = DLFHETSGELNI LQW242955.y1 = DLFHETSGELNI >GCiWno824_n04.b1 ATATTTTCCACTGTGTTTTTAGGAATCTTATATCCAGATATATTCAACTCTCCCGACGTTGCATGAAATAGGTCCAAAGG TGTGAGAGTTCGGTATCTATAAATTTCCTCTATAAATGCTCGCGTATAAGGCATGCTCTCTCTGTGTGCCATACTGACAG TCGTTGACTGGCCTATGTAAAGTAAACAGGTATCGGTAAGTATACGTGTTATATTGTTTGTACAGGCACTAAGCTACTTT GGTGTCATTCTGTTTTTTACCCATATGTCCCAAAATACCTGTATTGTGGTTTTCTAATAAAAACATAAAGTAAAATGGGG TAAGACGGGACACCTGTAGGACATACCATCCAAATATCCTGATCGTGTTTTAAACAATTAAAACGGTCTATGAGAGTTAT GGGGATACCGTTTTATAATTCTTTGAATGATCTTTTTTACTACTAAATGGGACGAGAAAATAGAATGAAAAGGTGCCCAT TTCCCACTACCCTACTATATTGCAGTGACGAAACCTAAAACTTTGTGAATTTCATTCCGTAGCTTGTCTTGTACTCCAGG ATTGTGAAGCAGAACCAGCAACGCCCACCTCAAAGTACTCGTTGTGGTTTCAGTGCCAGCAATGAATAAATCCCTCAAAA ACACGAGCAACTGAAACTCCTGCAAGGATTTTATTACTTAATCAATTTGTCTTGCGTCTGTTTTACCCTCCCGCGAGTTT TGGAGTTTCGGCGTGGAAATAATATTGTTATAATTGGTTCCTCTCGCGTATAGCGTATAGAGTAAATTGATCCCGCCTAC GCTTGTTTTGCAC >GCiWno824_n04.b1_4 VQNKRRRDQFTLYAIRERNQL*QYYFHAETPKLAGG*NRRKTN*LSNKILAGVSVARVFE GFIHCWH*NHNEYFEVGVAGSASQSWSTRQATE*NSQSFRFRHCNIVG*WEMGTFSFYFL VPFSSKKDHSKNYKTVSP*LS*TVLIV*NTIRIFGWYVLQVSRLTPFYFMFLLENHNTGI LGHMGKKQNDTKVA*CLYKQYNTYTYRYLFTLHRPVNDCQYGTQREHALYASIYRGNL*I PNSHTFGPISCNVGRVEYIWI*DS*KHSGKY >GCiWno824_n04.b1_5 AKQA*AGSIYSIRYTREEPIITILFPRRNSKTRGRVKQTQDKLIK**NPCRSFSCSCF*G IYSLLALKPQRVL*GGRCWFCFTILEYKTSYGMKFTKF*VSSLQYSRVVGNGHLFILFSR PI***KRSFKEL*NGIPITLIDRFNCLKHDQDIWMVCPTGVPSYPILLYVFIRKPQYRYF GTYG*KTE*HQSSLVPVQTI*HVYLPIPVYFT*ASQRLSVWHTERACLIREHL*RKFIDT ELSHLWTYFMQRRES*IYLDIRFLKTQWKIX >GCiWno824_n04.b1_6 CKTSVGGINLLYTLYARGTNYNNIISTPKLQNSREGKTDARQID*VIKSLQEFQLLVFLR DLFIAGTETTTSTLRWALLVLLHNPGVQDKLRNEIHKVLGFVTAI**GSGKWAPFHSIFS SHLVVKKIIQRIIKRYPHNSHRPF*LFKTRSGYLDGMSYRCPVLPHFTLCFY*KTTIQVF WDIWVKNRMTPK*LSACTNNITRILTDTCLLYIGQSTTVSMAHRESMPYTRAFIEEIYRY RTLTPLDLFHATSGELNISGYKIPKNTVENX >SEQUENCE 73 48% TO 2C9 132 ALVKQGEDFAGRPKSPLFDMLTNGCGIVFVDGEKWKAQRKFGIMTLRRY 278 DEV12431.x1 DEV35102.x1 DEV35102.x4 >SEQUENCE 79, 215, 157 60% TO 2C8 409 WTSVAVIAVSLFYIWWRRPHNFPPGPRGLPLIGVLPFLGRFPGEVFKKW 263 262 SLEYGPVMSIRMGRSDVVV 206 366 DFFLAGSETTSTNILWILLLLVHYPEHTAKVIKEIDTIIG 488 THSSQMPFTCAFIQESMRYRTSVPLGAQHYCQKTFQLNGYTIPKGTL (0) IYPNIWGVHNDPKSWPNPS DEV46638.x1 I-helix LQW279985.x1 I-helix LQW268448.y1 I-helix LQW268448.x1 N-TERM LQW261925.y1 I-helix LQW150256.y1 I-helix LQW273875.y1 N-TERM LQW252666.y1 N-TERM GCiWno979_d10.g1 >GCiWno979_d10.g1 TCAGCTGGACCCAGATGGACACAGATAGAACATAATATCCTAAATAAATTAGAAAGTGCCGGGATACATTACAATTATAG TAGGGTGGGGTAAGATAGGATACTTTAAGCACCTAATATCCAAATATCCTAAACGTTTCAAACAATTAACAATGGTCTAT GGAAGTAGTGAGGATACGCTTTTATAATTCTTTAAATGTGTTTTTTTGTTTACTACCAAATCGGACAAAAATAGAAAAAA AATGTATGATATTTTTTACATTACTATACCTATACAGGACCAAATGCATCCGCCAGTTCCACAACGCATAGCTCACAAAT GCCATTTACTTGCGCATTCATTCAGGAGTCCATGAGGTATCGCACAAGTGTGCCACTAGGCGCCCAGCACTATTGTCAGA AAACTTTTCAGTTGAACGGCTACACAATACCGAAAGGAACACTGGTAAGATAGATTTACATCGTATACGTATATAGGATA GTCGCAAAAAAAGTTTGTTACTAATACATACTAGTAACAACGCTGCACGTTATACAACTTGGGTAATGATAAACCAATAT TACTACAGCGTTTTTTAAAGTTATAAGCTCACCAGACCAGTATACGAGAACATGTTAAGTTATTTATATATCAAGATAAA GTGTCTAAAAATGGCCAATATTGTGTCGGCGTCGTACAATTTATACACCAACAAAAATACATATACATTGTAACTCATAA GCGGGCCAGAGGTGTATGAAACAGGACACCCGTGTTATAAAGACTGTCGTTGCACCTGAAACATTTATTACAACAAAACA TTTCAGATATACCCCAATATATGGGGGTGTCCACAACGATCCTAAATCTTGGCCGAACCCATCATAGTTTGAA >GCiWno979_d10.g1_1 SAGPRWTQIEHNILNKLESAGIHYNYSRVG*DRIL*APNIQIS*TFQTINNGLWK**GYA FIIL*MCFFVYYQIGQK*KKNV*YFLHYYTYTGPNASASSTTHSSQMPFTCAFIQESMRY RTSVPLGAQHYCQKTFQLNGYTIPKGTLVR*IYIVYVYRIVAKKVCY*YILVTTLHVIQL G***TNITTAFFKVISSPDQYTRTC*VIYISR*SV*KWPILCRRRTIYTPTKIHIHCNS* AGQRCMKQDTRVIKTVVAPETFITTKHFRYTPIYGGVHNDPKSWPNPS*FE >GCiWno979_d10.g1_2 QLDPDGHR*NIIS*IN*KVPGYITIIVGWGKIGYFKHLISKYPKRFKQLTMVYGSSEDTL L*FFKCVFLFTTKSDKNRKKMYDIFYITIPIQDQMHPPVPQRIAHKCHLLAHSFRSP*GI AQVCH*APSTIVRKLFS*TATQYRKEHW*DRFTSYTYIG*SQKKFVTNTY**QRCTLYNL GNDKPILLQRFLKL*AHQTSIREHVKLFIYQDKVSKNGQYCVGVVQFIHQQKYIYIVTHK RARGV*NRTPVL*RLSLHLKHLLQQNISDIPQYMGVSTTILNLGRTHHSL >GCiWno979_d10.g1_3 SWTQMDTDRT*YPK*IRKCRDTLQL**GGVR*DTLST*YPNILNVSNN*QWSMEVVRIRF YNSLNVFFCLLPNRTKIEKKCMIFFTLLYLYRTKCIRQFHNA*LTNAIYLRIHSGVHEVS HKCATRRPALLSENFSVERLHNTERNTGKIDLHRIRI*DSRKKSLLLIHTSNNAARYTTW VMINQYYYSVF*SYKLTRPVYENMLSYLYIKIKCLKMANIVSASYNLYTNKNTYTL*LIS GPEVYETGHPCYKDCRCT*NIYYNKTFQIYPNIWGCPQRS*ILAEPIIV* >GCiWno515_f08.b1 CHROMAT_FILE: GCiWno515_f08.b1 PHD_FILE: GCiWno515_f08.b1.phd.1 CHEM: term DYE: big TIME: Wed Oct 17 10:56:58 2001 TEMPLATE: GCiWno515_f08 DIRECTION: fwd Length = 894 Score = 84.3 bits (205), Expect = 2e-16 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 DFFLAGSETTSTNILWILLLLVHYPEHTAKVIKEIDTIIG 40 DFFLAGSETTSTNILWILLLLVHYPEHTAKVIKEIDTIIG Sbjct: 34 DFFLAGSETTSTNILWILLLLVHYPEHTAKVIKEIDTIIG 153 >GCiWno515_f08.b1 ATACAGGAAGACGAGTTGAATGTTTTGTTTCGTGACTTTTTCCTTGCTGGCTCAGAAACAACAAGCACCAACATATTGTG GATTCTATTACTGCTTGTTCACTATCCTGAACATACTGCAAAAGTGATTAAAGAAATAGACACCATCATAGGTGGGTACT GGTGAGATGATGTATAGTAGGGTGGGGTAAGATGGACACAGATAGAACATAATATCCTAAATAAATTAGAAAGTGCCGGG ATACATTACAATTATAGTAGGGTGGGGTAAGATGGGATACTTTAAGCACCTAATATCCAAATATCCTAAACGTTTCAAAC AATTAACAATGGTCTATGGAAGTAGTGAGGATACGCTTTTATAATTCTTTAAATGCGTTTTTTTGTTTACTACCAAATCG GACAAAAATAGAAAAAATGTATGATATTTTTTACATTACTATACCTATACAGGACCAAATGCATCCGCCAGTTCCACAAC ACATAGCTCACAAATGCCATTTACTTGCGCATTCATCCAGGAGTCCATGAGGTATCGCACAAGTGTGCCACTAGGCGCCC AGCACTATTGTCAGAAAACTTTTCAGTTGAACGGCTACACAATACCGAAAGGAACACTGGTAAGATAGATTTACATCGCA TACGTATATAGTCGCAAAAAAAGTTTGTTACTAATACATACTAGTAAATGCGCTGCACGAACAACTGCGGGAGTAATGAT AAACCAATATTACTACAGCGACTTTTAAAGTTATAAGCTCACCAGACCAGTATACGAAAACATGATGAGCTATTTATATA TCAAGAATAAGTGTCAGANAATGACCAATATTGTGACGCTGCGTACAATTTATACGCCAACACGATACATATACGTTGTA AATCATAAGCGGGC >GCiWno515_f08.b1_1 IQEDELNVLFRDFFLAGSETTSTNILWILLLLVHYPEHTAKVIKEIDTIIGGYW*DDV** GGVRWTQIEHNILNKLESAGIHYNYSRVG*DGIL*APNIQIS*TFQTINNGLWK**GYAF IIL*MRFFVYYQIGQK*KKCMIFFTLLYLYRTKCIRQFHNT*LTNAIYLRIHPGVHEVSH KCATRRPALLSENFSVERLHNTERNTGKIDLHRIRI*SQKKFVTNTY**MRCTNNCGSND KPILLQRLLKL*AHQTSIRKHDELFIYQE*VSXNDQYCDAAYNLYANTIHIRCKS*AG >GCiWno515_f08.b1_2 YRKTS*MFCFVTFSLLAQKQQAPTYCGFYYCLFTILNILQK*LKK*TPS*VGTGEMMYSR VG*DGHR*NIIS*IN*KVPGYITIIVGWGKMGYFKHLISKYPKRFKQLTMVYGSSEDTLL *FFKCVFLFTTKSDKNRKNV*YFLHYYTYTGPNASASSTTHSSQMPFTCAFIQESMRYRT SVPLGAQHYCQKTFQLNGYTIPKGTLVR*IYIAYVYSRKKSLLLIHTSKCAARTTAGVMI NQYYYSDF*SYKLTRPVYENMMSYLYIKNKCQXMTNIVTLRTIYTPTRYIYVVNHKR >GCiWno515_f08.b1_3 TGRRVECFVS*LFPCWLRNNKHQHIVDSITACSLS*TYCKSD*RNRHHHRWVLVR*CIVG WGKMDTDRT*YPK*IRKCRDTLQL**GGVRWDTLST*YPNILNVSNN*QWSMEVVRIRFY NSLNAFFCLLPNRTKIEKMYDIFYITIPIQDQMHPPVPQHIAHKCHLLAHSSRSP*GIAQ VCH*APSTIVRKLFS*TATQYRKEHW*DRFTSHTYIVAKKVCY*YILVNALHEQLRE*** TNITTATFKVISSPDQYTKT**AIYISRISVRX*PIL*RCVQFIRQHDTYTL*IISG >SEQUENCE 72, 86 K-HELIX TO PKG 46% TO 2R1 86 and 18 are almost identical at the C-term from IIPNLWA on EFQLLVFLRDLFIAGTETTTSTLRWALLVLLHNPGVQDKLRNEIHKVLGF very similar to seq 72 187 MAHRESMPYTRAFIEEIYRYRTLTPLDLFHATSGELNISGYKIPKNTVV 41 IIPNLWAVHNDRDVWDEPSKFKHERHVDEK similar to seq 18 and 23 and seq 1 LQW47566.x1 LQW242955.y2 GCiWno1042_c15.b1 GCiWno729_f06.g1 RTLTPLDLFHETSGELNISGYKIPKNTV GCiWno760_a19.g1 RTLTPLDLFHETSGELNISGYKIPKNTV GCiWno127_m05.b1 RTLTPLDLFHATSGELNISGYKIPKNTV GCiWno824_n04.b1 RTLTPLDLFHATSGELNISGYKIPKNTV GCiWno127_m05.g1 RTLTPLDXFHATSGELNISGYKIPKNTV IIPNLWAVHNDRDVWDEPSKFKHERHVDEK GCiWno568_j05.g1 RTLTPLDLFHETSGELNISGYKIPK >GCiWno40_n18.b1 CHROMAT_FILE: GCiWno40_n18.b1 PHD_FILE: GCiWno40_n18.b1.phd.1 CHEM: term DYE: big TIME: Sat Sep 1 10:55:00 2001 TEMPLATE: GCiWno40_n18 DIRECTION: fwd Length = 982 Score = 205 bits (517), Expect(2) = 3e-73 Identities = 111/127 (87%), Positives = 112/127 (87%), Gaps = 8/127 (6%) Frame = -1 Query: 74 PIFPHPTIYK-YGTVTTMCVILYWILYCVVK-VILLDCKSNFPDIVF-TVDDDETYTATV 130 PIFPH TIYK YGTVTTMCVILYWILYCVVK VILLDCKSNFPDIVF TVDDDETYTATV Sbjct: 706 PIFPHXTIYK*YGTVTTMCVILYWILYCVVK*VILLDCKSNFPDIVF*TVDDDETYTATV 527 Query: 131 IIL-IFFVYYQKEQ-MGMKTCPIFP-PTI-Y-QIIPNLWAVHNDRDVWDEPSKFKHERHV 185 IIL IFFVYYQKEQ MGMKTCPIFP PTI QIIPNLWAVHND DVWDEPSKFK ERH+ Sbjct: 526 IIL*IFFVYYQKEQ*MGMKTCPIFP*PTI*Y*QIIPNLWAVHNDPDVWDEPSKFKPERHL 347 Query: 186 DEKAVMV 192 DEK V Sbjct: 346 DEKGNFV 326 this seq has the same intron seq but no errors at RDVWDEPSKFKHERHV LQW253263.x1 this seq fits with two others at the E/G and V/A GCiWno40_n18.b1 has G GCiWno336_d01.g1 has G GCiWno1042_c15.g1 has G and A LQW253263.x1.phd.1 LQW253263.y1 12:12:24 2001 TEMPLATE: LQW253263 DIRECTION: fwd Length = 866 Score = 85.8 bits (209), Expect = 5e-17 Identities = 40/43 (93%), Positives = 40/43 (93%) Frame = -1 Query: 1 LVSMVQKFEFLPDPNEPNLPEINHGVNATVFVAYPFNIVANQV 43 LVSMVQKF FLPDPNEPNLPEINHGVNAT FVAYP NIVANQV Sbjct: 635 LVSMVQKFGFLPDPNEPNLPEINHGVNATAFVAYPLNIVANQV 507 >GCiWno127_m05.g1_4 LVPVQTI*HVYLPIPVYFT*ASQRLSVWHTERACLIREH**RKFIDTELSHLWTYFMQRR ES*IYLDIRFLKTQW*NIL**AGEYGTPVHSILSYHLVVNKDNLNSYKTVSSRLQQYSVV IV*NTIRIFGYCVLKVSPSSPTLPYINNTEQ*LQCV*YYIGFYTV**SR*YC*TVNPIFL ISCFKQLTMMRRIRLRL*FCKYSLFTTKKNNKWE*KHVPSFPNLLYNIDRSYRIYGRYTT IVMCGTNQASLNMSAT*MRRQSWSISCFQ*TDGAVMRHSCFQ*NDGQSGHSVSSKRRP >GCiWno127_m05.g1_5 FSACTNNITRILTDTCLLYIGQSTTVSMAHRESMPYTRALIEEIYRYRTLTPLDXFHATS GELNISGYKIPKNTVVKYIIVGWGIWDTRSFYFIVPFSSKQRQFK*L*NRVLTTSAI*RC YCLKHDQDIWILCA*GIPIFPHPTIYK*YGTVTTMCVILYWILYCVVK*VILLDCKSNFP DIVF*TVDDDETYTATVIIL*IFFVYYQKEQ*MGMKTCPIFP*PTI*Y*QIIPNLWAVHN DRDVWDEPSKFKHERHVDEKAVMVNIVFPVNRWRSDAS*LFPVKRRPVRS*RFQ*TTAX >GCiWno127_m05.g1_6 *CLYKQYNTYTYRYLFTLHRPVNDCQYGTQREHALYASINRGNL*IPNSHTFGXISCNVG RVEYIWI*DS*KHSGKIYYSRLGNMGHPFILFYRTI***TKTI*IVIKPCPHDFSNIALL LFKTRSGYLDIVCLRYPHLPPPYHI*IIRNSNYNVCNIILDSILCSKVGDIVRL*IQFS* YRVLNS*R**DVYGYGYNSVNILCLLPKRTINGNENMSHLSLTYYIILTDHTESMGGTQR S*CVGRTKQV*T*APRR*EGSHGQYRVSSKPMAQ*CVIAVSSKTTASQVIAFPVNDGX >GCiWno1042_c15.b1 CHROMAT_FILE: GCiWno1042_c15.b1 PHD_FILE: GCiWno1042_c15.b1.phd.1 CHEM: term DYE: big TIME: Fri Jan 4 11:17:18 2002 TEMPLATE: GCiWno1042_c15 DIRECTION: fwd Length = 826 Score = 103 bits (255), Expect = 3e-22 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +1 Query: 1 EFQLLVFLRDLFIAGTETTTSTLRWALLVLLHNPGVQDKLRNEIHKVLGF 50 EFQLLVFLRDLFIAGTETTTSTLRWALLVLLHNPGVQDKLRNEIHKVLGF Sbjct: 508 EFQLLVFLRDLFIAGTETTTSTLRWALLVLLHNPGVQDKLRNEIHKVLGF 657 >GCiWno1042_c15.b1 I-helix region AACGATCCTCATTTCACGGTTACTATATATGTGCTGTGCCAGAAGCCTGTTTCAGTAACCTAAACTATAGCACTGGTTTC GTAGAGAGAATTTTGTCCACGCAAAACATTTTTATAGGCATATTCAAAATGTTGAATAATGACCATTTATATTAACTGCA TGTCTGAATAAATACAAAAGCTATTTTTGTACTTATATGCATGTTCACTCTATTGCATATACATTAACCATTTATCTTAA CTGCGTAACAGTTTGCTAGCTTTGACTGTAGACTAAATCACTGGCTAAACAATGCCAGTAAAATGCAGTTCCTGAAAATT ACAACAAAGCACAACAACTGCTGAAAGAGTGGCAAAACAAGCGTAGGCGGGATCAAATTTACTCTATACGCTATACGCGA GAGGAACCAATTATAACAATAATTATTTCCACGCCGAATACTCCAAAACTCGCGGGGAGGTTAAAACAGACGCAAGACAA ATTGATTAAGTAATAAAATCCTTGCAGGAGTTTCAGTTGCTCGTGTTTTTGAGGGATTTATTCATTGCTGGCACTGAAAC CACAACGAGTACTTTGAGGTGGGCGTTGCTGGTTCTGCTTCACAATCCTGGAGTACAAGACAAGCTACGGAATGAAATTC ACAAAGTTTTAGGTTTCGTCACTGCAATATAGTAAGGGTAGTGGGAGATGGGCACCTTTTCATTCTATTTTCTCGTCCCA TTTAGTAGTAAAAAGATCATTCAAGAATTTATAAACGTACCCCATACTCTCATAGACCTTTTAATGTTTAAACACATCGG ATATTTTGATGTATGGTCTACAGTGN >GCiWno1042_c15.g1 NLWA to end 2 aa diffs with seq 18, 216 these must be adjacent genes in a cluster since 86 and 18 overlap and do not match TTCGAGCTCGGTACCAAAGAATACATAACCGTAGCTTTACGACTTTAAAAGACGTTGTTAATTGTTTAAAAACGAATGGG AATATGGGACATTGTTTGTTAAAGAATTACCATCTTACCCCACAGTACTGAATCTACAATATATCTAAACTGTTTAGTTA CATGCATTAGACTTGATTGGCCACTATGTTAAATGGGTACGCTACAAATGCAGTTGCGTTCACACCGTGATTTATCTCCG GAAGATTCGGCTCATTCGGATCCGGAAGAAACCCAAATTTCTGAACCATTGAAACCAGAAAGATGAAGATTTCCATTCGA GCTAGTTGTTCTCCCAAGCAATGACGTGGACCCACCGAGAAAGGTATCACGTGTTTAGACTGAACAAAGTTTCCTTTCTC ATCGAGGTGACGCTCAGGTTTAAACTTGCTTGGTTCGTCCCACACATCAGGATCGTTGTGTACCGCCCATAGATTCGGTA TGATCTGTCAATATTATATAGTAGGTTAGGGAAAGATGGGACATGTTTTCATTCCCATTTATTGTTCTTTTTGGTAGTAA ACAAAGAATATTTACAGAATTATAACCGTAGCCGTATACGTCTCATCATCGTCAACTGTTTAAAACACGATATCAGGAAA ATTGGATTTACAGTCTAACAATATCACCTACTTTACTACACAGTATAGAATCCAATACAATATTACACACATTGTAGTTA CTGTTCCGTATTATTATATATGGTAGGGGGGGGGGAAAAATGGGGATACCTTAAGCACACAATATCCAAATATCCTGATC GTGGTTTTAAACAATAACAACGCTATAATGCTGAAGTCGTGAAGGACCCGGTTTTATAACTATTTGAATTTTCCTGGTTT ACTACTAAATGGTACCATAAA GCiWno1042_c15.g1 sequence 18, 216 11 accessions similar to sequence 1 PKG to heme 52% to 2J2 Length = 500 Minus Strand HSPs: Score = 562 (197.8 bits), Expect = 6.7e-57, P = 6.7e-57 Identities = 104/106 (98%), Positives = 104/106 (98%), Frame = -1 Query: 484 IIPNLWAVHNDPDVWDEPSKFKPERHLDEKGNFVQSKHVIPFSVGPRHCLGEQLARMEIF 305 IIPNLWAVHNDPDVWDEPSKFKPERHLDEKGNFVQSKHVIPFSVGPRHCLGEQLARMEIF Sbjct: 395 IIPNLWAVHNDPDVWDEPSKFKPERHLDEKGNFVQSKHVIPFSVGPRHCLGEQLARMEIF 454 Query: 304 IFLVSMVQKFGFLPDPNEPNLPEINHGVNATAFVAYPFNIVANQV* 167 IFLVSMVQKF FLPDPNEPNLPEINHGVNAT FVAYPFNIVANQV* Sbjct: 455 IFLVSMVQKFEFLPDPNEPNLPEINHGVNATVFVAYPFNIVANQV* 500 >GCiWno127_m05.g1 TGGCCGTCGTTTACTGGAAACGCTATGACCTGACTGGCCGTCGTTTTACTGGAAACAGCTATGACGCATCACTGCGCCAT CGGTTTACTGGAAACACGATATTGACCATGACTGCCTTCTCATCTACGTGGCGCTCATGTTTAAACTTGCTTGGTTCGTC CCACACATCACGATCGTTGTGTACCGCCCATAGATTCGGTATGATCTGTCAATATTATATAGTAGGTTAGGGAAAGATGG GACATGTTTTCATTCCCATTTATTGTTCTTTTTGGTAGTAAACAAAGAATATTTACAGAATTATAACCGTAGCCGTATAC GTCTCATCATCGTCAACTGTTTAAAACACGATATCAGGAAAATTGGATTTACAGTCTAACAATATCACCTACTTTACTAC ACAGTATAGAATCCAATATAATATTACACACATTGTAGTTACTGTTCCGTATTATTTATATATGGTAGGGTGGGGGAAGA TGGGGATACCTTAAGCACACAATATCCAAATATCCTGATCGTGTTTTAAACAATAACAACGCTATATTGCTGAAGTCGTG AGGACACGGTTTTATAACTATTTAAATTGTCTTTGTTTACTACTAAATGGTACGATAAAATAGAATGAACGGGTGTCCCA TATTCCCCAGCCTACTATAATATATTTTACCACTGTGTTTTTAGGAATCTTATATCCAGATATATTCAACTCTCCCGACG TTGCATGAAATANGTCCAAAGGTGTGAGAGTTCGGTATCTATAAATTTCCTCTATTAATGCTCGCGTATAAGGCATGCTC TCTCTGTGTGCCATACTGACAGTCGTTGACTGGCCTATGTAAAGTAAACAGGTATCGGTAAGTATACGTGTTATATTGTT TGTACAGGCACTAAA >_5 FSACTNNITRILTDTCLLYIGQSTTVSMAHRESMPYTRALIEEIYRYRTLTPLDXFHATS GELNISGYKIPKNTVVKYIIVGWGIWDTRSFYFIVPFSSKQRQFK*L*NRVLTTSAI*RC YCLKHDQDIWILCA*GIPIFPHPTIYK*YGTVTTMCVILYWILYCVVK*VILLDCKSNFP DIVF*TVDDDETYTATVIIL*IFFVYYQKEQ*MGMKTCPIFP*PTI*Y*QIIPNLWAVHN DRDVWDEPSKFKHERHVDEKAVMVNIVFPVNRWRSDAS*LFPVKRRPVRS*RFQ*TTA >SEQUENCE 72 60% TO 2C9 Length = 40 Score = 143 (50.3 bits), Expect = 8.1e-13, P = 8.1e-13 Identities = 29/40 (72%), Positives = 31/40 (77%) Query: 11 DLFIAGTETPKEFFEVGVVVLLHNPGVQDKLGNEIHKVLG 50 DLFIAGTET ++VLLHNPGVQDKL NEIHKVLG Sbjct: 1 DLFIAGTETTTSTLRWALLVLLHNPGVQDKLRNEIHKVLG 40 >GCiWno127_m05.g1 CHROMAT_FILE: GCiWno127_m05.g1 PHD_FILE: GCiWno127_m05.g1.phd.1 CHEM: term DYE: big TIME: Wed Sep 12 02:36:30 2001 TEMPLATE: GCiWno127_m05 DIRECTION: rev Length = 895 Score = 98.3 bits (241), Expect = 3e-20 Identities = 46/51 (90%), Positives = 47/51 (91%) Frame = -1 Query: 47 LGMAHRESMPYTRAFIEEIYRYRTLTPLDLFHETSGELNISGYKIPKNTVV 97 + MAHRESMPYTRA IEEIYRYRTLTPLD FH TSGELNISGYKIPKNTVV Sbjct: 820 VSMAHRESMPYTRALIEEIYRYRTLTPLDXFHATSGELNISGYKIPKNTVV 668 >GCiWno760_a19.b1 AACCACTGGTTGATCAAAGTACCGCCAATATCGACTTACAACAAAATGCAAATCAGCAACAGGGACGACATGTTCAGTGA GTAAACGGTCAAAATATTTTATTTGGATGTGCTATTACCAACAAGCTGTTTTATAAAAACTAAAAAAAAATTATTAACAA AGTTATACCAACGTGGTAACTCGTAAGCGAGCACGAGCTGCGCGAAACAAAACACAAGTGTTGTAACAAGTGTCGCTGCT CCGCCATGCGAGGATAAATAGGTTACACCATTCAAGACTTTAACCATAGTATACTGAAATGATAGTATACTCACTTCAGT ATACTATGCTTTAACGCAGAGACAATAACTTTATACATAAAGTTGGTCGCATAACGTGGTGCAGAACCACCCCTGTTACA GCGACTGTCGTTTTCACGCCACGCGAGGATAAACAAGCGCCAAATATTTTACATTCATTCACTTACTCAAGTTTCACACT GACAAATTAGAGTAAAAAAATGAACTTATTGAAAAAAGATAACATAACCATAACTAAAACATAGGTATCCACTTACACGT TATATGATTGGGTTATCGCAACGGCGTAGGCTTGCTAATTATCTCACTGATTATAATCCAATGCTTATTGTTCAATGCAT GCANGCCTTTTCCGAGAATTATTGACGAGCATAGAGCGACATTTGACAAAGAAACATTCGTGATTTTATTGACGCCTTCC NNTGACGTATGGCTGGGAACGATCCTCATTTCACGNTACTATATATGCTGTGCCAGAGCCCTGTTCAGTAACCTAACTAT AGCACTGGTTTCGTAAAAGAGAATTTTGTCACGCCAAACCTTTTTATAAGCATATTCAAAATGTGGATAATGACCATTNA TATAACTGCCTGCN >GCiWno760_a19.g1 TCAGCTCGGACCCTATATATTAGGGTGGGGGAGATGGGGATACCTTTAGCACACAATATCCTGATCGTGTTTTAAACAAT AACAACGCTATATTGCTGAAGTCGTGAGGACACGGTTTTATAACTATTTGAATTTCCTTGGTTTACTACTAAATGGTACG ATAAAATAGAATGAACGGGTGTCCCATATTCCCCAGCCTACTATAATATATTTTACCACTGTGTTTTTGGGAATCTTATA TCCAGATATATTCAACTCTCCCGACGTTTCATGGAATAGGTCCAAAGGTGTGAGAGTTCGGTATCTATAAATTTCCTCTA TAAATGCTCGCGTATAAGGCATGCTCTCTCTGTGTGCCATACTGACAGTCGTTGACTGGCCTATGTAAAGTAAACAGGTA TCGGTAAGTATACGTGTTATATTGTTTGTACAGGCACTAAAGCTACTTTGATATCATTCTGTTTTTTACCCATATGTCCC AAAATACCTGTATTGTGGTTTTCTAATAAGAACATAAAGTAAAATGGGGTAAGACGGGACACCTGTAGGACATACCATCC AAATATCCTGGTGGTGTTTTACACAATTAAAAGCGGTCTATGAGAGTTATGGGGATACCGTTTTATAATTCTTTGAATGA TCTTTTTTACTACTAAATGGGACGAGAAAATAGAATGAAAAGGTGCCCATCTCCTACTACCCTACTATATTGCAGTGACG AAACCTAAAACTTTGTGAATTTCATTCCCTAACTTGTCTTGTACTCCAGGATTGTGAAGCAAAACCACCACGCCCACCTC AAAGAACTCCTTGGGGGTTTCAGTGCCAGCAATGAATAAATCCCCCCAAAACACGAGCAACTGAAACTCCTGA >GCiWno760_a19.g1_4 SGVSVARVLGGFIHCWH*NPQGVL*GGRGGFASQSWSTRQVRE*NSQSFRFRHCNIVG** EMGTFSFYFLVPFSSKKDHSKNYKTVSP*LS*TAFNCVKHHQDIWMVCPTGVPSYPILLY VLIRKPQYRYFGTYG*KTE*YQSSFSACTNNITRILTDTCLLYIGQSTTVSMAHRESMPY TRAFIEEIYRYRTLTPLDLFHETSGELNISGYKIPKNTVVKYIIVGWGIWDTRSFYFIVP FSSKPRKFK*L*NRVLTTSAI*RCYCLKHDQDIVC*RYPHLPHPNI*GPS* >GCiWno760_a19.g1_5 RSFSCSCFGGIYSLLALKPPRSSLRWAWWFCFTILEYKTS*GMKFTKF*VSSLQYSRVVG DGHLFILFSRPI***KRSFKEL*NGIPITLIDRF*LCKTPPGYLDGMSYRCPVLPHFTLC SY*KTTIQVFWDIWVKNRMISK*L*CLYKQYNTYTYRYLFTLHRPVNDCQYGTQREHALY ASIYRGNL*IPNSHTFGPIP*NVGRVEYIWI*DSQKHSGKIYYSRLGNMGHPFILFYRTI ***TKEIQIVIKPCPHDFSNIALLLFKTRSGYCVLKVSPSPPP*YIGSELX >GCiWno760_a19.g1_6 QEFQLLVFWGDLFIAGTETPKEFFEVGVVVLLHNPGVQDKLGNEIHKVLGFVTAI**GSR RWAPFHSIFSSHLVVKKIIQRIIKRYPHNSHRPLLIV*NTTRIFGWYVLQVSRLTPFYFM FLLENHNTGILGHMGKKQNDIKVALVPVQTI*HVYLPIPVYFT*ASQRLSVWHTERACLI REHL*RKFIDTELSHLWTYSMKRRES*IYLDIRFPKTQW*NIL**AGEYGTPVHSILSYH LVVNQGNSNSYKTVSSRLQQYSVVIV*NTIRILCAKGIPISPTLIYRVRAX >SEQUENCE 88 197251 MID REGION 37% TO 2B6 TVIYSTTSVSSTICFGRSFTRQDPELKEFLRNFQSFDKAMGASQIINFWPFLKYFP LQW240272.y1 >GCiWno3_j02.b1 CHROMAT_FILE: GCiWno3_j02.b1 PHD_FILE: GCiWno3_j02.b1.phd.1 CHEM: term DYE: big TIME: Sat Sep 1 10:44:48 2001 TEMPLATE: GCiWno3_j02 DIRECTION: fwd Length = 887 Score = 96.7 bits (237), Expect = 4e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 14 CFGRSFTRQDPELKEFLRNFQSFDKAMGASQIINFWPFLKYFP 56 CFGRSFTRQDPELKEFLRNFQSFDKAMGASQIINFWPFLKYFP Sbjct: 448 CFGRSFTRQDPELKEFLRNFQSFDKAMGASQIINFWPFLKYFP 576 >GCiWno3_j02.b1_1 FCI*TYCFTLADDSFGCNNVTYLSLRGG*RQSL*HRCMNMI*NSPKTITHKVTYVVTGRP KRARGL*NRTPVL*QLSLPRHARINKLHTW*LVSGHEVYETEHPC*RLSLSHHAGIHNLN NFNYIDFQGLVGDLHDTVIYSTTSVSSTICFGRSFTRQDPELKEFLRNFQSFDKAMGASQ IINFWPFLKYFPVLGKSFRVISHNYIXGIGGXXGXXXNLFXXXFWLXI KNIQRIIKPCPW DFHRPGVNCLKHEHGIDIFCAQGW PRFPPPTPRVQNWVLAFLPRVRPPPIIHTVVX >GCiWno3_j02.b1_2 FVYRLIVLLWRMIHLAVIM*LIYPYVAGNDSPYNTGA*I*YKILPKQ*PTK*HTW*LVGL SGHEVYETEHPCYNNCRCPVMRG*INYIRGNL*VGTRCMKQNTRVNDCRYPTTREYTT*T TLITLISRV**ATSTTR*YTAPPA*VPRFVSGEVLQGKTRS*KNFSEIFKVSTKPWARLR LSTFGHF*NTFRCWESPFG*FPIIILXG*GXXXXTXXIYFXVHFGCXLRTFKEL*NLALG TFIDPVLIV*NTNTELIYFVLKGGPVSPPPPPGSKIGCWPFYPGSGHRPSFTRWFX >GCiWno3_j02.b1_3 LYIDLLFYFGG*FIWL**CNLFILTWRVTTVLITQVHEYDIKFSQNNNPQSNIRGNW*A* AGTRFMKQNTRVITTVVAPSCEDK*ITYVVTCKWARGV*NRTPVLTTVVIPPRGNTQLKQ L*LH*FPGFSRRPPRHGDIQHHQREFHDLFRAKFYKARPGVERISQKFSKFRQSHGRVSD YQLLAIFKILSGAGKVLSGNFP*LY*XDRGXXGXLX*SIXXXILVVX*EHSKNYKTLPLG LS*TRC*LFKTRTRN*YILCSRVAPFPPPHPPGPKLGAGLFTQGQATAHHSHGGL >GCiWno329_k19.b1 CHROMAT_FILE: GCiWno329_k19.b1 PHD_FILE: GCiWno329_k19.b1.phd.1 CHEM: term DYE: big TIME: Mon Oct 22 09:47:38 2001 TEMPLATE: GCiWno329_k19 DIRECTION: fwd Length = 920 Score = 93.6 bits (229), Expect = 3e-19 Identities = 46/49 (93%), Positives = 46/49 (93%), Gaps = 3/49 (6%) Frame = +3 Query: 1 LYIDLLFYFGG-FIWL--CNLFILTWRVTTVLITQVHEYDIKFSQNNNP 46 LYIDLLFYFGG FIWL CNLFILTWRVTTVLITQVHEYDIKFSQNNNP Sbjct: 480 LYIDLLFYFGG*FIWL**CNLFILTWRVTTVLITQVHEYDIKFSQNNNP 626 >GCiWno329_k19.b1_1 XRHPCYNPTVSIILLIDSPEWERQKQCTIKALKLYTSGSDKRSTMEETVSSHAKQLAEDL INSADQQVTIQFTISALLSKLHT*IHYYIVRWGKMGHLFTRFPRPI***TKNIQ*IMKPN PHNFHRALLIVQNTIRIFGYYVLKVSYLPPPCYNKMIGKFCI*TYCFTLADDSFGCNNVT YLSLRGG*RQSL*HRCMNMI*NSPKTITQLSNIRGNW*A*AGTTFMKQNTRVITTVVAPS CEDNINTYVVTCKLARGV*NRTPVXTTVXIPPRRNTQLKHFNYIXFQGVSRRPPRTGDIQ HHQREVP >GCiWno329_k19.b1_2 XDTHVITRQ*A*YF*LTARNGNGRSNAPSRH*NFTQADQTKDQQWKKPYPPMQNNSQRI* STLQTSR*QYNLLYRLY*VSYIHKYITI**DGGRWDTFSLDFLVPFSSKQRTFNKL*NRI LTTSIERC*LFKTRSGYLDIMC*RCPIFPHPAIIK*LASFVYRLIVLLWRMIHLAVIM*L IYPYVAGNDSPYNTGA*I*YKILPKQ*PN*VTYVVTGRPKRARRL*NRTPVL*QLSLPRH ARIT*IHTW*LVSWHEVYETEHPX*RLSXSHHAGIHNLNTLITXDSRGLVGDLHEPVIYS TTNGKFX >GCiWno329_k19.b1_3 KTPML*PDSEHNTFD*QPGMGTAEAMHHQGIETLHKRIRQKINNGRNRILPCKTTRRGFN QLCRPAGNNTIYYIGFTK*VTYINTLLYSKMGEDGTPFH*ISSSHLVVNKEHSINYETES SQLP*SVVNCSKHDQDIWILCAKGVLSSPTLL**NDWQVLYIDLLFYFGG*FIWL**CNL FILTWRVTTVLITQVHEYDIKFSQNNNPTK*HTW*LVGLSGHDVYETEHPCYNNCRCPVM RG*HKYIRGNL*VGTRCMKQNTRXNDCRYPTTPEYTT*TL*LHXIPGG**ATSTNR*YTA PPTGSS >GCiWno444_g16.b1 CHROMAT_FILE: GCiWno444_g16.b1 PHD_FILE: GCiWno444_g16.b1.phd.1 CHEM: term DYE: big TIME: Fri Oct 12 10:22:42 2001 TEMPLATE: GCiWno444_g16 DIRECTION: fwd Length = 923 Score = 166 bits (417), Expect = 3e-41 Identities = 82/82 (100%), Positives = 82/82 (100%) Frame = -3 Query: 2 RHPCYNPTVSIILLIDSPEWERQKQCTIKALKLYTSGSDKRSTMEETVSSHAKQLAEDLI 61 RHPCYNPTVSIILLIDSPEWERQKQCTIKALKLYTSGSDKRSTMEETVSSHAKQLAEDLI Sbjct: 351 RHPCYNPTVSIILLIDSPEWERQKQCTIKALKLYTSGSDKRSTMEETVSSHAKQLAEDLI 172 Query: 62 NSADQQVTIQFTISALLSKLHT 83 NSADQQVTIQFTISALLSKLHT Sbjct: 171 NSADQQVTIQFTISALLSKLHT 106 >GCiWno444_g16.b1_4 V*THHVVWGISSHPCYTLPVGTRCINMLYPDSEHEVYESIMCXGV*XDTHVITRQ*A*GV *IHHVCLVYK*TXHVIT*Q*ARGV*ICYNPTVSMRCMNTSCVSGV*EDTHVITRQ*A*GV *IHHVCLVYK*TPML*LDSEHEVYEYVITRQ*A*GV*IHHVCLVYKKTPML*LNSEHELY EYTMCVWCIRRHPCYNPTVSIILLIDSPEWERQKQCTIKALKLYTSGSDKRSTMEETVSS HAKQLAEDLINSADQQVTIQFTISALLSKLHT*IHYYIVRWGKMGHLFTRFPRPI***TK NIQ*IMK >GCiWno444_g16.b1_5 CMNTPCGLGY**PPMLYLASGHEVYKYVIPRQ*A*GV*IHHVXWCIXRHPCYNSTVSMRC MNTSCVSGV*VDTPCYNLTVSTRCMNML*PDSEHEVYEYIMCVWCIRRHPCYNSTVSMRC MNTSCVSGV*VDTHVIT*Q*ARGV*ICYNPTVSMRCMNTSCVSGV*EDTHVITQQ*A*AV *IHHVCLVYKKTPML*PDSEHNTFD*QPGMGTAEAMHHQGIETLHKRIRQKINNGRNRIL PCKTTRRGFNQLCRPAGNNTIYYIGFTK*VTYINTLLYSKMGEDGTPFH*ISSSHLVVNK EHSINYEX >GCiWno444_g16.b1_6 MYEHTMWFGVLVATHVIPCQWARGV*ICYTPTVSMRCMNPSCVXVYXKTPML*LDSEHEV YEYIMCVWCISRHXML*LDSEHEVYEYVITRQ*A*GV*IHHVCLVYKKTPML*LDSEHEV YEYIMCVWCISRHPCYNLTVSTRCMNML*PDSEHEVYEYIMCVWCIRRHPCYNSTVSMSC MNTPCVSGV*EDTHVITRQ*A*YF*LTARNGNGRSNAPSRH*NFTQADQTKDQQWKKPYP PMQNNSQRI*STLQTSR*QYNLLYRLY*VSYIHKYITI**DGGRWDTFSLDFLVPFSSKQ RTFNKL*X >SEQUENCE 89 RYG TO MID 332% TO 1A1 MDSLVFVLVDTVLVMKYQILLLLVIVYAIKLLAASQSRRLNIPGPYPWPVIGNVIEMGGQPQFSLTNMAK 210 RYGPVYLMKLGTADVLVLNNYEVIKEALLRQRRIFGGRPIFDSFKKISQGLGVVFNSTMT 389 390 QGDEWMKLKMTIVKHVHRFVSSEETKGYVAHHVQMEAVELVRILTEKCRS 539 540 SPNKVIFPIEQINLAIANVVCAIMFGHRYQHGN 638 LQW233975.x1 LQW215364.y2 f_GECi27_c13 GCiWno151_k07.b1 GCiWno240_b21.g1 GCiWno117_a14.b1 GCiWno82_n13.b1 exon 1 GCiWno155_l18.g1 exon 1 GCiWno658_g08.g1 exon 1 GCiWno82_n13.b1 upstream of gene GCiWno312_i02.b1 upstream of gene >GCiWno82_n13.b1 CHROMAT_FILE: GCiWno82_n13.b1 PHD_FILE: GCiWno82_n13.b1.phd.1 CHEM: term DYE: big TIME: Sat Sep 1 16:31:00 2001 TEMPLATE: GCiWno82_n13 DIRECTION: fwd Length = 906 Score = 67.9 bits (163), Expect = 2e-11 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 1 LNIXGPYPWPVIGNVIEMGGQPQFSLTNMAK 31 LNI GPYPWPVIGNVIEMGGQPQFSLTNMAK Sbjct: 119 LNIPGPYPWPVIGNVIEMGGQPQFSLTNMAK 27 >scf/ciona01/G126/seq_dir/hrs/G126P64874R.T0/G126P64874RB5.T0.seq 968 0 968 ABI Length = 968 Plus Strand HSPs: Score = 135 (47.5 bits), Expect = 2.0e-08, P = 2.0e-08 Identities = 24/28 (85%), Positives = 25/28 (89%), Frame = +3 Query: 63 IXGPYPWPVIGNVIEMGGQPQFSLTNMA 90 I GPYPWPVIGNV+EMG QPQ SLTNMA Sbjct: 225 IPGPYPWPVIGNVVEMGSQPQISLTNMA 308 >scf/ciona01/G126/seq_dir/hrs/G126P64874R.T0/G126P64874RB5.T0.seq_1 968 0 968 ABI IGTELLWWPAKFLRTHPLCFYRACYYNNF*RSTSKWIS*QPS*LRYALSKYKSLLTLRSC TPRSGIWGYIKTDQRSRVHIHGQ*SGMWWRWDRSRRFHSPTWQTSKCR*LVNHHCRN*SL I*QVRSYVSYQARDR*RADP**L*R**KKHLYFHKGCSPAARHLIHSRKPSIGRGIVLNN TSTQGAAWERMTMTIVKHVHRFIVAPQTKGSLAGHVQKETDQLVRM*SEKCRSSTNQAIE PVENINLAFANVVCSIMFGHRYQHGNKGIQILNILIYLLLGHRRMCNPVC**QSCIVFLL SIPNIFRCTCAWGQSQTEVQLTP >scf/ciona01/G126/seq_dir/hrs/G126P64874R.T0/G126P64874RB5.T0.seq_2 968 0 968 ABI LELSSCGGLLNFSGLTLFVFTEHAIIIISSDQHQNGYPNSRHNYDMLFQNINHY*PYDRV PREVVYGVT*RPTKDPGSISMASDRECGGDGIAAADFTHQHGKQVSAGDSLTTTAGINH* FSRYGPMYLIKLGTADVLILNNYDGNKRSIYTSTRGVLRPPGI*FTQENLA*VEALCSTT LRRRGRRGNV*R*PS*SMFIDSSWPHKPRAHWLVTCKKKPINWCACDPKNAEALRTKRLS P*RISILHSQTLYARSCSDIDTNMGIREFRF*IY*YTYCSDTGVCVIQCADSKVALFSFY PFPTYSDAPVHGDNLKRRFN*PX >scf/ciona01/G126/seq_dir/hrs/G126P64874R.T0/G126P64874RB5.T0.seq_3 968 0 968 ABI WN*APVVAC*ISPDSPSLFLQSMLL**FLAINIKMDILTAVITTICSFKI*ITIDLTIVY PEKWYMGLHKDRPKIPGPYPWPVIGNVVEMGSQPQISLTNMANK*VQVTR*PPLQELITD LAGTVLCILSSSGPLTC*SLIIMTVIKEAFILPQGVFSGRPAFDSLKKT*HRSRHCAQQH FDAGGGVGTYDDDHREACSSIHRGPTNQGLTGWSRAKRNRSTGAHVIRKMPKLYEPSD*A RREYQSCIRKRCMLDHVRTSIPTWE*GNSDFKYIDIPTARTPAYV*SSVLIAKLHCFPFI HSQHIPMHLCMGTISNGGSIDP IPGPYPWPVIGNVVEMGSQPQISLTNMA RYGPMYLIKLGTADVLILNNYDVIKEAF >GCiWno117_a14.b1_4 MYLALSRKFVLKPXTGLAKFKRWIRGVRAGGHSAGDEIPNPXILVMGLRHKXISNVTVKA LEHSWSLPVASDRKCDRNGRPTSVFTDKHGEKVSLI*QRYRYHLHLQIYTT*TNKQRNPF KFLVV*SFTATQPVVLLW*RNFEIIKSNLSF*GEAYSMKL*I*C*TNIYRSM*IVNTFRA *FS*DMHNLVT*LRLLEFFLLC*VLIQIEIKY*VLCVFGKACYKLIFLTFRYGPVYLMKL GTADVLVLNNYEVIKEALLRQRRIFGVPPDMPVV*QDSAMTMSGPSFYWKHTMNHDRAVV LLANRL*PX >GCiWno117_a14.b1_5 NVFSPXQKIRTKTXYWIGKIQTMDSWCSCWWTQCW**NTKSXYISNGSTP*XY*QRHSQG A*TFXVLTRGQ*SEM**KWEANLSFH*QTWRKSEFDLTALSLSLTSSNIHHLNEQTEKSI QVFSCLIFHGNATSCPVMVTQL*NNKVQPIVLRRGLQYETLNLMLNQYL*VHVNREYISC VILLRYA*SGDITTTVGIFPFMLSFDSD*DKILSTLCVW*SLL*TNLFDFQVRTCVFDET RNC*RSGAQQL*SHQRSIITSKTHLWCTARYASRLTGFSYDHEWSVVLLETHYEP*SCRR FTGKQAMTQX >GCiWno117_a14.b1_6 CI*PXAENSY*NLXLDWQNSNDGFVVFVLVDTVLVMKYQILXY**WVYAIXLLATSQSRR LNIXGPYPWPVIGNVIEMGGQPQFSLTNMAKK*V*FDSAIAITYIFKYTPLERTNREIHS SF*LFNLSRQRNQLSCYGNATLK**SPTYRSKERPTV*NFKFDAKPIFIGPCKS*IHFVR NSLEICIIW*HNYDCWNFSFYVEF*FRLR*NIKYFVCLVKLVIN*SF*LSGTDLCI**NS ELLTFWCSTIMKSSKKHYYVKDASLVYRQICQSFNRIQL*P*VVRRFTGNTL*TMIVPSF YWQTGYDPX >GCiWno240_b21.g1_3 AVVLLETLDLTGRRFTGNSYDLTVR*FTGNMM*RPVYLMKLETADVLVLNNYEVIKEALL RQRRIFGGRPIFDSFKKISQGRGVVFNSTMTQGDEWMKLKMTIVKHVHRFVSSEETKGYV AHHVQMEAVELVRILTEKCRSSPNEVIFPIEQINLAIANVVCAIMFGHRYQHGNK VQLTA CKT*MI*CGLTGLCKTNIDAFDKRRYSRLPVTGRYSEIGSIILILSF*LKLRPIRVSIKT KSTD*KIGVVKKTNXGNNIHTKIRCPFPNFKLSRGIEWCRLCWRSRDP*IPVCMHHLFD >SEQUENCE 91 WXXP TO END 39% TO 2R1 on same clone as seq 36 N-term GCiWno609_a01 57% to seq 36 seems to be a pseudogene. Ends in mid exon, no savignyi ortholog extra aa in heme signature. 487 WPQPNKFDPHRHLDSAKKFISSSKIVPFSVGARYYCMGRETAQTEIFVFVVAL 332 LQKFKITRDPTLKWPIHMEDGIQSALCCPSRYKIILN* 216 LQW188730.y1 LQW92134.y1 LQW64081.y1 LQW66533.y1 .X1 = SEQ 36 not same gene (gene cluster?) GCiWno844_j14.g1 - GCiWno390_j12.b1 + GCiWno619_l10.g1 - >GCiWno844_j14.g1_4 RDMEW*TYSFATIN**YLLRIQQ*NLVLLITVTYIRRVVAV*VRYSR*SYKLVSRPTASY MYFL*RFYIFFMLGLEALNRCTHV*SIVGYKRGMSLVP*SYIS*SCEPLTTFFERRSYGY IILGYLSPQYPNIISIVFYTFNKGLLESWGYNFIFL*MFFVYYTMRRENRMKNCPIFPPK TRTLLQFTLTM*SSRRLYSKYSEGRKLATTKQV*PSQTLRFCEEIYLLEQNCAFFGRCTL LLYGAGNCSNRNFCICRRSFTEI*NNS*SDFEMANSHGRWYTICMCWYRARID >GCiWno844_j14.g1_5 GYGVVNLFVRYD*LIIPSPYSAVKFSSAYNSHIYTPCGSGLS*I*QVEL*AGIKAYSKLH VFSVAILYIFYARTRGVKSLYTCIKYCGV*KRDVVSTLKLYFLIV*TIDNIF*EAELRLY NSGIPFATISKYYLDRILYI*QGSIGVVGIQFYISLNVLCLLHNETRK*NEKLSHLPTQD TNIAPVYPHDVIIA*AI*QILRRA*TGHNQTSLTLTDT*ILRRNLSPRAKLCLFRSVHVI IVWGGKLLKPKFLYLSSLFYRNLK*LVIRL*NGQFTWKMVYNLHVLVPSSN*X >GCiWno844_j14.g1_6 GIWSGKLIRSLRLINNTFSVFSSEI*FCL*QSHIYAVW*RFKLDIAGRVISWYQGLQQAT CIFCSDFIYFLCSDSRR*IAVHMYKVLWGIKEGCR*YLKAIFLNRVNH*QHFLRGGATVI *FWDTFRHNIQILSRSYFIHLTRVYWSRGDTILYFFECSLFTTQ*DEKIE*KIVPSSHPR HEHCSSLPSRCNHRVGYIANTQKGVNWPQPNKFDPHRHLDSAKKFISSSKIVPFSVGARY YCMGRETAQTEIFVFVVALLQKFKITRDPTLKWPIHMEDGIQSACVGTELELX First walk upstream >GCiWno793_o16.b1 CHROMAT_FILE: GCiWno793_o16.b1 PHD_FILE: GCiWno793_o16.b1.phd.1 CHEM: term DYE: big TIME: Tue Dec 4 11:35:10 2001 TEMPLATE: GCiWno793_o16 DIRECTION: fwd Length = 819 Score = 111 bits (274), Expect = 8e-24 Identities = 62/72 (86%), Positives = 63/72 (87%), Gaps = 5/72 (6%) Frame = +3 Query: 86 YKLVSRPTASYMYFL--RFYIFFMLGLEALNRCTHV-SIVGYKRGMSLVP-SYIS-SCEP 140 YKLVSRPTASYMYF RFY FFMLGLEALNRCT+V SIVGYKRGMSLVP SYIS SCE Sbjct: 321 YKLVSRPTASYMYFYL*RFYRFFMLGLEALNRCTYV*SIVGYKRGMSLVP*SYIS*SCEQ 500 Query: 141 LTTFFERRSYGY 152 LTTFFE RSYGY Sbjct: 501 LTTFFETRSYGY 536 >GCiWno793_o16.b1_1 THLVVNKKRSNNYKNVSSRLLYRPFLIAYKTRSGYLNIMCLSVLLSGFDDMVISAITAG* *VVNLFVRYD*LIIPFSYSAGEI*FCL*QSHIYAVW*RFKLDIAGRVISWYQGLQQATCI FTCSDFIDFLCSDSRR*IAVHMYKVLWGIKEGCR*YLKAIFLNRVNN*QHFLRRGATVI* LWDTFRHNIQILSRSYFKHLTRVYWSRGDTILYFFECSLFTTQ*DEKIEWKIVPSSHPRH EHCSSLPSRCNRRVGP*AI*QILRRA*TGTHQQ >GCiWno793_o16.b1_2 PIW**TKNVQIITKTYPHDSYIDRF*LHIKHDRDI*ILCA*AFYYLVLMIWLLVL*PRDN EW*TYSFVTIN**YLSRIQQVKFSSAYNSHIYTPCGSGLS*I*QVEL*VGIKAYSKLHVF LPVAIL*IFYARTRGVKSLYICIKYCGV*KRDVVSTLKLYFLIV*TIDNIF*DAELRLYN SGIPFATISKYYLDRILNI*QGSIGVVGIQFYISLNVLCLLHNETRK*NGKLSHLPTQDT NIAPVYPHDVIVA*GRRLYSKYSEGRKLAHTN >GCiWno793_o16.b1_3 PFGSKQKTFK*LQKRILTTPI*TVFNCI*NTIGIFEYYVLKRFIIWF**YGY*CYNRGIM SGKLIRSLRLINNTFLVFSR*NLVLLITVTYIRRVVAV*VRYSR*SYKLVSRPTASYMYF YL*RFYRFFMLGLEALNRCTYV*SIVGYKRGMSLVP*SYIS*SCEQLTTFFETRSYGYIT LGYLSPQYPNIISIVF*TFNKGLLESWGYNFIFL*MFFVYYTMRRENRMENCPIFPPKTR TLLQFTLTM*SSRRAVGYIANTQKGVNWHTPT Second walk >GCiWno266_m04.g1 CHROMAT_FILE: GCiWno266_m04.g1 PHD_FILE: GCiWno266_m04.g1.phd.1 CHEM: term DYE: big TIME: Wed Oct 3 13:13:00 2001 TEMPLATE: GCiWno266_m04 DIRECTION: rev Length = 884 Score = 104 bits (258), Expect = 1e-22 Identities = 52/57 (91%), Positives = 52/57 (91%) Frame = +3 Query: 1 THLVVNKKRSNNYKNVSSRLLYRPFLIAYKTRSGYLNIMCLSVLLSGFDDMVISAIT 57 THLVVNKKRSNNYKNVSSRLLYRPFLIA TRSGYLNIMCL LLSGFDDMVI AIT Sbjct: 714 THLVVNKKRSNNYKNVSSRLLYRPFLIAXXTRSGYLNIMCLKRLLSGFDDMVIXAIT 884 >GCiWno266_m04.g1_1 WPSFYWKRLT*LAVVLLETAMT*LAVLLLKDRYEYTLNMRSDGDSLYLSNGHALMARLHN LTTRIKERGDRIKTDLSELDLHTQNARVLLYSALEEGQAIKEEIDRLGRELRRHRDERRD FIRRMTENED*TTFFYPFI*IIGTLELRLMRNILRKCTNMQSRVRIH*SSLRS*SFYFFY TIHSTQTRHNL*RVFANVISALFYLQLSARAE**I*VYRKYSRPYMVGEDRSSFYSFRPI W**TKNVQIITKTYPHDSYIDRF*LHXXHDRDI*ILCA*SVYYLVLMIWLLXL*P >GCiWno266_m04.g1_2 GRRFTGNA*PDWPSFYWKQL*HDWPSYY*KTDMNIH*I*DPMAILCI*VTGML*WRDCTT SQPG*RSEVTG*KRICQNLICTRRMLECFFTLLLKKARR*KKK*IASEGSFVAIATNGET L*EE*LKTKTEQPFFTLLYK*SVHLN*G**EIYLENVLICNQELEYTKAH*DHRVFISSI QFIAHKLDTTYNECLRT**VRFFTYSYQQERNNKYRYTESIVGPIWWGKIGHHFIPFDPF GSKQKTFK*LQKRILTTPI*TVFNCIXXTIGIFEYYVLKAFIIWF**YGYXCYNX >GCiWno266_m04.g1_3 AVVLLETLDLTGRRFTGNSYDMTGRPITERQI*IYTKYEIRWRFSVFE*RACFNGETAQP HNQDKGAR*PDKNGFVRT*FAHAEC*SASLLCS*RRPGDKRRNRSPRKGASSPSRRTERL YKKND*KRRLNNLFLPFYINNRYT*IKADEKYT*KMY*YAIKS*NTLKLIKIIEFLFLLY NS*HTNSTQLITSVCERNKCAFLLTAISKSGIINIGIQKV**ALYGGGR*VIILFLSTHL VVNKKRSNNYKNVSSRLLYRPFLIAXXTRSGYLNIMCLKRLLSGFDDMVIXAIT Third walk >GCiWno464_p17.g1 CHROMAT_FILE: GCiWno464_p17.g1 PHD_FILE: GCiWno464_p17.g1.phd.1 CHEM: term DYE: big TIME: Mon Oct 15 09:59:49 2001 TEMPLATE: GCiWno464_p17 DIRECTION: rev Length = 906 Score = 134 bits (335), Expect = 3e-31 Identities = 67/67 (100%), Positives = 67/67 (100%) Frame = -1 Query: 36 NMRSDGDSLYLSNGHALMARLHNLTTRIKERGDRIKTDLSELDLHTQNARVLLYSALEEG 95 NMRSDGDSLYLSNGHALMARLHNLTTRIKERGDRIKTDLSELDLHTQNARVLLYSALEEG Sbjct: 309 NMRSDGDSLYLSNGHALMARLHNLTTRIKERGDRIKTDLSELDLHTQNARVLLYSALEEG 130 Query: 96 QAIKEEI 102 QAIKEEI Sbjct: 129 QAIKEEI 109 >GCiWno464_p17.g1_4 XPVV*PDISXNXHS*TSYTTSPVQYNITIDPKASVYSGCIYTIHHALCQNKNIGVRITSF VLQTT**EINVKEL*RPLKTYNLSRFEYKHVIIL*HGQKLKRQSSWLA*DTTVTIIWLYC RLKT*LSLKARKITSYFYWYVCLKNLTIRIL*YDNNIMHFT*HFTRINTPQQHKQITLF* ESNLEW*PILARLKIGIYGNMRSDGDSLYLSNGHALMARLHNLTTRIKERGDRIKTDLSE LDLHTQNARVLLYSALEEGQAIKEEIDRLGRELRRHRDGRRDFIRRMTENED*TTYFYAF I* >GCiWno464_p17.g1_5 XRSLT*YFYXPPFVDELYYFTRTI*YHH*PKSVGVFGMYIHYTSCTXPKQKHRSQNYLIC IADHLIRN*RKGIIKTP*DIQFIAF*I*TRHYSMTRTKTEATVVMACLGHDCHNNLVVLQ AKDVIVIKSA*NYIVFLLVCMS*ESHNTNIVI*QQHYAFYVTFHSYKYTSTT*TNHFVLR IKS*MVTYPSSIEDWDIRKYEIRWRFSVFE*RACFNGETAQPHNQDKGAR*PNKNGFVRT *FAHAEC*SASLLCS*RRPGDKRRNRSPRKGASSPSRRTKRLYKKND*KRRLNNLFLRFY IX >GCiWno464_p17.g1_6 XP*SDLIFLXTXIRRRAILLHPYNIISPLTQKRRCIRDVYTLYIMHXAKTKT*ESELPHL YCRPLDKKLT*RNYKDPLRHTIYRVLNINTSLFYDTDKN*SDSRHGLLRTRLSQ*SGCIA G*RRNCH*KRVKLHRIFIGMYVLRISQYEYCNMTTTLCILRNISLV*IHLNNINKSLCFK NQILNGNLS*LD*RLGYTEI*DPMAILCI*VTGML*WRDCTTSQPG*RSEVTE*KRICQN LICTRRMLECFFTLLLKKARR*KKK*IASEGSFVAIATDEETL*EE*LKTKTEQPIFTLL YX fourth walk >GCiWno18_a15.b1 CHROMAT_FILE: GCiWno18_a15.b1 PHD_FILE: GCiWno18_a15.b1.phd.1 CHEM: term DYE: big TIME: Sat Sep 1 07:43:42 2001 TEMPLATE: GCiWno18_a15 DIRECTION: fwd Length = 883 Score = 85.4 bits (208), Expect(2) = 6e-31 Identities = 43/52 (82%), Positives = 46/52 (87%), Gaps = 2/52 (3%) Frame = -1 Query: 21 VQYNITIDPKASVYSGCIYTIHHALCQNKNIGVRITSFVLQTT--EINVKEL 70 VQYNITI+PKA V GCIYTI HALCQNKNIGV+ITSFVLQ+T EINVKEL Sbjct: 310 VQYNITIEPKALVLFGCIYTIQHALCQNKNIGVKITSFVLQST**EINVKEL 155 Score = 69.9 bits (168), Expect(2) = 6e-31 Identities = 36/39 (92%), Positives = 36/39 (92%), Gaps = 2/39 (5%) Frame = -2 Query: 77 NLSRFEYKHVIIL-HGQKLKRQSSWLA-DTTVTIIWLYC 113 NLSRFEYKHVIIL H QKLKRQSSWLA DTTVTIIWLYC Sbjct: 147 NLSRFEYKHVIIL*HRQKLKRQSSWLA*DTTVTIIWLYC 31 >GCiWno18_a15.b1_4 VTSV*HVIAINR*RPVGMND*PMMTSSXVGFSNLMPFSPAXIMPLSNRGSQNHFICNTAK *SSKTCFSWLNYYTVIFSAVRWIVKYHPVYDTNRQIFVIVFKSYCAVGY*DGYR*NKNPR IS*PGF*QQTKLFLES*EYDYKRVGTMGQLFISFSCPM***RARHSNMASNRSLT*YFCK PQS*TS*TTSPYNIISPLNQKRWCYSDVYTLYSMHFAKTKT*ESKLPHLYCRALDKKLT* RNYKDNLSRFEYKHVIIL*HRQKLKRQSSWLA*DTTVTIIWLYCRLKT*LSLKT >GCiWno18_a15.b1_5 RHQRLTRHRY*QVTSGRNE*LTYDDVIXRWFQ*SDAFFPGXNHASEQSRKPESLYL*YS* MKLKNMFFLA*LLYSYFLCGKMDS*IPPGLRYKSPNFRNRF*ELLCGGVLRWIPLE*KSS NFVTGFLATNKAIFGVMRIRL*KGGDDGTTIYFIFLSYVIVTCSSLKHGIEP*SDLIFL* TPIVDELDYFTVQYNITIEPKALVLFGCIYTIQHALCQNKNIGVKITSFVLQST**EINV KEL*RQFIAF*I*TRHYSMTQTKTEATVVMACLGHDCHNNLVVLQAKDVIVIKNX >GCiWno18_a15.b1_6 SPASDTSSLLTGNVRSE*MINL**RHRPLVSVI*CLFPRQXSCL*AIAEARITLFVIQLN EAQKHVFLGLTIIQLFSLR*DG*LNTTRSTIQIAKFS*SFLRVIVRWGIKMDTVRIKILE FRNRVFSNKQSYFWSHENTIIKGWGRWDNYLFHFLVLCDSNVLVTQTWHRTVV*PDISVN PNRRRARLLHRTI*YHH*TKSVGVIRMYIHYTACTLPKQKHRSQNYLICIAEHLIRN*RK GIIKTIYRVLNINTSLFYDTDKN*SDSRHGLLRTRLSQ*SGCIAG*RRNCH*KR Fifth walk GCiWno18_a15.g1 CHROMAT_FILE: GCiWno18_a15.g1 PHD_FILE: GCiWno18_a15.g1.phd.1 CHEM: term DYE: big TIME: Sat Sep 1 07:43:42 2001 TEMPLATE: GCiWno18_a15 DIRECTION: rev Length = 944 Score = 177 bits (444), Expect(2) = 1e-49 Identities = 87/91 (95%), Positives = 87/91 (95%), Gaps = 3/91 (3%) Frame = +1 Query: 27 GFSNLMPFSPAXIMPLSNRGSQNHFICNTAK-SSKTCFSWLNYYTVIFSAVRWIVKYHPV 85 GFSNLMPFSPA IMPLSNRGSQNHFICNTAK SSKTCFSWLNYYTVIFSAVRWIVKYHPV Sbjct: 274 GFSNLMPFSPAKIMPLSNRGSQNHFICNTAK*SSKTCFSWLNYYTVIFSAVRWIVKYHPV 453 Query: 86 YDTNRQIFVIVFKSYCAVGY-DGYR-NKNPR 114 YDTNRQIFVIVFKSYCAVGY DGYR NKNPR Sbjct: 454 YDTNRQIFVIVFKSYCAVGY*DGYR*NKNPR 546 Score = 40.6 bits (93), Expect(2) = 1e-49 Identities = 26/31 (83%), Positives = 26/31 (83%), Gaps = 3/31 (9%) Frame = +3 Query: 1 VTSV-HVIAINR-RPVGMND-PMMTSSXVGF 28 VTSV HVIAINR RPVGMND PMMTSS V F Sbjct: 186 VTSV*HVIAINR*RPVGMND*PMMTSSAVWF 278 >GCiWno18_a15.g1_1 X*TXL*RHLARTHDKPFSFQIH*IMCGLRNHFCVVS*FPWLCT*VIPCFYAIPIFTAPRT VTSPASDTSSLLTGNVRSE*MINL**RHRPFGFSNLMPFSPAKIMPLSNRGSQNHFICNT AK*SSKTCFSWLNYYTVIFSAVRWIVKYHPVYDTNRQIFVIVFKSYCAVGY*DGYR*NKN PRIS*PGF*QQTKLFLES*EYDYKRVGTMGQLFISXSCPM***RARHSXMASNRSLT*YF CKPQS*TS*TTSPYNIISPLDPKXWVYSDVYTLYSMHFAKQNIGVKFPSLYCXALDRNYV KDF*DIYRVFDLTPX >GCiWno18_a15.g1_2 FKLXCSDI*LVPMINLFLFKFIELCVG*EIISVSFPNSRGCALK*FLVFMQYQFSQHHVP *RHQRLTRHRY*QVTSGRNE*LTYDDVIGRLVSVI*CPFPRQKSCL*AIAEARITLFVIQ LNEAQKHVFLGLTIIQLFSLR*DG*LNTTRSTIQIAKFS*SFLRVIVRWGIKMDTVRIKI LEFRNRVFSNKQSYFWSHENTIIKGWGRWDNYLFHXLVLCDSNVLVTXTWHRTVV*PDIS VNPNRRRARLLHRTI*YHHWTQSXGCIRMYIHYTACTLPNKT*ESNFPHCIAXHWIEIT* RIFKTFIAFLI*HLX >GCiWno18_a15.g1_3 LNXLVATSSSYP**TFFFSNSLNYVWVKKSFLCRFLIPVVVHLSNSLFLCNTNFHSTTYR DVTSV*HVIAINR*RPVGMND*PMMTSSAVWFQ*SDALFPGKNHASEQSRKPESLYL*YS *MKLKNMFFLA*LLYSYFLCGKMDS*IPPGLRYKSPNFRNRF*ELLCGGVLRWIPLE*KS SNFVTGFLATNKAIFGVMRIRL*KGGDDGTTIYFIXLSYVIVTCSSLXHGIEP*SDLIFL *TPIVDELDYFTVQYNITIGPKAVGVFGCIYTIQHALCQTKHRSQISLIVLXSTG*KLRK GFLRHLSRF*FNTF LQW188730.y1 LQW188730.y1.phd.1 LQW188730.x1 13:29:27 2001 TEMPLATE: LQW188730 DIRECTION: rev Length = 944 Score = 282 bits (656), Expect = 1e-75 Identities = 86/90 (95%), Positives = 87/90 (96%), Gaps = 1/90 (1%) Frame = -2 Query: 1 WPQPDKFDPHRHLDSAKKFISSSEIVPFSVGARY-CMGRETAQTEIFVFVVALLQKFKIT 59 WPQP+KFDPHRHLDSAKKFISSS IVPFSVGARY CMGRETAQTEIFVFVVALLQKFKIT Sbjct: 445 WPQPNKFDPHRHLDSAKKFISSSKIVPFSVGARYYCMGRETAQTEIFVFVVALLQKFKIT 266 Query: 60 RDPTLKWPIHMEDGIQSALCCPSRYKIILN 89 RDPTLKWPIHMEDGI SALCCPSRYKIILN Sbjct: 265 RDPTLKWPIHMEDGIPSALCCPSRYKIILN 176 >LQW188730.y1 >lcl|LQW188730.y1 CHROMAT_FILE: LQW188730.y1 PHD_FILE: LQW188730.y1.phd.1 CHEM: term DYE: ET TIME: Wed Aug 22 13:29:27 2001 TEMPLATE: LQW188730 DIRECTION: rev GCGGAGACTAACTAGCCTGCACCCTGGTGAGACAGCCCAGTACTCTTCATAAGTGAAAATTCATGCTTACACCAATATTA AGTTTAGAACACTATTTTTATTGTCACGAAAACGTTGTATTATTACGCCACGAAAAAGATTGAAAGTTTAAATAAATATC TATTATGCGTCTCTAGTTCAGGATTATCTTATACCGACTGGGACAACACAATGCAGATGGTATACCATCTTCCATGTGAA TTGGCCATTTCAAAGTCGGATCACGAGTTATTTTAAATTTCTGTAAAAGAGCGACGACAAATACAAAAATTTCGGTTTGA GCAGTTTCCCGCCCCATACAATAATAACGTGCACCGACCGAAAAAGGCACAATTTTGCTCGAGGAGATAAATTTCTTCGC AGAATCTAAGTGTCTGTGAGGGTCAAACTTGTTTGGTTGTGGCCAGTTTACGCCCTTCTGAGTATTTGCTATATAGCCTA CGCGATGATTACATCGTGAGGGTAAACTGGAGCAATGTTCGTGTCTTGGGTGGGAAGATGGGACAATTTTTCATTCTATT TTCTCGTCTCATTGTGTAGTAAACAAAGAACATTCAAAGAAATATAAAATTGTATCCCCACGACTCCAATAGACCCTCTG TTAATGTATAAAATACGATCGAGATAATATCTGGATATTGTGGCGAAAGGTACCCAGAATTATTAACCGTAGCTCGNCTC TCAAAAATGTGTCCATGTTCACCGATTAGAAATTAGCTTAGGTACTACGACATCTCTTTATACCCACATACTATACTGTT ACGCATTAAGCTCAGTCGAATAAAATTTAATGTAGGAAAATGTGTGCGAGCTGAACATTAACACGGATTACTACGCACCG GTATTCCGTTGCACATCCGGACAAGATATAGGAAATCCACGGTGAACTGAAACAAATCCTAGCC >LQW188730.y1_4 LGFVSVHRGFPISCPDVQRNTGA**SVLMFSSHTFSYIKFYSTELNA*QYSMWV*RDVVV PKLISNR*TWTHF*EXSYG**FWVPFATISRYYLDRILYINRGSIGVVGIQFYISLNVLC LLHNETRK*NEKLSHLPTQDTNIAPVYPHDVIIA*AI*QILRRA*TGHNQTSLTLTDT*I LRRNLSPRAKLCLFRSVHVIIVWGGKLLKPKFLYLSSLFYRNLK*LVIRL*NGQFTWKMV YHLHCVVPVGIR*S*TRDA**IFI*TFNLFRGVIIQRFRDNKNSVLNLILV*A*IFTYEE YWAVSPGCRLVSLR >LQW188730.y1_5 ARICFSSPWISYILSGCATEYRCVVIRVNVQLAHIFLH*ILFD*A*CVTV*YVGIKRCRS T*ANF*SVNMDTFLRXELRLIILGTFRHNIQILSRSYFIH*QRVYWSRGDTILYFFECSL FTTQ*DEKIE*KIVPSSHPRHEHCSSLPSRCNHRVGYIANTQKGVNWPQPNKFDPHRHLD SAKKFISSSKIVPFSVGARYYCMGRETAQTEIFVFVVALLQKFKITRDPTLKWPIHMEDG IPSALCCPSRYKIILN*RRIIDIYLNFQSFSWRNNTTFS*Q*K*CSKLNIGVSMNFHL*R VLGCLTRVQAS*SPX >LQW188730.y1_6 G*DLFQFTVDFLYLVRMCNGIPVRSNPC*CSARTHFPTLNFIRLSLMRNSIVCGYKEMS* YLS*FLIGEHGHIFEXRATVNNSGYLSPQYPDIISIVFYTLTEGLLESWGYNFIFL*MFF VYYTMRRENRMKNCPIFPPKTRTLLQFTLTM*SSRRLYSKYSEGRKLATTKQV*PSQTLR FCEEIYLLEQNCAFFGRCTLLLYGAGNCSNRNFCICRRSFTEI*NNS*SDFEMANSHGRW YTICIVLSQSV*DNPELETHNRYLFKLSIFFVA**YNVFVTIKIVF*T*YWCKHEFSLMK STGLSHQGAG*LVSA Try to go downstrream and then jump back upstream >GCiWno609_a01.g1_1 FELGTRYYCMGRETAQTEIFVFVVALLQKFKITRDPTLKWPIHMEDGIQSALCCSSRYKI ILN*RRIINIYLKLSIFFVA***NVFVTKIVFKSLILGVRH*IYKLMEELHGLVVNQGII VLAVTQMCTDHCFNSFVTKMHMLKGLKCDAPXCRG >GCiWno609_a01.b1_5 P450 N-term this matches seq 36 must be a gene cluster KXN*FESLIVVNVELVQMLYAYIYSXVSQ*YT*CLISICHIVSICFIDRSIKCR*IICSL CLKFFS*TPAFLQPSLY*SITVNDLGRQFFLRLDKKSRVFKI*IRYIYFNFIYIDYRIYI LY*LF*F*MH*FFNFFYFKLLDIKATA MASVLTVVGDYLNIWSIVLGGSALIFYMWSRKG NLPPGPRGYPILGAMPYLVVHPEKVITKWSREIYGPILSVPLLNRTIIYLNTYEAITEAF SKQGLKLAGRPYMFLFHQISSDLGITIKHX LQW92134.y1 CHEM: term DYE: ET TIME: Fri May 4 12:18:08 2001 TEMPLATE: LQW92134 DIRECTION: rev Length = 526 Score = 150 bits (346), Expect(2) = 1e-73 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -3 Query: 46 FVFVVALLQKFKITRDPTLKWPIHMEDGIQSALCCPSRYKIILN 89 FVFVVALLQKFKITRDPTLKWPIHMEDGIQSALCCPSRYKIILN Sbjct: 350 FVFVVALLQKFKITRDPTLKWPIHMEDGIQSALCCPSRYKIILN 219 Score = 147 bits (339), Expect(2) = 1e-73 Identities = 45/46 (97%), Positives = 45/46 (97%), Gaps = 1/46 (2%) Frame = -1 Query: 1 WPQPDKFDPHRHLDSAKKFISSSEIVPFSVGAR-YCMGRETAQTEI 45 WPQPDKFDPHRHLDSAKKFISSSEIVPFSVGAR YCMGRETAQTEI Sbjct: 487 WPQPDKFDPHRHLDSAKKFISSSEIVPFSVGARYYCMGRETAQTEI 350 LQW66533.y1 CHEM: term DYE: ET TIME: Wed Apr 4 14:59:20 2001 TEMPLATE: LQW66533 DIRECTION: rev Length = 738 Score = 150 bits (347), Expect(2) = 2e-41 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = +2 Query: 40 TAQTEIFVFVVALLQKFKITRDPTLKWPIHMEDGIQSALCCPSRYKIILN 89 TAQTEI VVALLQKFKITRDPTLKWPIHMEDGIQSALCCPSRYKIILN Sbjct: 68 TAQTEI-CIVVALLQKFKITRDPTLKWPIHMEDGIQSALCCPSRYKIILN 214 Score = 39.2 bits (85), Expect(2) = 2e-41 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 1/13 (7%) Frame = +3 Query: 28 FSVGARY-CMGRE 39 FSVGARY CMGRE Sbjct: 30 FSVGARYYCMGRE 68 >LQW92134.x1 >lcl|LQW92134.x1 CHROMAT_FILE: LQW92134.x1 PHD_FILE: LQW92134.x1.phd.1 CHEM: term DYE: ET TIME: Fri May 4 12:17:36 2001 TEMPLATE: LQW92134 DIRECTION: fwd AAAATTTATGAAGCTAAAAATGTGCCTTTCAGTATTTCTAGCTATGTAAGGGAAAAATCCACTTCATATAATGCAAATTA AAATTGGCCATTTAAGATGAATGCACTGCTGCCTTTCACCATAAATGACCAAACCATTATTCTTTTCAAATATCATTGAA TTTATGTGTGGGTTGAGAAATCATTTCTGTGTCGTTTCCTAATTCCCGTGGTTGTGCACTTAAGTAATTCCTTGTTTTTA TGCAATACCAATTTTCACAGCACCACGTACCGTGACGTCACCAGCGTCTGACACGTCATCGCTATTAACAGGTAACGTCC GGTCGGAATGAATGATTAACCTATGATGACGTCATCGGCCGTTTGGTTTCAGTAATCTGATGCCCTTTTCCCCGGCAAAA ATCATGCCTCTGAGCAATCGCGGAAGCCAGAATCACTTTATTTGTAATACAGCTAAATGAAGCTCAAAAACATGTTTTTC TTGGCTTAATTATTATACAGTTATTTTCTCTGCGGTAAGATGGATAGTTAAATACCACCCGGTCTACGATACAAATCGAC AAATTTTCGTAATCGTTTTTAAGAGTTATTGTGCGGTGGGGTATTAAGATGGATACC >_1 KIYEAKNVPFSISSYVREKSTSYNAN*NWPFKMNALLPFTINDQTIILFKYH*IYVWVEK SFLCRFLIPVVVHLSNSLFLCNTNFHSTTYRDVTSV*HVIAINR*RPVGMND*PMMTSSA VWFQ*SDALFPGKNHASEQSRKPESLYL*YS*MKLKNMFFLA*LLYSYFLCGKMDS*IPP GLRYKSTNFRNRF*ELLCGGVLRWIP >_2 KFMKLKMCLSVFLAM*GKNPLHIMQIKIGHLR*MHCCLSP*MTKPLFFSNIIEFMCGLRN HFCVVS*FPWLCT*VIPCFYAIPIFTAPRTVTSPASDTSSLLTGNVRSE*MINL**RHRP FGFSNLMPFSPAKIMPLSNRGSQNHFICNTAK*SSKTCFSWLNYYTVIFSAVRWIVKYHP VYDTNRQIFVIVFKSYCAVGY*DGYX >_3 NL*S*KCAFQYF*LCKGKIHFI*CKLKLAI*DECTAAFHHK*PNHYSFQISLNLCVG*EI ISVSFPNSRGCALK*FLVFMQYQFSQHHVP*RHQRLTRHRY*QVTSGRNE*LTYDDVIGR LVSVI*CPFPRQKSCL*AIAEARITLFVIQLNEAQKHVFLGLIIIQLFSLR*DG*LNTTR STIQIDKFS*SFLRVIVRWGIKMDT >_4 YPS*YPTAQ*LLKTITKICRFVS*TGWYLTIHLTAEKITV**LSQEKHVFELHLAVLQIK *FWLPRLLRGMIFAGEKGIRLLKPNGR*RHHRLIIHSDRTLPVNSDDVSDAGDVTVRGAV KIGIA*KQGIT*VHNHGN*ETTQK*FLNPHINSMIFEKNNGLVIYGERQQCIHLKWPILI CII*SGFFPYIARNTERHIFSFINF >_5 VSILIPHRTITLKNDYENLSICIVDRVVFNYPSYRRENNCIIIKPRKTCF*ASFSCITNK VILASAIAQRHDFCRGKGHQITETKRPMTSS*VNHSFRPDVTC**R*RVRRW*RHGTWCC ENWYCIKTRNYLSAQPRELGNDTEMISQPTHKFNDI*KE*WFGHLW*KAAVHSS*MANFN LHYMKWIFPLHS*KY*KAHF*LHKFX >_6 GIHLNTPPHNNS*KRLRKFVDLYRRPGGI*LSILPQRK*LYNN*AKKNMFLSFI*LYYK* SDSGFRDCSEA*FLPGKRASDY*NQTADDVIIG*SFIPTGRYLLIAMTCQTLVTSRYVVL *KLVLHKNKELLKCTTTGIRKRHRNDFSTHT*IQ*YLKRIMVWSFMVKGSSAFILNGQF* FALYEVDFSLT*LEILKGTFLAS*IX >LQW66533.x1 >lcl|LQW66533.x1 CHROMAT_FILE: LQW66533.x1 PHD_FILE: LQW66533.x1.phd.1 CHEM: term DYE: ET TIME: Fri May 4 11:56:41 2001 TEMPLATE: LQW66533 DIRECTION: fwd AGAAACTGTGAATTTCTGCAGAAGAGAGGTGAGAAAAATAAAGATTTCTGCTTTGGCAATTCCTTCTCCCATGCAGTAAC GTGGTCCGATTGAAAACGGGAGAATTTTAGGTGAGTGGATGAATTTCCCATCTGAATCAATATGCCTATGAGGATTGAAC TTTTCTGGCTCTGGCCAGGTGTCTGGGTCATTATGCAAGGCCCACAGGTTTGCTACAACCATAGTACCCGAAGGAATGTC GTACCCGTTTAGTTTGATGTCCTCCATTGCACTATGGGGTGCAGCTCCTGGGGTTAGGGTACGGAATCTCATTATTTCTT GTATGAAGGCGCATGTTACCGGCATCTTTTCACGATCTTTCATGCACGGTACACCATCACTACCCAGAGCTTCATATACT TCATTATACATCAAGTCCATGTACTTTGGGTTATACAGCAGGGCAAGGATTGACCACTGGATTGTGTTACTTGTAGTTTC AACCCCAGCAATGAATAAATCACGAACATAAACCTTGAGTTGGTCGTTTTCAAAGAGCTTTGTGTTTTTTCCAATGCCAA ATTTCTGCTCGTATATATAAGCATCAATAAAATCCTCTACATTATTTGGATCAAAATTCTTCTGGTGTTCTTCAATTATC CCCAGCAACATGCTTAAAATTCGATGCTGGTT >_4 NQHRILSMLLGIIEEHQKNFDPNNVEDFIDAYIYEQKFGIGKNTKLFENDQLKVYVRDLF IAGVETTSNTIQWSILALLYNPKYMDLMYNEVYEALGSDGVPCMKDREKMPVTCAFIQEI MRFRTLTPGAAPHSAMEDIKLNGYDIPSGTMVVANLWALHNDPDTWPEPEKFNPHRHIDS DGKFIHSPKILPFSIGPRYCMGEGIAKAEIFIFLTSLLQKFTVS >_5 PASNFKHVAGDN*RTPEEF*SK*CRGFY*CLYIRAEIWHWKKHKAL*KRPTQGLCS*FIH CWG*NYK*HNPVVNPCPAV*PKVHGLDV**SI*SSG**WCTVHERS*KDAGNMRLHTRNN EIPYPNPRSCTP*CNGGHQTKRVRHSFGYYGCSKPVGLA**PRHLARARKVQSS*AY*FR WEIHPLT*NSPVFNRTTLLHGRRNCQSRNLYFSHLSSAEIHSFX >_6 TSIEF*ACCWG*LKNTRRILIQIM*RILLMLIYTSRNLALEKTQSSLKTTNSRFMFVIYS LLGLKLQVTQSSGQSLPCCITQSTWT*CIMKYMKLWVVMVYRA*KIVKRCR*HAPSYKK* *DSVP*PQELHPIVQWRTSN*TGTTFLRVLWL*QTCGPCIMTQTPGQSQKSSILIGILIQ MGNSSTHLKFSRFQSDHVTAWEKELPKQKSLFFSPLFCRNSQFL >SEQUENCE 94, 189, 97, 96, 137, 191 41% to 26B1 fugu MSFSVVSAYQKVAPMMVVTYDLLRMPATTGRNTTTLWQHEFLSTMENATEG WETELEVETVAEATFQQGANGEHEYSGSDQFFEQLNGTLQSLFDSSAVAASPLMAFILLG LAAILAVCILVHPLKAWWLNYNMKSAVDPDSKLNHLPIPPGSFGLPFIGETL LQGPKFNSNRRKKYGNVFTTNAISLPIVKVSGHEYVKEVILTGEHDKVTTIWPYTVRTILGSHGIVNSIGDIH KYKRKVAFKAFTRAALNDYVPIMRNHATRIVRQMQESDQPLVYPNMLRLTFDVAVNALLG LEISDQVELDMLFKTFHQLVSNVFCLPYNVPGFGFNK (?) GMKARNQLLDLLQIHIEAKKQAVFSEINKSGEGADPCDGLAFRGALGTILYEEIKNSI (?) RLKKLREESNLDNNNTKSDADNEFELGDLEIKEIAIELMFAGYYTSASALTS AILELARHPEVFSKLENELLQHGILREDSSDEEHMPELNLQNIHKLTYLDQVLKETLRIR PPVLGAYRRAKKTFQIGDYRIPKGWTVIYNIRDTHELEFEHMTGKCEFDPEHFAPDANDKKFR FIPFGGGPRVCIGQEYARIIMKVSLIEMIRCNSSWKLANKTLPKMVAIPTLHP KDGLPVHLQPRKTVGVVTSRSEPVATDSS* cilv031l15 cilv024m24 cicl027g11 citb010j08 GCiWno156_d15.g1 GCiWno628_i18.b1 cibd014f18 DEV14823.x1 N-TERM DEV14823.y1 LQW248720.x1 LQW248720.y1 N-TERM DEV55031.y1 DEV30891.y1 LQW272125.x1 N-TERM >scf/ciona01/G126/seq_dir/hrs/G126P65492F.T0/G126P65492FE3.T0.seq 725 0 725 ABI Length = 725 Minus Strand HSPs: evidence for middle exon Score = 196 (69.0 bits), Expect = 2.2e-15, P = 2.2e-15 Identities = 41/58 (70%), Positives = 47/58 (81%), Frame = -1 Query: 1 GMKARNQLLDLLQIHIEAKKQAVFSEINKSGEGADPCDGLAFRGALGTILYEEIKNSI 58 GMKAR QLLDLLQ HIE KK+AV +EINK G ++P + AFRGALG IL+EEIKNSI Sbjct: 254 GMKARQQLLDLLQTHIEIKKKAVLAEINKDGAESEPDNRSAFRGALGIILHEEIKNSI 81 >GCiWno491_n12.b1 CHROMAT_FILE: GCiWno491_n12.b1 PHD_FILE: GCiWno491_n12.b1.phd.1 CHEM: term DYE: big TIME: Tue Oct 16 10:26:40 2001 TEMPLATE: GCiWno491_n12 DIRECTION: fwd Length = 905 Score = 104 bits (257), Expect = 4e-22 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 64 RLKKLREESNLDNNNTKSDADNEFELGDLEIKEIAIELMFAGYYTSASALTS 115 RLKKLREESNLDNNNTKSDADNEFELGDLEIKEIAIELMFAGYYTSASALTS Sbjct: 497 RLKKLREESNLDNNNTKSDADNEFELGDLEIKEIAIELMFAGYYTSASALTS 652 Score = 40.6 bits (93), Expect = 0.007 Identities = 19/21 (90%), Positives = 20/21 (94%) Frame = +2 Query: 35 FNKGMKARNQLLDLLQIHIEA 55 F +GMKARNQLLDLLQIHIEA Sbjct: 206 FYQGMKARNQLLDLLQIHIEA 268 >GCiWno491_n12.b1_1 S*GSPNLLE*XSYLIFRSVERGYL*LQFTIKARRVVGWKKLKQIAASLRLIGAPLRLL*L *RRIE*AYFLSGNESTKPTFGLASNSYRSQKASGVFGNQ*KWRRSGSV*WTCFSGGTWHH SLRGN*KLNQVIV*YNIYHTNIYT*IGVYDSFKCFFPYNVYSILI*TEEIKRRKQLGQQQ HKIRCRQ*V*IRRLGDQRNCD*TNVRRLLHLCQCSYIRYT*TSAPPRCFL*A*K*TTSAW YPA*RFI**RHMPELTFRHTXLPTSISPKGTLAFDTSPGAYREQKDLQIG*VTWHGXS*V LX >GCiWno491_n12.b1_2 LEAPQICWSDXPT*SLGLWSAATYDFSLR*RRGAWLAGKNSNKLQPV*DLLAPP*GCSNC SGV*NKLIFYQGMKARNQLLDLLQIHIEA KKQAVFSEINKSGEGADPCDGLAFRGALGTI LYEEI KNSIR*LFNTTYTIPIYILELEFMIVLNVFSHITYILF*SRLKKLREESNLDNNN TKSDADNEFELGDLEIKEIAIELMFAGYYTSASALTSAILELARHPDVFSKLENELLQHG ILREDSSDEDTCQSLPSDIHXYLPRSVLREPSHSTPVXAHTESKKTFKSGKSLGTXXHEC *X >GCiWno491_n12.b1_3 LRLPKFAGVTVLLNL*VCGARLLMTSVYDKGAARGWLEKTQTNCSQFETYWRPLKAALIV AAYRISLFFIRE*KHETNFWTCFKFI*KPKSKRCFRKSIKVAKERIRVMDLLFGGHLAPF STRKLKTQSGNCLIQHIPYQYIYLNWSL**F*MFFPI*RIFYFNLD*RN*EKKATWTTTT QNPMPTMSLN*ATWRSKKLRLN*CSPVTTPLPVLLHPLYLN*RATPMFSLSLKMNYFSMV SCVKIHLMKTHARAYLQTYTTTYLDQS*GNPRIRHQSXRIPRAKRPSNRVSHLARXXMSV E >GCiWno628_i18.b1_1 NRWCIQTCFD*RLTLRSMLCLDWK*VTKSSWTCCSKPFTN*SATCSAFHTTFQDLVLIR* TKL*SSLLVSMTIFK*FVQN**IEYTVAKFRKFVFFIYSIKLATNYRESHVF*SSDYRKR HKK*LSNSHTSSPFPINDVLKSRSIPCYTVFALEITVSDTCNWRPMGLLEFAYRDHASKR EVICNEPQVKFCGGPATRKLNLEPRNLAAYIAGPPKIYSEVHDLLNLSGWGSAPTYEGRL PIKAPG*EWPEKNSHQNCGPAQHPLLPRTLKACYQCGNGA*SSNVVYFYMRVVHYPIRPA RATRSSHPHTHX >GCiWno628_i18.b1_2 TAGVSKHASIDV*RCGQCFAWIGNK*PSRAGHVVQNLSPTSQQRVLPSIQRSRIWF**GK LNYRVAYWFQ*RYSNNLYRISKLSIQSQNSGNLYFLFIA*SWLLITESHMYSNHQTIVND IRNSFQIRILHHHSRSMTY*NRAVYHVIPCSHLK*QFRTHVIGAQWVCLSSPIATTHPNG KLFATNHR*SFVAVRPPGNLTSSPVTLRPI*RAPRKFTRRYTTYLIFQGGAARLLMKAGY Q*RLPAESGRKKTPTKIAAQPNTLFCRAP*RLVINVETALKAVTSYTSICASCTILYAQL VPRALLTRTLI >GCiWno628_i18.b1_3 PLVYPNMLRLTFDVAVNALLGLEISDQVELDMLFKTFHQLVSNVFCLPYNVPGFGFNKVN *TIE*PIGFNDDIQIICTELVN*VYSRKIQEICIFYL*HKVGY*LQRVTCILIIRLS*TT *EIAFKFAYFITIPDQ*RTKIAQYTMLYRVRT*NNSFGHM*LAPNGFA*VRLSRPRIQTG SYLQRTTGEVLWRSGHPET*PRAP*PCGLYSGPPENLLGGTRPT*SFRVGQRAYL*RQAT NKGSRLRVAGKKLPPKLRPSPTPSFAAHLKGLLSMWKRRLKQ*RRILLYARRALSYTPSS CHALFSPAHSY >GCiWno628_i18.g1_4 = seq 96 TCTIXYEEIKTQSGNCLXHIXPYQYIS*IGVYDSLKCFFPYNVYSILI*TEEIREXSNLD NNNTKSDADNEFELGDLEIKEIAIELMFAGYYTSASALTSAILELARHPEVFSKLENELL QHGILREDSSDEEHMPELNLQNIHKLTYLDQVLKETLRIRPPVLGAYRRAKKTFQIGVST LGHGLVMSCCDGKLRKFTSWPLSYISLATWLTLKLLTHLYVFYR*AHSLPIDRRFSTKTV PIM*MSFSPIF*KLRHILFVRPVTSSSSGSSCTCLVEGQVKPSEAWARPVDLSRIPILNF *PAPSVHT >GCiWno628_i18.g1_5 HLHHFXRGNKNSIR*LFNXHXXIPIYILNWSL**FKMFFPI*RIFYFNLD*RNKRRXQLG QQQHKIRCRQ*V*IRRLGDQRNCD*TNVRRLLHLCQCSYIRYT*TSAPPRSFL*A*K*TT SAWYPA*RFI**RTHARA*PSEHTQTNLPRSSPKGNPPHSTTSPRRIPTSQKDLSNRGKY TWSRVSHELL*WKTTKIYKLAFVVHFTCDVAYFKVADASICILPISAQSTNRPQV*H*NC TDYVNVILTHFLKTPPHPICATCNIFFEWK*LHLSRRRTGQAV*SMGAAC*SISYTYTEL LTCAIGTYX >GCiWno628_i18.g1_6 LAPFXTRK*KLNQVIV*XTYXHTNIYLELEFMIV*NVFSHITYILF*SRLKK*EKXATWT TTTQNPMPTMSLN*ATWRSKKLRLN*CSPVTTPLPVLLHPLYLN*RATPKFSLSLKMNYF SMVSCVKIHLMKNTCQSLTFRTYTN*PTSIKS*RKPSAFDHQSSAHTDEPKRPFKSG*VH LVTG*S*VVVMENYENLQVGLCRTFHLRRGLL*SC*RIYMYFTDKRTVYQ*TAGLALKLY RLCKCHSHPFFKNSATSYLCDL*HLLRVEVVALVSSKDRSSRLKHGRGLLIYLVYLY*TF NLRHRYIL >cicl027g11_1 KYGNVFTTNAISLPIVKVSGHEYVKE ILTGEHDKVTTIWPYTVRTILGSHGIVNSIGDIH KYKRKVAFKAFTRAALNDYVPIMRNHATRIVRQMQESDQPLVYPNMLRLTFDVAVNALLG LEISDQVELDMLFKTFHQLVSNVFCLPYNVPGFGFNKGMKARNQLLDLLQIHIEA >SEQUENCE 95 MID REGION 288-313 55% TO 26B1 probable accidental match EGTLGLISGAYAGTSSARTKLVPSTMELL LQW235922.y1 >SEQUENCE 97 MID REGION 181229 46% TO 26C1 LVYPNMLRLTFDVAVNALLGLEISDQVELDMLFKTFHQLVSNVFCLPYNVP DEV10394.y1 >SEQUENCE 98, 31, 200 65% TO SEQ 13 KHELIX TO PKG 51% TO 2R1 LKRTLLGFINIHEKTYDSTNIRDFIDAFLLLKHRQLDESFNDKQLIHYIYDLFLGGTETT TGTLRWAILCLLHYPEKQAKLRKEIIQVLGDQEVTILKKHEMPYASAFIHEVYRFRTLFP LGLPHKTSHQVILDSYVIPQGTTVCTNLWAVHNDPKVFDEPEEFKPERHLYGNGEFGRSP YVIPFSVGPRHCLGEQLASMMLFIYLVSLVRSF EFLPDPKLNGLPDIRSGASGPVFLPKSFNVVAREL* LQW261662.y1 >sequence 200 547 DLFLGGTETTTGTLRWAILCLLHYPEKQAKLRKEIIQVLG 666 LQW104382.y1 I-HELIX >cilv035a12 Length = 639 Score = 93.2 bits (228), Expect = 4e-19 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 1 MPYASAFIHEVYRFRTLFPLGLPHKTSHQVILDSYVIPQGTTV 43 MPYASAFIHEVYRFRTLFPLGLPHKTSHQVILDSYVIPQGTTV Sbjct: 304 MPYASAFIHEVYRFRTLFPLGLPHKTSHQVILDSYVIPQGTTV 432 >cilv035a12 TTAAAACGAACCCTTCTCGGGTTTATAAACATACACGAAAAGACATATGACAGCACGAACATTAGGGACTTTATTGACGC CTTTCTTCTGCTCAAGCATCGCCAACTGGACGAGTCATTTAACGACAAACAGTTAATACATTATATATACGACTTATTTT TGGGCGGGACCGAAACAACGACTGGTACCCTACGATGGGCCATTCTATGTTTACTGCATTATCCTGAAAAGCAAGCCAAG TTACGGAAAGAAATAATTCAAGTACTCGGAGATCAAGAAGTTACAATTCTAAAGAAACACGAGATGCCGTATGCAAGCGC TTTCATTCACGAAGTTTATAGATTCAGGACTTTATTTCCTCTTGGTTTACCACATAAAACAAGTCATCAGGTTATTTTGG ACAGCTACGTTATACCACAGGGAACAACGGTATGCACTAATCTTTGGGCGGTACACAACGACCCAAAGGTATTTGACGAG CCCGAGGAATTTAAACCTGAGCGTCATCTTTATGGAAACGGGGAGTTCGGACGCTCTCCCTACGTCATACCCTTTTCAGT TGGACCTCGTCACTGCTTAGGCGAGCAGCTAGCATCTATGATGTTGTTTATATATTTAGTTTCACTCGTTAGGAGTTTC >cilv035a12_1 LKRTLLGFINIHEKTYDSTNIRDFIDAFLLLKHRQLDESFNDKQLIHYIYDLFLGGTETT TGTLRWAILCLLHYPEKQAKLRKEIIQVLGDQEVTILKKHEMPYASAFIHEVYRFRTLFP LGLPHKTSHQVILDSYVIPQGTTVCTNLWAVHNDPKVFDEPEEFKPERHLYGNGEFGRSP YVIPFSVGPRHCLGEQLASMMLFIYLVSLVRSF >SEQUENCE 84 JOINT AT HEME 53% TO 2C8 join with 99 KINKFVKAEIKQHRQNLDPRNPRDYIDCYLNELNHMNDQSEL (1) agt MSIMDLFQAGTETTSTTLRWAILYLANNPHIQ (?) EKVQQEIDEVLGFDQLPQYEDRMRMPYCEATVLEVQRMATIAPIGL (?) HCSEDDQVLGGYHVPKRTSXXACYHSIHFDPKFWKNPN KFDPCNFLDSNGKVCIPDAFMPFGGG (?) LRICVGMNIAKQELFLFFVAILQKFSLHLPDDMDHLDEKPGPGIILAPKIYRVQIKRRA LQW177629.x1 HEME opposite end = LQW177629.y1 LQW275459.y1 HEME rciad099g22 LQW172566.y1 LQW172566.y1.phd.1 LQW172566.x1 13:48:05 2001 TEMPLATE: LQW172566 DIRECTION: rev Length = 956 Score = 68.3 bits (164), Expect = 1e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +2 Query: 44 SIMDLFQAGTETTSTTLRWAILYLANNPHIQEK 76 SIMDLFQAGTETTSTTLRWAILYLANNPHIQ K Sbjct: 656 SIMDLFQAGTETTSTTLRWAILYLANNPHIQGK 754 Score = 48.8 bits (114), Expect(2) = 7e-12 Identities = 20/26 (76%), Positives = 23/26 (87%) Frame = +3 Query: 20 KNPRDYIDCYLKELDQMNDQSELSSI 45 +NPRDYIDCYL EL+ MNDQSELS + Sbjct: 123 RNPRDYIDCYLNELNHMNDQSELSEL 200 Score = 40.2 bits (92), Expect(2) = 7e-12 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = +2 Query: 1 KINKFVKAEIEQHRQNFDRKNPR 23 KINKFVKAEI+QHRQN D + P+ Sbjct: 65 KINKFVKAEIKQHRQNLDPEKPK 133 >SEQUENCE 99, 84, 206 J-HELIX K-HELIX 47% TO 2A13 very similar to seq 111 or 84 may be same gene SIMDLFQAGTETTSTTLRWAILYLANNPHIQ (?) EKVQQEIDEVLGFDQLPQYEDRMRMPYCEATVLEVQRMATIAPIGL ATIAPIGLHCSEDDQVLGGYPCPKRTSIVACYHSIHFDPKFWKNPT (many frameshifts) LQW213341.x1 LQW181002.x1 LQW143057.y1 LQW181002.x1 LQW181002.x1.phd.1 LQW181002.y1 14:12:22 2001 TEMPLATE: LQW181002 DIRECTION: fwd Length = 901 Score = 92.4 bits (226), Expect = 5e-19 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +3 Query: 1 VQQEIDEVLGFDQLPQYEDRMRMPYCEATVLEVQRMATIAPIGL 44 VQQEIDEVLGFDQLPQYEDRMRMPYCEATVLEVQRMATIAPIGL Sbjct: 174 VQQEIDEVLGFDQLPQYEDRMRMPYCEATVLEVQRMATIAPIGL 305 >LQW181002.x1 >lcl|LQW181002.x1 CHROMAT_FILE: LQW181002.x1 PHD_FILE: LQW181002.x1.phd.1 CHEM: term DYE: ET TIME: Wed Aug 22 14:12:22 2001 TEMPLATE: LQW181002 DIRECTION: fwd NGGAGTTGTAACTTTTGTGGGTGATTTGTTTTTTTTTATATGGCTTACAATTTAAACAACCCATTAGTGACCACTGGGTT GGAGCAATTGCTATTAAGTCTTTTGCTTTAGGAGTTACATACACCCACAATGATTTATACTTAGTTTAAATGCTCTTTCT TTTATCAGAGAAAGTCCAGCAGGAGATTGATGAAGTTTTGGGTTTTGATCAACTTCCTCAATATGAAGATCGAATGAGAA TGCCATATTGTGAAGCAACTGTTTTAGAAGTACAAAGAATGGCAACCATTGCACCAATTGGTTTGTGCTTTTTAATTTAA ACCTAGGTGACTGCGGCTTGGGCACAGTGATTAGCGCACCTGCTCCTGACCCAGGGTGTTCCCTTATGAGTTCAAATTGT CAGTCAAAGGTTATACAAAAAAAATCCATTAAAAATTGTTACCCATAAAGTTACATACAAGGTAACTCGTAAGCGGGCAC AAGGTGTTTAAAACAAAACACCCGTATGTATTATAGCAACTGACTTTACCCACGAGGCAAGGATAAATAAGATATTTATT TATTCAGTGTACCAACATTATAACTAATCATACAGGTTTGCAACATTGTTCAGAAGACGACCAGGTGTTAGGTGGCTATC CGTGTCCAAAGCGTACAAGTATTGTGGCATGTACCACTCTATTCATTTCGACCAAAATTTGGAAAATCCAACAATTGATC CTGCATTTCTGACGCATGCAAATTGATTCTGATCTTATCGTGGGGAGGAGTACATTAAAATGAGTTAAAGTCAGGAGGGT ACACCGGCTAATTTACAATATTTGGGAACCGAATTTAAACTAATCGGACCCAGTTTTTACTCGATGGCCAAGTTTTTACA CACTCTTTAAACACGACTACG >_1 XSCNFCG*FVFFYMAYNLNNPLVTTGLEQLLLSLLL*ELHTPTMIYT*FKCSFFYQRKSS RRLMKFWVLINFLNMKIE*ECHIVKQLF*KYKEWQPLHQLVCAF*FKPR*LRLGHSD*RT CS*PRVFPYEFKLSVKGYTKKIH*KLLPIKLHTR*LVSGHKVFKTKHPYVL*QLTLPTRQ G*IRYLFIQCTNIITNHTGLQHCSEDDQVLGGYPCPKRTSIVACTTLFISTKIWKIQQLI LHF*RMQIDSDLIVGRSTLK*VKVRRVHRLIYNIWEPNLN*SDPVFTRWPSFYTLFKHDY X >_2 GVVTFVGDLFFFIWLTI*TTH**PLGWSNCY*VFCFRSYIHPQ*FILSLNALSFIRESPA GD**SFGF*STSSI*RSNENAIL*SNCFRSTKNGNHCTNWFVLFNLNLGDCGLGTVISAP APDPGCSLMSSNCQSKVIQKKSIKNCYP*SYIQGNS*AGTRCLKQNTRMYYSN*LYPRGK DK*DIYLFSVPTL*LIIQVCNIVQKTTRC*VAIRVQSVQVLWHVPLYSFRPKFGKSNN*S CISDACKLILILSWGGVH*NELKSGGYTG*FTIFGNRI*TNRTQFLLDGQVFTHSLNTTT >_3 EL*LLWVICFFLYGLQFKQPISDHWVGAIAIKSFALGVTYTHNDLYLV*MLFLLSEKVQQ EIDEVLGFDQLPQYEDRMRMPYCEATVLEVQRMATIAPIGLCFLI*T*VTAAWAQ*LAHL LLTQGVPL*VQIVSQRLYKKNPLKIVTHKVTYKVTRKRAQGV*NKTPVCIIATDFTHEAR INKIFIYSVYQHYN*SYRFATLFRRRPGVRWLSVSKAYKYCGMYHSIHFDQNLENPTIDP AFLTHAN*F*SYRGEEYIKMS*SQEGTPANLQYLGTEFKLIGPSFYSMAKFLHTL*TRL LQW246766.y1 LQW246766.y1.phd.1 LQW246766.x1 12:25:07 2001 TEMPLATE: LQW246766 DIRECTION: rev Length = 1003 Score = 92.4 bits (226), Expect = 5e-19 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +3 Query: 1 VQQEIDEVLGFDQLPQYEDRMRMPYCEATVLEVQRMATIAPIGL 44 VQQEIDEVLGFDQLPQYEDRMRMPYCEATVLEVQRMATIAPIGL Sbjct: 462 VQQEIDEVLGFDQLPQYEDRMRMPYCEATVLEVQRMATIAPIGL 593 LQW213341.x1 LQW213341.x1.phd.1 LQW213341.y1 11:06:27 2001 TEMPLATE: LQW213341 DIRECTION: fwd Length = 951 Score = 92.4 bits (226), Expect = 5e-19 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 1 VQQEIDEVLGFDQLPQYEDRMRMPYCEATVLEVQRMATIAPIGL 44 VQQEIDEVLGFDQLPQYEDRMRMPYCEATVLEVQRMATIAPIGL Sbjct: 353 VQQEIDEVLGFDQLPQYEDRMRMPYCEATVLEVQRMATIAPIGL 222 >LQW213341.x1 >lcl|LQW213341.x1 CHROMAT_FILE: LQW213341.x1 PHD_FILE: LQW213341.x1.phd.1 CHEM: term DYE: ET TIME: Mon Aug 27 11:06:27 2001 TEMPLATE: LQW213341 DIRECTION: fwd CCGGAGTTGCTATAATACATACGGGTGTTTTGTTTTAAACACCTTGTTGCCCGCTTACGAGTTACCTTGTATGTAACTTT ATGGGTAACAATTTTTAATGGATTTTTTTTGTATAACCTTTGACTGACAATTTGAACTCATAAGGGAACACCCTGGGTCA GGAGCAGGTGCGCTAATCACTGTGCCCAAGCCGCAGTCACCTAGGTTTAAATTAAAAAGCACAAACCAATTGGTGCAATG GTTGCCATTCTTTGTACTTCTAAAACAGTTGCTTCACAATATGGCATTCTCATTCGATCTTCATATTGAGGAAGTTGATC AAAACCCAAAACTTCATCAATCTCCTGCTGGACTTTCTCTGATAAAAGAAAGAGCATTTAAACTAAGTATAAATCATTGT GGGTGTATGTAACTCCTAAAGCAAAAGACTTAATAGCAATTGCTCCAACCCAGTGGTCACTAATGGGTTGTTTAAATTGT AAGCCATATAAAAAAAAACAAATCACCCACAAAAGTTACAACTCGTAAGCGGGCACAAGGTGTATGACACAGAACATCCG TGTTATAACGACTGTTGTTTCACCGTAATGCAAGTACAAAGCAAATTACATTACAGAGGCCTAAAAACAATGCAATAGGT TTACTTGAATATGAGGATTATCAGCTCAGTATCAAATTGCCAACGTAAGGTAGTTGATGTAGTTCAGTTCCAGCTTGAAC AGTTCATGATCACATTCTAAGCTGAGACCAACAGTTGATGACGTATTAGTCGCCCTAGGCCCATAGAAGACGAACGCTCA AAGCTAGAAGGTGAACGAAACACGTGTACCGCTGTATTCCGAACAATACGTCGACAGGCGGAATAGTCGGCCCTTGCAAT AACGCGGACAGCCATGGGGGCCGGACCAAAGGCACGACGACGGGAGACGCACACCCACACGAAGGTGCACA >_4 CAPSCGCASPVVVPLVRPPWLSALLQGPTIPPVDVLFGIQRYTCFVHLLALSVRLLWA*G D*YVINCWSQLRM*S*TVQAGTELHQLPYVGNLILS**SSYSSKPIALFLGLCNVICFVL ALR*NNSRYNTDVLCHTPCARLRVVTFVGDLFFFIWLTI*TTH**PLGWSNCY*VFCFRS YIHPQ*FILSLNALSFIRESPAGD**SFGF*STSSI*RSNENAIL*SNCFRSTKNGNHCT NWFVLFNLNLGDCGLGTVISAPAPDPGCSLMSSNCQSKVIQKKSIKNCYP*SYIQGNS*A GNKVFKTKHPYVL*QLR >_5 CTFVWVCVSRRRAFGPAPMAVRVIARADYSACRRIVRNTAVHVFRSPSSFERSSSMGLGR LIRHQLLVSA*NVIMNCSSWN*TTSTTLRWQFDTELIILIFK*TYCIVFRPL*CNLLCTC ITVKQQSL*HGCSVSYTLCPLTSCNFCG*FVFFYMAYNLNNPLVTTGLEQLLLSLLL*EL HTPTMIYT*FKCSFFYQRKSSRRLMKFWVLINFLNMKIE*ECHIVKQLF*KYKEWQPLHQ LVCAF*FKPR*LRLGHSD*RTCS*PRVFPYEFKLSVKGYTKKIH*KLLPIKLHTR*LVSG QQGV*NKTPVCIIATPX >_6 VHLRVGVRLPSSCLWSGPHGCPRYCKGRLFRLSTYCSEYSGTRVSFTF*L*AFVFYGPRA TNTSSTVGLSLECDHELFKLELNYINYLTLAI*Y*ADNPHIQVNLLHCF*ASVM*FALYL HYGETTVVITRMFCVIHLVPAYEL*LLWVICFFLYGLQFKQPISDHWVGAIAIKSFALGV TYTHNDLYLV*MLFLLSEKVQQEIDEVLGFDQLPQYEDRMRMPYCEATVLEVQRMATIAP IGLCFLI*T*VTAAWAQ*LAHLLLTQGVPL*VQIVSQRLYKKNPLKIVTHKVTYKVTRKR ATRCLKQNTRMYYSNSG >sequence 206 656 SIMDLFQAGTETTSTTLRWAILYLANNPHIQ 748 LQW172566.y1 I-HELIX LQW246766.y1 I-HELIX LQW43790.y1 I-HELIX >SEQUENCE 102, 53, 150 SIMILAR TO SEQ 8 N-TERM 39% TO 2B6 MIDIFQTICASTGPYPFTVLVICVVWVFRWWRRPHDLPPGPRGFPLLGVIPFMGEFPER VIKKWSLENYGPIMCARMGMQDSVFLNTADAIKM (?) AFCDNSEYLSGRPTTTIFKQVTGDKGIGLKQYGENYKVIRKFIVRTLSK (?) YGVGKTMIENQIVEEAGLLAEFLKTKTNQLVDL (?) FYLYVLTSNIVSRVVCGRRYDFEDEKYHQVLINLQKM (?) LGDAKDAPFTLLIDFFPGLKHLPWFRGANNRMIERIKNWL (?) EHSKDHVEEHKKTFDKNNLRDLIDSFLHEQAYGKTENKN (?) EEELIVIVRDLFSAGSETSSNSILWILIVLLHHPHHAKKCIQEIDDVMG PNGAPSSQHREKMPFTCAVIQETFRYRTVAPIGLQHYAQATVELGGLRIPQGQG VYSNIWGVHNDPVAWPNPS EFDPYRHINKDGKFVLSNNIMTFSIGPRSCPGEALAKLEIFMFVTKILQKF NVRASPNNPPSLDGVNCLQFTPLSCEVILTER* DEV25655.y1 1 DIFF LQW55279.x1 GCiWno334_n06.b1 GCiWno274_n06.b1 GCiWno133_n06.g1 GCiWno535_f10.b1 GCiWno949_k07.g1 >GCiWno678_h15.g1 CHROMAT_FILE: GCiWno678_h15.g1 PHD_FILE: GCiWno678_h15.g1.phd.1 CHEM: term DYE: big TIME: Fri Nov 2 13:23:55 2001 TEMPLATE: GCiWno678_h15 DIRECTION: rev Length = 923 Score = 69.9 bits (168), Expect = 4e-12 Identities = 34/35 (97%), Positives = 35/35 (99%) Frame = +3 Query: 1 YGVGKTMIENQIVEEAGLLAEFLKTKTNQLVDLKL 35 YGVGKTMIENQIVEEAGLLAEFLKTKTNQLVDLK+ Sbjct: 45 YGVGKTMIENQIVEEAGLLAEFLKTKTNQLVDLKV 149 >GCiWno678_h15.g1_1 LITNNRINLTK*YLDMESGKQ*LKIR*LKKLGCWQNF*KLKQTNWLI*R*RYSPH*INRI DGWVK*ALVDPTSYTGFSGVLYLL*Y*LPL*PETKQFMIS*YILFLFLV*VQDTVSGLRL HVGRARARKSPP*A*TDLEVSVPIVVLVG*LSFLVISYCARERANYLPDRIT*QQCDVVR *RGIDLG*TGHH*PRLTGGLFYRKVSHEISRICSVDID**SIGNWVM*RHYTRRVCTKII QMTSEIHITAWHILHLLKGCI**PTVXXDXTHXTXIS*SCF*SKSCGYNFINL*MXLCLL PNRXHKYX >GCiWno678_h15.g1_2 LLLTTELILQNNI*IWSRENND*KSDS*RSWVAGRIFKN*NKPTG*SEGKDIAPTK*TGL MVGLNEPLLIRLHIQASAGCYIYCSTSCLYNQRPNSS*YLDIFYSFFWYKYRIQYRA*DC MSAEQGLARARHEPRLTSRSQCR*WC*LGSYRFSLLVIVLGKGRIIYRTESRDSSVTSCA KGESIWAERDIINLV*RGVCFIGKSLMR*VVSAVLTLINEVLGIGLCDVTIRVEFAQRLY K*HRKYISQHGIYCTC*KDVYSSLLXGXIXHIXXKYPNRVSNRSRVDTTL*IFEWXFVYY QIGTINIX >GCiWno678_h15.g1_3 YY*QQN*SYKIIFRYGVGKTMIENQIVEEAGLLAEFLKTKTNQLVDLKVKI*PPLNKQD* WLG*MSPC*SDFIYRLQRGAISTVVLVAFITRDQTVHDILIYFIPFSGISTGYSIGPKIA CRPSKGSQEPAMSLD*PRGLSADSGVSWVVIVSRY*LLC*GKGELFTGQNHVTAV*RRAL KGNRFGLNGTSLTSFNGGFVL*ESLS*DKSYLQC*H*LMKYWELGYVTSLYASSLHKDYT NDIGNTYHSMAYIALVKRMYIVAYCXVXXDTXYXNILIVFLIEVVWIQLYKSLNGSLFTT K*XP*IF >GCiWno678_h15.b1_4 = seq 53 SIGVVWIHL*FL*MFFVTTK*DHKIF*KCPIYP*FTISNGYRSFIXMFYVQTL*VALFVE DDTILRTRNITKF*SIYKKCKLECNFH*IYRPNTRFTFSLGDAKDAPFTLLIDFFPGLKH LPWFRGANNRMIERIKNWLGENVFTYKSCLWCYILCSILLREPYIYPRT**RSR*RTQEN L**KQSSRLD*LIPTRTSIWENGKQERIYSKLRCMQYK*ETF*KRIIVY*NNVTSLQEEE LIVIVRDLFSAGSETSSNSILWILIVLLHHPHHAKKCIQEIDDVMGKRF*IPN >GCiWno678_h15.b1_5 FYRSRVDTLIISLNVLCYYQIGP*NILKMSHLPLIYYI*WLSQFYLYVLRPNIVSRVVCG RRYDFEDEKYHQVLINLQKM*VRM*LSLNL*TQYKVYI*FG*RERCTVHTSH*FFSWS*T PALVSWG**QDDRTNKKLVR*ECVYI*KLFVVLYIMQHIIKRTIYLSKNIVKITLKNTRK PLIKTIFAT*LTHSYTNKHMGKRKTRTYIQ*VTLYAI*IRNILKTHYSVLK*RYVVTGGR TDCYRP*SIFCWL*NQ**LYTVDIDSSTASSTPCKKMYTRNRRCYG*ALLNS*X >GCiWno678_h15.b1_6 XLSESCGYTYNFFECSLLLPNRTIKYFKNVPSTPNLLYLMVIAVLSXCSTSKHCKSRCLW KTIRF*GREISPSFNQSTKNVS*NVTFIKSIDPIQGLHLVWVTRKMHRSHFSLIFFLVLN TCLGFVGLITG*SNE*KTG*VRMCLHIKAVCGVIYYAAYY*ENHIFIQEHSKDHVEEHKK TFDKNNLRDLIDSFLHEQAYGKTENKNVYTVSYVVCNINKKHFENAL*CIEITLRRYRRK N*LLSSVIYFLLALKPVVTLYCGY**FYCIIHTMQKNVYKKSTMLWVSAFKFLX walk >GCiWno581_b05.b1 CHROMAT_FILE: GCiWno581_b05.b1 PHD_FILE: GCiWno581_b05.b1.phd.1 CHEM: term DYE: big TIME: Wed Oct 24 12:48:32 2001 TEMPLATE: GCiWno581_b05 DIRECTION: fwd Length = 924 Score = 92.4 bits (226), Expect = 2e-18 Identities = 51/78 (65%), Positives = 56/78 (71%), Gaps = 4/78 (5%) Frame = -2 Query: 1 KGNRFGLNGTSLTSFNGGFVLESLSDK----SYLQCHLMKYWELGYVTSLYASSLHKDYT 56 KGNRFGL G SLTSFNGGFV S S + + + LGYVTSLYASS +KDYT Sbjct: 539 KGNRFGLKGISLTSFNGGFVFIGRSLMR*VVSAVLTLINEVLGLGYVTSLYASSCNKDYT 360 Query: 57 NDIGNTYHSMAYIALVKR 74 N IGNTYHSMAYIALVK+ Sbjct: 359 NGIGNTYHSMAYIALVKK 306 Score = 57.0 bits (135), Expect = 9e-08 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -3 Query: 78 YFYVMTSNIIGRVVCGRRHDFEDEEYHEIL 107 Y YV+TSNI+ RVVCGRR+DFEDE+YH++L Sbjct: 103 YLYVLTSNIVSRVVCGRRYDFEDEKYHQVL 14 >SEQUENCE 103 93% TO SEQ 102 (3 DIFFS) SIMILAR TO SEQ 8 N-TERM 37% TO 2R1 note new C-term like seq 53 MFENMVYTLQYIFASIGPYPFTVLAICVAMLVRWWRRPHGLPLGPRGIPLLGVIPFMGE FPERVIKKWSLENYGPIMCARMGMEDGVFLNTAEAIKM AFCDKSEHLSGRPRTTIFKQVTKDKGLALKQYGKDYNIIRKFVVRTLSQ WGVGKTMIEDQIVEEAGLLADFLKNKTNQPIELK LYFYVMTSNIIGRVVCGRRHDFEDEEYHEILN NIQKVLGEADDAXLTLLIDFFPGLKHLPWFRGANNRMIERVKKTLEYCKGVIEEH KKTFDKNNLRDLIDALLYEQQFGKKSKRKVLL EDELVVIVRDLFTAGS GETSSLMISWVLIMLLHHPEHAKKVIEEIDDVMGPNGAPSTKHRDRMPFTCAVIQETFRC KIVAPIGIQHYAQATVELGGYIIPQGTMVYSNIWGVHNDPVAWPNPSKFDPYRHISKDGKFF TSNNIISFSTGPRSCPGEPLAKMEIFLFVTKILQKFEVKAPPDKLPSLVGVNCLLFSPES CEVILTER cigd034j09 LQW5999.y01 LQW5999.y1 >cigd034j09_2 HEILN NIQKVLGEADDAXLTLLIDFFPGLKHLPWFRGAXNRMIERVKKTLEYCKGVIEEH KKTFDKNNLRDLIDALLYEQQFGKKSKRKVLLEDELVVIVRDLFTAGS ETSSLMISWVLI MLLHHPEHAKKVIEEIDDVMGPNGAPSTKHRDRMPFTCAVIQETFRCKIVAPIGIQHYAQ ATVELGGYIIPQGTMVT*VLLVNYYLLSRTMVSTPVIKX >cibd044f17_3 GETSSLMISWVLIMLLHHPEHAKKVIEEIDDVMGPNGAPSTKHRDRMPFTCAVIQETFRC KIVAPIGIQHYAQATVELGGYIIPQGTMVYSNIWGVHNDPVAWPNPSKFDPYRHISKDGKFF TSNNIISFSTGPRSCPGEPLAKMEIFLFVTKILQKFEVKAPPDKLPSLVGVNCLLFSP XSCEVILTER* cibd044f17 cigd035c09 GCiWno390_d18.g1 GCiWno688_g17.g1 GCiWno821_j18.b1 >rcigd035c09_4 New C-term seq TSNNIISFSTGPRSCPGELLAKMEIFLFVTKILQKFEVKAPPDKLPSLVGVNCLLFSPES CEVILTER*MSRSANYGIHT*TN*H**CKFKQKLTTIIKCT*P*N*FLHLWAC*LFYSFK SIKELSFHFTVKKPVQTITQESTALMRGLITLNVKSXAWSQHALILLALLLKQA*FS*VY FKR*YQIIKLIKCCSCKKKRFFTDLRIVIKFMQSEIKKI >SEQUENCE 105 N-TERM TO KYG 38% TO 2R1 MMEVLIGLNVSTLATFLVVFYAVYYWYKRPGSYPPGPRGYPLVGVLPRLGKYPERVMRKWSRKY 122 GPVMSVRMGRNDWVSLNDYSSIKE (0?) Missing exon 2 CGFGKRSLEERIVEEVSYLNDAIRATMGKPFEIM (0?) LQW172064.y1 GCiWno938_m19.g1 >GCiWno629_g21.g1_1 FNY*HYHSQVHNWVHVCVYTITSSIFTSVKLC*GKSAAFASAASANEWLYITSVKTVQFT *A*WKY**G*T*AH*RLF*LCFTRFITGTNGREVIRLAPEVTPLWVCYPDLANTQNV*CE NGAGNMDP*CLSVWAGTIGFLSTITLQ*KRYTVTSKLRLINVIKLSSRGGKTTVF*HKCS VLHTSCP*RVSVW*REGTWDTFSK*YITC*SCFKQITTVYRSLEDSVFEFFKCSLVTILQ MGQENRRKKVPHLSPTLL*KM*RSGMSDNXHTHKRWFCPAGGQTV*YWALYRLNNHRASF PQTPTN*X >GCiWno629_g21.g1_2 LIINITTVKYTTGFTSVYIRSQVQFLRV*SYAEVKVQHLQVLPAQTNGYI*PPLKQYSSH RHDGSTNRVKREHISDFSSCVLRGLLLVQTAGKLSAWPQRLPPCGCVTPTWQIPRTCNAK MEQEIWTRDVCPYGPERLGFSQRLLFNKRGIRLLQSCD*SMLLNYLHVAGKQRSFDTSVL FYTPRAPDE*VYGSVREHGTLSANNI*HADLVLNK*QRYIGVLRIRFLNFLNVPWLLYYK WDKKIEEKKCPIFPPPYYKKCNVRVCLTIXTPISDGSVLPADKRFDIGHFID*ITTELHF LKHLLIE >GCiWno629_g21.g1_3 *LLTLPQSSTQLGSRLCIYDHKFNFYECKAMLR*KCSICKCCQRKRMVIYNLR*NSTVHI GMMEVLIGLNVSTLATFLVVFYAVYYWYKRPGSYPPGPRGYPLVGVLPRLGKYPERVMRK WSRKYGPVMSVRMGRNDWVSLNDYSSIKEVYGYFKVAINQCY*IIFTWRENNGLLTQVFC FTHLVPLTSKCMVA*GNMGHFQQIIYNMLILF*TNNNGI*ES*GFGF*IF*MFLGYYTTN GTRK*KKKSAPSFPHPTIKNVTFGYV*QFXHP*AMVLSCRRTNGLILGTL*IK*PPSFIS SNTY*L >GCiWno629_g21.b1_4 opp end of clone with N-term CGCAVRGRMLWQGCGGGCWALAVLRRMKCFGGEKRGNFGWV*APG*VGIWPLV*W*V*RP G*CSHWWFGPVG*GSEHVCQEGQSGLFAGCGGLLNVCEVIKKYLDSNDIHITPQ*SNLSR YRVFIG*YKGQLNTSG*RSPYRYSKVGVDGTPLAHNIQIP*SCF*TIRPTNGLW*S*GYT VL*IFDFSFTTK*KKTIRE*NKKVSQLPPPYYTA*AYRCLLYDHLILFGVLADVDLEREV WKKELLKKFHI*TMRYVPLWENHLK*W*HSILKC*LKQCI*DGGYTRYN*ITK*NFLPSK WRSKDSPCKGISKVFGRQI >GCiWno629_g21.b1_5 XWVCRTGXDVVAGLRGRVLGPGSVAEDEVFWWGEKR*LRVGIGARISGYMATCVMVGIKT GVM*SLVVWTGWVGERTCVPGGAKRIVRGLWRVVKCVRGD*KIFGFQRYSYYPTVE*FVA ISCLYWVI*GPTQYIRVT*PIQI**GGGRRDTFST*YSNTLIVFLNN*AYQRSVVVVRIY GFINL*FFVYYQIKKNNKRVE*KSVPTSSTLLYCISI*VSII*PFDSIWCFGRCGFGKRS LEERIVEEVSYLNDAIRATMGKPFEIMVAQYFKMLIEAVHLGRGLYAV*LNN*MKLFTLE VAEQRQSL*GDLKSLRQANX >GCiWno629_g21.b1_6 VGVPYGXGCCGRVAGEGVGPWQCCGG*SVLVGRKEVTSGGYRRPDKWVYGHLCDGRYKDR GDVVIGGLDRLGRGANMCARRGKADCSRVVEGC*MCAR*LKNIWIPTIFILPHSRVICRD IVSLLGNIRANSIHQGNVAHTDIVRWG*TGHL*HIIFKYPDRVFKQLGLPTVCGSRKDIR FYKSLIFRLLPNKKKQ*ESRIKKCPNFLHPTILHKHIGVYYMTI*FYLVFWQMWIWKEKF GRKNC*RSFIFKRCDTCHYGKTI*NNGSTVF*NVN*SSAFRTGVIRGITK*LNETFYPRS GGAKTVLVRGSQKSSAGKX >SEQUENCE 106, 23 N-TERM TO KYG 39% TO 17 MSMLVNLVTNFDMSSIVLTASCAFVFILYYWYKRPRNFPPGPRGIPLLGMVPFLGKHTEK DFRKWSKKYGPMMSVRLGQNDWIVLGDHKTINE (0?) QCLVKGGNSFSGRPDHPVFKQVTKNHGVAMVDYGDHWKVQRRFGLTTLRG (?) FGVGKRGMEDRIVEEIAYLNDAIRSNNGKPFDIA (?) ELMANGVSNNISSIVMGQRMDYNDEIFKTLSKKAPNR Missing exon 5 here QAIVNWVSQHKSTYDEHNVRDFIDAFIGEQKKETDVSFT from opp end same as seq 18 LQW210348.y1 GCiWno963_i22.b1 GCiWno56_k09.b1 opposite end = seq 23 GCiWno356_k24.b1 GCiWno697_m22.b1 GCiWno23_b01.b1 >DEV23492.y1_4 TILYMNNNP*F*N*LFFVLL*ELMANGVSNNISSIVMGQRMDYNDEIFKTLSKKAPNR*Q LA*FALF*QLCFLNE*YYFGMFYPRVAGLQNSLQHGYSVLYTSCLLNELPRRCMCNYVSN LSF*FRFYICLILTITIVFETV*TNLSLCYALSCNLLMVVRL*QRHNWENYEVGFVHAGL RNCF >DEV23492.y1_5 HTIYE**PMILKLTVFCFIIGTYGKRSFKQHFQHCNGSKNGLQ**NI*NTQ*KSTE*VTA GLVCFVLTTVFFE*MILFWHVLPSRGGATKFITTRVFCFIHIVPA*RITTQVYV*LCK*F VFLISFLYLFNPHYNYRIRNGIN*LKFVLCSIL*LTYGCTFITATQLGKLRSWFCTCRSK ELLX >DEV23492.y1_6 PYYI*IITHDFEINCFLFYYRNLWQTEFQTTFPAL*WVKEWTTMMKYLKHSVKKHRIGNS WLSLLCFNNCVF*MNDTILACFTLAWRGYKIHYNTGILFYTHRACLTNYHAGVCVTM*VI CLSNFVFIFV*SSL*LSYSKRYKLT*VCVMLYLVTYLWLYVYNSDTIGKITKLVLYMPV* GIAX >GCiWno56_k09.g1_4 LF*AVKRL*A*GTSPKCLTHVHSCKXCFVSARLHXWVYRTRSAMMFKYKGGPFQRERG*E DML**KNHFI*STI*LLQ LVCNLWAVHNDPDVWDEPSKFKLERHLDEKGNFVQSKYVMPF SVGPRHCLGEQLARMEIFIFLVSMVQKFEFLPDPNEPQLSEVQQGVSGFMCVPHPFKQIA KEV* IN*QSTYKLL*HIHTRGGGAEGPLSPPKF*VLQ*CYW*KQ*R*IGYTC*TVMFKWG ISIRFRIFFQIKRKRKKRKHLSLFLNFLHMLNDEVPIPIMTQNNRRVNSMGTSEFD >GCiWno356_k24.b1 CHROMAT_FILE: GCiWno356_k24.b1 PHD_FILE: GCiWno356_k24.b1.phd.1 CHEM: term DYE: big TIME: Fri Oct 5 12:31:25 2001 TEMPLATE: GCiWno356_k24 DIRECTION: fwd Length = 934 Score = 76.9 bits (186), Expect = 1e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 1 ELMANGVSNNISSIVMGQRMDYNDEIFKTLSKKAPNR 37 ELMANGVSNNISSIVMGQRMDYNDEIFKTLSKKAPNR Sbjct: 752 ELMANGVSNNISSIVMGQRMDYNDEIFKTLSKKAPNR 642 Score = 41.8 bits (96), Expect = 0.004 Identities = 29/85 (34%), Positives = 34/85 (39%), Gaps = 34/85 (40%) Frame = -2 Query: 43 TYNFQFITATWREKLFDFLYLFLLCGICF------------------------------- 71 TY FITAT KL + GICF Sbjct: 348 TYGCTFITATQLGKLRSWFCTCRS*GICFSCF*ANQKK*TKLTH*FEVKLMRK*FLVTFK 169 Query: 72 ---FYFQHKQAIVNWVSQHKSTYDE 93 F+F+ +AIVNWVSQHKSTYD+ Sbjct: 168 *TCFFFRFAEAIVNWVSQHKSTYDD 94 >GCiWno356_k24.b1_4 *HIMXXCLIVFKQLTSVYRVVFFYRMG*KHIMKRCLIFSPPILYE**PIILKFTVFRFII GTYGKRSFKQHFQHCNGSKNGLQ**NI*NTQ*KSTE*VTASLVCFVLTTVFFE*MILFWL VLPSRGGATKFITTRVFCFIHIVPA*RITTQVYV*LCK*FFFLISFLYLFNPHYNYRIRN GIN*LKFVLCSIL*LTYGCTFITATQLGKL RSWFCTCRS*GICFSCF*ANQKK*TKLTH* FEVKLMRK*FLVTFK*TCFFFRFAEAIVNWVSQHKSTYDDTQR*RLYVCF*GTT*NRIVQ YVFLASRL*SD >GCiWno356_k24.b1_5 XAHNVPXSYRV*TINIGL*SRVFLPNGMKTYNEKVSHLFPTHTI*IITHNFEIHCFSFYY RNLWQTEFQTTFPAL*WVKEWTTMMKYLKHSVKKHRIGNS*LSLLCFNNCVF*MNDTILA CFTLAWRGNKIHYNTGILFYTHRACLTNYHAGVCVTM*VIFLSNFVFIFV*SSL*LSYSK RYKLT*VCVMLYLVTYLWLYVYNSDTIGKITKLVLYMPFLRNLLFLFLSKPKEMNKINTL IRGKVNEEMIPCDL*VNLFFFSFCRSNRKLGFAA*IYL*RHTTLETLCMLLGNNIKQDRA VRFPGKQAMIRX >GCiWno356_k24.b1_6 ST*CXXVLSCLNN*HRSIESCFFTEWDENI**KGVSSFPHPYYMNNNP*F*NSLFFVLL* ELMANGVSNNISSIVMGQRMDYNDEIFKTLSKKAPNR*QLA*FALF*QLCFLNE*YYFGL FYPRVAGQQNSLQHGYSVLYTSCLLNELPRRCMCNYVSNFSF*FRFYICLILTITIVFET V*TNLSLCYALSCNLLMVVRL*QRHNWENYEVGFVHAVLKEFAFLVFKQTKRNEQN*HIN SR*S**GNDSL*PLSKLVFFFVLQKQS*IGFRSINLLMTTHNVRDFMYAFREQHKTGSCS TFSWQAGYDPX walk >GCiWno697_m22.b1 CHROMAT_FILE: GCiWno697_m22.b1 PHD_FILE: GCiWno697_m22.b1.phd.1 CHEM: term DYE: big TIME: Tue Nov 6 10:42:02 2001 TEMPLATE: GCiWno697_m22 DIRECTION: fwd Length = 866 Score = 69.9 bits (168), Expect = 9e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +3 Query: 61 ELMANGVSNNISSIVMGQRMDYNDEIFKTLSKKA 94 ELMANGVSNNISSIVMGQRMDYNDEIFKTLSKKA Sbjct: 333 ELMANGVSNNISSIVMGQRMDYNDEIFKTLSKKA 434 Score = 50.8 bits (119), Expect = 5e-06 Identities = 23/29 (79%), Positives = 27/29 (92%) Frame = +1 Query: 32 RSMEDRIVEEIEYLNNAIRSHNGKPFNIS 60 R MEDRIVEEI YLN+AIRS+NGKPF+I+ Sbjct: 1 RGMEDRIVEEIAYLNDAIRSNNGKPFDIA 87 >GCiWno515_d21.b1_4 opposite end of clone with N-term GCXPYHEKVSHLSPPHTI*IITPNFEINCCSXYYRNYGQTESQQTFPAL*WVKEWTTMMK YLKHSVKKHRIGNSWLSFSLF*QLCFLNE*YYLGLFYPRVAGQQKSLQHGYSVLYTSCLL NELPRRCMCNYVSNFSF*FRFYICLILTITIVFETV*TNLSLCYALSCNLLMVVRL*QRH NWENYEVGFVHAVLKEFAFLVFKQTKRNEQN*HINSR*S**GNNSL*PFSKLVFFSFCRS NRKLGFAT*IYL*RTQR*RLYRCFYWRTKKRN*CFLYGKGCYAVPLTFRP* >GCiWno515_d21.b1_5 GMXTIS*KGVSSFPPPYYMNNNP*F*N*LLFVLL*ELWANGVSTNISSIVMGQRMDYNDE IFKTLSKKAPNR*QLA*FFFVLTTVFFK*MILSWLVLPSRGGATKVITTRVFCFIHIVPA *RITTQVYV*LCK*FFFLISFLYLFNPHYNYRIRNGIN*LKFVLCSIL*LTYGCTFITAT QLGKLRSWFCTCRS*GICFSCF*ANQKK*TKLTH*FEVKLMRK*FLVTF**TCFFFVLQK QS*IGFRNINLLMTNTTLETLSMLLLENKKKKLMFPLR*RLLRCAFNFQTIX >GCiWno515_d21.b1_6 XDAXHIMKRCLIFPPPILYE**PLILKLTVVRXIIGTMGKRSLNKHFQHCNGSKNGLQ** NI*NTQ*KSTE*VTAGLVFLCFNNCVF*MNDTILACFTLAWRGNKSHYNTGILFYTHRAC LTNYHAGVCVTM*VIFLSNFVFIFV*SSL*LSYSKRYKLT*VCVMLYLVTYLWLYVYNSD TIGKITKLVLYMPFLRNLLFLFLSKPKEMNKINTLIRGKVNEEIIPCDLLVNLFFFRFAE AIVNWVSQHKSTYDEHNVRDFIDAFIGEQKKETDVSFTVKAATLCL*LSDHX >GCiWno515_d21.g1_1 HVL*IQTRCERAQLVVVA*KILCITTIEK*VCW*T*LQILT*ASF*RQAALSFLFCITGT NDQGISPLVREVFRFWVWCHSWANTQKKILGNGARSMDL*CLCDWVKTIGLYSVTTRL*T R*LIVKFGIEYVIIT*P*RFSY*QCLVKGGNSFSGRPDHPVFKQVTKNHGVAMVDYGDHW KVQRRFGLTTLRG*ANVSV*EMA*MVKKDIEYIF*RVLHKYTHRXILLIDLFTVLYIHCS CI*FVAACRFMCPCVDT*SNCSLSSGHNGLTKFSVAHKNITPKLDTRYSX >GCiWno515_d21.g1_2 MCYKYRRAVNVRSWL*LHRRYFV*QQ*KNEYVGKLSYKF*HEHRFNGKLRFRFYFVLLVQ TTKEFPPWSERYSAFGYGAILGQTHRKRF*EMEQEVWTYDVCAIGSKRLDCTR*PQDYKR GNLS*SLV*NMLL*HDRNDFPINSAW*KAAIHFLVDQTTLCLNRLQKITEWRWLTMEIIG KFNDVLG*QHSVGKRMYLYKKWHRW*KRI*NISSDACYISIHIGXFC**IYLQYCTYTAP AFDLLLLVGLCVLV*TPKVIALYPVVTMD*PNFQLHTKTSRQS*IRGTP >GCiWno515_d21.g1_3 CVINTDAL*TCAVGCSCIEDTLYNNNRKMSMLVNLVTNFDMSIVLTASCAFVFILYYWYK RPRNFPPGPRGIPLLGMVPFLGKHTEKDFRKWSKKYGPMMSVRLGQNDWIVLGDHKTINE VTYREVWYRICYYNMTVTIFLLTVLGERRQFIFW*TRPPCV*TGYKKSRSGDG*LWRSLE SSTTFWVNNTPWVSECICIRNGIDGKKGYRIYLLTRAT*VYT*XNSVNRFIYSIVHTLLL HLICCCL*VYVSLCRHLK*LLFIQWSQWIDQIFSCTQKHHAKVRYAVL >SEQUENCE 107, 20, 87, 90 SIMILAR TO SEQ 4 MVMPRKGMRKKVVHLMSEVSAGLRVEVFTGFVALCYGTGRPKSFP PGPRGVPFLGVIPFLGNYPARVMQKWSRKYGPVMSVRMGSRDLVVLNNHENIQK (0?) QALVMQGQIFSGRPNMPALTQVTDGLGLATIDYTDHWKTQRRFGQTTLRG (1?) FGVGKRSMEDRIVEEVEYLNNAIRSHNGKPFDIL Missing 3 exons DLQLLQYVRDLFVAGTETTTSTLRWSILCLIHNPEKQEKLRKEIYKVTG (1?) QDRVPAMSDKAQMPYTCAFMQEVFRYRTLVPLSLFHATNDDVSLNGYRIPKGTT (0) VLPNLWAVHNDPDVWDEPSSKFKPERHLDEKGNFVQSKHVIPFSVGPRQCLGEQLARMEIFIFLV SMVQKFEFLPDPNEPNLPEIENGSCGTVFVPFRFKQIAKMK* LQW265414.y2 >GCiWno456_p09.g1_4 ILCRFIYPFMSDXPRNKXE*XAQLPKNVIYLXSIHVTATPFPISLGLHCKR*AHGSFKRF *LFILXNYTQLFKFIRPV*LFGRLTLTLYHLIV*EI*ILNKFN*KPSKYGLLKKYIYILE NSCFTL*FKIKSKHEEKLHKTPSIPLTTMVNGNDPRKRESVWPLSFVNIGDTRSIFFLW* IHGDSILF*DLQLLQYVRDLFVAGTETTTSTLRWSILCLIHNPEKQEKLRKEIYKVTGKF LNQGVCWCSK**NSF*IGQDRVPAMSDKAQMPYTCAFMQEVFRYRTLVPLSLFHATNDDV SLNGYRIPKG >GCiWno456_p09.g1_5 SLSIHLPFYE*XPQK*XRVXRATAKKRDISXFYSRDRHSVSHFAWSPL*KIGAW*F*EVL AVYFXXLHPTVQVY*ASLVIW*VNAYTLPLNCLGNLNIK*I*LKTFKIRVVKKIYIYIRK *LFYPMI*N*VKTRRKTT*NAIDSIDYDGKRKRPAKERECMAPLLCQHWRYAFYFFSVVN TW*FNFILGSTTVAICSGFVCCWDRNDNQYTKVVNSVFDS*SGEARKTTKRNL*SYG*IS KSRGMLVF*IIKFLLNRPG*GTGDE*QSSDALHLRVHAGSF*IPHSGSLKLISCNK**CK LEWIPYPERX >GCiWno456_p09.g1_6 FSVDSFTLL*VXTPEIKXSXTRNCQKT*YIFXLFT*PPLRFPFRLVSIVKDRRMVVLRGF SCLF*XTTPNCSSLLGQFSYLVG*RLHFTT*LFRKFKY*INLIKNLQNTGC*KNIYIY*K IVVLPYDLKLSQNTKKNYIKRHRFH*LRW*TETTRERERVYGPSPLSTLEIRVLFFFCGE YMVIQFYFRIYNCCNMFGICLLLGQKRQPVH*GGQFCV*FIIRRSKKNYEKKSIKLRVNF *IKGYVGVLNNKIPFK*ARIGYRR*VTKLRCLTLARSCRKFLDTALWFP*AYFMQQMMM* A*MDTVSRKX sequence 20, 87, 90 2 accessions 53% to 2U1 C-HELIX 44% TO 2F1 QALVMQGQIFSGRPNMPALTQVTDGLGLATIDYTDHWKTQRRFGQTTLR FGVGKRSMEDRIVEEVEYLNNAIRSHNGKPFDI DLQLLQYVRDLFVAGTETTTSTLRWSILCLIHNPEKQEKLRKEIYKVTG (1?) QDRVPAMSDKAQMPYTCAFMQEVFRYRTLVPLSLFHATNDDVSLNGYRIPKGTT (0) VLPNLWAVHNDPDVWDEPSSKFKPERHLDEKGNFVQSKHVIPFSVGPRQCLGEQLARMEIFIFLV SMVQKFEFLPDPNEPNLPEIENGSCGTVFVPFRFKQIAKMK* sequence 20, 87 2 accessions 53% to 2U1 C-HELIX 44% TO 2F1 QALVMQGQIFSGRPNMPALTQVTDGLGLATIDYTDHWKTQRRFGQTTLR this matches seq 90 FGVGKRSMEDRIVEEVEYLNNAIRSHNGKPFDI matches seq 18 DLQLLQYVRDLFVAGTETTTSTLRWSILCLIHNPEKQEKLRKEIYKVTG (1?) looks like seq 2 but different joint QDRVPAMSDKAQMPYTCAFMQEVFRYRTLVPLSLFHATNDDVSLNGYRIPKGTT (0) VLPNLWAVHNDPDVWDEPSSKFKPERHLDEKGNFVQSKHVIPFSVGPRQCLGEQLARMEIFIFLV SMVQKFEFLPDPNEPNLPEIENGSCGTVFVPFRFKQIAKMK* LQW256489.x1 LQW272521.x1 LQW272521.y1 LQW222687.x1 GCiWno456_p09.g1 GCiWno687_n09.b1 GCiWno425_i01.g1 GCiWno855_l16.b1 GCiWno1021_j12.g1 GCiWno425_i01.g1 GCiWno687_n09.b1 GCiWno677_l07.b1 + >GCiWno67_e07.b1_4 RKLVA***GKVQKTWHGHAKEGNEKEGGSFNE*GKRWIKGGSIHWVRCFVLRDRAAKELP TRTKRCSFSGSHTISWQLSSTCNAKMEQKVWSCDVCTYGEPGLGGA**S*KYTEGNCSGV GDTFPFYFPAPFGGKEHSKNYKTLFARLR*TVVNGLKKTIVY*DIMSHRCPTLPHGTI*N KLGV*ASNEITSNRH**CKVKFSLEAQTCRH*PR*TDGAWFGYHRVH*SLENSTSVRAKY FERVSQDERTVITVKFIDV*RFRLSHLGKLDIKLI*QGGENVHIYHI >GCiWno67_e07.b1_5 PQTGCMMIRKGAENLAWSCQGRE*ERRWFI**VR*ALD*GWKYSLGSLLCVTGQGGQRAS HQDQEVFLFWESYHFLAIIQHV*CKNGAESMVL*CLYVWGAGTWWCLIIMKIYRR*L*WS GRHLPILFSRPIWW*RTFKEL*NLIRTTPIDRC*WFKKNDRILGYYVPQVSHLTPRYYIK *TWCISVK*NYFQQALVMQGQVFSGSPNMPALTQVNRWSLVWIP*STLIIGKLNVGSGKI L*EGESRRTYSHYSQIH*RIKI*IVTFG*IRHKVDIAGRGKCTYLSHX >GCiWno67_e07.b1_6 ANWLHDDKERCRKLGMVMPRKGMRKKVVHLMSEVSAGLRVEVFTGFVALCYGTGRPKSFP PGPRGVPFLGVIPFLGNYPARVMQKWSRKYGPVMSVRMGSRDLVVLNNHENIQKVIVVEW ETPSHSIFPPHLVVKNIQRIIKPYSHDSDRPLLMV*KKRSYIRILCPTGVPPYPTVLYKI NLVYKRQMKLLPTGISDARSSFLWKPKHAGINPGEQMELGLDTIEYTDHWKTQRRFGQNT LRG*VKTNVQSLQSNSLTYKDLDCHIWVN*T*S*YSREGKMYIFITX LQW272521.y1 LQW272521.y1.phd.1 LQW272521.x1 12:12:57 2001 TEMPLATE: LQW272521 DIRECTION: rev Length = 1002 Score = 91.3 bits (223), Expect = 2e-18 Identities = 42/50 (84%), Positives = 44/50 (88%) Frame = +3 Query: 1 QALVMQGQVFSGSPNMPALTQVXXXLGLDTIEYTDHWKTQRRFGQNTLRG 50 QALVMQGQ+FSG PNMPALTQV LGL TI+YTDHWKTQRRFGQ TLRG Sbjct: 225 QALVMQGQIFSGRPNMPALTQVTDGLGLATIDYTDHWKTQRRFGQTTLRG 374 Score = 66.0 bits (158), Expect = 7e-11 Identities = 31/34 (91%), Positives = 32/34 (93%) Frame = +2 Query: 51 FGVGKRSMEDRIVEEVAYLNDAIRSHNDKPFDIL 84 FGVGKRSMEDRIVEEV YLN+AIRSHN KPFDIL Sbjct: 635 FGVGKRSMEDRIVEEVEYLNNAIRSHNGKPFDIL 736 >SEQUENCE 108 FROM 5A1 BLAST N-TERM 30% TO 5A1 352 STFSRIFKVNFRHERPSFFKKKLYSGYQGDVKYILRPKFSLVTSDRITQIVYVNVFSNFT 173 LQW216114.x1 LQW54677.x1 >GCiWno468_k19.g1_1 XYPXYXIQFRPRYPHRMRITTFDFYVTDYVIC*FFWI*RLRVKRRG*GWVKG*DLGFSLT *NSAKNTIIKCCNVRNMSLL*RNISLL*RNKSLTLRKSGELR*RSTFSRIFKVNFRHERP SFFKKKLYSGYQGDVKYILRPKFSLVTSDRITHFLYVSSSQFSLCGCLLKLF*HPK*IHF *YLKRKNTWWFSTYQA*IELHC*HHKCRALICSVCLP*FYIRQIIHE*ITQKITKFLTTK SSRQKY**RHSNVALLL*I**NHRVSNPFFIKFQVYQCPKKRSGNISSQCTILKX >GCiWno468_k19.g1_2 GILXIXYNFDLGTLIECVLQPLISTLQIT*FVSFFGFRGYGLNVGVRVGLRVRTWGFP*H KTVRKTRL*NAVTYVICHYCDVTYRYCDVINR*LYASQANYGDAARFRAFSKLIFDTNAR VFSKKNYTAGIRET*STF*DQNFHWSPATGLPIFYTFQALSLVCVGVY*SYFDTLNKYIF SI*NARIHGGFLLTKLKLNCTVSITNVGH*FVLYVFHDFT*DR*FMSKLPKKLPNF*QQK VPAKNISDVTAMLHFYCRFNKTIELVTLSL*NSKFISVLKKEVEIYPPNALF*N >GCiWno468_k19.g1_3 VS*X*XTISTSVPS*NAYYNL*FLRYRLRNLLVFLDLEVTG*T*GLGLG*GLGLGVFPNI KQCEKHDYKML*RT*YVTTVT*HIAIVT**IVNFTQVRRITVTQHVFAHFQS*FSTRTPE FFQKKIIQRVSGRRKVHFETKIFTGHQRQDYPFFIRFKLSV*FVWVFIKVILTP*INTFL VFKTQEYMVVFYLPSLN*TALLASQM*GINLFCMSSMILHKTDNS*VNYPKNYQIFNNKK FPPKILVTSQQCCTSIVDLIKP*S**PFLYKIPSLSVS*KKKWKYILPMHYFK >best savignyi hit to CYP24 53% to seq 110 possible processed pseudogene with no introns and an in frame stop 41% to human 4F12 (note: CYP24 not found in savignyi) 47% TO SEQ 110 MFQQLWEPLRLILYNVAVLAILAVLFKFFKRISVICKIRWNLRTEWKGPPCHWFWGHLGQVT KGNKDPANFIPYFTKNEKLFPFGFAIYAGPLRTILTIHHPNLVKQVLNASTFDAPKPKEAYGGLLLKWL GLGLLSLNNREWFRHRKLLTSAFHHDILKPYVKISNSCTDILLDTWQKKVKQQPTGFSIEIFEQA SLLTLDIALQCLMSYESKCQERLDNDYISSIKNLSFLYVRRNRSKNLLLKYFPFLYKWS QEGKLYYKECDSVHKFSTSLINRRKQELGNPDIAPKREFLDFLDMLLQARDSNGLGLTTS EICAEVDTFLFGSHDTTASGISWFLYCISQNPEVQNKCF*EITQVLGDRENVRWSDLSSL PYLTRCIKETLRLYPPAPYISRTVNKDIYAEGKTILKGTTVLLSIIGVQRSVLFWKYPQK FNPDRFTPESASMQNNHAFIPFSAGPRNCIGQHFAMNEMRVVLSKMLRTFRFSIDPNHKI VPCHEIIYRSRGGIHLIVEPRTSVSI* G126P65561R.T0/G126P65561RC8.T0.seq 744 (04) * in frame stop G126P64272R.T0/G126P64272RF1.T0.seq 749 (02) * in frame stop G126P64994R.T0/G126P64994RG7.T0.seq 691 (01) G126P64994R.T0/G126P64994RG7.T0.seq 691 (01) G126P606322R.T0/G126P606322RD2.T0.seq 740 (19) * in frame stop G126P607244F.T0/G126P607244FA8.T0.seq 748 (20) * in frame stop G126P604191R.T0/G126P604191RC9.T0.seq 713 (17) N-term >SEQUENCE 110, 121, 139 31 accessions 67% TO 4F3 MLFMFIKYAVYASFSLLALSILHSLFS (2) IQEFYTVTKYLKSNWPEPESHWLWGSFGAV (0) MLKMSADPSYYFTYMNDCMKKYPYGFRTQLGPFIKSLNTYHPTIAKAIL (1) agt = exon 2 of 4T5 NVPKLKRAYKLLFEWL (1) = exon 3 of 4T5 GHGLLVLEDKVWLRHRRLLTPSFHFEVLKPYVKTMNESAHVMV (0) = to exon 4 4T5 ENWLSKTSDNKVAKVEIFHYA SLMTLDTTLRCLMSYQSNCQDEN (2) aagt = to exon 5 4T5 STNDYVAKIYELSETIVRRQRNLNILNRIDPIYNVT (1) ACGT = to exon 6 4T5 NEW INTRON LOCATION KEGRKYLKLCDDVHKFSESVINRRKCDSEQPAHNETRKYFDFLDTLLKAG (0) = to exon 7 4T5 DSDGKGLSD SEIRAEVDTFMFEGHDTTASGISWTFYCLAMHPEHQEKCFQEIEKVMADRTDIEW (2) = to exon 8 4T5 NDLSNLPHLTLCIKESLRQYPPVPIIFRKLNKDIEVDGKTIVK (1) = to exon 9 4T5 DTNVVLHIYALHHHEEFWKDPHIFDPSRFTQENMKSMNSYAYVPFSAGPR (2) = to exon 10, 11 4T5 NCIGQRFAMNEIKIAVAQVLSKFQLKPDLSKKIQHSVDVIYRATTGLYLKAERRV * = to exon 12 4T5 Note 121 and 122 are identical in the PERF region might be an error in exon 10,11 I think the end of citb077m23 is poor quality it is only found once AV969192.1 EST I-helix covers ESAHVM in exon 4 to NDLS in exon 9 LQW181437.x1 exon 2 LQW181437.x3 exon 2 LQW176830.y1 exon 2 LQW104191.x01 exon 2 LQW97026.x1 exon 2 LQW36556.x1 exon 2 LQW194134.y2 exon 2, 3 LQW194134.y1 exon 2, 3 LQW97026.x1 exon 3 LQW235871.y1 exon 3, 4 C-HELIX LQW146376.y1 exon 3, 4 C-HELIX LQW157967.x1 exon 4 C-HELIX LQW202346.y2 exon 4 C-helix exon 5 LQW29332.y1 exon 5 four diffs LQW258852.y1 exon 5, 6 LQW76039.x1 exon 7 LQW277116.y1 exon 7, 8 I-helix LQW97026.y1 exon 7, 8 I-helix LQW745.y1 exon 8 I-helix LQW58344.x1 exon 8 I-helix LQW36556.y1 exon 8 I-helix LQW157967.y1 exon 9 K-helix exon 10, 11 fused, to heme DEV3119.x1 exon 9 K-helix LQW235871.x1 exon 10, 11 fused PKG TO HEME LQW258852.x1 exon 10, 11 fused PKG to PERF LQW60852.y1 exon 10, 11 fused PKG to PERF LQW156737.y1 exon 12 heme to end may be seq 122 LQW199395.x1 exon 12 heme to end 3 diffs may be seq 122 DEV42408.y1 exon 12 may be seq 122 DEV28111.x1 exon 12 may be seq 122 >citb077m23 TTGAAAGCAGGGGACAGTGATGGGAAGGGGTTGTCAGATTCTGAGATTCGCGCCGAAGTTGACACTTTTATGTTTGCCGG CCATGATACAACTGCTAGTGGGATTTCATGGACATTTTATTGCTTAGCCATGCACCCTGAGCATCAGGAAAAATGCTTTA AAGAGATTGAGAAAGTTATGGCTGACCGTACTGATATAGAATGGAATGATCTGTCCAACCTCCCCCACCTTACATTATGC ATCAAAGAAAGTTTGCGCCAATATCCACCAGTTCCAATCATTTTCCGTAAACTTAACAAAGATATTGAAGTTGATGGGAA GACCATTGTGAAAGACACCAATGTGGTTCTACATATTTATGCATTACATCATCACGAGGAGTTTTGGAAGGATCCTCATA TATTTGATCCAAGTCGGTTCACGCAGGAAAACATGAAAAACATGAATAGTTATGCTTATGTACCTTTCTCTGCTGGCCCA AGAAACTGCATCGGGCAAAAATTTGCGATGAACAAGATGAAAATTGCGGTTGCTCAGGTGTTGAGGCAATTCCAGATTAA ACCAGATTTGACTAGAACGATCAAGCGTTCAGCGGATATGATTTATAAAACAACAAGTGGCCTCTACTTGAACATTGAGC GCAGATATTAAAAATCAATGCAATTTTGTGAATTATAAAAATTAATAATATTTTTGTCTGTTACGTTTTTA >citb077m23_1 LKAGDSDGKGLSDSEIRAEVDTFMFAGHDTTASGISWTFYCLAMHPEHQEKCFKEIEKVM ADRTDIEWNDLSNLPHLTLCIKESLRQYPPVPIIFRKLNKDIEVDGKTIVKDTNVVLHIY ALHHHEEFWKDPHIFDPSRFTQENMKNMNSYAYVPFSAGPR NCIGQKFAMNKMKIAVAQV LRQFQIKPDLTRTIKRSADMIYKTTSGLYLNIERRY* >GCiWno108_n12.b1 CHROMAT_FILE: GCiWno108_n12.b1 PHD_FILE: GCiWno108_n12.b1.phd.1 CHEM: term DYE: big TIME: Tue Sep 11 22:26:09 2001 TEMPLATE: GCiWno108_n12 DIRECTION: fwd Length = 927 Score = 76.5 bits (185), Expect = 3e-14 Identities = 32/36 (88%), Positives = 34/36 (93%) Frame = +3 Query: 23 HSLFRSIQEFYTVTKYLKSNWPEPESHWLWGSFGAV 58 +S + SIQEFYTVTKYLKSNWPEPESHWLWGSFGAV Sbjct: 639 YSFYFSIQEFYTVTKYLKSNWPEPESHWLWGSFGAV 746 Score = 53.5 bits (126), Expect = 2e-07 Identities = 26/27 (96%), Positives = 27/27 (99%) Frame = +1 Query: 1 MLFMFIKYAVYASFSLLALSILHSLFR 27 MLFMFI+YAVYASFSLLALSILHSLFR Sbjct: 307 MLFMFIQYAVYASFSLLALSILHSLFR 387 >GCiWno108_n12.b1 GTGGGTATAGCTGTTTCCGTAAAACGACGGCCAGTCTGGTCATAGCTGTTTCCAGTAAAACGACGGCCAGACATGGTCAT ATCTGTTTCCAGTAAAACGACTGCCACTACTTGTCATACCTTGAATCTACATAAACAACATTTATATAAAAACTATCCTG ATATGTAAAATATGTGTCAATGAAATATATTGTATTTATATATAATTTTCTATTGATATTTGTTTCTAATCTATGTATGT TTTCTATTAATATTAAGTTTTTATATATCAGTGTTTGCATACTTTTAGTGATTGCTAGTTAAAACAATGTTGTTTATGTT CATACAATATGCCGTGTATGCTTCATTTTCGTTGCTGGCATTATCTATTCTACATTCCCTGTTTCGAAGGTAAACATTTG CTGTTTAAATGTTTTATTTTAAATAAGAATTATTTTGAATCTTTTGTATGCAATTAATATAAAGATTATAAATTTTAAAG TATAATAAACAATTTCGGAAAAGTAAAATATAATAATTTATTTCATCTAAAAAGATCCTATTTTTGTTGAAAATGCTTTA CAGTTGGTAGATCACCAGGAATCTTTTAACTTTAATAATCTATAGGCCTAACTGGAATAAACCATATATTCATAAAGTTA CTCTTTTTATTTCAGCATACAAGAATTTTACACTGTAACAAAATACCTAAAGTCAAACTGGCCCGAGCCAGAAAGCCACT GGTTATGGGGTTCATTTGGCGCAGTGGTAAGTTATCAATAAAGGTGGCTTTAGTTTTAAATTGAAACACTTGAAAAGAAA ATGTATTATGCATTCATACAGGCTGTCAATCTGTCATATTTGTTTTGAAACTAACCCTAATAAGCTATCATATTGATTGA ATGAATGAAATTTTTTTCCTCCTCTTCGTCACGATNACGAAGAACAA >_1 VGIAVSVKRRPVWS*LFPVKRRPDMVISVSSKTTATTCHTLNLHKQHLYKNYPDM*NMCQ *NILYLYIIFY*YLFLIYVCFLLILSFYISVFAYF**LLVKTMLFMFIQYAVYASFSLLA LSILHSLFRR*TFAV*MFYFK*ELF*IFCMQLI*RL*ILKYNKQFRKSKI**FISSKKIL FLLKMLYSW*ITRNLLTLIIYRPNWNKPYIHKVTLFISAYKNFTL*QNT*SQTGPSQKAT GYGVHLAQW*VINKGGFSFKLKHLKRKCIMHSYRLSICHICFETNPNKLSY*LNE*NFFP PLRHDXEEQ >_2 WV*LFP*NDGQSGHSCFQ*NDGQTWSYLFPVKRLPLLVIP*IYINNIYIKTILICKICVN EIYCIYI*FSIDICF*SMYVFY*Y*VFIYQCLHTFSDC*LKQCCLCSYNMPCMLHFRCWH YLFYIPCFEGKHLLFKCFILNKNYFESFVCN*YKDYKF*SIINNFGKVKYNNLFHLKRSY FC*KCFTVGRSPGIF*L**SIGLTGINHIFIKLLFLFQHTRILHCNKIPKVKLARARKPL VMGFIWRSGKLSIKVALVLN*NT*KENVLCIHTGCQSVIFVLKLTLISYHID*MNEIFFL LFVTXTKN >_3 GYSCFRKTTASLVIAVSSKTTARHGHICFQ*NDCHYLSYLEST*TTFI*KLS*YVKYVSM KYIVFIYNFLLIFVSNLCMFSINIKFLYISVCILLVIAS*NNVVYVHTICRVCFIFVAGI IYSTFPVSKVNICCLNVLF*IRIILNLLYAINIKIINFKV**TISEK*NIIIYFI*KDPI FVENALQLVDHQESFNFNNL*A*LE*TIYS*SYSFYFSIQEFYTVTKYLKSNWPEPESHW LWGSFGAVVSYQ*RWL*F*IETLEKKMYYAFIQAVNLSYLF*N*P**AIILIE*MKFFSS SSSRXRRT >cigd043a14 Length = 614 Score = 174 bits (437), Expect = 1e-43 Identities = 80/85 (94%), Positives = 82/85 (96%), Gaps = 1/85 (1%) Frame = +1 Query: 2 YSFYFSIQEFYTVTKYLKSNWPEPESHWLWGSFGA-MLKMSADPSYYFTYMNDCMKKYPY 60 +S + SIQEFYTVTKYLKSNWPEPESHWLWGSFGA MLKMSADPSYYFTYMNDCMKKYPY Sbjct: 82 HSLFRSIQEFYTVTKYLKSNWPEPESHWLWGSFGAVMLKMSADPSYYFTYMNDCMKKYPY 261 Query: 61 GFRTQLGPFIKSLNTYHPTIAKAIL 85 GFRTQLGPFIKSLNTYHPTIAKAIL Sbjct: 262 GFRTQLGPFIKSLNTYHPTIAKAIL 336 >cigd043a14 GGGCTAGTTAAAACAATGTTGTTTATGTTTATAAAATATGCCGTGTATGCTTCATTTTCGTTGCTGGCATTATCTATTCT ACATTCCCTGTTTCGAAGCATACAAGAATTTTACACTGTAACAAAATACCTAAAGTCAAACTGGCCCGAGCCAGAAAGCC ATTGGTTATGGGGTTCATTTGGCGCAGTGATGCTTAAAATGAGTGCAGACCCTTCGTATTACTTCACCTACATGAATGAT TGTATGAAGAAATATCCATATGGCTTTCGGACTCAGTTAGGACCTTTTATTAAGTCCTTAAACACTTACCACCCAACCAT TGCCAAAGCTATACTTAGTGGCTCAGCTGCAGATGTTCCAAAACTAAAGAGGGCTTACAAGTTACTGTTTGAATGGTTGG GACATGGACTGTTGGTTTTGGAGGACAAGGTTTGGTTGCGTCATCGAAGGTTGCTCACTCCATCATTTCATTTTGAAGTT CTTAAACCTTACGTAAAAACTATGAATGAAAGTGCTCATGTTATGGTGGAAAATTGGTTAAGCAAAACATCTAACAATAA AGTTGCCAAAGTTGAAATATTTCATTATGCAAGCCTTATGACATTAGATACAAC >_1 GLVKTMLFMFIKYAVYASFSLLALSILHSLFRSIQEFYTVTKYLKSNWPEPESX >_2 G*LKQCCLCL*NMPCMLHFRCWHYLFYIPCFEAYKNFTL*QNT*SQTGPSQKA >_3 AS*NNVVYVYKICRVCFIFVAGIIYSTFPVSKHTRILHCNKIPKVKLARARK Related N-term >cign078n05 Length = 637 Score = 64.0 bits (153), Expect = 9e-11 Identities = 27/58 (46%), Positives = 38/58 (64%) Frame = +2 Query: 1 MLFMFIKYAVYASFSLLALSILHSLFRSIQEFYTVTKYLKSNWPEPESHWLWGSFGAV 58 ML +++YAVYA+ A+ +L S+F S++ FYTV K L S WP P+ +W WGS V Sbjct: 11 MLLFYLQYAVYATVCAFAVFLLPSVFTSLKRFYTVRKNLNSQWPGPKGNWFWGSSAKV 184 >savignyi ortholog to seq 110 63% identical to seq 110 boundaries need checks MGIKPEYSIPSYIFLYFSIYEQYRARKYLKRNWPGPKGHWFWGYAGEL (0) MRKIRKDPGYYFSYIRGITKTYPYGFSSNLTPLFASLNIYHPNAVKAVL DAPKLKRAYRSLFEWL XHGLLVLEDKEWFRHRRLLTPSFHFEILKPYIKTMNECSITMV (0) ESWVKKTSEKAQIADDMDITPSISRMTLDTILKCLMSYESNCQDEX STNSYVSKIYEISASVAHRMRDVNIFKRINAIFYAT TSFRAHGKAFLKLCEAVHEFSDSVINCRKAELKQPLVKQNRKYLDFLDTLLKAR DADGKGLSDREIRAEVDTFMFEGHDTTASGISWILYCLAENADHQEMCFREIQEQMGDRTDIEW DDLAKLPCLTMCIKESMRLFPPVPIIFRKLNKDIEVDGKLIAK GTDIVLHIYALHHHEMFWKDPEKFDPNRFLPKNSSNVEGYTYVPFSAGPR NCIGQNFAMNEMKICLAQVIRNLRLYIDGDSPVPKMHPMLVLQSKSGIFIKFEKI exon 1 G126P600457F.T0/G126P600457FH11.T0.seq 703 (09) exon 2 G126P605984F.T0/G126P605984FF10.T0.seq 735 (19) exon 2 G126P67014F.T0/G126P67014FD12.T0.seq 734 (03) exon 3 exon 4 G126P600637F.T0/G126P600637FD5.T0.seq 709 (09) exon 5 G126P601992R.T0/G126P601992RE6.T0.seq 741 (14) exon 6 G126P64098R.T0/G126P64098RH5.T0.seq 731 (06) exon 7 G126P65862F.T0/G126P65862FH11.T0.seq 697 (04) exon 8 G126P68504R.T0/G126P68504RH1.T0.seq 730 (10) exon 9 G126P602307F.T0/G126P602307FE3.T0.seq 769 (14) exon 10 G126P67550F.T0/G126P67550FF3.T0.seq 1029 exon 11 >DEV17425.x1 XXXXXXXXXXXXXXXXXXXXXCAGCCCGTATAAATGCATAATACAATTTCTTTTCAAACGTTTCAATTTA AAACTAAAGCCACCTTTATTGATAACTTACCACTGCACCAAATGAACCCCATAACCAATGGCTTTCTGGC TCGGGCCAGTTTGACTTTAGGTATTTTGTTACAGTGTAAAATTCTTGTATGCTGAAATAAAAAGAGTAAC TTTATATTAAATTTAATATATGGTTTATTCCAGTTAGGCCTATAGATTATTAAAGTTAAAAAATTCGTGG TAATATACTAAATGTAAAGCATTTTCAACAAAAATAGGATCTTTTTAGATGAAATAAATTATTATATTTT ACTTTTCCGAAATTGTTTATTATACTTTAAAATTTATAATCTTTATATTAATTGCATACGTAAGATTCAA AATAATTCTTATTTAAAATAAAACATTTAAACAGCAAATATTTACCTTCGAAACAGGGAATGTAGAATAG ATAATGCCAGCAACGAAAATGAAGCATACACGGCATATTGTATGAACATAAACAACATTGTTTTAACTAG CAATCACTAAAAGTATGCAAACACTGATATATAAAAACCATTAATAATAGA >DEV17425.x1_4 YY*WFLYISVCILLVIAS*NNVVYVHTICRVCFIFVAGIIYSTFPVSKVNICCLNVLF*I RIILNLTYAINIKIINFKV**TISEK*NIIIYFI*KDPIFVENALHLVYYHEFFNFNNL* A*LE*TIY*I*YKVTLFISAYKNFTL*QNT*SQTGPSQKAIGYGVHLVQW*VINKGGFSF KLKRLKRNCIMHLYGLXXXXXXX >DEV17425.x1_5 LLLMVFIYQCLHTFSDC*LKQCCLCSYNMPCMLHFRCWHYLFYIPCFEGKYLLFKCFILN KNYFESYVCN*YKDYKF*SIINNFGKVKYNNLFHLKRSYFC*KCFTFSILPRIF*L**SI GLTGINHILNLI*SYSFYFSIQEFYTVTKYLKSNWPEPESHWLWGSFGAVVSYQ*RWL*F *IETFEKKLYYAFIRAXXXXXXXX >DEV17425.x1_6 SIINGFYISVFAYF**LLVKTMLFMFIQYAVYASFSLLALSILHSLFRR*IFAV*MFYFK *ELF*ILRMQLI*RL*ILKYNKQFRKSKI**FISSKKILFLLKMLYI*YITTNFLTLIIY RPNWNKPYIKFNIKLLFLFQHTRILHCNKIPKVKLARARKPLVMGFIWCSGKLSIKVALV LN*NV*KEIVLCIYTGXXXXXXXX SYSFYFSIQEFYTVTKYLKSNWPEPESHWLWGSFGAV posssible N-term of intestinalis >LQW176830.y1 CATCGAGCCGGTCCTGCTTACTTGACTTATAAAAGTATGATTGCACAAAT ACAATAACTATATGAACAATTGTTCAACATATTCTTACCTGAGCCACTAA GTATAGCTTTGGCAATGGTTGGGTGGTAAGTGTTTAAGGACTTAATGAAA GGTCCTAACTGAGTCCGAAAGCCATATGGATATTTCTTCATACAATCATT CATGTAGGTGAAGTAATACGAAGGGTCTGCACTCATTTTAAGCATCTATA TAAAATAATATACAGCTATAATAATATTGTAGGTTGTAACAGTCACGCTT TTTATCCAAAACAAAATATTTCTTTCTTTTTTATCAATGTTTTAACAACT GTTGTTTTACCATTACTACCCGGCTTTTCGCTTTTGTCAACTCTCTTGTT CTTCGTTATCGTGACCGAAGAGAGGAAATAAATTTCATTCAATCAATTTG ATAAGTTTTATTCGGTTAGTTTCAAAACAAATATGACAGATTGACAGCCC GTATAAATGCATAATACAATTTCTTTTCAAACGTTTCAATTTAAAACTAA AGCCACCTTTATTGATAACTTACCACTGCACCAAATGAACCCCATAACCA ATGGCTTTCTGGCTCGGGCCAGTTTGACTTTAGGTATTTTGTTACAGTGT AAAATTCTTGTATGCTGAAATAAAAAGAGTAACTTTATATTACATTTAAT ATATGGTTTATTCCAGTTAGGCCTATAGATTATTAAGGTAAAAAATTCGT GGTAATATACTAAATGTACAGCATTTCAACAAAATAGGATCTTTAGATAA ATAAATATATATTACTTTTCGAAATGTTATTAACTTAAAATAATATCTAT TAATGCTAGTAAATTAATAATTTATAAATAAATTAAGGAGATACTTGAAG GGGTAAAAATGGAGAAAAAAAGGTTGTTAAAAGTTAGCACAAGAAGTAAA CAAACAAAAATAAATTGCAA >SEQUENCE 146 related but different can aid in identifying the N-term MLLPDYLEFSLSLYSIGAVCVVVFLYKSRKLIGRFLKER RIRKELTKEIDGPQ PHWLFGHLNLLQPNEETILKTCEQTQKYPKLGMVWFGPALAYLMVFHPHVVRPVLNVEH PKDNLAYRFIKPWIGDGLLVSHGSKWRRNRHLLTKAFHFDILKQYTKVFDACC KTMLEKWSRKCDGSTVEVFRPVSLMTLDSMLQCAIS 338 LSKLPFVTMFIKEVLRLYPPVFAVARRTEQPVKFP 533 Possible N-term for savignyi MGIKPEYSIPSYIFLYFSIYEQYRARKYLKRNWPGPKGHWFWGYAGEL (0) Seq 146 RIRKELTKEIDGPQPHWLFGHLNLL SYSFYFSIQEFYTVTKYLKSNWPEPESHWLWGSFGAV posssible N-term of intestinalis >scf/ciona01/G126/seq_dir/hrs/G126P600457F.T0/G126P600457FH11.T0.seq 703 (09) 0 703 ABI Length = 703 Plus Strand HSPs: Score = 141 (49.6 bits), Expect = 1.9e-07, P = 1.9e-07 Identities = 25/49 (51%), Positives = 30/49 (61%), Frame = +1 Exon 2 Query: 1 MLKMSADPSYYFTYMNDCMKKYPYGFRTQLGPFIKSLNTYHPTIAKAIL 49 M K+ DP YYF+Y+ K YPYGF + L P SLN YHP KA+L Sbjct: 112 MRKIRKDPGYYFSYIRGITKTYPYGFSSNLTPLFASLNIYHPNAVKAVL 258 >scf/ciona01/G126/seq_dir/hrs/G126P605984F.T0/G126P605984FF10.T0.seq 735 (19) 0 735 ABI Length = 735 Plus Strand HSPs: Score = 141 (49.6 bits), Expect = 2.3e-09, P = 2.3e-09 Identities = 25/49 (51%), Positives = 30/49 (61%), Frame = +2 Query: 1 MLKMSADPSYYFTYMNDCMKKYPYGFRTQLGPFIKSLNTYHPTIAKAIL 49 M K+ DP YYF+Y+ K YPYGF + L P SLN YHP KA+L Sbjct: 503 MRKIRKDPGYYFSYIRGITKTYPYGFSSNLTPLFASLNIYHPNAVKAVL 649 >scf/ciona01/G126/seq_dir/hrs/G126P605984F.T0/G126P605984FF10.T0.seq 735 0 735 ABI GTCTTGCGAACTGAAATCATCTTTCTGTGGTGGTATTTGTGGAATCAAAC TGGGCGTTACCGTCCTGGCAATCTTATTTTTCTTTATGCCAAAAGTCGAA TTTTCCAGCTATTGCAATATGCTTTATATCAGGCATGGGCAACATACGGC CTGTTGGCCCGGTCCCGCCTCGTGAGGGGATTTTGACCAGCCAGCTGACT GTATCTAACCATATCTTGTAATTAAGATATTAAATACTATTTATCTGATA ATCTGGCCCACTAAGAACTTCATTTCCCACATCTTGCCTGCTGACTAGAG AAGTTGTCTACCCCTGCTGTATATCAATGAGATGTTTTAGCTGTTTAAGT TTAACCCATAAATCACTGGGTTTAGGCGATGACTGCTAATGTAAAAACAT TGTTTAAACCAAATGGGAATCCGTTTGGTTTAAACCTGTGTAAAAAACAA ACAAAACATATCTNTTGGAGTACCTATCTCTTATATGAATGACGTTTTCC AGATGAGAAAAATAAGAAAAGATCCAGGATACTACTTCTCTTATATTAGA GGAATTACCAAAACTTATCCGTATGGCTTCAGCAGTAACCTAACTCCACT ATTTGCTTCACTGAACATCTATCATCCAAATGCTGTCAAGGCAGTTCTCT GCGCATCAGGTAAATGTATTTTCCTCTCCTGAGTGTTGTTATCAGTAAAG TAATGATTTTTGAATTGTTGGGTTGGGTGCTTCAA For walking upstream to find exon 1 >_1 VLRTEIIFLWWYLWNQTGRYRPGNLIFLYAKSRIFQLLQYALYQAWATYGLLARSRLVRG F*PAS*LYLTISCN*DIKYYLSDNLAH*ELHFPHLAC*LEKLSTPAVYQ*DVLAV*V*PI NHWV*AMTANVKTLFKPNGNPFGLNLCKKQTKHIXWSTYLLYE*RFPDEKNKKRSRILLL LY*RNYQNLSVWLQQ*PNSTICFTEHLSSKCCQGSSLRIR*MYFPLLSVVISKVMIFELL GWVLQ >_2 SCELKSSFCGGICGIKLGVTVLAILFFFMPKVEFSSYCNMLYIRHGQHTACWPGPAS*GD FDQPADCI*PYLVIKILNTIYLIIWPTKNFISHILPAD*RSCLPLLYINEMF*LFKFNP* ITGFRR*LLM*KHCLNQMGIRLV*TCVKNKQNISXGVPISYMNDVFQMRKIRKDPGYYFS YIRGITKTYPYGFSSNLTPLFASLNIYHPNAVKAVLCASGKCIFLS*VLLSVK**FLNCW VGCF >_3 LAN*NHLSVVVFVESNWALPSWQSYFSLCQKSNFPAIAICFISGMGNIRPVGPVPPREGI LTSQLTVSNHIL*LRY*ILFI**SGPLRTSFPTSCLLTREVVYPCCISMRCFSCLSLTHK SLGLGDDC*CKNIV*TKWESVWFKPV*KTNKTYLLEYLSLI*MTFSR*EK*EKIQDTTSL ILEELPKLIRMASAVT*LHYLLH*TSIIQMLSRQFSAHQVNVFSSPECCYQ*SNDF*IVG LGAS >scf/ciona01/G126/seq_dir/hrs/G126P600330R.T0/G126P600330RA5.T0.seq 737 0 737 ABI Length = 737 Minus Strand HSPs: Score = 137 (48.2 bits), Expect = 6.8e-09, P = 6.8e-09 Identities = 27/27 (100%), Positives = 27/27 (100%), Frame = -3 Query: 1 IFQLLQYALYQAWATYGLLARSRLVRG 27 IFQLLQYALYQAWATYGLLARSRLVRG Sbjct: 393 IFQLLQYALYQAWATYGLLARSRLVRG 313 >scf/ciona01/G126/seq_dir/hrs/G126P600330R.T0/G126P600330RA5.T0.seq 737 (08) AAATGNGGCGCTGAAACCCCAAAGTGGGGATTCATATGAATCCTTTGCTT TTTACACAGGTTTAAACTAACGGATTCCATTTGGTTTAAACAATGTTTTT ACATTAGCAGTCATCGCCTAAACCCAGTGATTTATGGGTTAAACTTAAAC AGCTAAAACATCTCATTGATATACAGCAGGGGTAGACAACTTCTCTAGTC AGCAGGCAAGATGTGGGAAATGAAGTTCTTAGTGGGCCAGATTATCAGAT AAATAGTATTTAATATCTTAATTACAAGATATGGTTAGATACAGTCAGCT GGCTGGTCAAAATCCCCTCACGAGGCGGGACCGGGCCAACAGGCCGTATG TTGCCCATGCCTGATATAAAGCATATTGCAATAGCTGGAAAATTCGACTT TTGGCATAAAGAAACTTAAGATTGCCTTTTCGGTAACGCCCAGTTTTCCC ATTAACAGAAAAACAAAAAATCCTTCCCCATACAGGGTTAGCAATTGTAC GAAATATACTAGACTTAATATGGGTTTATCCCATCAATTGAAGCACTCCA AATGATACTGTAGTAATTAAAGGTACACTTTATTTTATTTTCATATAAAT AAATATTTTAACGATTCATTTAAAACTTTTATAACTAGAAAAAAGGTAGC TCAAAGATTAGAACTCCTGCAGTAATTTCTTACCAATTCACCAGCATACC CCCAAAACCAATGTCCTTTAGGGCCCGGCCAATTTCT >_4 KLAGP*RTLVLGVCW*IGKKLLQEF*SLSYLFSSYKSFK*IVKIFIYMKIK*SVPLITTV SFGVLQLMG*THIKSSIFRTIANPVWGRIFCFSVNGKTGRYRKGNLKFLYAKSRIFQLLQ YALYQAWATYGLLARSRLVRGF*PAS*LYLTISCN*DIKYYLSDNLAH*ELHFPHLAC*L EKLSTPAVYQ*DVLAV*V*PINHWV*AMTANVKTLFKPNGIR*FKPV*KAKDSYESPLWG FSAXF >_5 EIGRALKDIGFGGMLVNW*EITAGVLIFELPFF*L*KF*MNR*NIYLYENKIKCTFNYYS IIWSASIDGINPY*V*YISYNC*PCMGKDFLFFC*WENWALPKRQS*VSLCQKSNFPAIA ICFISGMGNIRPVGPVPPREGILTSQLTVSNHIL*LRY*ILFI**SGPLRTSFPTSCLLT REVVYPCCISMRCFSCLSLTHKSLGLGDDC*CKNIV*TKWNPLV*TCVKSKGFI*IPTLG FQRXIX >_6 RNWPGPKGHWFWGYAGELVRNYCRSSNL*ATFFLVIKVLNESLKYLFI*K*NKVYL*LLQ YHLECFN*WDKPILSLVYFVQLLTLYGEGFFVFLLMGKLGVTEKAILSFFMPKVEFSSYC NMLYIRHGQHTACWPGPAS*GDFDQPADCI*PYLVIKILNTIYLIIWPTKNFISHILPAD *RSCLPLLYINEMF*LFKFNP*ITGFRR*LLM*KHCLNQMESVSLNLCKKQRIHMNPHFG VSAPHX >scf/ciona01/G126/seq_dir/hrs/G126P608416R.T0/G126P608416RE7.T0.seq 746 (21) 0 746 ABI Length = 746 Plus Strand HSPs: Score = 227 (79.9 bits), Expect = 1.1e-18, P = 1.1e-18 Identities = 40/48 (83%), Positives = 42/48 (87%), Frame = +3 Query: 1 RNWPGPKGHWFWGYAGELVRNYCRSSNL*ATFFLVIKVLNESLKYLFI 48 RNWPGPKGHWFWGYAGELVRNYCR NL*AT F+VIKVL + LKY FI Sbjct: 468 RNWPGPKGHWFWGYAGELVRNYCRRFNL*ATLFIVIKVLKD*LKYFFI 611 >scf/ciona01/G126/seq_dir/hrs/G126P608416R.T0/G126P608416RE7.T0.seq 746 0 746 ABI TGAGCTCCATGTGGTGGAATTCTCGTTACTTTATAATATACATTGTACCC ATTTTATCTGCCATACCACACAGTGTACAAAAGTACCAACCCTTATCCCA GTAAATGACTGGGTTCATGTTGTTTTGGTAACCTGACAATGGGTGTGATA GTGGGAAGAACGCTCACTAAAATGAAGGTTAAGGCATTGGAGTTTTATTC ATGGGGTTGGGGTTAGGGTTAGTTTTGGGGGTTCATTTTAGTGTTTAGGG CAGAATTAAAGTTAGTTTTCATAGTTTTAGTGAGCAGTTTCCTTGTTCTC TTTTTTAGTTTGCTCTGTATTAGCTCCGGTAACCTGAAAATTGGTGCGAT GTAATCTGACGATCCACTTTTACATTCATGGGGATAAAACCTGAATATTC TATTCCATCTTACATTTTTTTATATTTTAGCATTTACGAACAATACCGTG CTCGCAAATATCTCAAAAGAAATTGGCCGGGACCTAAAGGACATTGGTTT TGGGGGTATGCTGGTGAATTGGTAAGAAATTACTGCAGGCGTTTTAATCT TTGAGCTACCCTTTTTATAGTAATAAAAGTTTTAAAAGATTAATTAAAAT ACTTTTTTATATAAAAACAAAATAAAGGGTGCCTCCAATTAGTACAGGAT CACTTGGATCACTTGAAGCGCTTGGGTCGGGCGCTTAAAACCCTAATCAT TCACATTCAATGGGTGGAATAAACCCATATTAAGTCTAGTATATTT >_1 *APCGGILVTL*YTLYPFYLPYHTVYKSTNPYPSK*LGSCCFGNLTMGVIVGRTLTKMKV KALEFYSWGWG*G*FWGFILVFRAELKLVFIVLVSSFLVLFFSLLCISSGNLKIGAM*SD DPLLHSWG*NLNILFHLTFFYILAFTNNTVLANISKEIGRDLKDIGFGGMLVNW*EITAG VLIFELPFL***KF*KIN*NTFLYKNKIKGASN*YRITWIT*SAWVGRLKP*SFTFNGWN KPILSLVYX >_2 ELHVVEFSLLYNIHCTHFICHTTQCTKVPTLIPVNDWVHVVLVT*QWV**WEERSLK*RL RHWSFIHGVGVRVSFGGSF*CLGQN*S*FS*F**AVSLFSFLVCSVLAPVT*KLVRCNLT IHFYIHGDKT*IFYSILHFFIF*HLRTIPCSQISQKKLAGT*RTLVLGVCW*IGKKLLQA F*SLSYPFYSNKSFKRLIKILFYIKTK*RVPPISTGSLGSLEALGSGA*NPNHSHSMGGI NPY*V*YIX >_3 SSMWWNSRYFIIYIVPILSAIPHSVQKYQPLSQ*MTGFMLFW*PDNGCDSGKNAH*NEG* GIGVLFMGLGLGLVLGVHFSV*GRIKVSFHSFSEQFPCSLF*FALY*LR*PENWCDVI*R STFTFMGIKPEYSIPSYIFLYFSIYEQYRARKYLKRNWPGPKGHWFWGYAGELVRNYCRR FNL*ATLFIVIKVLKD*LKYFFI*KQNKGCLQLVQDHLDHLKRLGRALKTLIIHIQWVE* THIKSSIF 4T5 MEITRALVVLGWSHFYQLLALFCLAIVLYKLTVLLMLK est candidate >gi|19508322|dbj|BP016845.1|BP016845 BP016845 Nori Satoh unpublished cDNA library, young adult Ciona intestinalis cDNA clone ciad66m08 5'. Length = 640 Score = 26.6 bits (57), Expect = 6.9 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 6/38 (15%) Frame = +1 Query: 13 IFLYFS------IYEQYRARKYLKRNWPGPKGHWFWGY 44 +FLY S ++ R RK L + GP+ HW +G+ Sbjct: 88 VFLYKSRKLIGRFLKERRIRKELTKEIDGPQPHWLFGH 201 CGCCGTTGTAGATACGCTGCTATGCTGTTACCGGATTATTTAGAATTCAGCTTAAGTTTG TACAGTATTGGAGCGGTTTGTGTGGTAGTGTTTTTGTACAAGTCTCGAAAGTTAATTGGT AGATTTTTGAAAGAAAGGCGCATACGCAAAGAGCTCACGAAGGAAATTGATGGCCCGCAG CCACATTGGTTGTTTGGTCACCTAAATCTGCTTCAACCAAATGAAGAAACTATCCTCAAA ACATGCGAACAGACACAAAAATACCCGAAACTTGGAATGGTGTGGTTTGGTCCAGCATTA GCGTACTTGATGGTATTTCATCCGCATGTAGTGCGACCTGTACTGAACGTTGAACACCCG AAGGACAACTTGGCGTACAGATTCATCAAACCATGGATTGGCGACGGATTGCTGGTTAGC CACGGCAGTAAGTGGCGAAGAAACCGCCATCTACTTACTAAAGCTTTTCATTTCGACATA TTAAAACAGTACACTAAAGTTTTCGATGCATGCTGCAAAACAATGTTAGAAAAGTGGTCG CGGAAATGTGACGGTTCCATGGTAGAAGTGTTTAGGCCAGTTAGTCTGATGACCCTGGAC AGTATGCTGCAGTGTGCAATATCGTGTGAAACGGAATGCC This is a hit to seq 146 >SEQUENCE 146 Length = 117 Plus Strand HSPs: Score = 404 (142.2 bits), Expect = 3.7e-40, P = 3.7e-40 Identities = 79/89 (88%), Positives = 80/89 (89%), Frame = +1 Query: 358 PKDNLAYRFIKPWIGDGLLVSHGSKWRRNRHLLTKAFHFDILKQYTKVFDACCKTMLEKW 537 PKDNLAYRFIKPWIGDGLLVSHGSKWRRNRHLLTKAFHFDILKQ+ KTMLEKW Sbjct: 2 PKDNLAYRFIKPWIGDGLLVSHGSKWRRNRHLLTKAFHFDILKQF--------KTMLEKW 53 Query: 538 SRKCDGSMVEVFRPVSLMTLDSMLQCAIS 624 SRKCDGS VEVFRPVSLMTLDSMLQCAIS Sbjct: 54 SRKCDGSTVEVFRPVSLMTLDSMLQCAIS 82 >_1 RRCRYAAMLLPDYLEFSLSLYSIGAVCVVVFLYKSRKLIGRFLKERRIRKELTKEIDGPQ PHWLFGHLNLLQPNEETILKTCEQTQKYPKLGMVWFGPALAYLMVFHPHVVRPVLNVEHP KDNLAYRFIKPWIGDGLLVSHGSKWRRNRHLLTKAFHFDILKQYTKVFDACCKTMLEKWS RKCDGSMVEVFRPVSLMTLDSMLQCAISCETECX >SEQUENCE 146 MLLPDYLEFSLSLYSIGAVCVVVFLYKSRKLIGRFLKERRIRKELTKEIDGPQ PHWLFGHLNLLQPNEETILKTCEQTQKYPKLGMVWFGPALAYLMVFHPHVVRPVLNVEH PKDNLAYRFIKPWIGDGLLVSHGSKWRRNRHLLTKAFHFDILKQYTKVFDACC KTMLEKWSRKCDGSTVEVFRPVSLMTLDSMLQCAIS 338 LSKLPFVTMFIKEVLRLYPPVFAVARRTEQPVKFP 533 BP016845 EST DEV22920.x01 C-HELIX TO MID DEV22920.y1 K-HELIX LQW193399.x1 C-HELIX TO MID LQW223280.x1 K-helix LQW223280.y1 mid DEV54197.y1 mid DEV8162.x1 c-helix LQW23885.x1 C-HELIX LQW271226.y1 mid >scf/ciona01/G126/seq_dir/hrs/G126P67014F.T0/G126P67014FD12.T0.seq 734 (03) 0 734 ABI Length = 734 Minus Strand HSPs: Score = 85 (29.9 bits), Expect = 1.6, P = 0.80 Identities = 15/23 (65%), Positives = 19/23 (82%), Frame = -3 Exon 3 Query: 50 NVPKLKRAYKLLFEWLGHGLLVL 72 + PKLKRAY+ LFEWLG +L+L Sbjct: 204 DAPKLKRAYRSLFEWLGEWMLIL 136 Ciona ortholog to seq 110 >scf/ciona01/G126/seq_dir/hrs/G126P64618F.T0/G126P64618FC11.T0.seq 724 (00) 0 724 ABI Length = 724 Plus Strand HSPs: Score = 191 (67.2 bits), Expect = 4.3e-14, P = 4.3e-14 Identities = 34/46 (73%), Positives = 40/46 (86%), Frame = +3 Exon 4 Query: 67 HGLLVLEDKVWLRHRRLLTPSFHFEVLKPYVKTMNESAHVMVENWL 112 HGLLVLEDK W RHRRLLTPSFHFE+LKPY+KTMNE + MV +++ Sbjct: 45 HGLLVLEDKEWFRHRRLLTPSFHFEILKPYIKTMNECSITMVVSYI 182 >scf/ciona01/G126/seq_dir/hrs/G126P65148R.T0/G126P65148RB8.T0.seq 726 (03) 726 ABI Length = 726 Plus Strand HSPs: Score = 197 (69.3 bits), Expect = 9.3e-15, P = 9.3e-15 Identities = 35/47 (74%), Positives = 41/47 (87%), Frame = +2 Query: 66 GHGLLVLEDKVWLRHRRLLTPSFHFEVLKPYVKTMNESAHVMVENWL 112 GHGLLVLEDK W RHRRLLTPSFHFE+LKPY+KTMNE + MV +++ Sbjct: 113 GHGLLVLEDKEWFRHRRLLTPSFHFEILKPYIKTMNECSITMVVSYI 253 >scf/ciona01/G126/seq_dir/hrs/G126P65148R.T0/G126P65148RB8.T0.seq 726 0 726 ABI AAATCGGACAGCTANAACCTCCAATGNGGTGGNAATTCGTTATCTTTATC AAAACATTATGNGTCCATAAAATACGACTTATGCACAACTTTAACGACTT CATTCGTGCAAAGGTCACGGTCTTCTGGTATTGGAGGACAAAGAGTGGTT TCGTCATCGTAGGTTGCTCACTCCATCATTCCACTTTGAAATCCTTAAAC CTTACATTAAGACCATGAACGAATGCTCCATTACTATGGTGGTAAGTTAC ATTTTGGTATGTTTGTTCTACATGATTTGTCATTCAGTATCACTAAGCGT ATCTGAAACATATTTCGTAATCATGATCTTGCGTATTTTGTGAACCTTCA ACAGATTCTTATCTTGAAAAAACCCTGAGTTCTTATTCCATGAGCTCATT TATCTTAACACCACTTGCCACAGTGCGGGTGTCCCGCCCTCTCTCCCCCG CGCTTCTTCTCTATTTGCTGCTTCGCCCCCCACTTTTATCTCACTCACAT ACACTCTACCTACCCGCATAATTAAAATGAGTATAGTTTATCANACAAAG AATTTTCATCATTTACCCTATCACCACTAACCAATTCATGAATTTCCTCC AGGACTCCCTCCCTCGTTCCCCCTCGTTATTCCACTCTGATTCCCCGTTT CCACCTTATTCTTTAATTACAAACTTATATACCTATACCTCTCTATATAT GTCCAACCCCACAACTACACACCCCC >_1 KSDSXNLQXGGNSLSLSKHYXSIKYDLCTTLTTSFVQRSRSSGIGGQRVVSSS*VAHSII PL*NP*TLH*DHERMLHYYGGKLHFGMFVLHDLSFSITKRI*NIFRNHDLAYFVNLQQIL ILKKP*VLIP*AHLS*HHLPQCGCPALSPPRFFSICCFAPHFYLTHIHSTYPHN*NEYSL SXKEFSSFTLSPLTNS*ISSRTPSLVPPRYSTLIPRFHLIL*LQTYIPIPLYICPTPQLH TP >_2 NRTAXTSNXVXIRYLYQNIMXP*NTTYAQL*RLHSCKGHGLLVLEDKEWFRHRRLLTPSF HFEILKPYIKTMNECSITMVVSYILVCLFYMICHSVSLSVSETYFVIMILRIL*TFNRFL S*KNPEFLFHELIYLNTTCHSAGVPPSLPRASSLFAASPPTFISLTYTLPTRIIKMSIVY XTKNFHHLPYHH*PIHEFPPGLPPSFPLVIPL*FPVSTLFFNYKLIYLYLSIYVQPHNYT P >_3 IGQLXPPMXWXFVIFIKTLXVHKIRLMHNFNDFIRAKVTVFWYWRTKSGFVIVGCSLHHS TLKSLNLTLRP*TNAPLLWW*VTFWYVCST*FVIQYH*AYLKHIS*S*SCVFCEPSTDSY LEKTLSSYSMSSFILTPLATVRVSRPLSPALLLYLLLRPPLLSHSHTLYLPA*LK*V*FI XQRIFIIYPITTNQFMNFLQDSLPRSPSLFHSDSPFPPYSLITNLYTYTSLYMSNPTTTH P >scf/ciona01/G126/seq_dir/hrs/G126P600637F.T0/G126P600637FD5.T0.seq 709 (09) 0 709 ABI Length = 709 Minus Strand HSPs: Score = 122 (42.9 bits), Expect = 4.0e-05, P = 4.0e-05 Identities = 25/48 (52%), Positives = 36/48 (75%), Frame = -2 Exon 5 Query: 63 EWLENWLSKTSDN-KVAK-VEIFHYASLMTLDTTLRCLMSYQSNCQDE 108 ++ E+W+ KTS+ ++A ++I S MTLDT L+CLMSY+SNCQDE Sbjct: 513 QFQESWVKKTSEKAQIADDMDITPSISRMTLDTILKCLMSYESNCQDE 370 >scf/ciona01/G126/seq_dir/hrs/G126P601992R.T0/G126P601992RE6.T0.seq 741 (14) 0 741 ABI Length = 741 Plus Strand HSPs: Score = 98 (34.5 bits), Expect = 0.020, P = 0.019 Identities = 18/36 (50%), Positives = 26/36 (72%), Frame = +3 Exon 6 Query: 66 STNDYVAKIYELSETIVRRQRNLNILNRIDPIYNVT 101 STN YV+KIYE+S ++ R R++NI RI+ I+ T Sbjct: 576 STNSYVSKIYEISASVAHRMRDVNIFKRINAIFYAT 683 >scf/ciona01/G126/seq_dir/hrs/G126P64098R.T0/G126P64098RH5.T0.seq 731 (06) 731 ABI Length = 731 Minus Strand HSPs: Score = 166 (58.4 bits), Expect = 2.0e-10, P = 2.0e-10 Identities = 36/66 (54%), Positives = 45/66 (68%), Frame = -3 Exon 7 Query: 131 NLNILN-RIDPIYNVTKEGRKYLKLCDDVHKFSESVINRRKCDSEQPAHNETRKYFDFLD 189 NLNI N D + G+ +LKLC+ VH+FS+SVIN RK + +QP + RKY DFLD Sbjct: 465 NLNITNVPTD**TSFRAHGKAFLKLCEAVHEFSDSVINCRKAELKQPLVKQNRKYLDFLD 286 Query: 190 TLLKAR 195 TLLKAR Sbjct: 285 TLLKAR 268 >scf/ciona01/G126/seq_dir/hrs/G126P65862F.T0/G126P65862FH11.T0.seq 697 (04) 0 697 ABI Length = 697 Plus Strand HSPs: Score = 280 (98.6 bits), Expect = 6.1e-24, P = 6.1e-24 Identities = 53/75 (70%), Positives = 60/75 (80%), Frame = +3 Query: 228 FDFLDTLLKARDSDGKGLSDSEIRAEVDTFMFEGHDTTASGISWTFYCLAMHPEHQEKCF 287 F F +L D+DGKGLSD EIRAEVDTFMFEGHDTTASGISW YCLA + +HQE CF Sbjct: 411 FIFQ*PILYL*DADGKGLSDREIRAEVDTFMFEGHDTTASGISWILYCLAENADHQEMCF 590 Query: 288 QEIEKVMADRTDIEW 302 +EI++ M DRTDIEW Sbjct: 591 REIQEQMGDRTDIEW 635 >scf/ciona01/G126/seq_dir/hrs/G126P67830F.T0/G126P67830FH2.T0.seq 721 (02) 721 ABI Length = 721 Plus Strand HSPs: Score = 213 (75.0 bits), Expect = 9.4e-23, Sum P(2) = 9.4e-23 Identities = 38/63 (60%), Positives = 50/63 (79%), Frame = +3 Query: 243 KGLSDSEIRAEVDTFMFEGHDTTASGISWTFYCLAMHPEHQEKCFQEIEKVMADRTDIEW 302 K L+ EIR EVDTF+FEGHDTTASGI+W+FYCLA + EHQE C +EI++V+ +T + W Sbjct: 84 KKLTAREIRDEVDTFLFEGHDTTASGIAWSFYCLATNTEHQETCRREIKEVLGTKTSLNW 263 Query: 303 NDL 305 +L Sbjct: 264 *EL 272 Score = 80 (28.2 bits), Expect = 9.4e-23, Sum P(2) = 9.4e-23 Identities = 18/34 (52%), Positives = 22/34 (64%), Frame = +1 Query: 304 DLSNLPHLTLCIKESLRQYPPVPIIFRKLNKDIE 337 DLS LP +T+ IKE LR YPPV I R+ I+ Sbjct: 577 DLSKLPFVTMFIKEVLRLYPPVFAIARRTQHAIQ 678 >scf/ciona01/G126/seq_dir/hrs/G126P68504R.T0/G126P68504RH1.T0.seq 730 (10) 730 ABI Length = 730 Plus Strand HSPs: Score = 188 (66.2 bits), Expect = 1.6e-14, P = 1.6e-14 Identities = 36/50 (72%), Positives = 43/50 (86%), Frame = +3 Query: 190 TLLKARNDLSNLPHLTLCIKESLRQYPPVPIIFRKLNKDIEVDGKTIVKG 239 +L+ R+DL+ LP LT+CIKES+R +PPVPIIFRKLNKDIEVDGK I KG Sbjct: 576 SLIIPRDDLAKLPCLTMCIKESMRLFPPVPIIFRKLNKDIEVDGKLIAKG 725 >scf/ciona01/G126/seq_dir/hrs/G126P61654R.T0/G126P61654RD8.T0.seq 759 (00) 759 ABI Length = 759 Minus Strand HSPs: Score = 120 (42.2 bits), Expect = 0.00018, P = 0.00018 Identities = 20/26 (76%), Positives = 22/26 (84%), Frame = -3 Exon 10 Query: 346 GTNVVLHIYALHHHEEFWKDPHIFDP 371 GT++VLHIYALHHHE FWKD FDP Sbjct: 127 GTDIVLHIYALHHHEMFWKDQEKFDP 50 >scf/ciona01/G126/seq_dir/hrs/G126P601042R.T0/G126P601042RH9.T0.seq 787 (09) 0 787 ABI Length = 787 Plus Strand HSPs: Score = 94 (33.1 bits), Expect = 0.084, P = 0.081 Identities = 16/28 (57%), Positives = 22/28 (78%), Frame = +3 Query: 261 IFDPSRFTQDNMKSMNSYAYVPFSAGPR 288 +FDP RFT++N+ ++AYVPFSAG R Sbjct: 279 VFDPERFTKENIAKRPAFAYVPFSAGSR 362 >scf/ciona01/G126/seq_dir/hrs/G126P68588R.T0/G126P68588RD5.T0.seq 606 (11) 606 ABI Length = 606 Minus Strand HSPs: Score = 94 (33.1 bits), Expect = 0.027, P = 0.027 Identities = 17/28 (60%), Positives = 20/28 (71%), Frame = -3 Query: 174 IFDPSRFTQDNMKSMNSYAYVPFSAGPR 201 +FDP RF N M+ YA+VPFSAGPR Sbjct: 553 VFDPERFYVKNSAEMHPYAFVPFSAGPR 470 >scf/ciona01/G126/seq_dir/hrs/G126P602307F.T0/G126P602307FE3.T0.seq 769 (14) 0 769 ABI Length = 769 Plus Strand HSPs: Score = 201 (70.8 bits), Expect = 6.1e-16, P = 6.1e-16 Identities = 34/50 (68%), Positives = 39/50 (78%), Frame = +1 Query: 195 GTNVVLHIYALHHHEEFWKDPHIFDPSRFTQDNMKSMNSYAYVPFSAGPR 244 GT++VLHIYALHHHE FWKDP FDP+RF N ++ Y YVPFSAGPR Sbjct: 67 GTDIVLHIYALHHHEMFWKDPEKFDPNRFLPKNSSNVEGYTYVPFSAGPR 216 >scf/ciona01/G126/seq_dir/hrs/G126P67550F.T0/G126P67550FF3.T0.seq 1029 0 1029 ABI Length = 1029 Minus Strand HSPs: Score = 166 (58.4 bits), Expect = 1.8e-09, P = 1.8e-09 Identities = 32/56 (57%), Positives = 39/56 (69%), Frame = -1 Exon 12 Query: 395 RNCIGQNFAMNEMKIAIGQTLRRFKVIPDESSPKPSITPQVVLRPKDGIFIKLMKI 450 RNCIGQNFAMNEMKI + Q +R ++ D SP P + P +VL+ K GIFIK KI Sbjct: 750 RNCIGQNFAMNEMKICLAQVIRNLRLYIDGDSPVPKMHPMLVLQSKSGIFIKFEKI 583 >4T5 Fugu Possible N-term for savignyi MGIKPEYSIPSYIFLYFSIYEQYRARKYLKRNWPGPKGHWFWGYAGELVRNYCRRFNL 4T5fugu MEITRALVVLGWSHF--YQLLALFCLAIVLYKLTVLLMLKRALIRNFESFPGPPGHWLFGNILE 693 (0) 4T2 MELTEAFLTLHWGLPRLHHLLALLCLVAVVYKLATLLAKRRDVFRSYEDFPGPPTHWLFGHVLEF 4T3 MWNALVWQQVAALLCLLAVLLKATQIYLSKKRQERILEQFPGPPRHWLLGNVDQI MVAQSQLESLLLQSGGGFIFQTLLADVLLFAALVFVTAKYVSPAVKHQVLLRKCAKEVGGPKGHWFYGDLLEV seq 156 Seq 146 RIRKELTKEIDGPQPHWLFGHLNLL Seq 110 SYSFYFSIQEFYTVTKYLKSNWPEPESHWLWGSFGAV possible N-term 902 FKQDGNDLDKLVKFGQKYPYCFPLWFGPFVCFLNIHHPEYVKTILAST 1045 (1) 1142 EPKDDLAYSFIQNWI 1186 (1) 1291 GNGLLVSQGQKWFRHRRLLTPGFHYDVLKPYVKLMAHSTKTML 1419 (0) 1673 DKWESYAKTNKPLEVFEYVSLMTLDTILNCAFSYDSNCQTER 1798 (2) 2267 KNTYIKAVYELSNLINLRFRIFPYHNDLIFYLSPHGFRYRKACMVAHSHT 2416 (1) 2521 EEVIKKRREALKKEKELERIQAKRNLDFLDILLFAK 2638 (0) 3171 DENQQGLLDEDIRA EVDTFMFEGHDTTASGISFLLYNLACHPKHQKLCRKEIMQVLHGKDTMDW 3362 (2) 3457 EDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFDGRTLPA 3588 (1) 392 ESRIGTSVFGIHRNASLWENPNV 457 (1) this exon from Fugu LPC.11421.x1 fdhwrflpenvskrsphafvpfsagpr this exon from 4T2 Dicentrarchus labrax NCIGQNFAMNEMKVVIAMTLLKYELLEEPTLKPKIIPRLVLRSLNGIHIKIKNANQN* cannot find this seq now DEV54467.y1 CHEM: term DYE: ET TIME: Fri May 4 12:30:46 2001 TEMPLATE: DEV54467 DIRECTION: rev Length = 566 Score = 26.6 bits (57), Expect = 31 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -2 Query: 33 GPPGHWLFGNVLE 45 GP GHW +G++LE Sbjct: 247 GPKGHWFYGDLLE 209 >LQW235871.x1 GAGCATGCCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATAATT TCATTTTTATAACTTATTATATCTATTTTTATATAAGCANATCTAATTAT TACAATTAGAATCATCTTACAAGATTTGAACATGTTTCTAAAATATTATT AATTTAATTGTAGGGGTCAAGCCCTAAAACAACTATTCTTATTAATTGTT CAGGTGTGATTATTCTGACTTTTGTTACAGTACCTGAAGCTAAAATACAG TTATGTCTATTTAATATTATATGTGACTTAGTTCTGCCCTTTTCTTTAAG CAATTTCCTTCTACTTCAAACTAAAAACCTCCCCCCCAAAACCCTGAATG TCTTAACTAATGTGATTTGAATGTCGTTGAAACAGAAAAACAGTTGTTGT CTTGCTTACCTTGGGCCAGCAGAGAAAGGTACATAAGCATAACTATTCAT GCTTTTCATGTTTTCCTGCGTGAACCGACTTGGATCAAATATATGAGGAT CCTTCCAAAACTCCTCGTGATGGTGTAATGCATAAATATGTAGAACCACA TTGGTGCCTATCGTTAAAGCAATAGTTAGGATCAAGTGCTACGAGAACGT AACAGACAAAAATCAAGTCCAACCAATTGTTTAATAAAAAAAAGTATTCT GTCTAAATGGGATTGGTAATCTATTATTCAAATAGAATCCTATCTACAAT GTCAGATTCGTGGCATTAATACAGTTATAATTGTACTGGTGTTATTAAAC ATAAACTAGTTACATAATGACTTATGTCGCGGTGTGGCCAGAGTTAATGC TGCTTAAACAAAAACAGGTAAGTTGATACACGAAAAGTAAAGCCAAGGGG AGTAGTTCAAGTGGTCCCATTTTTATCCCCTCAAGGTCCCATCATTTTTT GGAAAGAGGCTGGACTTGAAAAGGGGGGGCGAAAAATTTAAGGAATTCGA AAG >LQW60852.y1 TCACATCCATTAGACAGAATACTTTTTATTAACAATGATGGACTGATTTTGTCTGTTACGTTCTCGNTAG CACCAGATCCTAACTATGCTTTAACGATAGAACACCAATGTGGTTCTACATATTTATGCATTACATCATC ACGAGGAGTTTTGGAAGGATCCTCATATATTTGATCCAAGTCGGTTCACGCAGGATAACATGAAAAGCAT GAATAGTTATGCTTATGTACCTTTCTCTGCTGGCCCAAGGTAAGCAAGACAACAACTGTTTTTCTGTTTC AATGACATTCAATTCACATTAGTTAAGACATTCAGGGTTTTGGGGGGGGGGAGGTTTTTAGGTTGAAGTA GAACGGAATTGCTTAAAGAAAAGGGCAGAACTAAGTTACATATAATATTAAATAGACATAACTGTATTTT AGCTTCAGTTACTGTAACAAAAGTCAGATTAATCACACCTGAACAATTAATAAGAATAGTTGTTTTAGGG CTTGACCCCTACAATTAAATTAATAATATTTTAGAAACATATTCAAATCTTGTAAGATGAATTCTAAATT GTAATAATTAGATATTGCTTATATTAAAAA >DEV3119.x1 XXXXXXXXXXXTCTTAAATAGTATGGACTCTGGATCAGACAACATAAAAGTCCTGTATAAATAGGGCCAC CTACATGCTTCTTTTGTCATAGATTCTTTAACATATCTTTCATGAATACATGGTAGAGTGGGGGAAGATG GGATACCTTTTTGTTCTATTTTCTCGCCCTATTTTATAGCAAACGAAACACATTCAAAGAATTATAAAAC CGCATCCTCACGACTCCCACAGACCAACGTTAATTGTTTAAAACACGGTCAAGATATTTGAATATTATGT ACTAAAGGTGTCCCAACTTCCCCCTTCCTACTATATCATATAATTTAGTCCTTGTGTTCTTCCATAAATA AAACTGTTGTTCTTCTATTGGCCAGGAATGATCTATCCAACCTCCCCCACCTTACATTATGCATCAAAGA AAGTTTGCGCCAATATCCACCAGTTCCAATCATTTTCCGTAAACTTAACAAAGATATTGAAGTTGATGGG AAGACCATTGTGAAAGGTAGAGATATGCAGTTAAATTTTAAATGATAAGAATTGCTTTATTTAGGAATTA AATAAATGAATAAATGTAACTGCCTTTATCCTGGTGTGGCTGGGAAGGGACAGTTGTTTTAACTTGGGTG TTCTGTTTCATACACTTGTGCCAGTTTAC >LQW76039.x1 AACGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTTTTGTTTATTAAAGTGGCTTAA TATTACAACTATTGTGTGAATGAGTATGTTATGTGGCAAAACACTATATTTCTTCAACCCAGCATTCTTG TGTTGTTTGAATTGTAAACCATACAATTACACTCATTACAGTAAACTAGTCTTGGAAACTAATGTTCTGT AATAAAAATTAAGTAATAAAACAGAAAAAAGTTGTGATTAAATCTCAACATTGACAAATGAAAAAGAATC GACTTTGTTTTATTTTAGAAAGGAAGGTCGCAAGTATCTGAAACTTTGTGATGATGTGCATAAGTTTTCC GAAATTCAGTTATTTCAATCGNTNNAGAAAATGCGAAAACAGTGAGCAACCCTGCACATAATGAAACACG GAAATATTTTGATTTTCTTGACACACTGTTGAAAGCAAGGGTAAGTTTTGAAAAAATATTTGCTTTTTGT TTTGTAGTCAAGCCATATAAGTTCGTCTAACGTCTAACATTCACAAGCAAGGTTTTAACATGTATGGTTA GGACATCACC >LQW258852.y1 AGACTGAACTGAGCCTGGNACCGAAATATTCATTATGCAAGCCTTATGAC ATTAGATACAACTCTTAGGTGCTTAATGTCTTATCAATCTAACTGCCAAG ATGAAAAGTAAGCTTGTCAATTTAATTTTCTATTCTATGTTGGTGAGGTG TGACGAACATGGGTCCTAAGGTTAGGTCAGAGTTGGCACATTACCCAAAC ACCAAGAGTGTTACTGTATGGACCTCACGAGATGTTGTAGCCTGTGAAGA TCTTCCCTAATCACAATACTAAACATTACTAAAAACAACATTCTTCTAGT CTTAGTGCGATAACACTGCATAATCAAAGGGTAAAATACGATTAATGTGC TGACACCTATTAAAAATACCAGAATTGAAAAATGATGCTACAACCATTGT GGTGTTTGTCCCTTACACTGGCCTAACTAGAGTTTGAGGTTGAATTATTG AACTATTAATATATTTCATTACAGCTCTACAAATGATTATGTTGCAAAGA TATACGAGTTATCTGAAACAATTGTGAGAAGGCAAAGGAACTTGAATATT TTGAATCGAATTGACCCAATTTATAATGTAACGTATGTAAATGTATTTTA ATATACATATTTATAATCTTTATTTTAATAAAAGTGGCTTAATGTTGCAA CTATTGTGAATGAGCATGTTATGTGGCAAAACACTATATTTCTTCAACCC AGCATTCTTGTGTTGTTTGAATTGTAAACTATACAATTACACTCATTACA GTAACTAGTCTTGGAACTAATGTCTGTAATAAAATCAGTAATCAAAGAAA AAGTGTGATAATCCAAATGGCATTGAAATATGATTGTTATTAGAAAGAGT GTAGTTTGATTGTGTATTGATGTGCGAAGTATATGGAGTGAGTGCATTGA CTAACGGATTGTTTGACGAAGGGGGTGAATTCTGTGGAGAATGCGAACCG GCTTGGATAAGATAGTTTTTCTTCTTTTTTTATTTTCGCAAGAAAACAAG AAGAGA >LQW202346.y2 CTGAGCTCGGTACCGGGNAAGATCTTCACAGGCTACAACATCTCGTGAGG TCCATACAGTAACACTCTTGGTGTTTGGGTAATGTGCCAACTCTGACCTA ACCTTAGGACCCATGTTCGTCACACCTCACCAACATAGAATAGAAAATTA AATTGACAAGCTTACTTTTCATCTTGGCAGTTAGATTGATAAGACATTAA GCACCTAAGAGTTGTATCTAATGTCATAAGGCTTGCATAATGAAATATTT CAACCTTGGCAACTTTATTGTCAGATGTTTTGCTTAACCAATTTTCCTGT GGAGTAAAACAATCCATAAGTCGTATGATACACAACAAACATTATCAGTT TTGTAAATATTATTATATAGAAATTTATTGGGCATTAATTTCTACATGTA AACAAAAAAATTAAAGCATGAGTAAACTTATACTACCTAAGAGACAAAAT AAATTACATTTCTTTCATTCATTTATACTTGAACTGACATTTGATTTTAA ACAAATACTCATACTGGGGTCTTTTTACATGAAGAGGCATTTTATAAACC TTTATTGTAATAAAACTTATAGCCCAACAAAACAAGCTTACCACCATAAC ATGAGCACTTTCATTCATAGTTTTTACGTAAGGTTTAAGAACTTCAAAAT GAAATTGAAGGAGTAAGCAACCTTCGATGACGCAACCAAACCTTGTCCTC CAAANACAACAGTCCATGTCCTAACAACAAAATTAAATAAACAAAAAAAA CCTAACCAGAACTGTGGGTAGTGCGCCTGTCTCTAGTCCAAATGTTGCCG GTACAAAGTTGCTTTAAAATAGTCAAGGTATGCATGCTACTGTAACAGGT CGTCTTTTAACCAGCCAAGGACAAGGAGCAATATTTTTCCCCTTCATGCC AGGATCGCTGTATTCTTAGGGAACCGGTATAGGTAATAAATAGGTATACG CATTTTATTTTCCCCTTATAGAAGTGCCCTATGGGACCGGGTCAAAACAC AAAGACGACACGGGCAAAAGGATAAATATCAAAGTTATG >LQW277116.y1 GGGANAAGAATAGTAGCTGGGACCTGATGTAAACTATAAATTACACTCAT TACAGTAAACTAGTCTTGGAAACTAATGTTCTGTAATAAAAATTAAGTAA TCAAACAGAAAAAAGCTGTGATTAAATCTCAACATTGACAAATGAAAAAT AGTTGAGTTTGTTTTATTTTAGAAAGGAAGGTCGCAAGTATCTGAAACTT TGTGATGATGTGCATAAGTGTTACGAATAAGTTATCAATCGTAGAAAATG CGACAGTGAGCAACCTGCACACAATGAAACACGGAAATATTTTGATTTTC TTGACACACTGTTGAAAGCAAGGGTAAGTTTTGAAAAAATATTTGCTTTT TGTTTTGTAGTCAAGCCATATAAGTTCGTCTAACGTCTAACATTCACAAG CAAGGTTTTAACATGTATGGTTAGGACATCACCTTAATATTGAAAGAATG CAACTTATAAACAGGACAGTGATGGGAAGGGGTTGTCAGATTCTGAGATT CGGGCCGAAGTTGACACTTTTATGTTTGAGGGCCATGATACAACTGCTAG TGGAATTTCATGGACATTTTATTGCTTAGCCATGCACCCTGAACATCAGG AAAAATGCTTTCAAGAGATTGAGAAAGTTATGGCTGACCGTACTGATATA GAATGGTTGGTATTATGTATTAATTTTTTTAAATATAGTTCTAAGATTAC ATTTCCTTGAATGTGAGAGACTTTAATTTAAGCTACGAGAACTGCAAATT TGTGCTTAGCTTTATTCTGTATAGATGGTCCACTGGCACACTTTTATTTG CACCTTTACCTAAGAAGTTACCTAGCGAGATAACAGACGCCGAATGCGGC AATCCGACCCCGCGCGGTAAAGAATCCAATCCGTACCTAATCGGACACGG CACAGCAAGTAACACTTAAAGCCTCCGAGGAACCCCGGTCCGGGGTCGAA CCCCAAAA >DEV17425.x1 XXXXXXXXXXXXXXXXXXXXXCAGCCCGTATAAATGCATAATACAATTTCTTTTCAAACGTTTCAATTTA AAACTAAAGCCACCTTTATTGATAACTTACCACTGCACCAAATGAACCCCATAACCAATGGCTTTCTGGC TCGGGCCAGTTTGACTTTAGGTATTTTGTTACAGTGTAAAATTCTTGTATGCTGAAATAAAAAGAGTAAC TTTATATTAAATTTAATATATGGTTTATTCCAGTTAGGCCTATAGATTATTAAAGTTAAAAAATTCGTGG TAATATACTAAATGTAAAGCATTTTCAACAAAAATAGGATCTTTTTAGATGAAATAAATTATTATATTTT ACTTTTCCGAAATTGTTTATTATACTTTAAAATTTATAATCTTTATATTAATTGCATACGTAAGATTCAA AATAATTCTTATTTAAAATAAAACATTTAAACAGCAAATATTTACCTTCGAAACAGGGAATGTAGAATAG ATAATGCCAGCAACGAAAATGAAGCATACACGGCATATTGTATGAACATAAACAACATTGTTTTAACTAG CAATCACTAAAAGTATGCAAACACTGATATATAAAAACCATTAATAATAGA >DEV17425.x1_4 YY*WFLYISVCILLVIAS*NNVVYVHTICRVCFIFVAGIIYSTFPVSKVNICCLNVLF*I RIILNLTYAINIKIINFKV**TISEK*NIIIYFI*KDPIFVENALHLVYYHEFFNFNNL* A*LE*TIY*I*YKVTLFISAYKNFTL*QNT*SQTGPSQKAIGYGVHLVQW*VINKGGFSF KLKRLKRNCIMHLYGLXXXXXXX >DEV17425.x1_5 LLLMVFIYQCLHTFSDC*LKQCCLCSYNMPCMLHFRCWHYLFYIPCFEGKYLLFKCFILN KNYFESYVCN*YKDYKF*SIINNFGKVKYNNLFHLKRSYFC*KCFTFSILPRIF*L**SI GLTGINHILNLI*SYSFYFSIQEFYTVTKYLKSNWPEPESHWLWGSFGAVVSYQ*RWL*F *IETFEKKLYYAFIRAXXXXXXXX >DEV17425.x1_6 SIINGFYISVFAYF**LLVKTMLFMFIQYAVYASFSLLALSILHSLFRR*IFAV*MFYFK *ELF*ILRMQLI*RL*ILKYNKQFRKSKI**FISSKKILFLLKMLYI*YITTNFLTLIIY RPNWNKPYIKFNIKLLFLFQHTRILHCNKIPKVKLARARKPLVMGFIWCSGKLSIKVALV LN*NV*KEIVLCIYTGXXXXXXXX SYSFYFSIQEFYTVTKYLKSNWPEPESHWLWGSFGAV posssible N-term of intestinalis >LQW181437.x3 AACGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXA TGCTTACTTGACTTTATAAAAGTTATGATTGCAACAAATACAATAACTAT ATGAACGATTGTTCAACATATTCTTACCTGAGCCACTAAGTATAGCTTTG GCAATGGTTGGGTGGTAAGTGTTTAAGGACTTAATGAAAGGTCCTAACTG AGTCCGAAAGCCATATGGATATTTCTTCATACAATCATTCATGTAGGTGA AGTAATACGAAGGGTCTGCACTCATTTTAAGCATCTATAAAATATAATAT ACAGCTATAATAATATTGTAGGTTGTAACGGTCACGCTTTTTATCCAAAA CAAAATATTTCTTTCTTTTTTATCAATGTTTTAACAACTGTTTTTTTACC ATTACTACCCGGCTTTTCGCTTTTGTCAACTCTCTTGTTCTTCGTTATCG TGACCGAAGAGAGGAATTAAATTTCATTCATTCAATCAATATGATAAGTT TTATTCGGGTAGTTTCAAAACAAATATGACAGATTGACAGCCTGTATGAA TGCATAATACAATTTCTTTTCAAGTGTTTCAATTTAAAACTAAAGCCACC TTTATTGATAACTTACCACTGCGCCAAATGAACCCCATAACCAATGGCTT TCTGGCTCGGGCCAGTTTGACTTTAGGTATTTTGTTACAGTGTAAAATTC TTGTATGCTGAAATAAAAAGAGTACTTTATGACTATTGGTTATTCCAGTA AGCCTATAGATACTAAGTTAAAGATCCTGTGATCTCCACTGTAAAGCTTT TCACAAATAGGATCTTAGATAATACTTTAATCACTTCCGAATGGTATAAC TAAAATTTAGCTAATTATGGTCGCAGATAAAACTTTTACAAACTTTACGA ATTCCTAAGGA SLGIRKVCKSFICDHN*LNFSYTIRK*LKYYLRSYL*KALQWRSQDL*LS IYRLTGITNSHKVLFLFQHTRILHCNKIPKVKLARARKPLVMGFIWRSGK LSIKVALVLN*NT*KEIVLCIHTGCQSVIFVLKLPE*NLSY*LNE*NLIP LFGHDNEEQES*QKRKAG**W*KNSC*NIDKKERNILFWIKSVTVTTYNI IIAVYYIL*MLKMSADPSYYFTYMNDCMKKYPYGFRTQLGPFIKSLNTYH PTIAKAILSGSGKNMLNNRSYSYCICCNHNFYKVK*A P*EFVKFVKVLSATIIS*ILVIPFGSD*SII*DPICEKLYSGDHRIFNLV SIGLLE*PIVIKYSFYFSIQEFYTVTKYLKSNWPEPESHWLWGSFGAVVS YQ*RWL*F*IETLEKKLYYAFIQAVNLSYLF*NYPNKTYHID*MNEI*FL SSVTITKNKRVDKSEKPGSNGKKTVVKTLIKKKEIFCFG*KA*PLQPTIL L*LYIIFYRCLK*VQTLRITSPT*MIV*RNIHMAFGLS*DLSLSP*TLTT QPLPKLYLVAQVRIC*TIVHIVIVFVAIITFIKSSKX LRNS*SL*KFYLRP*LAKF*LYHSEVIKVLSKILFVKSFTVEITGSLT*Y L*AYWNNQ*S*STLFISAYKNFTL*QNT*SQTGPSQKAIGYGVHLAQW*V INKGGFSFKLKHLKRNCIMHSYRLSICHICFETTRIKLIILIE*MKFNSS LRSR*RRTRELTKAKSRVVMVKKQLLKH**KRKKYFVLDKKRDRYNLQYY YSCILYFIDA*NECRPFVLLHLHE*LYEEISIWLSDSVRTFH*VLKHLPP NHCQSYT*WLR*EYVEQSFI*LLYLLQS*LL*SQVSX >CYP4T5 Scaffold_15094 Length = 4295 Length = 485 Score = 736 (259.1 bits), Expect = 7.1e-90, Sum P(2) = 7.1e-90 Identities = 156/350 (44%), Positives = 212/350 (60%) Query: 20 KKYPYGFRTQLGPFIKSLNTYHPTIAKAILSG---------------LGHGLLVLEDKVW 64 +KYPY F GPF+ LN +HP K IL+ +G+GLLV + + W Sbjct: 78 QKYPYCFPLWFGPFVCFLNIHHPEYVKTILASTEPKDDLAYSFIQNWIGNGLLVSQGQKW 137 Query: 65 LRHRRLLTPSFHFEVLKPYVKTMNESAHVMVENWLSKTSDNKVAKVEIFHYASLMTLDTT 124 RHRRLLTP FH++VLKPYVK M S M++ W S NK +E+F Y SLMTLDT Sbjct: 138 FRHRRLLTPGFHYDVLKPYVKLMAHSTKTMLDKWESYAKTNK--PLEVFEYVSLMTLDTI 195 Query: 125 LRCLMSYQSNCQDENSTNDYVAKIYELSETIVRRQRNLNILNRIDPIYNVTKEGRKYLKL 184 L C SY SNCQ E N Y+ +YELS I R R N D I+ ++ G +Y K Sbjct: 196 LNCAFSYDSNCQTERK-NTYIKAVYELSNLINLRFRIFPYHN--DLIFYLSPHGFRYRKA 252 Query: 185 CDDVHKFSESVINRRK--CDSEQPAHN-ETRKYFDFLDTLLKARDSGGKGLSDSEIRAEV 241 C H +E VI +R+ E+ + ++ DFLD LL A+D +GL D +IRAEV Sbjct: 253 CMVAHSHTEEVIKKRREALKKEKELERIQAKRNLDFLDILLFAKDENQQGLLDEDIRAEV 312 Query: 242 DTFMFEGHDTTASGISWTFYCLAMHPEHQEKCFQEIEKVMADRTDIEWNDLSNLPHLTLC 301 DTFMFEGHDTTASGIS+ Y LA HP+HQ+ C +EI +V+ + ++W DL+ +P+ T+C Sbjct: 313 DTFMFEGHDTTASGISFLLYNLACHPKHQKLCRKEIMQVLHGKDTMDWEDLNKIPYTTMC 372 Query: 302 IKESLRQYPPVPIIFRKLNKDIEV-DGKTIVKGGTNVILHIYALHHHEEFWKDPHI 356 IKESLR +PPVP I RK K I DG+T+ + + ++ +H + W++P++ Sbjct: 373 IKESLRMHPPVPGISRKTTKPITFFDGRTL-PAESRIGTSVFGIHRNASLWENPNV 427 Score = 145 (51.0 bits), Expect = 7.1e-90, Sum P(2) = 7.1e-90 Identities = 28/52 (53%), Positives = 40/52 (76%) Query: 384 NCIGQNFAMNEMKIAIGQTLRRFKVIPDESSPKPSITPQVVLRPKDGIFIKL 435 NCIGQNFAMNEMK+ I TL +++++ +E + KP I P++VLR +GI IK+ Sbjct: 428 NCIGQNFAMNEMKVVIAMTLLKYELL-EEPTLKPKIIPRLVLRSLNGIHIKI 478 >scf/ciona01/G126/seq_dir/hrs/G126P65019F.T0/G126P65019FD4.T0.seq 739 0 739 ABI Length = 739 Plus Strand HSPs: Score = 153 (53.9 bits), Expect = 8.7e-11, P = 8.7e-11 Identities = 29/61 (47%), Positives = 37/61 (60%), Frame = +2 Query: 1 MLKMSADPSYYFTYMNDCMKKYPYGFRTQLGPFIKSLNTYHPTIAKAILSGSGKNMLNNC 60 M K+ DP YYF+Y+ K YPYGF + L P SLN YHP KA+L SG N+ ++ Sbjct: 443 MRKIRKDPGYYFSYIRGITKTYPYGFSSNLTPLFASLNIYHPNAVKAVLCASG-NVFSSL 619 Query: 61 S 61 S Sbjct: 620 S 622 >LQW194134.y2 AAGGGAAAGGACTAAACTGAGCCTGGTACCAAAGTATGCATGCTACTTGA ACAAGTCGTTCTATTTAAACAACCAAAATGACAAAGAAGCAAATATACTT TCCCCCTTCCATGCCATGCATTCGCATGCTAGTCTTACAGGTAAACACGT GTAATAGCGTAAATAAAATTAAAGTTTAATAAAGTAATATTAATACATTA CATACCCAACCATTCAAACAGTAACTTGTAAGCCCTTTTTAATTTTGGAA CATCTGCAGCTGTGTGAATATAAAAATACATTATAAATAATAAGATGTAC ATGTAATATAACGTGTTGTGGGCCTATATTACATACAAGCGTACATTTAA TGAGTAACTAATAAAATAGGCTACCTTCTTACAAAATGAAAAAGTGAACC TTGATGGATATTTATGATATTTTAATGTAACAAGGCTCCTGGATTATTTA TACATACATAGCAAAACTTTATTGGATTTTTGGCATGTGTACACCTTGGA CCTTAAACATGCTTACCTTGACTTTATAAAAGTTATGATTGCAACAAATA CAATAACTATATGAACAATTGTTCAACATATTCTTACCTGAGCCACTAAG TATAGCTTTGGCAATGGTTGGGTGGTAAGTGTTTAAGGACTTAATGAAAG GTCCTAACTGAGTCCGAAAGCCATATGGATATTTCTTCATACAATCATTC ATGTAGGTGAAGTAATACGAAGGGTCTGCACTCATTTTAAGCATCTATAT AAAATAATATACAGCTATAATAATTATGTACGTCGTAACAGTCACGCTTT TAATCCACAACAAAATATTCCTTCCTCTTTATCAATGTTTAACCGCTGGT GGTTTACATTACTACCGGGATTTCGTTTGGTAACTCTCTTGTCTCGGTAC TGGACCGAAAAAGGACTAATTATTAGCAGTGAAGGTTATCGGTATCACAA TATGATGGCGGAAAGATAATTTTAAGTACAAAAAGCTTGTTAGACAGCAA GTGGGTGCTTTTTGCTTCATCAACATCTCAAGAAATTTTATTGGGGGGGA GGGAGGGGTT NPSLPPNKIS*DVDEAKSTHLLSNKLFVLKIIFPPSYCDTDNLHC**LVL FRSSTETRELPNEIPVVM*TTSG*TLIKRKEYFVVD*KRDCYDVHNYYSC ILFYIDA*NECRPFVLLHLHE*LYEEISIWLSDSVRTFH*VLKHLPPNHC QSYT*WLR*EYVEQLFI*LLYLLQS*LL*SQGKHV*GPRCTHAKNPIKFC YVCINNPGALLH*NIINIHQGSLFHFVRR*PILLVTH*MYACM*YRPTTR YITCTSYYL*CIFIFTQLQMFQN*KGLTSYCLNGWVCNVLILLY*TLILF TLLHVFTCKTSMRMHGMEGGKYICFFVILVV*IERLVQVACILWYQAQFS PFPX TPPSPPIKFLEMLMKQKAPTCCLTSFLYLKLSFRHHIVIPITFTANN*SF FGPVPRQESYQTKSR**CKPPAVKH**RGRNILLWIKSVTVTTYIIIIAV YYFI*MLKMSADPSYYFTYMNDCMKKYPYGFRTQLGPFIKSLNTYHPTIA KAILSG SGKNMLNNCSYSYCICCNHNFYKVKVSMFKVQGVHMPKIQ*SFA MYV*IIQEPCYIKIS*ISIKVHFFIL*EGSLFY*LLIKCTLVCNIGPQHV ILHVHLIIYNVFLYSHSCRCSKIKKGLQVTV*MVGYVMY*YYFIKL*FYL RYYTCLPVRLACECMAWKGESIFASLSFWLFK*NDLFK*HAYFGTRLSLV LSL PLPPPQ*NFLRC**SKKHPLAV*QAFCT*NYLSAIIL*YR*PSLLIISPF SVQYRDKRVTKRNPGSNVNHQRLNIDKEEGIFCCGLKA*LLRRT*LL*LY IILYRCLK*VQTLRITSPT*MIV*RNIHMAFGLS*DLSLSP*TLTTQPLP KLYLVAQVRIC*TIVHIVIVFVAIITFIKSR*ACLRSKVYTCQKSNKVLL CMYK*SRSLVTLKYHKYPSRFTFSFCKKVAYFISYSLNVRLYVI*AHNTL YYMYILLFIMYFYIHTAADVPKLKRAYKLLFEWLGM*CINITLLNFNFIY AITRVYL*D*HANAWHGRGKVYLLLCHFGCLNRTTCSSSMHTLVPGSV*S FPX 1142 EPKDDLAYSFIQNWI 1186 (1) >LQW36556.x1 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTCGGACTCAGTTAGGACCTTTCATTAAGTCCTTAAACACT TACCACCCAACCATTGCCAAAGCTATACTTAGTGGCTCAGGTAAGAATATGTTGAACAATCGTTCATATA GTTATTGTATTTGTTGCAATCATAACTTTATAAAGTCAAGGTAAGCATGTTAAGGTCCAAGGTGTACACA TGCCAAAAATCCAATAAAGTTTTGCTATGTATAAATACTCCAAGAGCCTTGTTACATTAAAATATCATAA ATATCCATCAAGGTTCACTTTTTCNATTTTGTAAGAAGGTAGCCTATTTTATAAGTTACTCATTAAATGT ACGCTTGTATATAATATAGGCCCACAACACGTTATATTACATGTACATCTTATTATTTATAATGTTATTT TTATATTCACACAGCTGCAGATGTTCCAAAATTAAAAAGGGCTTACAANGTTACTGGTTTGAAAATGGCT AGGNNNTATGTAATGTATTAAGTATTACNTTTA >LQW247289.x1 related gene GAGAACAGCAGCGCGGCCNAAAGTGCXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXGTTATGAAACAGAACAATCGTGTTATAATGACTGG TGTTACCATGCTGGGATAAAACAAGTTATGTTTATTCAACTTTTATTACA CAAATATTTCCCAATGTGTTTAAAGAAAAATACTACATTGATTGTTTCTT TCAGATTGCAGAGGTCCAAAAAGACAGTGCTTACTATTTTACTTACATCA AGGAAATGACAAAGCAATTTCCTCAAGGTTTTAGAGGTCAACTTGGTCCT ATATTTCTTTCATTAAATGCTTATCACCCAAATATGATAAAGGCTGTTCT KAVL CTGTGCACCAGGTGAGGCACTTATTACAAATTTTTATTACTACATCTTAA AAGAACAAGTGTTACTTAATTTTTATTGTGTTTTACTAATCTTAGACGTA ATAACACGTTATTAAAACTCTTTTGTGCACCTGGGTAATAGTAATAATAA TAACTTTTATTTGTCTCTTTGATTACGATAGTAAAGATTTAGAAATATTT TAAAAGAAAGACAGGATATAATGACAAAACAACAAGTGTTAAAACACATA CAGTTCTGTACTGCTAACATTTTGGCAACTTATTGTTTACTTATTACCAC TATGAGATAATATTTACTTTGCCTTTTATTTGTTTCTCGTGTTGGTTATG TGTTAACAAACTTATGAATACATAGTGATCTCGTGCCCAGANACGTATCA GATTAAAATCAAACTTTATTTGTTTNNAACAGAATGGTCANCTCTATGAG CACAGATCAGGGTAGGTTCGCGAATTATACGGCTATCCTGGCGATACTTT TTATTGTGCGTCTGTGCCAAATCAAAGCTCAGGGTTTTGCGGTGGTAATT TTCGGTTCGGGTTAATTTCGTTAGGTTTGGGCCTATGGCCCCCCCTTTTG TTTCTTCTTCTCCCTTTTTCATCGCCCGGGTTTTTGGGGGCGCCTCC >LQW235871.y1 CGAGACTAATTGAGCCGGTTACCTTACATGTACAGTCTTATTATTTATAA TGTTATTTTTATATTCACACAGCTGCAGATGTTCCAAAATTAAAAAGGGC TTACAAGTTACTGTTTGAATGGCTAGGTATGTAATGTATTAGTATTACTT TATTAAACTTTAATTTTATTTACGCTATTACACGTATTTACCTGTAAGAC TAGCATGGGAATGCATGGCATGGAAGGGGGAAAGTAAATTTGCTCCTTTG TCATTTTGGTTGTTTAAATAGAACGACTTGTTCAAGTAGCATTGCATACT TTGATTATTTTTAAGCAACGTAGGGCCTTGTACCTGCAACATTTGGACTA GAGACATGCCCACTACCCACAGTTCTGGTTAGGTTGTTTTTGTTTAGTTA ATTTTGTTGTTAGGACATGGACTGTTGGTTTTGGAGGACAAGGTTTGGTT GCGTCATCGAAGGTTGCTCACTCCATCATTTCATTTTGAAGTTCTTAAAC CTTACGTAAAAACTATGAATGAAAGTGCTCATGTTATGGTGGTAAGCTAG TTTTGTTGAGCTATAAGTTTTATTACAATAAAGGTTTATAAAATGCCTCT TCATGTAAAAAGACCCCAGTATGAGTATTTGTTTAAAAATCAAATGTCAG TTCAAGTATAAATGAATGAAAGAAATGTACTTTATTTTGTCTCTTAGGTA GTATAAGTATACTCATGCTTTAATTTTTTATTTACATGTGGAAATTAATG CTCCATAATTTCTATATAATAATATTTACAAACTGATAATATTGGTGTGT ATCCAACGACTTAGGATGGTTTACTCCCGGGAACTGGCTAGCAAACCTCA CCATTAAGTGCAGGTGAAAATTCTTCGCAGCCTAGAATTGGAAACCCTGG GCAAGGCTATAACCAGCCGATAAGAGCGCCAGAGTCACAAGGGGGGGAAC CAGCCGAGAGGAAGGCTCCCCCCGTTTGGCCCAGAGGGGAGACCCGCGAA AGAGAACCTGCCAACGGCGCCG ETN*AGYLTCTVLLFIMLFLYSHSCRCSKIKKGLQVTV*MARYVMY*YYF IKL*FYLRYYTYLPVRLAWECMAWKGESKFAPLSFWLFK*NDLFK*HCIL *LFLSNVGPCTCNIWTRDMPTTHSSG*VVFV*LILLLGHGLLVLEDKVWL RHRRLLTPSFHFEVLKPYVKTMNESAHVMVVS*FC*AISFITIKVYKMPL HVKRPQYEYLFKNQMSVQV*MNERNVLYFVS*VV*VYSCFNFLFTCGN*C SIISI**YLQTDNIGVYPTT*DGLLPGTG*QTSPLSAGENSSQPRIGNPG QGYNQPIRAPESQGGEPAERKAPPVWPRGETREREPANGAX RD*LSRLPYMYSLIIYNVIFIFTQLQMFQN*KGLTSYCLNG*VCNVLVLL Y*TLILFTLLHVFTCKTSMGMHGMEGGK*ICSFVILVV*IERLVQVALHT LIIFKQRRALYLQHLD*RHAHYPQFWLGCFCLVNFVVRTWTVGFGGQGLV ASSKVAHSIISF*SS*TLRKNYE*KCSCYGGKLVLLSYKFYYNKGL*NAS SCKKTPV*VFV*KSNVSSSINE*KKCTLFCLLGSISILML*FFIYMWKLM LHNFYIIIFTN**YWCVSNDLGWFTPGNWLANLTIKCR*KFFAA*NWKPW ARL*PADKSARVTRGGTSREEGSPRLAQRGDPRKRTCQRRX RLIEPVTLHVQSYYL*CYFYIHTAADVPKLKRAYKLLFEWLGM*CISITL LNFNFIYAITRIYL*D*HGNAWHGRGKVNLLLCHFGCLNRTTCSSSIAYF DYF*AT*GLVPATFGLETCPLPTVLVRLFLFS*FCC*DMDCWFWRTRFGC VIEGCSLHHFILKFLNLT*KL*MKVLMLWW*ASFVEL*VLLQ*RFIKCLF M*KDPSMSICLKIKCQFKYK*MKEMYFILSLR*YKYTHALIFYLHVEINA P*FLYNNIYKLIILVCIQRLRMVYSRELASKPHH*VQVKILRSLELETLG KAITSR*ERQSHKGGNQPRGRLPPFGPEGRPAKENLPTAP >LQW156737.y1 GATAGATCAATCGAGCTCGGTACCCGGCTAGGCTTAACGGGTACATGTGT ATGAAACAGTTCTTTGGGTTATAACGACTGTTGTACATTATTCATTTAAG CAGCATTAAAGTAGCAGATACACTTCTGACACCAGGATTGGCCGATTACC CCTGGCCAGCCTGGGGAATTATATAGGGACTTGAATACTTGATGTACAGA TATTTAAAGTTTAATATTTAAATGAACTTCACAGGAATTTATCCCAGAGA GATTTAAACCAGAAAATATGAAGGGAAGGTCACCTCATGCATACCTACCT TTTTCTGCAGGTCCAAGGTAAAACATTGGATGATGTTTTATTAAATAAAT GCACAAAGATTACAGGCTTGATGCTGCTACCATAATGTTACAAAGTTACA TATGTGATATATTGTAAGCAGGCACAGGGTTTATGAAACAGAACACACAT GTTATAACGACTGTCATTGCTCTGCCTTAACATTCAATTTCCTAAAGATT GAAACATATCACACTTACCCTAACCGCAGAAACTGCATCGGGCAAAACTT TGCGATGAACGAAATGAAGATTGCAATCGGACAAACCCTTCGTAGATTCA AGGTGATCCCGGATGAATCATCCCCGAAACCTTCCATTACACCTCAGGTG GTTCTTCGGCCAAAAGATGGAATCTTCATAAAATTAATGAAGATCTAAAC GGATTAGCATATAGAGAATACATAGAAAATTATTTATTGGGAGAGAAATT GTGCTATGATAATTTCGCTTATTCAGTATTCTATTCCTTGCAATCAAATA AGGGTATCTTTTAAACCACTTGCATAAAGATTTCTTTACAATTTAGCCAC TTATACATTTTCATATTGACTGGT >gi|19458956|dbj|AV969192.1|AV969192 AV969192 Nori Satoh unpublished cDNA library, larva Ciona intestinalis cDNA clone cilv18c11 5'. Length = 627 Score = 101 bits (251), Expect = 2e-22 Identities = 46/55 (83%), Positives = 47/55 (84%) Frame = +3 Query: 2 GKGLSDSEIRAEVDTFMFEGHDTTASGISWTFYCLAMHPEHQEKCFQEIEKVMAD 56 G+G EVDTFMFEGHDTTASGISWTFYCLAMHPEHQEKCFQEIEKVMAD Sbjct: 432 GRGCQILRFGPEVDTFMFEGHDTTASGISWTFYCLAMHPEHQEKCFQEIEKVMAD 596 >sequence 228, 143 LQW45332.y1 DEV18086.y1 LQW265376.y2 LQW240800.y1 >GCiWno512_p10.g1 CHROMAT_FILE: GCiWno512_p10.g1 PHD_FILE: GCiWno512_p10.g1.phd.1 CHEM: term DYE: big TIME: Wed Oct 17 10:41:09 2001 TEMPLATE: GCiWno512_p10 DIRECTION: rev Length = 877 Score = 85.8 bits (209), Expect = 4e-17 Identities = 39/59 (66%), Positives = 49/59 (82%) Frame = -3 Query: 1 LRICVGMNVAKQELFLFFVAMFQKFSMNVPDGKDYIDDAPLHGVTLAPKPFSVRIKRRA 59 LRICVGMN+AKQELFLFFVA+ QKF++ +PD +DD P+ G+TLAPKPF V+IK R+ Sbjct: 233 LRICVGMNIAKQELFLFFVAILQKFTLQLPDDVKSLDDEPIPGMTLAPKPFRVKIKIRS 57 >GCiWno512_p10.b1 CHROMAT_FILE: GCiWno512_p10.b1 PHD_FILE: GCiWno512_p10.b1.phd.1 CHEM: term DYE: big TIME: Wed Oct 17 10:41:08 2001 TEMPLATE: GCiWno512_p10 DIRECTION: fwd Length = 877 Score = 76.5 bits (185), Expect = 2e-13 Identities = 37/59 (62%), Positives = 46/59 (77%) Frame = +1 Query: 1 KINKFVKAEIEQHRQNFDRKNPRDYIDCYLKELDQMNDQSELSKLWALQKGGEQGAPFT 59 KI+KFVKAEI+ HRQN D +NPRDYIDCYL EL+Q +DQSELS+L G+ +P+T Sbjct: 205 KIHKFVKAEIKHHRQNLDPQNPRDYIDCYLNELNQTSDQSELSEL------GKCNSPYT 363 >GCiWno512_p10.g1_4 LDIYVKVYILTPQYL*VAPCSEEDQ KLGGYHIPKHTCIMPSYHTIHFDPKFWKNPNEFDP CNFLDPDGKVGTRDAFMPFGGG I*MLLDLSSLGRKTTVVITRVFCFIHVVPAYELPRM*L CGGLFFSCSLC*QFGKPISDHC*SD*Q*MSCPRI**HIEVTFVWLIVLYFFYIYIVRSKN AVLLEVLHDTNTKQL*EIFVCRFAEVNLLQLCFRTSNLRWNEYSQTRTLPLLRGNPSKIY PATSG*CEKS***TDTGNDFSAQTISCENQNSILNSLDITKTYVST*EQVLS >GCiWno512_p10.g1_5 IGYIRKGLHSNPTVFIGCSMLRGRPKVRRIPHPETYMYHAILPYYTFRPEVLEKSE*V*S MQLSRSRWEGWHS*CIYAIWRRYMNVTGFILAWPENDSCYNTGVLFHTRRASLRVTTYVT LWGIVFFM*PMLTIWKTY**PLLKRLTMNVLPKDLITHRSDVRLAYCSIFLLHIHCPIKE CCSARSPT*Y*Y*TIIRNFCLPICGG*FIATLFQDFESALE*I*PNKNSSSSSWQSFKNL PCNFRMM*KVLMMNRYRE*L*RPNHFV*KSKFDPKFT*HNQNLRVNVGTGSIX >GCiWno512_p10.g1_6 WIYT*RSTF*PHSIYRLLHAQRKTKS*EDTTSRNIHVSCHLTILYISTRSSGKIRMSLIH ATF*IPMGRLALVMHLCHLAEVYECYWIYPRLAGKRQLL*HGCSVSYTSCQLTSYHVCNF VGDCFFHVAYVDNLENLLVTTVKAIDNECLAQGSNNT*K*RSFGLLFYISFTYTLSDQRM LFC*KSYMILILNNYKKFLFADLRRLIYCNFVSGLRICVGMNIAKQELFLFFVAILQKFT LQLPDDVKSLDDEPIPGMTLAPKPFRVKIKIRS*IHLT*PKPTCQRRNRFYX >DEV18086.y1 >lcl|DEV18086.y1 CHROMAT_FILE: DEV18086.y1 PHD_FILE: DEV18086.y1.phd.1 CHEM: term DYE: ET TIME: Wed Mar 21 15:41:56 2001 TEMPLATE: DEV18086 DIRECTION: rev CAACACGTCTGAATAGAACACTGTTCCATACGTTGACACGTAGGTTTTGGTTATGTCAAGTGAATTTAGGATCGAATTTT GATTTTCACACGAAATGGTTTGGGCGCTAAAGTCATTCCCGGTATCGGTTCATCATCAAGACTTTTCACATCATCCGGAA GTTGCAGGGTAAACTTTTGAAGGATTGCCACGAAAAAGAGAAAGAGTTCTTGTTTGGCTATATTCATTCCAACGCAGATT CGAAGTCCTGAAACAAAGTTGCAATAAATTAAACTCCGCAAATCGGCAAACAAAAATTTCTTATAATTGTTTAGTATTAG TATCATGTAGGACTTCTAGCAGAACGGCATTCTTTGATCCGACAATGTATATGTAAAAGAAATATAGAACAATAAGCCAA ACGAACGTCACTTCTATGTGTTATTAGATCCTTGGGCAAGACATTCATTGTCAATCGCTTTAACAGTGGTCACTAATAGG TTTTCCAAATTGTCAACATAGGCTACATGAAAAAAACAATCCCTCACAAAGTTACATAAGTGGTAACTCGTAAGCTTGTA CGAGGTGTATGAAACAGAACACCCGTGTTATAACAACTGTCGTTTTCCGGTCAAGCGAGGATAAATCCAATAACATTCAT ATACCTCCGCCAAATGGCATCAATGCATCACGAATGCCAACCTTCCCATTGGGATCTAGAAAGTTGCATGGATCAAACTC ATTCGGATTTTCCAG >_4 LENPNEFDPCNFLDPNGKVGIRDALMPFGGGI*MLLDLSSLDRKTTVVITRVFCFIHLVQ AYELPLM*LCEGLFFSCSLC*QFGKPISDHC*SD*Q*MSCPRI**HIEVTFVWLIVLYFF YIYIVGSKNAVLLEVLHDTNTKQL*EIFVCRFAEFNLLQLCFRTSNLRWNEYSQTRTLSL FRGNPSKVYPATSG*CEKS***TDTGNDFSAQTISCENQNSILNSLDITKTYVSTYGTVF YSDVL >_5 GKSE*V*SMQLSRSQWEGWHS*CIDAIWRRYMNVIGFILA*PENDSCYNTGVLFHTPRTS LRVTTYVTL*GIVFFM*PMLTIWKTY**PLLKRLTMNVLPKDLITHRSDVRLAYCSIFLL HIHCRIKECRSARSPT*Y*Y*TIIRNFCLPICGV*FIATLFQDFESALE*I*PNKNSFSF SWQSFKSLPCNFRMM*KVLMMNRYRE*L*RPNHFV*KSKFDPKFT*HNQNLRVNVWNSVL FRRVX >_6 WKIRMSLIHATF*IPMGRLAFVMH*CHLAEVYECYWIYPRLTGKRQLL*HGCSVSYTSYK LTSYHLCNFVRDCFFHVAYVDNLENLLVTTVKAIDNECLAQGSNNT*K*RSFGLLFYISF TYTLSDQRMPFC*KSYMILILNNYKKFLFADLRSLIYCNFVSGLRICVGMNIAKQELFLF FVAILQKFTLQLPDDVKSLDDEPIPGMTLAPKPFRVKIKIRS*IHLT*PKPTCQRMEQCS IQTCX >DEV7930.y1 >lcl|DEV7930.y1 CHROMAT_FILE: DEV7930.y1 PHD_FILE: DEV7930.y1.phd.1 CHEM: term DYE: ET TIME: Fri May 4 11:19:36 2001 TEMPLATE: DEV7930 DIRECTION: rev TCTTATAATTGTTTAGTATTAGTATCATGTAGGACTTCTAGCAGAACGGCATTCTTTGATCCGACAATGTATATGTAAAA GAAATATAGAACAATAAGCCAAACGAACGTCACTTCTATGTGTTATTAGATCCTTGGGCAAGACATTCATTGTCAATCGC TTTAACAGTGGTCACTAATAGGTTTTCCAAATTGTCAACATAGGCTACATGAAAAAAACAATCCCTCACAAAGTNCATAA GTGGTAACTCGTAAGCTTGTACGAGGTGTATGAAACAGAACACCCGTGTTATAACAACTGTCGTTTTCCGGTCAAGCGAG GATAAATCCAATAACATTCATATACCTCCGCCAAATGGCATCAATGCATCACGAATGCCAACCTTCCCATTGGGATCTAG AAAGTTGCATGGATCAAACTCATTCGGATTTTTCCAGAACTTGGGGTCGAAATGTATAGTATGGTAAGATGGCATGATAC ATGTATGTTTCGGGATGTGGTATCCTCTTAACTTTTGGTCTTCCTCTGAGCAATGG >SEQUENCE 224 89% to seq 17 opp end = seq 228 GIAVAPYGPKWMANRKFFYSAMRTMGLGKRGIEKCVIDEVPYIVEELEKLCSSD 422 ELFEPSSVFDPAVLNVLAYFTFGNR (2?) YSYQDEKFKELIHINNEFFQKAKFLNQPEFFLVTLIPGLHKYWLPQCGKDLKESVG (1?) KIHKFVKAEIKHHRQHLDPQNPRDYIDCYLNELNRTSDQSELS (?) DEV6147.y1 C-HELIX blast of DEV7930.y1 opp end of QSELS exon 4 diffs with seq 228 >SEQUENCE 228, 143 Length = 245 Minus Strand HSPs: Score = 361 (127.1 bits), Expect = 8.4e-36, P = 8.4e-36 Identities = 60/65 (92%), Positives = 62/65 (95%), Frame = -2 Query: 535 HCSEEDQKLRGYHIPKHTCIMPSYHTIHFDPKFWKNPNEFDPCNFLDPNGKVGIRDALMP 356 HCSEEDQKL GYHIPKHTCIMPSYHTIHFDPKFWKNPNEFDPCNFLDP+GKVG RDA MP Sbjct: 123 HCSEEDQKLGGYHIPKHTCIMPSYHTIHFDPKFWKNPNEFDPCNFLDPDGKVGTRDAFMP 182 Query: 355 FGGGI 341 FGGG+ Sbjct: 183 FGGGL 187 >DEV6147.y1 >lcl|DEV6147.y1 CHROMAT_FILE: DEV6147.y1 PHD_FILE: DEV6147.y1.phd.1 CHEM: term DYE: ET TIME: Wed Mar 21 15:34:53 2001 TEMPLATE: DEV6147 DIRECTION: rev CTCGGTACCAGTACAGTAAGATCTGGTGGGTCAGAAATTTTGTTTTTGAAAGAATCATTATTGATGTGAATGAGTCTTTA AACTTTTCGTCTTGATAAGAATATCTAAAAATGTTAAACGTTTTTTTATCGAATAATTAAATGAATTAATGAATGAATGT AACTTTCTTTATCCAGTCGTTATAACACTGGTTCTGTTTCACCAATGCCAGCTTGCGAGTTACCACGAATGTAACTTCGT AAATTGTTTTGTTGATTTATTTTTATATTTTGTTTCACCTATGGCTGACAACTTGGACAGCCCATTAGAAACCATTTATT TTTAACTGTTAAAACTAATATTCTTACCGATTCCCAAACGTGAAATAAGCAAGCACGTTTAGTACAGCAGGGTCGAATAC GCTCGATGGTTCGAACAACTCGTCACTAGAGCAAAGTTTTTCAAGTTCTTCCACAATGTAGGGAACTTCATCAATCACGC ACTTTTCTATTCCACGTTTTCCCAACCCCATGGTCCGCATAGCAGAGTAGAAAAACTTCCGATTTGCCATCCATTTAGGT CCATACGGTGCAACCGCGATACCTTGATATAAAATGTCGGAATAAAACAAACTT >DEV6147.y1_4 VCFIPTFYIKVSRLHRMDLNGWQIGSFSTLLCGPWGWENVE*KSA*LMKFPTLWKNLKNF ALVTSCSNHRAYSTLLY*TCLLISRLGIGKNISFNS*K*MVSNGLSKLSAIGETKYKNKS TKQFTKLHSW*LASWHW*NRTSVITTG*RKLHSFINSFNYSIKKRLTFLDILIKTKSLKT HSHQ**FFQKQNF*PTRSYCTGTE >DEV6147.y1_5 SLFYSDILYQGIAVAPYGPKWMANRKFFYSAMRTMGLGKRGIEKCVIDEVPYIVEELEKL CSSDELFEPSSVFDPAVLNVLAYFTFGNR*EY*F*QLKINGF*WAVQVVSHR*NKI*K*I NKTIYEVTFVVTRKLALVKQNQCYNDWIKKVTFIH*FI*LFDKKTFNIFRYSYQDEKFKD SFTSIMILSKTKFLTHQILLYWYRX >DEV6147.y1_6 KFVLFRHFISRYRGCTVWT*MDGKSEVFLLCYADHGVGKTWNRKVRD**SSLHCGRT*KT LL**RVVRTIERIRPCCTKRACLFHVWESVRILVLTVKNKWFLMGCPSCQP*VKQNIKIN QQNNLRSYIRGNSQAGIGETEPVL*RLDKESYIHSLIHLIIR*KNV*HF*IFLSRRKV*R LIHINNDSFKNKISDPPDLTVLVPX >LQW103752.y1 trhis looks like seq 17 not 228 >lcl|LQW103752.y1 CHROMAT_FILE: LQW103752.y1 PHD_FILE: LQW103752.y1.phd.1 CHEM: term DYE: ET TIME: Fri May 4 11:01:09 2001 TEMPLATE: LQW103752 DIRECTION: rev TTTCATTTATTCTTACAGGTTATCACTGACAGAGCAAAAGATTTGCATCAAGATGTCCCAACATGCCAGGAAGAATTGTC CGTGGAGAAGGTTTAGATGGTGAATGGTTATGTTAATATGTAAAAGGTTATGTATATATGTGTTTATTTATAATATACAT GAAACATACCTGTTTTAGGTATGCAAAGTAACAGCAATTGTATTCTACCTTATAAATTTATTAAGTTATATACTTTTTGA TAAAATTTTGTTTACATATGATATACATATATATACACAATGCACGATTGTGATAGCCTAACAAACTATTTGTATTACTT TAAACAAGATGGAACAGTTTTGGTGATACAGGCACTAAAATATAGAAAAGCTTGAAACTAAAGCAGCTGTGAACCTTTTC TTAAGTAAAAGCATGATTTAAAGTTATATTACCCATTGCGCTGCATTTGCTAAGCTACGGTAATCTCTGAAAGTGCTTAT AATTTTGACAAACAGCCTGTGTAAATTTTTCAGCTTGATTTTCTTTTTTTTCAGAATTTAAATAATCTTCGCTGTCATGT AAAAAAAATTATAAAAAATTATGTCGGGTAGGCCTATGTAAAATTTTTGTTAATGGCCAACAATTTTTAAGCTAATTGTG GTATATTCATCAGGCATTGCTGCAGCCCCATATGGTCCCAAATGGATGGCAAATCGTAAGTTCTTTTACTCTGCCATGC >LQW103752.y1_1 FHLFLQVITDRAKDLHQDVPTCQEELSVEKV*MVNGYVNM*KVMYICVYL*YT*NIPVLG MQSNSNCILPYKFIKLYTF**NFVYI*YTYIYTMHDCDSLTNYLYYFKQDGTVLVIQALK YRKA*N*SSCEPFLK*KHDLKLYYPLRCIC*ATVISESAYNFDKQPV*IFQLDFLFFQNL NNLRCHVKKIIKNYVG*AYVKFLLMANNF*ANCGIFIRHCCSPIWSQMDGKS*VLLLCHA >LQW103752.y1_2 FIYSYRLSLTEQKICIKMSQHARKNCPWRRFRW*MVMLICKRLCIYVFIYNIHETYLF*V CKVTAIVFYLINLLSYILFDKILFTYDIHIYTQCTIVIA*QTICITLNKMEQFW*YRH*N IEKLETKAAVNLFLSKSMI*SYITHCAAFAKLR*SLKVLIILTNSLCKFFSLIFFFFRI* IIFAVM*KKL*KIMSGRPM*NFC*WPTIFKLIVVYSSGIAAAPYGPKWMANRKFFYSAMX >LQW103752.y1_3 SFILTGYH*QSKRFASRCPNMPGRIVRGEGLDGEWLC*YVKGYVYMCLFIIYMKHTCFRY AK*QQLYSTL*IY*VIYFLIKFCLHMIYIYIHNARL**PNKLFVLL*TRWNSFGDTGTKI *KSLKLKQL*TFS*VKA*FKVILPIALHLLSYGNL*KCL*F*QTACVNFSA*FSFFSEFK *SSLSCKKNYKKLCRVGLCKIFVNGQQFLS*LWYIHQALLQPHMVPNGWQIVSSFTLPC >sequence 229 very similar to 228 84 and 111 SLHLPDGVDHLDEESGSGITLAPKIYQVKIKRRA LQW143057.x1 >SEQUENCE 222 627 PPGPAGLPLIGSLHLAAPEFHISIL (?) KL 451 450 AKKYGPIFTIKAGCRRVVFLVGYDVIKE 367 LQW130468.y01 LQW130468.y1 N-TERM >ciad099g22 Length = 664 Score = 54.3 bits (128), Expect = 9e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +1 Query: 1 PPGPAGLPLIGSLHLAAPEFHISIL 25 PPGPAGLPLIGSLHL APEFHISIL Sbjct: 28 PPGPAGLPLIGSLHLVAPEFHISIL 102 >ciad099g22 Length = 664 Score = 62.5 bits (149), Expect = 3e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 111 KFPKLARKYGPIFTITAGYRRVVFLVGYDLIKE 143 + PKLA+KYGPIFTI AGYRRVVFLVGYD+IKE Sbjct: 190 ELPKLAKKYGPIFTIKAGYRRVVFLVGYDVIKE 288 ciad099g22_1 84% to seq 17 IALFNPWRYPPGPAGLPLIGSLHLVAPEFHISIL (?) IKFPFPFTPFLFSAFLKKQITGLF (?) NICFSELPKLAKKYGPIFTIKAGYRRVVFLVGYDVIKE (?) VITDRAKDFASRCPTIVARIVRGE GLDGIAASPYGPKWMANRKFFYSAMRTMGLGKRGIEKCVVDEIPYIVGELENICSNDGLF EPSSVFDSAVLNVLAYFTFGNRYSYQDEKFKELIHINNDFFX >rcieg059j02 Length = 708 Score = 50.0 bits (117), Expect = 2e-05 Identities = 21/25 (84%), Positives = 24/25 (96%) Frame = -3 Query: 1 PPGPAGLPLIGSLHLAAPEFHISIL 25 PPGPAG+P+IGSLHLAAP+FH SIL Sbjct: 127 PPGPAGIPVIGSLHLAAPDFHRSIL 53 MIFEIVITILAAVLLHWLVNFLFNPWRYPPGPAGIPVIGSLHLAAPDFHRSIL (?) IGFQISFAISVAFLQKQINRLV (?) >GCiWno730_l23.b1 CHROMAT_FILE: GCiWno730_l23.b1 PHD_FILE: GCiWno730_l23.b1.phd.1 CHEM: term DYE: big TIME: Wed Nov 28 12:57:17 2001 TEMPLATE: GCiWno730_l23 DIRECTION: fwd Length = 946 Score = 146 bits (364), Expect = 1e-34 Identities = 70/70 (100%), Positives = 70/70 (100%) Frame = +1 Query: 1 MIFEIVITILAAVLLHWLVNFLFNPWRYPPGPAGIPVIGSLHLAAPDFHRSILIGFQISF 60 MIFEIVITILAAVLLHWLVNFLFNPWRYPPGPAGIPVIGSLHLAAPDFHRSILIGFQISF Sbjct: 76 MIFEIVITILAAVLLHWLVNFLFNPWRYPPGPAGIPVIGSLHLAAPDFHRSILIGFQISF 255 Query: 61 AISVAFLQKQ 70 AISVAFLQKQ Sbjct: 256 AISVAFLQKQ 285 >GCiWno730_l23.b1 TTGATTTGAAAGATCTTTTCAACCAAACTTTTAACTCCTGTGATTTAATAGGAGATACCAAGTTAGGTTGGGGTGATGAT CTTTGAAATAGTAATCACCATTTTGGCGGCAGTGCTCTTGCACTGGCTCGTTAACTTTCTGTTCAATCCATGGCGTTATC CGCCAGGTCCGGCGGGGATTCCCGTGATCGGAAGTCTCCACTTGGCGGCACCAGACTTCCACAGAAGTATATTAATAGGA TTTCAAATCTCTTTTGCTATTTCTGTCGCCTTTCTTCAAAAACAAATAAATCGGCTCGTTTACGATAGGGCAGAAGAAAA TAGATAAAAGAGAATACCGTCGGGGTAGCTTGTCCCGATTAAACCCAAGAATAAGCTTTTTTAAGTTTCAAAATCGTAAA ATTTCACTTAAATGACCCCGAAATATTTCTAGACTTTCTGCTCCGCCTGCCATTGTTTGTAAAAGCCCTGTAAGTTTGGA TGTCGTGTGAAAGGTTAAAGTAAGCGTTGCTACCTATAGAATTANATCGTCCTGTAGCTAGCGGAACGCTGGTCGGATTG GTACACACGTTCCTAAACGGCGGTTTGTTAGGTTGCAATTTCGACCCTTTGCCGCCCNAATTTGGCTAANGCGGTGCTGC ATCGTTCTCGGTAGGAGATGATACTGTGGNGTAAGATAAGATACCCGTTAGCACCAAGCTAAAATCACTTTTCCTTATCG AATTTTAACCGACACCACCGAATGCTTTTTTGAAAAATATAGTAAAATGAGGGTAGATGGGACCCCTTGGCAATCCGTTT TCCGCCCATTGGGGAGTAAACATTAAGAACCTTTAAGGGATTTAAACCGTAACCCCCCCTTCCCAAAAACGGTGGTAATT GGTAGAACAACCTCCAAAATTTCCAATAATGGGTTAAAGGGGCACGGCCCCCCTCACCTAAAAAAT >GCiWno730_l23.b1_1 LI*KIFSTKLLTPVI**EIPS*VGVMIFEIVITILAAVLLHWLVNFLFNPWRYPPGPAGI PVIGSLHLAAPDFHRSILIGFQISFAISVAFLQKQINRLVYDRAEENR*KRIPSG*LVPI KPKNKLF*VSKS*NFT*MTPKYF*TFCSACHCL*KPCKFGCRVKG*SKRCYL*NXIVL*L AERWSDWYTRS*TAVC*VAISTLCRPNLAXAVLHRSR*EMILWXKIRYPLAPS*NHFSLS NFNRHHRMLF*KI**NEGRWDPLAIRFPPIGE*TLRTFKGFKP*PPLPKNGGNW*NNLQN FQ*WVKGARPPSPKKX >GCiWno730_l23.b1_2 *FERSFQPNF*LL*FNRRYQVRLG**SLK**SPFWRQCSCTGSLTFCSIHGVIRQVRRGF P*SEVSTWRHQTSTEVY**DFKSLLLFLSPFFKNK*IGSFTIGQKKIDKREYRRGSLSRL NPRISFFKFQNRKISLK*PRNISRLSAPPAIVCKSPVSLDVV*KVKVSVATYRIXSSCS* RNAGRIGTHVPKRRFVRLQFRPFAAXIWLXRCCIVLGRR*YCGVR*DTR*HQAKITFPYR ILTDTTECFFEKYSKMRVDGTPWQSVFRPLGSKH*EPLRDLNRNPPFPKTVVIGRTTSKI SNNGLKGHGPPHLKN >GCiWno730_l23.b1_3 DLKDLFNQTFNSCDLIGDTKLGWGDDL*NSNHHFGGSALALAR*LSVQSMALSARSGGDS RDRKSPLGGTRLPQKYINRISNLFCYFCRLSSKTNKSARLR*GRRK*IKENTVGVACPD* TQE*AFLSFKIVKFHLNDPEIFLDFLLRLPLFVKAL*VWMSCERLK*ALLPIELXRPVAS GTLVGLVHTFLNGGLLGCNFDPLPPXFG*XGAASFSVGDDTVX*DKIPVSTKLKSLFLIE F*PTPPNAFLKNIVK*G*MGPLGNPFSAHWGVNIKNL*GI*TVTPPSQKRW*LVEQPPKF PIMG*RGTAPLT*K >GCiWno730_l23.g1 TCGAGCTCGGACCCTAATGGACTATATATCAGAAGGTTTTATAGGCTACATACAATATATTTAGTCTAAGATAAGATGTG ACATTTTCTTTCATTATTTAAATTCTACCTGATTTGTTAGTAAACAAAGAATATTTACAGAGTTGAATAACCGTAGGCTA TTTAAAGAAGCGTTGTTGATATTTCAAAACAGGACCAGAAAGTAAATTACATTTGTTGCTAAAAGTATCATATATATCTT ACTGTATATTTGATTATACATAAAGCAGCAATAATAAATATTGAATTATGTTCTCCACGCAATAACACAAAGTTAACGTA AATTTCCACGATATAGTATTATCGTTGACATTTTAAATATCGCCGGTTCTTCTATTGCATATATATATATATATATATAT AAACCTAATTATAAAGTGGCGAAAAAAATGTGTGTATATAAAATATGGTTTTTATAGCATAGAGTTGGATAAGATAGCTT ACTCGTTTAAAATCTTTTTTACGGGTGGCTTTTTGAAGGTAAACACAAAAATCTAAATTATTTTCGACAGTATTCCTACG GCCCTATCCAAACGCGTGGGTCTGTTTTACAGGTATTAGCTTTCAATTTTGTTAGGTGTTTTTGTGAGATATTTATTTAT ATCTTTAATTCTATAAATGCAGTGTGATTCTAATATAGTGCAGTAATACATTAACATTATAATGTATGAATAATGCATTA AAATTCAGATACACGCACTTGGAGAAGAATGGTGANCAGTGCCTTATATGCCANATACAGTTTACTAATACATGTAACTA ACTTGTTTTATCCTCTTGTGACGGGGCAACGACGATCGTTTACAACACCGGTTGGTGTGTGTCGTACACCTCGTTTAAGC TTACGCGTGTATTATATGAACGAG >SEQUENCE 17, 111 PKG TO HEME 50% TO 2C8 differs from seq 84 first intron is over 3000 bp MIFEIVITILAAVLLHWLVNFLFNPWRYPPGPAGIPVIGSL HLAAPDFHRSILIGFQISFAISVAFLQKQINRLR (1) cgt NIVFSELPKLARKYGPIFTITAGYRRVVFLVGYDLIKE (?) VITDRAKDFASRCPNMPGRIVRGEG LDGIAAAPYGPKWMANRKFFYSAMRTMGLGKRGIEKCVVDEIPYIVEELEKLCTKNELFE PSSVFDSAVLNVLAYFTFGN (?) RYSYQDEKFKELIHINNDFFQKAKFLNQPLFFLLSLVPGLHKYWLPQCGKDLKESVG (?) KINKFVKAEIEQHRQNFDRKNPRDYIDCYLKELDQMNDQSELS (?) DLFQAGTETTSTTLRWAILYMVNNPNIQSKII (?) = seq 17 VQQEIDDVLGFDRLPQYEDRMRMPYCEATVLEVQRMATIAPIGL (?) MLGGYRIPKRTSIMACYHSIHFDPKFWKNPNEFDPCNFLDSNKKVCIPDAFMPFGGG (?) LRICVGMNIAKQELFLFFVAILQKFSLHLPDGVDHLDEESGSGITLAPKIYQVKIKRRA* LQW149317.x1 PKG TO HEME LQW207002.x1 LQW86359.y1 PKG TO HEME LQW222722.x1 PERF LQW59506.x1 cign080d21 LQW177629.y1 = seq 84 rcits048p05 extreme C-term cits048p05_1 IKFPFPFTPFLFSAFLKKQITGLF (?) >GCiWno508_p04.b1_1 CLFIIS*CFMILQF*CRTFKMCLLLVCLIFSGLY*FFQSAFF*KCFV*KI**AYVRMQL* CMYQQVKMHEKNQ*GNEGIMHVRIYLSILFDLKDLFNQTFNSCDLIGDTKLGWGDDL*NS NHHFGGSALALAR*LSVQSMALSARSGGDSRDRKSPLGGTRLPQKYINRISNLFCYFCRL SSKTNKSASFTIGQKKIDKREYRRGSLSRLNPRISFFKFQNRKISLK*PRNISRLSAPPA IVCKSPCSXDVV*KVK*ALLPIELNRPVPSGTLGR*YTRSKRRVXRVHFDLCRHFA*ACC IVSVEIYCWV >GCiWno508_p04.b1_2 AFL*LVNAL*FYNFSVELLRCVYCWCV*FFQGCINFFNPHSFRNVLCKRFSRPMSGCSFN VCISKLKCMKKISKAMRALCMCAFISLFSLI*KIFSTKLLTPVI**EIPS*VGVMIFEIV ITILAAVLLHWLVNFLFNPWRYPPGPAGIPVIGSLHLAAPDFHRSILIGFQISFAISVAF LQKQINRLRLR*GRRK*IKENTVGVACPD*TQE*AFLSFKIVKFHLNDPEIFLDFLLRLP LFVKAPVVWMSCER*SKRCYL*N*IVLYLAERWVDSTHVLNGGLXGCISTFAAILLKRAA SSR*KYTVGX >GCiWno508_p04.b1_3 PFYN*LMLYDFTILV*NF*DVFTVGVSDFFRVVLIFSIRILLEMFCVKDLVGLCQDAALM YVSAS*NA*KKSVRQ*GHYACAHLSLYSL*FERSFQPNF*LL*FNRRYQVRLG**SLK** SPFWRQCSCTGSLTFCSIHGVIRQVRRGFP*SEVSTWRHQTSTEVY**DFKSLLLFLSPF FKNK*IGFVYDRAEENR*KRIPSG*LVPIKPKNKLF*VSKS*NFT*MTPKYF*TFCSACH CL*KPL*XGCRVKGKVSVATYRIKSSCT*RNAGSIVHTF*TAGX*GAFRPLPPFCLSVLH RLGRNILLG >GCiWno508_p04.b1 TGCCTTTTTATAATTAGTTAATGCTTTATGATTTTACAATTTTAGTGTAGAACTTTTAAGATGTGTTTACTGTTGGTGTG TCTGATTTTTTCAGGGTTGTATTAATTTTTTCAATCCGCATTCTTTTAGAAATGTTTTGTGTAAAAGATTTAGTAGGCCT ATGTCAGGATGCAGCTTTAATGTATGTATCAGCAAGTTAAAATGCATGAAAAAAATCAGTAAGGCAATGAGGGCATTATG CATGTGCGCATTTATCTCTCTATTCTCTTTGATTTGAAAGATCTTTTCAACCAAACTTTTAACTCCTGTGATTTAATAGG AGATACCAAGTTAGGTTGGGGTGATGATCTTTGAAATAGTAATCACCATTTTGGCGGCAGTGCTCTTGCACTGGCTCGTT AACTTTCTGTTCAATCCATGGCGTTATCCGCCAGGTCCGGCGGGGATTCCCGTGATCGGAAGTCTCCACTTGGCGGCACC AGACTTCCACAGAAGTATATTAATAGGATTTCAAATCTCTTTTGCTATTTCTGTCGCCTTTCTTCAAAAACAAATAAATC GGCTTCGTTTACGATAGGGCAGAAGAAAATAGATAAAAGAGAATACCGTCGGGGTAGCTTGTCCCGATTAAACCCAAGAA TAAGCTTTTTTAAGTTTCAAAATCGTAAAATTTCACTTAAATGACCCCGAAATATTTCTAGACTTTCTGCTCCGCCTGCC ATTGTTTGTAAAAGCCCCTGTAGTNTGGATGTCGTGTGAAAGGTAAAGTAAGCGTTGCTACCTATAGAATTAAATCGTCC TGTACCTAGCGGAACGCTGGGTCGATAGTACACACGTTCTAAACGGCGGGTTGNTAGGGTGCATTTCGACCTTTGCCGCC ATTTTGCTTAAGCGTGCTGCATCGTCTCGGTAGAAATATACTGTTGGGT >GCiWno459_d01.g1_1 TEVY**DFKSLLLFMSPFFKNNKSARLR*GRRK*IKENTVGVACPD*TQE*AFFKFQNRK ISLK*SRNISRLSAPPAIVCKSPVSLGVV*KVKVSVAT*N*IVL*LAERWSDWYTRS*TA VC*VAISTFCRPILAKAVLHRSR*EMILWGKIGYR*HQARSTFLYRILNEYHECFFKKYS RMRVDGTPCHYVYRPIW*LTIREPLKNYKTVASRFQ*TGFNC*KHPQHISILCVKGVTSL LYLTGXXIX*LIFFVYHQIGLNRXXVYHITPPXVLNSYPXRIMRTPSHCARX >GCiWno459_d01.g1_2 QKYINRISNLFCYLCRLSSKTINRLVYDRAEENR*KRIPSG*LVPIKPKNKLFLSFKIVK FHLNDPEIFLDFLLRLPLFVKAL*VWVSCERLK*ALLPRIKSSCS*RNAGRIGTHVPKRR FVRLQFRPFAAQFWLRRCCIVLGRR*YCGVR*DTVSTKLDPLFFIVF*TNTTNAFLKNIV E*G*MGHLVIMFIVPFGS*QLENL*RIIKP*PHASNRPVLIVRNTLSIFRYYVLKVSRPS STLLDX*XXS*YSLFTTK*V*TEXKCIILPHRQY*IRILXV*CERLAIVLV >GCiWno459_d01.g1_3 RSILIGFQISFAIYVAFLQKQ*IGSFTIGQKKIDKREYRRGSLSRLNPRISFF*VSKS*N FT*MIPKYF*TFCSACHCL*KPCKFGCRVKG*SKRCYLELNRPVASGTLVGLVHTFLNGG LLGCNFDLLPPNFG*GGAASFSVGDDTVG*DRIPLAPS*IHFSLSYFKRIPRMLF*KI** NEGRWDTLSLCLSSHLVVNN*RTFKEL*NRSLTLPIDRF*LLETPSAYFDIMC*RCHVPP LPYWIXNXXVNILCLPPNRFKQXXSVSYYPTXSIKFVSXPYNANA*PLCS >GCiWno800_o11.g1_1 SARTLAANFG*GGAASFSVGDDTVG*DRIPLAPS*IHFSLSYFKRIPRMLF*KI**NEGR WDTLSFCFSSHLVVNN*RTFKEL*NRSLTLPIDRC*LLETPSAYFDIMC*RCHVPPLPYW I*IKLVNILCLPPNRFKQKKSVSYYPTASIKFGILPL*CERLAIVLVLVARESHCNPWFL FSIKIWFRIILFVFV*VFKTMVYVVDKH*AF*IIWFKKLCQNYGLIWLAGSLHRHHGIII **GVGKWYRRLAHIILIVF*IFNNDLR*S*GYGLINPLIFFVYYXFR*RIV*KX >GCiWno800_o11.g1_2 QLGPLPPILAKAVLHRSR*EMILWGKIGYR*HQARSTFLYRILNEYHECFFEKYSRMRVD GTPCHSVFRPIW*LTIREPLKNYKTVASRFQ*TVVNC*KHPQHISILCVKGVTSLLYLTG YK*N*LIFFVYHQIGLNRKKVYPITPPPVLNSVSFRYNANA*PLCSCLLQGRAIATHGFY FQSKYGFESSYLFLFKSLKQWCMLLISTRLSKLYGLKSCVKTMD*FGSRVHFIGTTVSLY SRVSENGIDV*HILS*SCFEYLTTIYVSRKDTV**TR*FSLFTTXLDKE*YEK >GCiWno800_o11.g1_3 SSDPCRQFWLRRCCIVLGRR*YCGVR*DTVSTKLDPLFFIVF*TNTTNAFLKNIVE*G*M GHLVILFFVPFGS*QLENL*RIIKP*PHASNRPLLIVRNTLSIFRYYVLKVSRPSSTLLD INKIS*YSLFTTK*V*TEKKCILLPHRQY*IRYPSVIMRTPSHCARACCKGEPLQPMVFI FNQNMVSNHPICFCLSL*NNGVCC**ALGFLNYMV*KAVSKLWIDLARGFTS*APRYHYI VGCRKMV*TFSTYYPDRVLNI*QRSTLVVRIRFDKPANFLCLLPI*IKNSMK >GCiWno201_d12.b1_4 XQGRAHCNPTVFIXNQNMVSNHPIGFVKVLKTMVYVVDKHFRLSKLYGLKSCVXTMD*FG SRVHFIGTTV*LYSRVWENGIDV*HIIS*SCFEYLTTIYVSRKDTV**TANFSLFTTNLD KEIV*KCVLASSPILLYV*KWHR*AHRP*F*KSNSITVKP*F*SNITISNTSF*TH*NAR CDS*RIMRYILCQRHRGAPVSNIEGESSKLLPLRA*IYLGKLFRGPLWVDPYKSMTCTMQ HIVHIIHA*A*TRCTKHNTGVVTIVVAPSQEDKTS*LHGISKLYLAYNATGXQFMTKSGA SFYGNSYDQTWPSFYGNSYTH >GCiWno201_d12.b1_5 ARESPLQPHGFYXQSKYGFESSYWFC*SLKNNGVCC*QAL*AF*IIWFKKLCXNYGLIWL AGSLHRHHGMII**GVGKWYRRLAHNILIVF*IFNNDLR*S*GYGLINR*FFFVYYQFR* RNSMKMCPSIFPHPTICVEMAPVGTSSLILKIKLNYGKTIILK*YNDIKHIILNTLKRTM **LEDYALYSLPTTPRCACL*HRR*KLEAATIAGVNISR*IVPWSIMG*PVQKYDMYHAT HRSYNTRVSLNEVYETQHRCCNDRRCPVTRG*NKLVTWY**TVFGI*CYWSXVYDQEWRV VLRKQL*PDLAVVLRKQLYPX >GCiWno201_d12.b1_6 CKGEPIATPRFLXSIKIWFRIILLVLLKS*KQWCMLLTSTLGFLNYMV*KAVSXLWIDLA RGFTS*APRYDYIVGCGKMV*TFST*YPNRVLNI*QRSTLVVRIRFDKPLIFLCLLPI*I KK*YENVS*HLPPSYYMCRNGTGRHIVPDFKNQTQLR*NHNFKVI*RYQTHHFKHIKTHD VIVRGLCAIFFANDTAVRLSLT*KVKARSCYHCGRKYISVNCSVVHYGLTRTKV*HVPCN TSFI*YTRKLKRGVRNTTPVL*RSSLPRHKRIKQVSYMVLVNCIWHIMLLVXSL*PRVAR RFTETAMTRPGRRFTETAIPT LQW172967.x1 LQW172967.x1.phd.1 LQW172967.y1 11:22:58 2001 TEMPLATE: LQW172967 DIRECTION: fwd Length = 1011 Score = 48.0 bits (112), Expect = 1e-05 Identities = 24/26 (92%), Positives = 25/26 (95%) Frame = -2 Query: 1 IAYGYSTL*IFFVY*QIR*NLNNERK 26 IAYGYSTL*IFFVY*QIR*N NNE+K Sbjct: 323 IAYGYSTL*IFFVY*QIR*NENNEKK 246 >GCiWno201_d12.b1 CHROMAT_FILE: GCiWno201_d12.b1 PHD_FILE: GCiWno201_d12.b1.phd.1 CHEM: term DYE: big TIME: Mon Oct 1 11:05:31 2001 TEMPLATE: GCiWno201_d12 DIRECTION: fwd Length = 963 Score = 111 bits (276), Expect = 6e-25 Identities = 53/56 (94%), Positives = 53/56 (94%), Gaps = 3/56 (5%) Frame = -3 Query: 1 VQKYDMYHATHRSYNTRVSLNEVYETQHRCCNDRRCPVTRG-NKLVTWY--TVFGI 53 VQKYDMYHATHRSYNTRVSLNEVYETQHRCCNDRRCPVTRG NKLVTWY TVFGI Sbjct: 271 VQKYDMYHATHRSYNTRVSLNEVYETQHRCCNDRRCPVTRG*NKLVTWY**TVFGI 104 >LQW61196.y1_1 VQKYDMYHATHRSYNTRVSLNEVYETQHRCCNDRRCPVTRG*NKLVTWY**TVFGI*GTC HHSSPSACI*ILMHYSYIIMLMYYCTILESHCIYRIKDINNINSQKHLTKLKANTCKTDP RVWIGP*EYCRN*FRFLCLPSKSHP*KRF*KSKLSYQTLCYKNHI*YTNIFFRHFIIRYI YIYIYAIEX >LQW61196.y1_2 YKSMTCTMQHIVHIIHA*A*TRCTKHNTGVVTIVVAPSQEDKTS*LHGISKLYLAYKALV TILLQVPVSEF*CIIHTL*C*CITALY*NHTAFIELKI*IILTHKNT*QN*KLIPVKQTH AFG*GRRNTVEINLDFCVYLQKATRKKDFKRVSYLIKLYAIKTIFNIRTFFFATL*LGIY IYIYMP*K >LQW61196.y1_3 TKV*HVPCNTSFI*YTRKLKRGVRNTTPVL*RSSLPRHKRIKQVSYMVLVNCIWHIRHLS PFFSKCLYLNFNALFIHYNVNVLLHYIRITLHL*N*RYK*Y*LTKTPNKIES*YL*NRPT RLDRAVGILSKLI*IFVFTFKKPPVKKILKE*AILSNSML*KPYLIYEHFFSPLYN*VYI YIYICHR >LQW51474.x1_4 LTQN*KLKYLVKQDPRVWIGP*EYCRN*FRFLCLPSKSHP*KRF*KSKLSYQTLCYKNHI *YTNIFFRHFIIRYIYIYIYAIEEPAVFEMSTIILDCGNLR*LCVIAWRT*FNIYHCCFM YNQIYSKIYMLLLATNVIYILVLF*NINNASLNSLRLFNSVNILCLLTN >LQW51474.x1_5 PNPKLKAKIPXKTGPTRLDRAVGILSKLI*IFVFTFKKPPVKKILKE*AILSNSML*KPY LIYEHFFSPLYN*VYIYIYICNRRTGGI*NVNDNIRLWKFTLTLCYCVENIIQYLSLLLY V*SNIQ*DIYVTFSNKCNIHSGPVLKY*QRFFK*PTVIQLCKYSLFTNKX >LQW51474.x1_6 *PKIES*NTX*NRTHAFG*GRRNTVEINLDFCVYLQKATRKKDFKRVSYLIKLYAIKTIF NIRTFFFATL*LGIYIYIYMQ*KNRRYLKCQR*Y*IVEIYVNFVLLRGEHNSIFIIAALC IIKYTVRYICYF*QQM*YTFWSCFEILTTLL*IAYGYSTL*IFFVY*QX LQW172967.x1_4 FCFFSFFCFSFFCCFFFLFLFVIRWRRDCIFCFFFFLLCIRSLLMCIIDYSDIRNVSLFN YPVWLLIFSI*FPHMDEGSD*LPIPAY*SYTVTDPPLYSPMYSVEMI*FCVTFLSHPCV* CSKGKLSDRTLCYCYHI*YTNIFFRHFIIRYIYIYIYAIEVPSLFEMSTIILDCGNLR*L CVIAWRT*FNIYHCCFMYNHIYSKIYMLLLATNVIYILVLF*NINNASLNSLRLFDSVNI LCLLTNQVE*E**KKMSHLILD*IYCM*PIKPPDI*SINYSGSLHCTGNYIHADIVGWRK MGYL*YIIFKYLARVSNN*QQSMRVVSITAALPCSCF >LQW172967.x1_5 LFFFFFLFFFFLLFFFFVLICYKMEEGLYFLFFFFFIMYTFSSYVYY*LF*YT*CVAV*L SCMVINFLHLIPSYG*RFRLTPYPGLLKLYGYRPSFV*SYVFCRNDLILCYLLKPPVCVM FKG*AI*SDSMLLLPYLIYEHFFSPLYN*VYIYIYICNRSTVVI*NVNDNIRLWKFTLTL CYCVEDIIQYLSLLLYV*SYIQ*DIYVTFSNKCNIHSGPVLKY*QRFFK*PTVIRLCKYS LFTNKSGRMRIMKKNVTSYLRLNILYVAYKTS*YIVH*L*WIIALYWKLYTC*YSWVEED GISLVHNIQVSCSCFKQLTTVYESCEHNSCTAVFLFX >LQW172967.x1_6 FVFFLFFVFLFFVVFFFCSYLL*DGGGIVFFVFFFFYYVYVLFLCVLLIILIYVMCRCLI ILYGY*FSPFDSLIWMKVQIDSLSRPIEVIRLQTLLCIVLCILSK*FDFVLPS*ATRVCD VQRVSYLIGLYAIVTIFDIRTFFFATL*LGIYIYIYMQ*KYRRYLKCQR*Y*IVEIYVNF VLLRGGHNSIFIIAALCIIIYTVRYICYF*QQM*YTFWSCFEILTTLL*IAYGYSTL*IF FVY*QIR*NENNEKKCHILS*TKYIVCSL*NLLIYSPLTIVDHCIVLETIYMLI*LGGGR WDIFST*YSSILLVFQTINNSL*EL*A*QLHCRVLVX >GCiWno867_l19.g1_4 TPSQLKGIPV*QHPPLLIERRKIVEII*ILGLPQKAPRKKDLKRVRYLFKLYVIKPILYI CTFFFATLYIGVYIYIYIYIYAIEXPAVFEMSTIILDRGNLR*LCVTAWRT*FNIYYCCF MYNQIYSKIYMLLLATNVIYILVLF*NINNASLNSLRLFNSVNILCLLTNQVEFK**KKM SHLILD*IYCM*PIKPSDI*SINYSVSLHCFGNYIDADIVGWRKMGYL*HIISKYPDRVS NN*QQSMRVVNIQFIINSLNVLCLLPNKKRKQKKWCLIFSHPAIYSVNQLFHFSGT >GCiWno867_l19.g1_5 HPFPIERYSCITTPTPFNRA*ENRGNNIDFGVTSKSPA*KRFKKSKVSFQTLCYKTHTLY MHIFFRHSIYRCIYIYIYIYICNRRXGGI*NVNDNIRSWKFTLTLCYCVENIIQYLLLLL YV*SNIQ*DIYVTFSNKCNIHSGPVLKY*QRFFK*PTVIQLCKYSLFTNKSGRI*IMKEN VTSYLRLNILYVAYKTF*YIVH*L*CIIALFWKLYRC*YSWVEEDGIPLAHNIQIS*SCF KQLTTVYESCEHTVYY*FFKCSLFATK*EKKTEKMVSHIFPPCYIFR*SVISF*WNX >GCiWno867_l19.g1_6 PLPN*KVFLYNNTHPF**SVGKSWK*YRFWGYLKKPRVKKI*KE*GIFSNSML*NPYSIY AHFFSPLYI*VYIYIYIYIYMQ*KXRRYLKCQR*Y*IVEIYVNFVLLRGEHNSIFIIAAL CIIKYTVRYICYF*QQM*YTFWSCFEILTTLL*IAYGYSTL*IFFVY*QIR*NLNNERKC HILS*TKYIVCSL*NLLIYSPLTIVYHCIVLETI*MLI*LGGGRWDTFST*YPNILIVFQ TINNSL*EL*TYSLLLIL*MFFVCYQIRKENRKNGVSYFPTLLYIPLISYFILVEX >GCiWno54_f02.g1_4 GYI*YF*HQCXYTFWSCXEISXRFL*IAYGYSTL*IFFVY*QIR*NXNNERKCHILS*TK YIVCSL*HLLIYSPINYSVSLHCTGNYIHADIVGWRKMGNL*HIISKYPDRVSNN*QQSV RVVNIQFIINSLNVLCLLPNKKRKQKKWCLIFSHPAIYSVNQLFHFSVNSLHKAT*QISY IQKKKYLYILYYV*AYILINVAYASRLLKGSFIGIKYVYVT*ICFCM*V*LMRGEDVFKS M*YI*RLTVRRAHIYRYLPEMILVSVGR*KHFNKCDLLILHHFAFNFHRLPAITVI >GCiWno54_f02.g1_5 RIYMILLAPMXIYFLVLX*NIXTLSXNSLRLFNSVNILCLLTNQVEXE**KKMSHLILD* IYCV*PITPSDI*SH*L*CIIALYWKLYTC*YSWVEEDGKPLAHNIQIS*SCFKQLTTVC ESCEHTVYY*FFKCSLFTTK*EKKTEKMVSHIFPPCYIFR*SVISF*CEQPSQSNLTNKL HTKKEIFIYIILCLGLHTYKCCLCFKIIKGFFYRN*ICLCNLNLFLYVGVTYARRRCV*I NVIYIAVNCASSTYLSIFTRNDFSLCWSVETF**M*FTDFTSFRFQFSPLTRYYSDX >GCiWno54_f02.g1_6 KDIYDTFSTNVNILSGPVXKYXHAFXK*PTVIQLCKYSLFTNKSGRX*IMKENVTSYLRL NILCVAYNTF*YIVPLTIVYHCIVLETIYMLI*LGGGRWETFST*YPNILIVFQTINNSL *EL*TYSLLLIL*MFFVYYQIRKENRKNGVSYFPTLLYIPLISYFILV*TAFTKQLNK*V TYKKRNIYIYYTMFRPTYL*MLPMLQDY*RVLL*ELNMFM*LEFVFVCRCNLCEEKMCLN QCNIYSG*LCVEHIFIDIYPK*F*SLLVGRNILINVIY*FYIISLSIFTAYPLLQ*X >GCiWno478_p11.b1_1 SMRVVNIQFIINSLNVLCLLPNKKRKQKKWCLIFSHPAIYSVNQLFHFSVNSLHKAT*QI SYIQKRNIYIYYTMFRPTYL*MLPMLQDY*RVLL*ELNMFM*LEFVFVCKCNLCEEKMCL NQCNIYSG*QCVEHIFIDIYPK*FKSLLVGRNILINVIY*FYIISLSIFTAYPLLQ*FIP LRLLLSFKSKVCLF*CGENLSLTD*DK*ISLAVNKRALKQGTSFSILNPLGTAPF*PXTI SIFNAFNFKHVLFVVSLNRKGVYLLTVFALPVVIHELX*LLRLYNYX >GCiWno478_p11.b1_2 L*EL*TYSLLLIL*MFFVCYQIRKENRKNGVSYFPTLLYIPLISYFILV*TAFTKQLNK* VTYKKEIFIYIILCLGLHTYKCCLCFKIIKGFFYRN*ICLCNLNLFLYVSVTYARRRCV* INVIYIAVNSASSTYLSIFTRNDLSLCWSVETF**M*FTDFTSFRFQFSPLTRYYSDLYH YVYCSHLSQKFVYFSAARTFPSLIEINK*V*R*TSGLSNKEQVFQY*IR*GLLPFNPXQF QFSMLLILNTFYL*CLLIEKVYIY*LYSLYQSLYMNXSNY*DCTTIX >GCiWno478_p11.b1_3 YESCEHTVYY*FFKCSLFATK*EKKTEKMVSHIFPPCYIFR*SVISF*CEQPSQSNLTNK LHTKKKYLYILYYV*AYILINVAYASRLLKGSFIGIKYVYVT*ICFCM*V*LMRGEDVFK SM*YI*RLTVRRAHIYRYLPEMI*VSVGR*KHFNKCDLLILHHFAFNFHRLPAITVIYTI TFIALI*VKSLSILVRREPFPH*LR*INKSSGKQAGSQTRNKFFNIKSVRDCSLLTXNNF NFQCF*F*TRFICSVS**KRCIFINCIRSTSRYT*IXLIIKTVQLF >GCiWno692_l23.b1_4 XPEMIXVSVGR*KHFNKCDLLILHHFAFNFHRLPAIQVIYTIRXIALI*VKSLSILVRRE PFPH*LR*INKSSGKQAGSQTRNKFFNIKSVRDCSLLTQNNFNFQCF*F*TRFICSVFLI EKWYIY*LYSL*PVVYT*ISLIIKTVQLIFSFFSFYILSGEFPVDFLALHFK*I*LSNRN LFGLRNVCRLSVKVECY*Y*LTYAFRFY*PRFLNLMKTHV*VRFRFALVLMVLYTRLTP* PIIPADFRIT*T*YTTFYSANAFLCS*NPQNIALV*SHFIV*YCFFRTA*TC*KV >GCiWno692_l23.b1_5 TRNDXSLCWSVETF**M*FTDFTSFRFQFSPLTRYTSDLYHTXYCSHLGKEFVYFSAART FPSLIEINK*V*R*TSGLSNKEQVFQY*IR*GLLPFNPKQFQFSMLLILNTFYL*CFFNR KVVYLLTVFALTSRLYMN*SNY*DCTTNFFFFFFLYLIGGISG*FFSAPF*MNMIK**ES VRIT*CLSFIGKS*VLLVLIDICVSVLLTQIPKSNENSRLSAI*ICVGVNGVVYPSNPLT DYTGRFPNYLNLIYDILFRKCIPLFIKPTKYCIGIITLYSVILFFQNCLNLLESX >GCiWno692_l23.b1_6 YPK*XKSLLVGRNILINVIY*FYIISLSIFTAYPLYK*FIPYVXLLSFR*RVCLF*CGEN LSLTD*DK*ISLAVNKRALKQGTSFSILNPLGTAPF*PKTISIFNAFNFKHVLFVVFF** KSGIFINCIRSNQSFIHELV*LLRLYN*FFLFFLSISYRGNFRLIF*RSILNEYD*VIGI CSDYVMFVVYR*KLSAISIN*HMRFGFINPDS*I**KLTFKCDLDLRWC*WCCIPV*PLD RLYRQISELLKPNIRHFIPQMHSFVHKTHKILHWYNHTL*CNIVFSELPKLARKX exon3 >GCiWno835_m11.g1_1 SIRARTLTD*DNK*V*R*TSGLSNKEQVFQY*IR*GLLPFNPKQFQFSMLLILNTFYL*C LLIEKWYIY*LYSL*PVVYT*ISLIIKTVQLIFYFFSFYILSGEFPVDFLALHFK*I*LG NRNLFGLRNVCRLSVKVECY*Y*LSYAFRFY*PRFLKLMKTHV*VRFRFALVLKLCCIPV *PLDRLYR*IS*LFEPNIRHFTPQIDSFVHKTHKILHCHNHTL*RNIVFSEL PKLARKYG PIFTITAGYRRVVFLVGYDFIXEVSSCILDXWIYLCN*LRDTMGRGYP >GCiWno835_m11.g1_2 QFELGPSLIEIINKSSGKQAGSQTRNKFFNIKSVRDCSLLTQNNFNFQCF*F*TRFICSV F**KSGIFINCIRSNQSFIHELV*LLRLYN*FFIFFLSISYRGNFRLIF*RSILNEYD*V IGICSGYVMFVVYR*KLSVISINCHMRFGFINPDS*N**KLTFKCALDLRWC*NCVVYPS NPLTDYTGRFPDYLNLIYDILLRK*IPLFIKPTKYCIAIITLYSVILFFQNCLNLLESMD PFSLLQLGIDAWCFLLAMTLLXK*VHVFWIXGYIYVTSFVTPWVEGT >GCiWno835_m11.g1_3 NSSSDPH*LR**ISLAVNKRALKQGTSFSILNPLGTAPF*PKTISIFNAFNFKHVLFVVS FNRKVVYLLTVFALTSRLYMN*SNY*DCTTNFLFFFFLYLIGGISG*FFSAPF*MNMIR* *ESVRVT*CLSFIGKS*VLLVLIVICVSVLLTQIPKTNENSRLSAL*ICVGVKIVLYTRL TP*PIIPVDFLII*T*YTTFYSANRFLCS*NPQNIALP*SHFIA*YCFFRTA*TC*KVWT HFHYYSWV*TRGVSCWL*LYXRSEFMYFG*XDIFM*LAS*HHG*RVP LQW143057.y1 LQW143057.y1.phd.1 LQW143057.x1 11:46:25 2001 TEMPLATE: LQW143057 DIRECTION: rev Length = 996 Score = 91.3 bits (223), Expect = 3e-18 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +3 Query: 1 VQQEIDDVLGFDRLPQYEDRMRMPYCEATVLEVQRMATIAPIGL 44 VQQEIDDVLGFDRLPQYEDRMRMPYCEATVLEVQRMATIAPIGL Sbjct: 549 VQQEIDDVLGFDRLPQYEDRMRMPYCEATVLEVQRMATIAPIGL 680 LQW103752.x1 LQW103752.x1.phd.1 LQW103752.y1 10:49:29 2001 TEMPLATE: LQW103752 DIRECTION: fwd Length = 736 Score = 68.3 bits (164), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 1 DLFQAGTETTSTTLRWAILYMVNNPNIQSKII 32 DLFQAGTETTSTTLRWAILYMVNNPNIQSKII Sbjct: 695 DLFQAGTETTSTTLRWAILYMVNNPNIQSKII 600 Score = 62.8 bits (150), Expect = 2e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -2 Query: 29 SKIIQQEIDEVLGFDQLPQYEDRMRMPYCEAT 60 S+ +QQEID+VLGFD+LPQYEDRMRMPYCEAT Sbjct: 96 SEKVQQEIDDVLGFDRLPQYEDRMRMPYCEAT 1 >r_GECi40_c10 Length = 993 Score = 68.7 bits (165), Expect = 2e-11 Identities = 32/33 (96%), Positives = 33/33 (99%) Frame = +1 Query: 1 DLFQAGTETTSTTLRWAILYMVNNPNIQSKIIM 33 DLFQAGTETTSTTLRWAILYMVNNPNIQSKII+ Sbjct: 289 DLFQAGTETTSTTLRWAILYMVNNPNIQSKIIV 387 >GCiWno1040_e04.b1 CHROMAT_FILE: GCiWno1040_e04.b1 PHD_FILE: GCiWno1040_e04.b1.phd.1 CHEM: term DYE: big TIME: Fri Jan 4 11:08:21 2002 TEMPLATE: GCiWno1040_e04 DIRECTION: fwd Length = 886 Score = 64.4 bits (154), Expect = 4e-10 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -2 Query: 34 LGGYRIPKRTSIMACYHSIHFDPKFWKNPNEF 65 LGGY IPK T IM YH+IHFDPKFWKNPNEF Sbjct: 96 LGGYHIPKHTCIMPSYHTIHFDPKFWKNPNEF 1 = seq 228 Seq 228 K-helix region VQSEIDNVLGFDQLPKYEDRSRMPYCEATVLEVQRMASITPFG DLFQAGTETTATTLRWAVLYMVNNPHIQGR seq 228 I-helix region GCiWno1040_e04.g1 >GCiWno1040_e04.b1_4 SICLVWGAPVSSLV*K*NLPQVPRFFFRVSNFGVFRFRKSLWVFSRGWEPTGVILGGPVV YMVNYPHYQG*TLL*WRITPLRGYDNNITCSCILDYGSEDLEIFKRKHTNLLQVNLTLSC FIRERSE*N*QRFGF*PTS*I*R*VKNAIL*SNCSRSTKNGVYNPFW*DLYKHTIKDF*R RTTLYF*HIIGWGNGTRFHSIFSSHWVVNKEYLKK*KRILTTPIDCFFV*NTIRVFGYYT LKVSHLTPQYYIGLLHCSEEDQKLGGYHIPKHTCIMPSYHTIHFDPKFWKNPNEF >GCiWno1040_e04.b1_5 LHLFSLGCPGQFFGLKMKPAPSSQIFFPGIKFWCF*V*KVIMGFFQGLGTNGGYFGWASC IHGQLSTLSRVDLIVMADYASAWV***YNL*LYPRLR*RRFRNI*TKTHKFITS*SYIIL FYQRTFRVKLTTFWVLTNFLNMKIGQECHIVKQLF*KYKEWRL*PLLVRFVQTYN*RFLT QNYSVFLTYNRLGKWDTLSFYFLVPLGSKQRIFKKMKTYPHDSHRLFFCLKHDQGIWILY VKGLTSDPTVLYRFAPLLRGRPKVRRIPHPETYMYHAILPYYTFRPEVLEKSE*VX >GCiWno1040_e04.b1_6 PFV*FGVPRSVLWFENETCPKFPDFFSGYQILVFLGLESHYGFFPGVGNQRGLFWVGQLY TWSIIHIIKGRPYCDGGLRLCVGMIII*PVVVSSITVAKI*KYLNENTQIYYKLILHYLV LSENVQSEIDNVLGFDQLPKYEDRSRMPYCEATVLEVQRMASITPFGEICTNIQLKIFNA ELLCIFNI**VGEMGHAFILFSRPIG**TKNI*KNENVSSRLP*TVFLFKTRSGYLDIIR *RSHI*PHSII*VCSIAQRKTKS*EDTTSRNIHVSCHLTILYISTRSSGKIRMSX >GCiWno1040_e04.g1 CHROMAT_FILE: GCiWno1040_e04.g1 PHD_FILE: GCiWno1040_e04.g1.phd.1 CHEM: term DYE: big TIME: Fri Jan 4 11:08:22 2002 TEMPLATE: GCiWno1040_e04 DIRECTION: rev Length = 825 Score = 108 bits (267), Expect = 1e-23 Identities = 63/127 (49%), Positives = 70/127 (54%), Gaps = 51/127 (40%) Frame = +2 Query: 1 DLFQAGTETTSTTLRWAILYMVNNPNIQSKI-----------------IVVQS------- 36 DLFQAGTETT+TTLRWA+LYMVNNP+IQ + +VV S Sbjct: 263 DLFQAGTETTATTLRWAVLYMVNNPHIQGRTYCDCGLRLCVVIIIILTVVVSSITVAKI* 442 Query: 37 ---------------------------EIDNVLGFDQLPKYEDRSRMPYCEATVLEVQRM 69 ++ LGFDQLPKYEDRSRMPYCEATVLEVQRM Sbjct: 443 KYFKRKHTNLLQVNLTLSCFYQRTFRVKLTTXLGFDQLPKYEDRSRMPYCEATVLEVQRM 622 Query: 70 ASITPFG 76 ASITPFG Sbjct: 623 ASITPFG 643 >GCiWno1032_k17.b1 CHROMAT_FILE: GCiWno1032_k17.b1 PHD_FILE: GCiWno1032_k17.b1.phd.1 CHEM: term DYE: big TIME: Thu Dec 27 12:36:47 2001 TEMPLATE: GCiWno1032_k17 DIRECTION: fwd Length = 881 Score = 58.9 bits (140), Expect = 1e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 1 DLFQAGTETTSTTLRWAILYMVNNPNIQSK 30 DLFQAGTETT+TTLRWA+LYMVNNP+IQ + Sbjct: 222 DLFQAGTETTATTLRWAVLYMVNNPHIQGR 133 = seq 228 >GCiWno1032_k17.b1_4 KLWALQK*GGEQGAPFTFLFVNAFGSSPNFIV*NIRAISSVLDIVLKFLIYSDHKLYCYL LATQFPCYLHRTIYAVVLPKLY*VR*IMLCGIGLTIIFVLCLPMCHGIYVSLSQPSIYPP GPVGIPLFGSFHYAASGILISMYVRNHNAYHYFIFRYYVLKVSRLPSILLHHFFAIA*DR VYQLHIIWFRK*KPAQDTKCFFFTVSSFCCFLGLEMSIMDLFQAGTETTATTLRWAVLYM VNNPHIQGRTYCDCGLRLCVVIIIILTVFVSSITVAKI*KNFKRKHTNLLQVN >GCiWno1032_k17.b1_5 KVMGIAKIGGGAGGPIYIFICKRVRFFPKLYCIEY*SHFLCSGHSPQVFDIQRSQALLLS PCHTVPMLPPPYYICCRITQIVLSSLDHVMRNRSYNNFRSLPSDVSRDLCFAFTT*YLSS WSSGNSAFWKFSLCCLRYPHKYVRSQS*CVSLLYI*ILCAKGVPSSLYSTTSFFRNCLRS GVPVTYHLV*KIKTCTRYQVFFFHGIKFLLLFRFRNVNYGFISSWYGNNGDYSTLGSFIH GQ*STYSR*NLL*LRITPLCCYYNNINCICILDYGSEDLEKF*TKTHKFITS*X >GCiWno1032_k17.b1_6 SYGHCKNRGGSRGPHLHFYL*TRSVLPQTLLYRILEPFPLFWT*SSSF*YTAITSSIVIS LPHSSHVTSTVLYMLSYYPNCIEFARSCYAE*VLQ*FSFFAFRCVTGFMFRFHNLVSILL VQWEFRFLEVFIMLPQVSS*VCTFAIIMRITTLYLDIMC*RCPVFPLFYYIIFSQLLEIG CTSYISSGLENKNLHKIPSVFFSRYQVFVAF*V*KCQLWIYFKLVRKQRRLLYVGQFYTW SIIHIFKVELIVIADYASVLLL**Y*LYLYPRLR*RRFRKILNENTQIYYKLX cits048p05_1 very similar to seq 222 and 224 N-term region up to I-helix RPLLPKLARKYGPIFTITAGYRRVVFLVGYDLIKEVITDRAKDFASRCPNMPGRIVRGEG LDGIAAAPYGPKWMANRKFFYSAMRTMGLGKRGIEKCVVDEIPYIVEELEKLCTKNELFE PSSVFDSAVLNVLAYFTFGN (?) RYSYQDEKFKELIHINNDFFQKAKFLNQPLFFLLSLVPGL HKYWLPQCGKDLKESVG (?) KINKFVKAEIEQHRQNFDRKNPRDYIDCYLKELDQMNDQSELS (?) >cits048p05 CGGCCGCTACTGCCTAAACTTGCTAGAAAGTATGGACCCATTTTCACTATTACAGCTGGGTATAGACGCGTGGTGTTTCT TGTTGGCTATGACTTAATTAAAGAAGTTATCACTGACAGAGCAAAAGATTTTGCATCAAGATGTCCCAACATGCCAGGAA GAATTGTCCGTGGAGAAGGTTTAGATGGCATTGCTGCAGCCCCATATGGTCCCAAATGGATGGCAAACCGTAAGTTCTTT TACTCTGCCATGCGCACCATGGGGTTGGGAAAACGTGGGATAGAAAAGTGTGTGGTTGATGAGATTCCCTACATTGTTGA AGAACTTGAGAAGCTTTGCACCAAAAATGAGTTGTTTGAACCATCGAGTGTATTTGACTCCGCTGTACTGAACGTGCTTG CATATTTCACTTTTGGAAACAGATATTCCTATCAAGACGAAAAATTTAAAGAGCTGATTCACATCAATAATGATTTCTTT CAAAAAGCAAAGTTTCTGAATCAGCCACTATTCTTCCTCCTCAGTTTGGTACCTGGCCTGCATAAATACTGGCTTCCTCA ATGTGGAAAAGATCTAAAAGAATCAGTTGGGAAAATCAACAAATTTGTAAAAGCTGAGATTGAACAACATCGACAAAATT TTGACCGCAAAAATCCAAGAGATTATATTGACTGTTATCTCAAAGAGCTCGATCAGATGAATGATCAAAGCGAACTATCG G LQW149317.y1 LQW149317.y1.phd.1 LQW149317.x1 13:50:18 2001 TEMPLATE: LQW149317 DIRECTION: rev Length = 977 Score = 91.7 bits (224), Expect = 7e-18 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = +1 Query: 196 VGKINKFVKAEIEQHRQNFDRKNPRDYIDCYLKELDQMNDQSELS 240 + KINKFVKAEIEQHRQN DRKNPRDYIDCYLKELDQMNDQSELS Sbjct: 562 IRKINKFVKAEIEQHRQNLDRKNPRDYIDCYLKELDQMNDQSELS 696 Score = 62.1 bits (148), Expect = 5e-09 Identities = 27/34 (79%), Positives = 29/34 (84%) Frame = +2 Query: 166 LNQPLFFLLSLVPGLHKYWLPQCGKDLKESVGKI 199 L +P LLSLVPGLHKYWLPQCGKDLKESVG + Sbjct: 8 LTEPDLLLLSLVPGLHKYWLPQCGKDLKESVGLV 109 >LQW149317.y1_1 XETD*AGPSPPQFGTWPA*VLASSMWKRSKRISWVGKELTLI*NYSKIITCKVKSMKCMI KKRVLSTGSTGLKHFFWYI*FLFVYIVFFPNIKVKTLNGKP**CFTFRSVLGG*GPAAWY SVGARI*GNIGLLPHKCLALWQ*KTPVFL*DMKNKNANTFLPHLH*KLQINMNIYSFIFN LNSDVFLIRKINKFVKAEIEQHRQNLDRKNPRDYIDCYLKELDQMNDQSELSELGN**SR F*LNTHIFSFNNGSSIETKQ*IWVLTLYTAPVSIIYLFTLVKKPLDSLALGVSKFINVLS VNVCVKTYIWND*KIQ*TRNQIGNQX >LQW149317.y1_2 ERLTEPDLLLLSLVPGLHKYWLPQCGKDLKESVGLVKS*L*FKIIQK*SPAKLKA*SV*S KNVFYRLGPLG*SIFSGIYSFYLFTLYFSQI*RLRHLMANPDDVSRFGLF*VGEVPQRGT LWVLGFRATLACYPINVSLYGNRKHQSSFRI*KTKTQTLSFHIYIKNYK*T*IFILLYSI *IQMFFLLGKSTNL*KLRLNNIDKILTAKIQEIILTVISKSSIR*MIKANYRSLVIDKVD FN*THTFSASTMVAV*KLNSKSGC*HFTQRLSALFTYSLLLKNLLIVWPWE*ASLSTYCP *TYA*KRTYGTIKKSNKQGIRLGTKX >LQW149317.y1_3 RD*LSRTFSSSVWYLACISTGFLNVEKI*KNQLGW*RVDFNLKLFKNNHLQS*KHEVYDQ KTCFIDWVHWVKAFFLVYIVFICLHCIFPKYKG*DT*WQTLMMFHVSVCFRWVRSRSVVL CGC*DLGQHWPVTP*MSRFMAIENTSLPLGYEKQKRKHFPSTFTLKTTNKHEYLFFYIQF KFRCFSY*ENQQICKS*D*TTSTKS*PQKSKRLY*LLSQRARSDE*SKRTIGAW*LIK*I LIEHTHFQLQQW*QYRN*TVNLGANTLHSACQHYLLIHSC*KTS**SGLGSKQVYQRIVR KRMRKNVHMERLKNPINKESDWEPK >ciht036p01 Length = 555 Score = 46.1 bits (107), Expect = 7e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 24 DYIDCYLKELDQMNDQSELS 43 DYIDCYLKELDQMNDQSELS Sbjct: 555 DYIDCYLKELDQMNDQSELS 496 >ciht036p01 GGGTTCGATACAGGATCAAAAACTTTAAAAAAACCTAAAAACAATGATTTTACTTTGTATATTTGGGTTGTTAACCATGT ATAAGATTGCCCAACGTAAAGTAATTGACGTAGTTTCAGTTCCAGCTTGAAATAAATCCATGATCGACATTTCCAAACCT GAGAAGCAAAAAGAATGAGAGAATGTAATTTATTTTATCTCTGCGTTCACCATAACGAAGAACGGTAAAGTTTACAACAG CGAAAAAACGCTTAAAACAGAAACAAAATAACGCTATGGATAAAAAGCTTGACTGTTACACCCAAAAGAACAAGAACATA TCAATGAAAGCTACTGTAAACAAAGAGTGAAATTAAGTAAAATAAATGCTGTACAGGCGCTGTGGTAAAGTGGTTAGCAC GCAGAGTTTACTGGTTTAGGTTCGATACTGCTACCATTGTAGAAGCTGAAAATGTGTGTGTTCAATTAAAATCTACTTTA TCAATTACCAAGCTCCGATAGTTCGCTTTGATCATTCATCTGATCGAGCTCTTTGAGATAACAGTCAATATAATC >ciht036p01_4 DYIDCYLKELDQMNDQSELSELGN**SRF*LNTHIFSFYNGSSIEPKPVNSAC*PLYHSA CTAFILLNFTLCLQ*LSLICSCSFGCNSQAFYP*RYFVSVLSVFSLL*TLPFFVMVNAEI K*ITFSHSFCFSGLEMSIMDLFQAGTETTSITLRWAILYMVNNPNIQSKIIVFRFF*SF* SCIEP LQW59506.x1 CHEM: term DYE: ET TIME: Wed Mar 21 14:51:31 2001 TEMPLATE: LQW59506 DIRECTION: fwd Length = 555 Score = 125 bits (312), Expect = 3e-28 Identities = 57/59 (96%), Positives = 58/59 (97%) Frame = +2 Query: 141 RYSYQDEKFKELIHINNDFFQKAKFLNQPLFFLLSLVPGLHKYWLPQCGKDLKESVGKI 199 RYSYQDEKFKELIHINNDFFQKAKFLNQPLFFLLSLVPGLHKYWLPQCGKDLKESVG + Sbjct: 68 RYSYQDEKFKELIHINNDFFQKAKFLNQPLFFLLSLVPGLHKYWLPQCGKDLKESVGLV 244 LQW207002.y1 LQW207002.y1.phd.1 LQW207002.x1 12:48:08 2001 TEMPLATE: LQW207002 DIRECTION: rev Length = 978 Score = 125 bits (312), Expect = 3e-28 Identities = 57/59 (96%), Positives = 58/59 (97%) Frame = +3 Query: 141 RYSYQDEKFKELIHINNDFFQKAKFLNQPLFFLLSLVPGLHKYWLPQCGKDLKESVGKI 199 RYSYQDEKFKELIHINNDFFQKAKFLNQPLFFLLSLVPGLHKYWLPQCGKDLKESVG + Sbjct: 60 RYSYQDEKFKELIHINNDFFQKAKFLNQPLFFLLSLVPGLHKYWLPQCGKDLKESVGLV 236 Score = 50.8 bits (119), Expect = 1e-05 Identities = 25/38 (65%), Positives = 28/38 (72%) Frame = +1 Query: 196 VGKINKFVKAEIEQHRQNFDRKNPRDYIDCYLKELDQM 233 + KINK VKAEIEQHRQN RK RDYIDC + DQ+ Sbjct: 685 IRKINKCVKAEIEQHRQNL*RKKSRDYIDC-ISRADQL 795 >ciad099g22 blast hit to cits048p05 Length = 664 Score = 297 bits (753), Expect = 4e-80 Identities = 142/157 (90%), Positives = 149/157 (94%) Frame = +1 Query: 4 LPKLARKYGPIFTITAGYRRVVFLVGYDLIKEVITDRAKDFASRCPNMPGRIVRGEGLDG 63 LPKLA+KYGPIFTI AGYRRVVFLVGYD+IKEVITDRAKDFASRCP + RIVRGEGLDG Sbjct: 193 LPKLAKKYGPIFTIKAGYRRVVFLVGYDVIKEVITDRAKDFASRCPTIVARIVRGEGLDG 372 Query: 64 IAAAPYGPKWMANRKFFYSAMRTMGLGKRGIEKCVVDEIPYIVEELEKLCTKNELFEPSS 123 IAA+PYGPKWMANRKFFYSAMRTMGLGKRGIEKCVVDEIPYIV ELE +C+ + LFEPSS Sbjct: 373 IAASPYGPKWMANRKFFYSAMRTMGLGKRGIEKCVVDEIPYIVGELENICSNDGLFEPSS 552 Query: 124 VFDSAVLNVLAYFTFGNRYSYQDEKFKELIHINNDFF 160 VFDSAVLNVLAYFTFGNRYSYQDEKFKELIHINNDFF Sbjct: 553 VFDSAVLNVLAYFTFGNRYSYQDEKFKELIHINNDFF 663 >ciad099g22 = seq 84 N-term ATCGCGCTGTTTAATCCATGGCGTTACCCGCCCGGTCCGGCGGGGCTTCCCCTGATCGGAAGTCTCCACCTGGTGGCACC AGAGTTCCACATAAGTATATTAATAAAATTTCCATTCCCCTTTACTCCCTTTCTCTTTTCTGCTTTTCTCAAAAAACAAA TTACCGGATTGTTTAATATTTGTTTTTCAGAGTTGCCTAAGCTTGCTAAAAAGTATGGACCCATTTTTACTATAAAAGCT GGATATAGACGTGTGGTGTTTCTAGTTGGCTATGACGTAATTAAAGAAGTTATCACAGACAGAGCAAAGGATTTTGCGTC AAGATGTCCCACCATAGTAGCAAGAATTGTTCGTGGAGAAGGTTTAGATGGTATTGCTGCATCCCCATACGGTCCCAAAT GGATGGCAAATCGCAAGTTTTTTTACTCTGCCATGCGTACCATGGGGTTGGGGAAACGTGGGATAGAGAAGTGTGTGGTT GATGAAATTCCCTACATTGTGGGAGAACTTGAGAATATTTGCTCCAATGATGGGTTGTTTGAACCATCGAGTGTATTTGA CTCTGCTGTACTGAACGTGCTGGCATATTTTACTTTCGGAAATCGCTACTCTTATCAAGATGAAAAATTTAAAGAACTTA TCCACATCAATAATGATTTCTTTC >ciad099g22_1 = seq 84 N-term similar to seq 222 and 224 IALFNPWRYPPGPAGLPLIGSLHLVAPEFHISILIKFPFPFTPFLFSAFLKKQITGLFNI CFSELPKLAKKYGPIFTIKAGYRRVVFLVGYDVIKEVITDRAKDFASRCPTIVARIVRGE GLDGIAASPYGPKWMANRKFFYSAMRTMGLGKRGIEKCVVDEIPYIVGELENICSNDGLF EPSSVFDSAVLNVLAYFTFGNRYSYQDEKFKELIHINNDFF >rciad099g22 = seq 84 C-term ATGTATTTTCATGTATTACAATATAAACTATTTAAAAAGTATAATTTCATCAAAAAGTAACAATCCAGTCGACAATAAAA TACACAAAAAAACAAACTGAACATTGTATAGATATTAGAAATCTTGTGATATATAACATGAAATAGGAGGTATATATAGC GTGCATTGATTTAATGTGCATTTAGTAATTTTGTTCGAATGCTGAAAGAAATATATTAAGAATTGTTACACCAGGGCTTT GAAAACCTGGGGGTAACAAACTTCAGGGGTCATCGAGAGTATACTAATTTTACAAAAGTTAAAAATAAAAAAATCAACTA CAAAGTAACATACATGGTACTTGTAAGCTGACACGAGGTGTATGAAACAGAACACCCGTATTATATCAACTGTCGTTTCC CAGCCATGCGAAGGTAAAGTAAGTTACATTCATTTATTCAGAAGATAAAACAGGGTTTGAGAGTAAACCCGTTTGGGAAG CTGAGTGTTAAACTCTGCGTTTTATCTGGACTTGATAGATCTTTGGAGCATGAGTGAAGTAAAAAGCCTCACAGAAAAGG TTAGGAGATTGAAAAGGTTTGAGTTTGGGAGGTCCTATGTTAAACTATGCTCTGCGTTTTATCTGGACTCGATAGATCTT GGGAGCGAGTATGATTCCTGGTCCAGGTTTTTCATCAAGATGATCCATATCATCCGGAAG >rciad099g22_5 = seq 84 C-term LPDDMDHLDEKPGPGIILAPKIYRVQIKRRA*FNIGPPKLKPFQSPNLFCEAFYFTHAPK IYQVQIKRRV*HSASQTGLLSNPVLSSE*MNVTYFTFAWLGNDS*YNTGVLFHTPRVSLQ VPCMLLCS*FFYF*LL*N*YTLDDP*SLLPPGFQSPGVTILNIFLSAFEQNY*MHIKSMH AIYTSYFMLYITRFLISIQCSVCFFVYFIVDWIVTF**NYTF*IVYIVIHENTX LQW177629.y1 = seq 84 CGACTAATGAGCTGGTCCTATTATCAGTGTACAACATTATAACTAATCATACAGGTTTGCAACATTGTTCAGAAGACGAC CAGGTGTTAGGTGGCTATCATGTCCCAAAGCGTACAAGTATGTGGCATGTTACCACTCTATTCATTTCGACCCAAAATTT TGGAAAAATCCCAACAAATTTGATCCATGCAATTTTCTTGACAGCAATGGAAAAGTTTGTATTCCTGATGCATTTATGCC GTTTGGTGGAGGTAATGTTCACGCTTTACTAATTTGCATGTTTATTAATGTAGTAGGTAATGGGTAAAATAGACTAAAGT ACTAGAATATACAATAAATAAATATTATTTTAGTTTAACTCCTTGAATATAATTTAAAAAAATACCCTTGAAGTTACGTA CGGGGTAACCCGTAAGCATGAGATGTATAAAACAGAACACCCTTGTTATAACAACTGTCCTTGTCACGAAAGATAAACAA GTTAATCATTCATTCCCCACTCACTAGTATAATAAGCCATTACACAATTGAATTGCAACACTCTACAACACACTAGTTAC ATTTTATATAATGACAAATTTCAACAAAAAACTTGTTTTTCCAGTAGTGTCGATAAGTTTAGAAAAATTCCAAAAAAATA ATCACCTACAAACAGGCGCGTATCCAGGAATTTATAAAGGGGGGGGTCCGCAAGTTTTTGCTTAGAAAATGGATGCGTAT AAAACGTAACGTGCTCGANTAAAAACCCCCTGACTAGCATAAATAATAAGCAAAGCTGGCGCAAATAGATGTGTCACAGG GAGGTATCTAATTGCGCCGAGGGGCAAAAAATTTGCTTAACCCTACTTCTGTTTAAACCCCCGTTTTCAACCTATTATTT TATTACCATCGTGCAGTATGGGTCACGCAACTATTGCATAAACATTTTGGTATGTTAATGCAGAAGCGTACATCGGTAAC AGTATTTGTTTGACACTTCAAGGAATATCGAGTGAGACATA >_1 = seq 84 RLMSWSYYQCTTL*LIIQVCNIVQKTTRC*VAIMSQSVQVCGMLPLYSFRPKILEKSQQI *SMQFS*QQWKSLYS*CIYAVWWR*CSRFTNLHVY*CSR*WVK*TKVLEYTINKYYFSLT P*I*FKKIPLKLRTG*PVSMRCIKQNTLVITTVLVTKDKQVNHSFPTH*YNKPLHN*IAT LYNTLVTFYIMTNFNKKLVFPVVSISLEKFQKNNHLQTGAYPGIYKGGGPQVFA*KMDAY KT*RARXKTP*LA*IISKAGANRCVTGRYLIAPRGKKFA*PYFCLNPRFQPIILLPSCSM GHATIA*TFWYVNAEAYIGNSICLTLQGISSETX >_2 D**AGPIISVQHYN*SYRFATLFRRRPGVRWLSCPKAYKYVACYHSIHFDPKFWKNPNKF DPCNFLDSNGKVCIPDAFMPFGGGNVHALLICMFINVVGNG*NRLKY*NIQ*INIILV*L LEYNLKKYP*SYVRGNP*A*DV*NRTPLL*QLSLSRKINKLIIHSPLTSIISHYTIELQH STTH*LHFI**QISTKNLFFQ*CR*V*KNSKKIITYKQARIQEFIKGGVRKFLLRKWMRI KRNVLX*KPPD*HK**AKLAQIDVSQGGI*LRRGAKNLLNPTSV*TPVFNLLFYYHRAVW VTQLLHKHFGMLMQKRTSVTVFV*HFKEYRVRHX >_3 TNELVLLSVYNIITNHTGLQHCSEDDQVLGGYHVPKRTSMWHVTTLFISTQNFGKIPTNL IHAIFLTAMEKFVFLMHLCRLVEVMFTLY*FACLLM**VMGKID*STRIYNK*ILF*FNS LNII*KNTLEVTYGVTRKHEMYKTEHPCYNNCPCHER*TS*SFIPHSLV**AITQLNCNT LQHTSYILYNDKFQQKTCFSSSVDKFRKIPKK*SPTNRRVSRNL*RGGSASFCLENGCV* NVTCSXKNPLTSINNKQSWRK*MCHREVSNCAEGQKICLTLLLFKPPFSTYYFITIVQYG SRNYCINILVC*CRSVHR*QYLFDTSRNIE*DI LGGYHVPKRTSXXACYHSIHFDPKFWKNPNKFDPCNFLDSNGKVCIPDAFMPFGGG LQW7880.x1 CHEM: term DYE: ET TIME: Wed Mar 21 15:59:13 2001 TEMPLATE: LQW7880 DIRECTION: fwd Length = 630 Score = 126 bits (313), Expect = 3e-29 Identities = 60/60 (100%), Positives = 60/60 (100%) Frame = -1 Query: 1 LYNTLVTFYIMTNFNKKLVFPVVSISLEKFQKNNHLQTGAYPGIYKGGGPQVFA*KMDAY 60 LYNTLVTFYIMTNFNKKLVFPVVSISLEKFQKNNHLQTGAYPGIYKGGGPQVFA*KMDAY Sbjct: 549 LYNTLVTFYIMTNFNKKLVFPVVSISLEKFQKNNHLQTGAYPGIYKGGGPQVFA*KMDAY 370 TTGGGTACTATCACAAAAAGAACAAGGAACGTAATTCTAACTTGTTTTTTACATCCACGATGTAGCTAATAACGGACGCG TCAATGGACATTATGACGCAATTAACCACATATAAATTGTTGTTACGTCGCAAAATAAGCTTCGCCGTCGTAACCCAATA ACATGACAACGTACGTGGTAATTTAAAAATTTAATTAGGTTTGTAAAACGGGGGGGTTTTACAGCAGAAAGGTAGGGGTT TAAGCAAAATTTTTTTTGCGCCTTCGGCGCAAATTAGATAGCCTCCCTTTGAACACATCTATTTGCGCCAGCGTGTGCGT TATTATTTATGCTAGTCAGGGGGGTTTTTTATCGAGCACGTTACGTTTTATACGCATCCATTTTCTAAGCAAAAACTTGC GGACCCCCCCCTTTATAAATTCCTGGATACGCCCCTGTTTGTAGGTGATTATTTTTTTGGAATTTTTCTAAACTTATCGA CACTACTGGAAAAACAAGTTTTTTGTTGAAATTTGTCATTATATAAAATGTAACTAGTGTGTTGTAGAGTGTTGCAATTC AATTGTGTAATGGCTTATTATACTAGTGAGTGGGGAATGAATGATTAACTTGTTTATCTTTCGTGACAAG >_4 LVTKDKQVNHSFPTH*YNKPLHN*IATLYNTLVTFYIMTNFNKKLVFPVVSISLEKFQKN NHLQTGAYPGIYKGGGPQVFA*KMDAYKT*RAR*KTPLTSINNNAHAGANRCVQREAI*F APKAQKKFCLNPYLSAVKPPRFTNLIKFLNYHVRCHVIGLRRRSLFCDVTTIYMWLIAS* CPLTRPLLATSWM*KTS*NYVPCSFCDSTQ >_5 CHER*TS*SFIPHSLV**AITQLNCNTLQHTSYILYNDKFQQKTCFSSSVDKFRKIPKK* SPTNRGVSRNL*RGGSASFCLENGCV*NVTCSIKNPPD*HK**RTRWRK*MCSKGGYLIC AEGAKKILLKPLPFCCKTPPFYKPN*IFKLPRTLSCYWVTTAKLILRRNNNLYVVNCVIM SIDASVISYIVDVKNKLELRSLFFL**YPX >_6 LSRKINKLIIHSPLTSIISHYTIELQHSTTH*LHFI**QISTKNLFFQ*CR*V*KNSKKI ITYKQGRIQEFIKGGVRKFLLRKWMRIKRNVLDKKPP*LA*IITHTLAQIDVFKGRLSNL RRRRKKNFA*TPTFLL*NPPVLQT*LNF*ITTYVVMLLGYDGEAYFAT*QQFICG*LRHN VH*RVRY*LHRGCKKQVRITFLVLFVIVPX possible C-term (no this is seq 84) >rciad099g22 Length = 700 Score = 37.5 bits (85), Expect = 0.009 Identities = 16/31 (51%), Positives = 23/31 (73%) Frame = -1 Query: 29 VPDGKDYIDDAPLHGVTLAPKPFSVRIKRRA 59 +PD D++D+ P G+ LAPK + V+IKRRA Sbjct: 700 LPDDMDHLDEKPGPGIILAPKIYRVQIKRRA 608 >cign080d21 = seq 84 TTCGGACGAGGCAGATGTTGGGTGGTTATCGCATCCCAAAGCGCACAAGCATAATGGCATGCTACCATTCTATTCATTTT GATCCAAAATTTTGGAAAAATCCCAACGAATTTGATCCATGCAATTTTCTTGATAGTAGTAAAAAAGTTTGTATTCCTGA TGCATTTATGCCGTTTGGTGGAGGTAATGTTAACACTTTTCTTATTATTTGCATGTTCAATAATGTAGCAGTTTAGAGAT AAATAGACTAACACAAAAATTTACATTAAATAAACATTATTATTTTTAATTACATATTTTATTACAATAACAAAAAAATT GCTTTAAAAAATTTGAAGTTATCTATTGGTAACATATAACAAAAAATAGCTTTAGAACTTTTTTTATTCATCTATTTAAA TACGATAAAAAATAGCTTTAAAAATATTCCCCCCATAGTTACATACATGGTAACTAAGCACGGCGCAAAACACCCATGTT ATAACGACTCTCTTGTCATGCGATGCTGAATAAGTTAATCATTCATTACCCACACCCAAAATAAACCATTACCCTATCAA GTTGAATAAATCAAACCTGCTTCATCATCGCGTGGCCAGAAAACGACAGTCGTTATAACCTATAACGGGATGTTTTTTTG TACACCTCGTGCCAGCTTACGAGTTACCACGAATGTAACTTTGTGGTCATTTTATTTTTATGTTTTGTATGTACAGCTGT CA >_1 FGRGRCWVVIASQSAQA*WHATILFILIQNFGKIPTNLIHAIFLIVVKKFVFLMHLCRLV EVMLTLFLLFACSIM*QFRDK*TNTKIYIK*TLLFLITYFITITKKLL*KI*SYLLVTYN KK*L*NFFYSSI*IR*KIALKIFPP*LHTW*LSTAQNTHVITTLLSCDAE*VNHSLPTPK INHYPIKLNKSNLLHHRVARKRQSL*PITGCFFVHLVPAYELPRM*LCGHFIFMFCMYSC X >_2 SDEADVGWLSHPKAHKHNGMLPFYSF*SKILEKSQRI*SMQFS****KSLYS*CIYAVWW R*C*HFSYYLHVQ*CSSLEINRLTQKFTLNKHYYF*LHILLQ*QKNCFKKFEVIYW*HIT KNSFRTFFIHLFKYDKK*L*KYSPHSYIHGN*ARRKTPML*RLSCHAMLNKLIIHYPHPK *TITLSS*INQTCFIIAWPENDSRYNL*RDVFLYTSCQLTSYHECNFVVILFLCFVCTAV X >_3 RTRQMLGGYRIPKRTSIMACYHSIHFDPKFWKNPNEFDPCNFLDSSKKVCIPDAFMPFGG GNVNTFLIICMFNNVAV*R*ID*HKNLH*INIIIFNYIFYYNNKKIALKNLKLSIGNI*Q KIALELFLFIYLNTIKNSFKNIPPIVTYMVTKHGAKHPCYNDSLVMRC*IS*SFITHTQN KPLPYQVE*IKPASSSRGQKTTVVITYNGMFFCTPRASLRVTTNVTLWSFYFYVLYVQLS >rcign080d21_6 GSGITLAPKVYQVKIKRRA*FNTELPNLYPFNLPTFSLEAFWLIVYYMQTSLIPSPFL*G CLVNNILYAIAFHLLTFFVGFFG**HITCST*CKIIILSVTPECLLPPVSEALP*HML*A LT*FLQHSNKVTNMHIKLMHYIFFIFHVISIQYYTNR*LYIVKFLILIQY*VSFLCLIML T*LVPFISSCMKHRLF*SCIRKYYVT*KSYSSYKC*IPMHLNVYNGT*RYSVELF*MCFF INAMTLX Possible savignyi ortholog of seq 111 YSFTIVYTKIDQWLHNFNVKGKIFENKLHTSGLIHCSEEDQKVAGYEIPKGTSIMPCYHS IHFDPKFWKNPNQFDPTNFLENDGKVGTRTAFMPFGGG LRICVGMNVAKQELFLFFVAMFQKFSMNVPDGKDYIDDAPLHGVTLAPKPFSVRIKRRA* >scf/ciona01/G126/seq_dir/hrs/G126P64154F.T0/G126P64154FG9.T0.seq 751 file 1 751 ABI Length = 751 Minus Strand HSPs: Score = 240 (84.5 bits), Expect = 4.6e-20, P = 4.6e-20 Identities = 42/58 (72%), Positives = 47/58 (81%), Frame = -3 Query: 1 QMLGGYRIPKRTSIMACYHSIHFDPKFWKNPNEFDPCNFLDSNKKVCIPDAFMPFGGG 58 Q + GY IPK TSIM CYHSIHFDPKFWKNPN+FDP NFL+++ KV AFMPFGGG Sbjct: 449 QKVAGYEIPKGTSIMPCYHSIHFDPKFWKNPNQFDPTNFLENDGKVGTRTAFMPFGGG 276 >scf/ciona01/G126/seq_dir/hrs/G126P64154F.T0/G126P64154FG9.T0.seq 751 0 751 ABI CCTTTTCGAGTACTGATATCCTNCGCTTCTTGTGGTGGGAATTCCTCAAG GCGGCAGCTACAATAGGATGTGTGTTATATTAAATNNTTTGTTATGTGGT GGTAGAAATATAAGAAATTTATATTTGTATAAGCCAGGATATATTAGGTG AGAAGTTTTTTTTTTTATAAATTTGTCATTTTTTTAGAAAAAAATTGTGG AAGCCAATTACCATTTGTATGTATAAATAATCCCAGGAAAATTTTTAACT TAATTTAATTTAAATTTAATAAATTACCTCCTCCAAATGGCATAAAGGCA GTGCGAGTACCAACTTTCCCATCATTCTCCAAAAAGTTTGTTGGGTCAAA TTGATTAGGATTTTTCCAAAACTTGGGATCGAAATGAATAGAATGGTAGC AGGGCATGATGGATGTGCCTTTAGGAATTTCATATCCAGCGACTTTCTGG TCTTCTTCTGAACAATGTATCAAACCTGAAGTGTGGAGTTTATTTTCGAA AATTTTCCCTTTAACATTAAAGTTGTGTAACCACTGGTCTATCTTGGTAT AAACAATTGTAAAAGAATAAGGACTTATTAATTAAGAGATTTTGACAAGA GCATCAATTCTTCTATCAAACTTTAGTCTTTGTTTTAAACTGAAGAAACT TATTGTTCTATAACAAGTCTATANAGAAGAGTTAGGAAAGGATGTACGTT TACTGCTATATTTGTTTAGTAATATAATAGTCTAGCCGGGTATAGTAATA A >_4 YYYTRLDYYITKQI*Q*TYILS*LFXIDLL*NNKFLQFKTKTKV**KN*CSCQNLLINKS LFFYNCLYQDRPVVTQL*C*RENFRK*TPHFRFDTLFRRRPESRWI*NS*RHIHHALLPF YSFRSQVLEKS*SI*PNKLFGE*WESWYSHCLYAIWRR*FIKFKLN*VKNFPGIIYTYKW *LASTIFF*KNDKFIKKKTSHLIYPGLYKYKFLIFLPPHNKXFNITHILL*LPP*GIPTT RSXGYQYSKR >_5 LLLYPARLLYY*TNIAVNVHPFLTLLYRLVIEQ*VSSV*NKD*SLIEELMLLSKSLN**V LILLQLFIPR*TSGYTTLMLKGKFSKINSTLQV*YIVQKKTRKSLDMKFLKAHPSCPATI LFISIPSFGKILINLTQQTFWRMMGKLVLALPLCHLEEVIY*I*IKLS*KFSWDYLYIQM VIGFHNFFLKK*QIYKKKNFSPNISWLIQI*ISYISTTT*QXI*YNTHPIVAAALRNSHH KKRRISVLEKX >_6 ITIPG*TIILLNKYSSKRTSFPNSSX*TCYRTISFFSLKQRLKFDRRIDALVKIS*LISP YSFTIVYTKIDQWLHNFNVKGKIFENKLHTSGLIHCSEEDQKVAGYEIPKGTSIMPCYHS IHFDPKFWKNPNQFDPTNFLENDGKVGTRTAFMPFGGG NLLNLN*IKLKIFLGLFIHTNG NWLPQFFSKKMTNL*KKKLLT*YILAYTNINFLYFYHHITXXLI*HTSYCSCRLEEFPPQ EAXDISTRKG >scf/ciona01/G126/seq_dir/hrs/G126P606724R.T0/G126P606724RC10.T0.seq 728 file 19 0 728 ABI Length = 728 Plus Strand HSPs: Score = 354 (124.6 bits), Expect = 4.0e-32, P = 4.0e-32 Identities = 77/123 (62%), Positives = 87/123 (70%), Frame = +3 Query: 53 SIMPCYHSIHFDPKFWKNPNQFDPTNFLENDGKVGTRTAFMPFGGGNLLNLN*IKLKIFL 112 +++P Y S+ +FWKNPNQFDPTNFLENDGKVGTRTAFMPFGGGNLLNLN*IKLKIFL Sbjct: 54 ALLPFY-SLR--SQFWKNPNQFDPTNFLENDGKVGTRTAFMPFGGGNLLNLN*IKLKIFL 224 Query: 113 GLFIHTNGNWLPQFFSKKMTNL*KKKLLT*YILAYTNINFLYFYHHITXXLI*HTSYCSC 172 GLFIHTNGNWLPQFF K + KK Y Y + Y Y T + + YCSC Sbjct: 225 GLFIHTNGNWLPQFFLKNDKFI-KKNSHPSYPGLY-KYKY*YLY---T*QNLYNNIYCSC 389 Query: 173 RLE 175 L+ Sbjct: 390 ALD 398 >scf/ciona01/G126/seq_dir/hrs/G126P606724R.T0/G126P606724RC10.T0.seq 728 0 728 ABI AATTTTGACACTGAAACTCCATGTTGTGGAAATTCCCAAGGCACATCCAT CATGCCCTGCTACCATTCTATTCACTTCGATCCCAATTTTGGAAAAATCC TAATCAATTTGACCCAACAAACTTTTTGGAGAATGATGGGAAAGTTGGTA CTCGCACTGCCTTTATGCCATTTGGGGGAGGTAATTTATTAAATTTAAAT TAAATTAAATTAAAAATTTTCCTGGGATTATTTATACATACAAATGGTAA TTGGCTTCCACAATTTTTTCTAAAAAATGACAAATTTATAAAAAAAAATT CTCACCCATCATATCCTGGCTTATACAAATATAAATATTAATATTTATAC ACATAACAAAATTTATATAACAACATCTATTGTAGCTGCGCATTGGATCA CACAAAATAATCTTAGTACATTGTACCGATAATATATTTATATATAAATG GCAATTTCTTGGATTGCCTGGTGTGGAGTTATAACAGGTACATTGAGAAT CACACACACATGTTGAAGTTAAACTGTAGCCTATGCATTTTAATGCAATT TTTTACAAAATAACAGGGACTTATTCCACTTCTGAGATAAAAATGTCTCC ACTAATTTCATTATTTATTTCTTCAGAATGTTTTGTTGTGATTTTTAAAG GATGTGAAAAGCTACTTAAATCTAAGGCAGTTCCATCAGTATTAAGTTTT CCAGTATATCTTATGCATGTAACTNTTN >_1 NFDTETPCCGNSQGTSIMPCYHSIHFDPNFGKILINLTQQTFWRMMGKLVLALPLCHLGE VIY*I*IKLN*KFSWDYLYIQMVIGFHNFF*KMTNL*KKILTHHILAYTNININIYTHNK IYITTSIVAAHWITQNNLSTLYR*YIYI*MAISWIAWCGVITGTLRITHTC*S*TVAYAF *CNFLQNNRDLFHF*DKNVSTNFIIYFFRMFCCDF*RM*KAT*I*GSSISIKFSSISYAC NXX >_2 ILTLKLHVVEIPKAHPSCPATILFTSIPILEKS*SI*PNKLFGE*WESWYSHCLYAIWGR *FIKFKLN*IKNFPGIIYTYKW*LASTIFSKK*QIYKKKFSPIISWLIQI*ILIFIHITK FI*QHLL*LRIGSHKIILVHCTDNIFIYKWQFLGLPGVEL*QVH*ESHTHVEVKL*PMHF NAIFYKITGTYSTSEIKMSPLISLFISSECFVVIFKGCEKLLKSKAVPSVLSFPVYLMHV TXX >_3 F*H*NSMLWKFPRHIHHALLPFYSLRSQFWKNPNQFDPTNFLENDGKVGTRTAFMPFGGG NLLNLN*IKLKIFLGLFIHTNGNWLPQFFLKNDKFIKKNSHPSYPGLYKYKY*YLYT*QN LYNNIYCSCALDHTK*S*YIVPIIYLYINGNFLDCLVWSYNRYIENHTHMLKLNCSLCIL MQFFTK*QGLIPLLR*KCLH*FHYLFLQNVLL*FLKDVKSYLNLRQFHQY*VFQYILCM* LX >scf/ciona01/G126/seq_dir/hrs/G126P600351F.T0/G126P600351FC11.T0.seq 712 file 9 0 712 ABI Length = 712 Plus Strand HSPs: Score = 295 (103.8 bits), Expect = 7.3e-26, P = 7.3e-26 Identities = 58/60 (96%), Positives = 59/60 (98%), Frame = +1 Query: 1 FI*QHLL*LRIGSHKIILVHCTDNIFIYKWQFLGLPGVEL*QVH*ESHTHVEVKL*PMHF 60 FI*QHLL*L +GSHKIILVHCTDNIFIYKWQFLGLPGVEL*QVH*ESHTHVEVKL*PMHF Sbjct: 391 FI*QHLL*LCLGSHKIILVHCTDNIFIYKWQFLGLPGVEL*QVH*ESHTHVEVKL*PMHF 570 >scf/ciona01/G126/seq_dir/hrs/G126P600351F.T0/G126P600351FC11.T0.seq 712 0 712 ABI ACTTTGGCGCTATGAATCCATCTTCCTGTGGTGGNATTCCCANAAGTCGC TGGTTATGAAATTCCCAAGGCACATCCATCATGCCCTGTTACCATTCTAT TCATTTCGATCCCAGTTTTGGAAAAATCCCAATCAATTTGACCCAACAAA CTTTTTGGAGAATGATGGGAAAGTTGGTACTCGCACTGCCTTTATGCCAT TTGGGGGAGGTAATTTATTAAATTTAAATTAAATTAAATTAAAAATTTTC CTGGGATTATTTATACATACAAATGGTAATTGGCTTCCACAATTTTTTCT AAAAAAATGACAAATTTATAAAAAAAATTCTCACCCAATATATCCTGGCT TATACAAATATAAATATTAATATTTATACACATAACAAAATTTATATAAC AACATCTATTGTAGCTGTGTCTTGGATCACACAAAATAATCTTAGTACAT TGTACCGATAATATATTTATATATAAATGGCAATTTCTTGGATTGCCTGG TGTGGAGTTATAACAGGTACATTGAGAATCACACACACATGTTGAAGTTA AACTGTAGCCTATGCATTTTAATGCAATTTTTTACAAAATAACAGGGACT TATTCCACTTCTGAGATAAAAATGTCTCCACTAATTTCATTATTTATTTC TTCAGAATGTNTTTGTTGTGATTTTTAAAGGATGTGAAAAGCTACTTAAA TCTAAGGCAGTA >_1 TLAL*IHLPVVXFPXVAGYEIPKAHPSCPVTILFISIPVLEKSQSI*PNKLFGE*WESWY SHCLYAIWGR*FIKFKLN*IKNFPGIIYTYKW*LASTIFSKKMTNL*KKFSPNISWLIQI *ILIFIHITKFI*QHLL*LCLGSHKIILVHCTDNIFIYKWQFLGLPGVEL*QVH*ESHTH VEVKL*PMHFNAIFYKITGTYSTSEIKMSPLISLFISSEC XCCDF*RM*KAT*I*GSX >_2 LWRYESIFLWWXSXKSLVMKFPRHIHHALLPFYSFRSQFWKNPNQFDPTNFLENDGKVGT RTAFMPFGGGNLLNLN*IKLKIFLGLFIHTNGNWLPQFFLKK*QIYKKNSHPIYPGLYKY KY*YLYT*QNLYNNIYCSCVLDHTK*S*YIVPIIYLYINGNFLDCLVWSYNRYIENHTHM LKLNCSLCILMQFFTK*QGLIPLLR*KCLH*FHYLFLQNVFVVIFKGCEKLLKSKAV >_3 FGAMNPSSCGGIPXSRWL*NSQGTSIMPCYHSIHFDPSFGKIPINLTQQTFWRMMGKLVL ALPLCHLGEVIY*I*IKLN*KFSWDYLYIQMVIGFHNFF*KNDKFIKKILTQYILAYTNI NINIYTHNKIYITTSIVAVSWITQNNLSTLYR*YIYI*MAISWIAWCGVITGTLRITHTC *S*TVAYAF*CNFLQNNRDLFHF*DKNVSTNFIIYFFRMXLL*FLKDVKSYLNLRQ >scf/ciona01/G126/seq_dir/hrs/G126P613771F.T0/G126P613771FC2.T0.seq 725 0 725 ABI Length = 725 Plus Strand HSPs: Score = 434 (152.8 bits), Expect = 1.3e-40, P = 1.3e-40 Identities = 85/87 (97%), Positives = 86/87 (98%), Frame = +1 Query: 1 QHLL*LCLGSHKIILVHCTDNIFIYKWQFLGLPGVEL*QVH*ESHTHVEVKL*PMHFNAI 60 QHLL*L +GSHKIILVHCTDNIFIYKWQFLGLPGVEL*QVH*ESHTHVEVKL*PMHFNAI Sbjct: 256 QHLL*LRIGSHKIILVHCTDNIFIYKWQFLGLPGVEL*QVH*ESHTHVEVKL*PMHFNAI 435 Query: 61 FYKITGTYSTSEIKMSPLISLFISSEC 87 FYKITGTYSTSEIKMSPLISLFISSEC Sbjct: 436 FYKITGTYSTSEIKMSPLISLFISSEC 516 >scf/ciona01/G126/seq_dir/hrs/G126P613771F.T0/G126P613771FC2.T0.seq 725 0 725 ABI ATATCGCCCTGTGGTGGAATTCGGGAAAGTTGGTACTCGCACTGCCTTTA TGCCATTTGGGGGAGGTAATTTATTAAATTTAAATTAAATTAAATTAAAA ATTTTCCTGGGATTATTTATACATACAAATGGTAATTGGCTTCCACAATT TTTTCTAAAAAATGACAAATTTATAAAAAAAAATTCTCACCCATCATATC CTGGCTTATACAAATATAAATATTAATATTTATACACATAACAAAATTTA TATAACAACATCTATTGTAGCTGCGCATTGGATCACACAAAATAATCTTA GTACATTGTACCGATAATATATTTATATATAAATGGCAATTTCTTGGATT GCCTGGTGTGGAGTTATAACAGGTACATTGAGAATCACACACACATGTTG AAGTTAAACTGTAGCCTATGCATTTTAATGCAATTTTTTACAAAATAACA GGGACTTATTCCACTTCTGAGATAAAAATGTCTCCACTAATTTCATTATT TATTTCTTCAGAATGTTTTGTTGTGATTTTTAAAGGATGTGAAAAGCTAC TTAAATCTAAGGCAGTTCCATCAGTATTAAGTTTTCCAGTATATCTTATG CATGTAACTTTTTACCTGTAAAAGTAAGATAATGCTGGTCAAGTTTTTCT ACTGTTAAGTGTAGCGGATTTAAATACCTACTGTTTTAATAATAAATATG CTGCATGATAACTTTAAAAAAATTA >scf/ciona01/G126/seq_dir/hrs/G126P613771F.T0/G126P613771FC2.T0.seq_1 725 0 725 ABI ISPCGGIRESWYSHCLYAIWGR*FIKFKLN*IKNFPGIIYTYKW*LASTIFSKK*QIYKK KFSPIISWLIQI*ILIFIHITKFI*QHLL*LRIGSHKIILVHCTDNIFIYKWQFLGLPGV EL*QVH*ESHTHVEVKL*PMHFNAIFYKITGTYSTSEIKMSPLISLFISSECFVVIFKGC EKLLKSKAVPSVLSFPVYLMHVTFYL*K*DNAGQVFLLLSVADLNTYCFNNKYAA**L*K NX >scf/ciona01/G126/seq_dir/hrs/G126P613771F.T0/G126P613771FC2.T0.seq_2 725 0 725 YRPVVEFGKVGTRTAFMPFGGGNLLNLN*IKLKIFLGLFIHTNGNWLPQFFLKNDKFIKK NSHPSYPGLYKYKY*YLYT*QNLYNNIYCSCALDHTK*S*YIVPIIYLYINGNFLDCLVW SYNRYIENHTHMLKLNCSLCILMQFFTK*QGLIPLLR*KCLH*FHYLFLQNVLL*FLKDV KSYLNLRQFHQY*VFQYILCM*LFTCKSKIMLVKFFYC*V*RI*IPTVLIINMLHDNFKK IX >scf/ciona01/G126/seq_dir/hrs/G126P613771F.T0/G126P613771FC2.T0.seq_3 725 0 725 IALWWNSGKLVLALPLCHLGEVIY*I*IKLN*KFSWDYLYIQMVIGFHNFF*KMTNL*KK ILTHHILAYTNININIYTHNKIYITTSIVAAHWITQNNLSTLYR*YIYI*MAISWIAWCG VITGTLRITHTC*S*TVAYAF*CNFLQNNRDLFHF*DKNVSTNFIIYFFRMFCCDF*RM* KAT*I*GSSISIKFSSISYACNFLPVKVR*CWSSFSTVKCSGFKYLLF***ICCMITLKK L >scf/ciona01/G126/seq_dir/hrs/G126P64145R.T0/G126P64145RH3.T0.seq 722 file 1 722 ABI Length = 722 Minus Strand HSPs: Score = 175 (61.6 bits), Expect = 3.7e-13, P = 3.7e-13 Identities = 35/35 (100%), Positives = 35/35 (100%), Frame = -1 Query: 26 VKVR*CWSSFSTVKCSGFKYLLF***ICCMITLKK 60 VKVR*CWSSFSTVKCSGFKYLLF***ICCMITLKK Sbjct: 722 VKVR*CWSSFSTVKCSGFKYLLF***ICCMITLKK 618 >scf/ciona01/G126/seq_dir/hrs/G126P64145R.T0/G126P64145RH3.T0.seq 722 0 722 ABI ATATTTAAGACGACNTGAAGACTCCACTGTTGGTGGNAATTCAATATATC ATTCTTTGTTAATATATATCAGTTGTTTTTTTCATTAACTTTATTTAAAA AAAATGTCTTAGTAATACAACCTATCGGAGTATCAATACTTACTTTTCTA CTTACACAAACCTCTAAAATAATATACTAAAAACAATAAAAAAATACATG TTTCCCTAACCTAAGCTATACGAACTGGTTACCACTAGATTCTCATTTGG AAGATATTTTCCATTGTTGTTCATGTGTTGACTTTTTCATATTTTAAACT GTTTCAGTTCCAATGTAATAAGTTTTCCAGTTTCCAACAGCACCTGATAA AAACGAAAAGTATGGCAATGGCACAAGCCATAACTATCTGTTGGACTATG CACTGTGCACCTTACACCAAAAATATAGATTTTGAGGTCAGCATATAAAG AATATTTTAAACTTTTACTTTTTTGTGTGACCCTGTATTTTGCACCAGTA GTAACACTTTTTGGTTGTTTTTTACTTAAAATAACTTTGACTTTAGGTTT ACTATCATTTTTAGAATTACTACACAACGGATTTTATAAAACACCGATAT TCTGTATTATTATTGAATTTTTTTAAAGTTATCATGCAGCATATTTATTA TTAAAACAGTAGGTATTTAAATCCGCTACACTTAACAGTAGAAAAACTTG ACCAGCATTATCTTACTTTTAC >_4 KSKIMLVKFFYC*V*RI*IPTVLIINMLHDNFKKIQ**YRISVFYKIRCVVILKMIVNLK SKLF*VKNNQKVLLLVQNTGSHKKVKV*NILYMLTSKSIFLV*GAQCIVQQIVMACAIAI LFVFIRCCWKLENLLHWN*NSLKYEKVNT*TTMENIFQMRI*W*PVRIA*VRETCIFLLF LVYYFRGLCK*KSKY*YSDRLYY*DIFFK*S**KKQLIYINKE*YIEXPPTVESSXRLKY >_5 *K*DNAGQVFLLLSVADLNTYCFNNKYAA**L*KNSIIIQNIGVL*NPLCSNSKNDSKPK VKVILSKKQPKSVTTGAKYRVTQKSKSLKYSLYADLKIYIFGVRCTVHSPTDSYGLCHCH TFRFYQVLLETGKLITLELKQFKI*KSQHMNNNGKYLPNENLVVTSSYSLG*GNMYFFIV FSILF*RFV*VEK*VLILR*VVLLRHFF*IKLMKKTTDIY*QRMIY*IXTNSGVFXSS*I X >_6 VKVR*CWSSFSTVKCSGFKYLLF***ICCMITLKKFNNNTEYRCFIKSVV**F*K***T* SQSYFK*KTTKKCYYWCKIQGHTKK*KFKIFFIC*PQNLYFWCKVHSA*SNR*LWLVPLP YFSFLSGAVGNWKTYYIGTETV*NMKKSTHEQQWKISSK*ESSGNQFV*LRLGKHVFFYC F*YIILEVCVSRKVSIDTPIGCITKTFFLNKVNEKNN*YILTKNDILNXHQQWSLXVVLN X >scf/ciona01/G126/seq_dir/hrs/G126P611543R.T0/G126P611543RD6.T0.seq 709 file 26 0 709 ABI Length = 709 Plus Strand HSPs: Score = 131 (46.1 bits), Expect = 2.9e-08, P = 2.9e-08 Identities = 33/51 (64%), Positives = 36/51 (70%), Frame = +3 Query: 1 F*YIILEVCVSRKVSIDTPIGCITKTFFLN-KVNEK-----NN*YILTKND 45 F*YIILEVCVSRKVSIDT IGCITKT F + +K N YIL KN+ Sbjct: 117 F*YIILEVCVSRKVSIDTLIGCITKTIFFK*SL*KKQLIYINKEYILDKNN 269 Score = 85 (29.9 bits), Expect = 0.0046, P = 0.0046 Identities = 17/22 (77%), Positives = 19/22 (86%), Frame = +1 Query: 23 ITKTFFLNKVNEKNN*YILTKN 44 + + FFLNKV EKNN*YILTKN Sbjct: 184 LLRQFFLNKVYEKNN*YILTKN 249 >scf/ciona01/G126/seq_dir/hrs/G126P611543R.T0/G126P611543RD6.T0.seq 709 0 709 ABI ATTCTATATATGAAAAAGTCACACCTGAACAACAATGGAAAATATCTTCC AAATGAGAATCTAGTGGTAACCAGTTCGTATAGCTTAGGTTAGGGAAACA TGTATTTTTTTATTGTTTTTAGTATATTATTTTAGAGGTTTGTGTAAGTA GAAAAGTAAGTATTGATACTCTGATAGGTTGTATTACTAAGACAATTTTT TTTAAATAAAGTTTATGAAAAAAACAACTGATATATATTAACAAAGAATA TATATTAGATAAAAACAACACCACAGCATGTTTATTACCTCTTTATCTTA CAGACGGCACAAATATCATTAAACTTGCACCTGGCTTAAATATCTTAAAC ACATGGTTCTTTTCAAAATAATTCGGTAAAGGTTAAACAAATAATGGTAG ATGTTTTAAATGATAAGTATACTGTACTACACAATAACAACTATACCTAT TCAACCATCAATACCACCTATGAAAATTCATTTTCATTTTTCACCATCGG TGGTTACAATTTTTCATTAAAGCCTGTGCATATCCTCTGGGTTATACATC TTAACCGGGTCAGTACTGGATACTGACAAACCAATTGTTTAAAAGGATTA CGCATCTGTGTTGGAATGAATGTTGCCAAGCAGGAGCTTTTCCTCTTCTT CGTAGCCATGGTTTCAGAAGTTTTCCATGAATGTTCCGGATGGTAAGGAT TACATTGAT >_1 ILYMKKSHLNNNGKYLPNENLVVTSSYSLG*GNMYFFIVFSILF*RFV*VEK*VLIL**V VLLRQFFLNKVYEKNN*YILTKNIY*IKTTPQHVYYLFILQTAQISLNLHLA*IS*THGS FQNNSVKVKQIMVDVLNDKYTVLHNNNYTYSTINTTYENSFSFFTIGGYNFSLKPVHILW VIHLNRVSTGY*QTNCLKGLRICVGMNVAKQELFLFFVAMVSEVFHECSGW*GLH*X >_2 FYI*KSHT*TTMENIFQMRI*W*PVRIA*VRETCIFLLFLVYYFRGLCK*KSKY*YSDRL YY*DNFF*IKFMKKTTDIY*QRIYIR*KQHHSMFITSLSYRRHKYH*TCTWLKYLKHMVL FKIIR*RLNK*W*MF*MISILYYTITTIPIQPSIPPMKIHFHFSPSVVTIFH*SLCISSG LYILTGSVLDTDKPIV*KDYASVLE*MLPSRSFSSSS*PWFQKFSMNVPDGKDYID >_3 SIYEKVTPEQQWKISSK*ESSGNQFV*LRLGKHVFFYCF*YIILEVCVSRKVSIDTLIGC ITKTIFFK*SL*KKQLIYINKEYILDKNNTTACLLPLYLTDGTNIIKLAPGLNILNTWFF SK*FGKG*TNNGRCFK**VYCTTQ*QLYLFNHQYHL*KFIFIFHHRWLQFFIKACAYPLG YTS*PGQYWILTNQLFKRITHLCWNECCQAGAFPLLRSHGFRSFP*MFRMVRITL Red seq is match to seq 84 SEQUENCE 84 JOINT AT HEME PFGGG OR PFVSG 53% TO 2C8 Length = 87 Score = 102 (35.9 bits), Expect = 6.5e-09, P = 6.5e-09 Identities = 19/24 (79%), Positives = 23/24 (95%) Query: 1 LRICVGMNVAKQELFLFFVAMVSE 24 LRICVGMN+AKQELFLFFVA++ + Sbjct: 30 LRICVGMNIAKQELFLFFVAILQK 53 >scf/ciona01/G126/seq_dir/hrs/G126P63017F.T0/G126P63017FB2.T0.seq 727 file 0 727 ABI Length = 727 Plus Strand HSPs: Score = 172 (60.5 bits), Expect = 7.6e-13, P = 7.6e-13 Identities = 35/37 (94%), Positives = 35/37 (94%), Frame = +1 Query: 1 LRICVGMNVAKQELFLFFVAX-QKFSMNVPDGKDYID 36 LRICVGMNVAKQELFLFFVA QKFSMNVPDGKDYID Sbjct: 259 LRICVGMNVAKQELFLFFVAMFQKFSMNVPDGKDYID 369 >scf/ciona01/G126/seq_dir/hrs/G126P63017F.T0/G126P63017FB2.T0.seq 727 0 727 ABI AAAATGGGGTACAGAGCTTCCTTTCTGTNGGTGGAAAATACGGTTAAACA AATAATGGTAGATGTTTTAAATGATAAGTATACTGTACTACACAATAACA ACTATACCTATTCAACCATCAATACCACCTATGAAAATTCATTTTCATTT TTCACCATCGGTGGTTACAATTTTTCATTAAAGCCTGTGCATATCCTCTG GGTTATACATCTTAACCGGGTCAGTACTGGATACTGACAAACCAATTGTT TAAAAGGATTACGCATCTGTGTTGGAATGAATGTTGCCAAGCAGGAGCTT TTCCTCTTCTTCGTAGCCATGTTTCAGAAGTTTTCCATGAATGTTCCGGA TGGTAAGGATTACATTGATGATGCTCCACTTCACGGAGTCACACTTGCTC CAAAGCCTTTCTCAGTGCGGATCAAAAGAAGAGCTTGATGTTCATTTCAT GCAACCTGTCATTTTTTAATTTAAAATATTTCCCAATTTGTATCAGTATA CTACACTACATATATGTTATTCACATTTGGTTTAATTCTTCCCCCTAAAC GGTTCTAAATTGTTTAAAAATGCTTAATTTATTACCTGGTAAAAATTGAT ATCTTAGGTCGACAAATTAAAACTAGCAAACTTAAACCAGGACATGTATT GTTTTCAATCATTTTGAGTTTTTTTTTACATATCGATTCAAGTGGATAAA ACCTTAGAAAAAAGAAAAGAAATCTTT >_1 KMGYRASFLXVENTVKQIMVDVLNDKYTVLHNNNYTYSTINTTYENSFSFFTIGGYNFSL KPVHILWVIHLNRVSTGY*QTNCLKG LRICVGMNVAKQELFLFFVAMFQKFSMNVPDGKD YIDDAPLHGVTLAPKPFSVRIKRRA*CSFHATCHFLI*NISQFVSVYYTTYMLFTFGLIL PPKRF*IV*KCLIYYLVKIDILGRQIKTSKLKPGHVLFSIILSFFLHIDSSG*NLRKKKR NLX >_2 KWGTELPFCXWKIRLNK*W*MF*MISILYYTITTIPIQPSIPPMKIHFHFSPSVVTIFH* SLCISSGLYILTGSVLDTDKPIV*KDYASVLE*MLPSRSFSSSS*PCFRSFP*MFRMVRI TLMMLHFTESHLLQSLSQCGSKEELDVHFMQPVIF*FKIFPNLYQYTTLHICYSHLV*FF PLNGSKLFKNA*FITW*KLIS*VDKLKLANLNQDMYCFQSF*VFFYISIQVDKTLEKRKE IF >_3 NGVQSFLSVGGKYG*TNNGRCFK**VYCTTQ*QLYLFNHQYHL*KFIFIFHHRWLQFFIK ACAYPLGYTS*PGQYWILTNQLFKRITHLCWNECCQAGAFPLLRSHVSEVFHECSGW*GL H**CSTSRSHTCSKAFLSADQKKSLMFISCNLSFFNLKYFPICISILHYIYVIHIWFNSS P*TVLNCLKMLNLLPGKN*YLRSTN*N*QT*TRTCIVFNHFEFFFTYRFKWIKP*KKEKK S >sequence 232 new seq like 112 probable pseudogene MITPLDILSLETWILILTSFILVR exon 1 from DEV38178.x1 IYIHKKWQVLKNINIPHDPPTILGVGNMMGIIKDPNQ (0) exon 2 from LQW68739.y1 LYIQKKWQLLKNINIPHDPPTILGVGNMMGIIKDPNQ exon 2 cigd043j06 MFLSYFKMKKKYGLVYG exon 3 cigd043j06 AYSWLTPSITIADPEILKQIFIKEFSTFPDRQ exon 4 cigd043j06 KALLDVNGKEMNTALTSVTGSQWKRIR exon 5 RNTLSPTFSSSKLKEMFGIVEDCADSFVQNIGTINSDGDGRFDVSL exon 6 GELTYETVQRLKHLTQCLNESLRL* exon 12 truncated MLDMNEIDPMIFQPFGAGPLNC exon 14 and 15 fused IGMRFALLEIKITFAKLLQKFYLDVCEDTPAPPLDVTFKISMKPKDQIFLKVTKINE* >LQW161860.y1_1 VHRVGPCMSNTKLSN*DILFSLQCWVLNQALGTIS*FR*QSNSIYCNLGLNQNL*TVLAK *P*KLHSLSCISMRAI*CGKIKIFYQAK*RCR*KLTC*MTPYTFQGELTYETVQRLKHLT QCLNESLRL*QCSSTRVGAKFLYAVS*HSKPLFNSGHF*YLYKFCVYFKKVHKIRFLFSI VVFFCQAQKHFTLYGNNKIITTRFIKDLFGILRRNFAFLFYYYMYNCGISRNEVYETEHL CYNDCRYPAILG*TNYLQSFNQILTINTTDK*IESNN*HTDK*FHINVX >LQW161860.y1_2 YIESVPV*ATQSLATKTYYSPYNAGF*TKHWEL*VNSDNKAIQFIAILV*IRIFKLFWPS SHKSYIV*VVFL*EPYNAGKLKFFIKLNDVADEN*HVK*PLTHSRVSLHMKLYKD*NI*R NV*MNLYVYNNVPVPGWVQSFYMQCHNIVNRYLIPDIFNIYINFVFILKKYIKLGFCFLL *YFFAKPKNILPYMVIIKL*QLGL*KISLEY*GVISHFYFIIICTTVV*AGMRCMKQNIY VIMTVVTPPF*DKQITFNHSIKY*QLTLLISELNLTINILISDFI*MC >LQW161860.y1_3 TSSRSLYEQHKA*QLRHIILLTMLGSKPSIGNYKLIQITKQFNLLQSWFKSESLNCFGQV AIKAT*FKLYFYESHIMREN*NFLSS*MTLQMKINMLNDPLHIPG*AYI*NCTKIETFDA MFE*IFTSITMFQYQGGCKVSICSVIT**TVI*FRTFLIFI*ILCLF*KST*N*VFVFYC SIFLPSPKTFYLIW***NYNN*VYKRSLWNIKA*FRIFILLLYVQLWYKQE*GV*NRTSM L**LSLPRHFRINKLPSIIQSNTNN*HY**VN*I*QLTY**VISYKC >cigd043j06 Length = 626 Score = 59.7 bits (142), Expect = 4e-08 Identities = 28/29 (96%), Positives = 29/29 (99%) Frame = +1 Query: 9 QQKALLDVNGKEMNTALTSVTGSQWKRIR 37 +QKALLDVNGKEMNTALTSVTGSQWKRIR Sbjct: 481 RQKALLDVNGKEMNTALTSVTGSQWKRIR 567 Score = 42.6 bits (98), Expect = 0.005 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 142 RNTLSPTFSSSKLKEMFGIV 161 RNTLSPTFSSSKLKEMFGIV Sbjct: 565 RNTLSPTFSSSKLKEMFGIV 624 >cigd043j06_1 opp end = seq 119 so there is a conflict GTRVR*KLF*KRNFTFCTRKLSFKANNINL*KICTKYIKQVCKIV*EIFPPA MITPLDIL SLETWILILTSFILIR LYIQKKWQLLKNINIPHDPPTILGVGNMMGIIKDPNQMFLSYFK MKKKYGLVYGAYSWLTPSITIADPEILKQIFIKEFSTFPDRQKALLDVNGKEMNTALTSV TGSQWKRIRNTLSPTFSSSKLKEMFGIV X >cigd043j06_2 ARGLDKNCFEKETLHSAQEN*VLKPTTLICKRSAPNI*SKFARLFKRYFHQP*LLLLIFY RWKLGF*S*LHSFLSDYTSKRNGNS*KT*IFPMTPLLYSG*EI*WVL*RTPTRCFCPISK *RKNTV*FMAHTVGLHPP*R*LIQKF*NKSLLKSFLHSPTGRKLCLMLMVKK*TLR*QV* LEVNGKE*GTPSLPHSHHQS*KKCLV*LX >cigd043j06_3 HEG*IKTVLKKKLYILHKKTEF*SQQH*SVKDLHQIYKASLQDCLRDISTSHDYSS*YFI VGNLDFNPDFIHSYQIIHPKEMATLKKHKYSP*PPYYTRGRKYDGYYKGPQPDVSVLFQN EEKIRFSLWRIQLAYTLHNDS*SRNFETNLY*RVFYIPRQAESSA*C*W*RNEHCVDKCN WKSMEKNKEHPLSHILIIKVERNVWYS* >LQW68739.x1_4 LFYLNFSTNRKLCLMLMVKK*TLR*QV*LEVNGKE*GK*LYK*IAIFFNFSLIIGKNFVI SNKSCYFLFEEKNCFKQSLYM*NRIFISSFSVY*LWFITLNHL**CKLKMRCFVCIKTKQ KILVLCL*KIKFLRTF*FIKLTLFWRNLSCVSPGTLSLPHSHHQS*KKCLV*LKIVPIVL FKTLEPLTQMVTEDLTFHCELNSLLVIEFLCIVDSLVYFQSKKN*KATKLHIR*LVSEA >LQW68739.x1_5 SFLFKLFYQQKALLDVNGKEMNTALTSVTGSQWKRIRQVTL*INSNFF*FFTYNREKFCH F**KLLFFI*RKKLF*TESLYVK*NFHLKLLSLLTLVYYLKPSLVM*VKNEVFCLY*N*A ENPCFMPLKN*ISANILVY*INSILEKSKLCISRNTLSPTFSSSKLKEMFGIVEDCADSF VQNIGTINSDGDGRFDVSL*VKQFIGH*ILMHS**LSLFSE*KKLKSYKVAYKVACK*SX >LQW68739.x1_6 FFFI*TFLPTESSA*C*W*RNEHCVDKCNWKSMEKNKASDFINK*QFFLIFHL**GKILS FLIKVVIFYLKKKIVLNRVSICKIEFSSQASQFINFGLLP*TIFSDVS*K*GVLFVLKLS RKSLFYASKKLNFCEHFSLLN*LYFGEI*VVYLQEHSLSHILIIKVERNVWYS*RLCR*F CSKHWNH*LRW*RKI*RFIVS*TVYWSLNSYA*LIA*FIFRVKKIKKLQSCI*GSL*VKL >LQW68739.y1_2 LVY*LGILALNQHE*NPVIFFIKTHLNFYIR*IIHLQKVSVPNVLIIGPYSLLIDKLSFS WIIHPQKLSISDLLIFTYLPFIVW*IDKISFS*IIYPQKVSISDLLIFTYLPYIVC*LTK YHFLRIYIHKKWQVLKNINIPHDPPTILGVGNMMGIIKDPNQVSGNITLNIISIIIYHIH YLQYVIVYHI*YYI >LQW168021.x1_4 VPTIFL*NTIFKLTNCNNYSFLYVTLYSKLFL**TFKYYLSILFLK**CATRS*V*VISI CPNINNFARLFKKISPSMILLLRFILETLDLILTSFILVRFESLVFYNKYMVFARLPVTQ RFGV*SLDAATIVNTGLKQLC*LSCSKELIYVFTISMFYTSI*N*YI*SKRFYFVWCVYI YIIIIFFFFKYHSFFY*ACSKIPCFLK*LHYFILFNGH*WQQVNANKVC*GLVVNRL*DI G*T*NIWFIDWQFQL*INMNETQLYFYKNSLEFLY*IDYTPAKSVCTKCAYHRPIFTAD* QVIIFLDYTSTKIVYI*SPYAALPFVSF >LQW168021.x1_5 THDFPVKHYF*VNKL*QLLFFIRNLIFKIISIINV*ILSIHLISQIIVCNQILSMSYFNL PKY*QFCKIV*ENFTIHDTPLEIYP*NLGFNPDFIHSCQV*KFGIL**IYGFCAAARNPE VWGLEPRCSHHCEHWVKATVLTVLLKGTHLCIHDIYVLH*YLKLIYLIKTFLFCLVCIYI YYYYFFFF*VPFFFLLSL**NSMFSKITSLLYIV*WPLMATSKCK*SMLRVSG**AVGYR LDLEHLVY*LAISALNQHE*NPVIFL*KLT*IFILDRLYTCKKCLYQMCLSSAHIHC*LT SYHFLGLYIHKNCLYLISLCCTAVRLLX >LQW168021.x1_6 YPRFSCKTLFLS*QIVTITLFYT*PYIQNYFYNKRLNIIYPSYFSNNSVQPDPKYELFQS AQILTILQDCLRKFHHP*YSS*DLSLKPWI*S*LHSFLSGLKVWYFIINIWFLRGCP*PR GLGFRASMQPPL*TLG*SNCVNCLAQRNSSMYSRYLCFTLVFKINIFNQNVFILFGVYIY ILLLFFFFLSTILFSIELVVKFHVF*NNFTTLYCLMAINGNK*MQIKYVKG*WLIGCRI* VRLRTSGLLIGNFSFKST*MKPSYIFIKTHLNFYIR*IIHLQKVSVPNVLIIGPYSLLID KLSFSWIIHPQKLSISDLLMLHCRSSPX >ciht041a12 Length = 639 Score = 55.4 bits (131), Expect = 1e-07 Identities = 25/27 (92%), Positives = 27/27 (99%) Frame = +3 Query: 1 APPLDVTFKMSLKPKDQIFLKVTKINE 27 APPLDVTFK+S+KPKDQIFLKVTKINE Sbjct: 453 APPLDVTFKISMKPKDQIFLKVTKINE 533 >ciht041a12_1 YGSIPEDMGTRLDAATSVGMFVLVKNS*RELHARSMKQNSGVITTVVALPSEDKRIRFCY *FIALNGLKSLWIPKLKPFWEMAATSL*L*DEKCFVCTECWT*MRLIQ*YSNHLVLVHLT VLE*DLHFLKLKSLSQNFCRNFISMFVKIPLPLHWT*RSKSA*NQKIKYSLKLLK*TSKK WCLLNLGLDHIVI*HDN*NHLVCIL*PVK*CAL >ciht041a12_2 MALSQRIWVQGSMLLLVWACLSLLKIPNGNCMQGV*NRTPVL*QLLLPCPVRIKEYVFVI NSLP*MA*KAYGSQS*NLFGKWLLHPFNCKMKNVLFVQNVGHE*D*SNDIPTIWCWST*L YWNEICTS*N*NHFRKTSAEILSRCL*RYPCPSIGRDVQNQHETKRSNIP*SY*NKRVKS GVF*TLVLTILSYSMIIETIWFVYFNQLNNVL >ciht041a12_3 WLYPRGYGYKARCCY*CGHVCPC*KFLTGIACKEYETELRCYNNCCCLAQ*G*KNTFLLL IHCLKWLKKLMDPKVKTFLGNGCYIPLTVR*KMFCLYR MLDMNEIDPMIFQPFGAGPLNC IGMRFALLEIKITFAKLLQKFYLDVCEDTPAPPLDVTFKISMKPKDQIFLKVTKINE*KV VSFKPWS*PYCHIA**LKPFGLYTLTS*IMCF >rciht041a12 Length = 761 Score = 55.4 bits (131), Expect = 1e-07 Identities = 25/27 (92%), Positives = 27/27 (99%) Frame = -1 Query: 1 APPLDVTFKMSLKPKDQIFLKVTKINE 27 APPLDVTFK+S+KPKDQIFLKVTKINE Sbjct: 656 APPLDVTFKISMKPKDQIFLKVTKINE 576 >rciht041a12 Length = 761 Score = 176 bits (443), Expect = 2e-43 Identities = 92/97 (94%), Positives = 92/97 (94%), Gaps = 5/97 (5%) Frame = -1 Query: 111 GPLNCIGMRFALLEIKITFAKLLQKFYLDVCEDTPAPPLDVTFKISMKPKDQIFLKVTKI 170 GPLNCIGMRFALLEIKITFAKLLQKFYLDVCEDTPAPPLDVTFKISMKPKDQIFLKVTKI Sbjct: 761 GPLNCIGMRFALLEIKITFAKLLQKFYLDVCEDTPAPPLDVTFKISMKPKDQIFLKVTKI 582 Query: 171 NE-KVVSFKPWS-PYCHIA--LKPFGLYTLTS-IMCF 202 NE KVVSFKPWS PYCHIA LKPFGLYTLTS IMCF Sbjct: 581 NE*KVVSFKPWS*PYCHIA**LKPFGLYTLTS*IMCF 471 >rciht041a12 CATTATAGCATACACATTATCATATATAACACAGATTCTCATTCGTTAAATATTTTAAATATAAGAAATAGTCTATAGTA TCACAATAAAATTTACTGCTACATTAGTAATTCTATTTTTATCATTTTAATTTTAATTTTTAAGAGCCATTCTGTCTCAA CACCAAACAATACATTGTAAAGAAGAAAGCTTTAAGGAAAACTGTTAGAAAATACTGATCTTTTAGATATATTTGGTAGA AATTGCATTTAATCTAGTACGCATGGCATAAAATAGAAGTAATGTATATTTATAAAGCAAACAGTATTTTACATTATAAA GGAAATTATGAATTTATGGCTTATCAACATGGTAGAGAGTAACCAAAAATGTAAAATGATCTTTATCAAAATTATATCAA CAGAATTAAAGAAAAATCAAAACTTTAACAAAACCACCGGACAATTTATTTAAATATTCCCTAATAGTTTAAAGCACATT ATTTAACTGGTTAAAGTATACAAACCAAATGGTTTCAATTATCATGCTATATGACAATATGGTCAAGACCAAGGTTTAAA AGACACCACTTTTTACTCGTTTATTTTAGTAACTTTAAGGAATATTTGATCTTTTGGTTTCATGCTGATTTTGAACGTCA CGTCCAATGGAGGGGCAGGGGTATCTTCACAAACATCGAGATAAAATTTCTGCAGAAGTTTTGCGAAAGTGATTTTAATT TCAAGAAGTGCAAATCTCATTCCAATACAGTTAAGTGGACC >rciht041a12_6 GPLNCIGMRFALLEIKITFAKLLQKFYLDVCEDTPAPPLDVTFKISMKPKDQIFLKVTKI NE*KVVSFKPWS*PYCHIA**LKPFGLYTLTS*IMCFKLLGNI*INCPVVLLKF*FFFNS VDIILIKIILHFWLLSTMLISHKFIISFIM*NTVCFINIHYFYFMPCVLD*MQFLPNISK RSVFSNSFP*SFLLYNVLFGVETEWLLKIKIKMIKIELLM*Q*ILL*YYRLFLIFKIFNE *ESVLYMIMCML*X combined WLYPRGYGYKARCCY*CGHVCPC*KFLTGIACKEYETELRCYNNCCCLAQ*G*KNTFLLL IHCLKWLKKLMDPKVKTFLGNGCYIPLTVR*KMFCLYR MLDMNEIDPMIFQPFGA GPLNCIGMRFALLEIKITFAKLLQKFYLDVCEDTPAPPLDVTFKISMKPKDQIFLKVTKI NE*KVVSFKPWS*PYCHIA**LKPFGLYTLTS*IMCFKLLGNI*INCPVVLLKF*FFFNS VDIILIKIILHFWLLSTMLISHKFIISFIM*NTVCFINIHYFYFMPCVLD*MQFLPNISK RSVFSNSFP*SFLLYNVLFGVETEWLLKIKIKMIKIELLM*Q*ILL*YYRLFLIFKIFNE *ESVLYMIMCML*X matches to this seq LQW161860.x1 opp end = GELTYETVQRLKHLTQCLNESLRL* exon 12 truncated LQW168021.y1 opp end = 729 LETLDLILTSFILVR exon 1 LQW46024.y2 opp end does not match LQW130135.x1 opp end does not match LQW46024.y1 opp end does not match LQW68739.y1 down from exon 1 = IYIHKKWQVLKNINIPHDPPTILGVGNMMGIIKDP Ope end LQW68739.x1 = exon KALLDVNGKEMNTALTSVTGSQWKRIR amd exon RNTLSPTFSSSKLKEMFGIVEDCADSFVQNIGTINSDGDGRFDVSL Try to go farther dowstream and then jump back LQW200969.x1 LQW200969.x1.phd.1 LQW200969.y1 13:07:11 2001 TEMPLATE: LQW200969 DIRECTION: fwd Length = 1021 Score = 91.3 bits (223), Expect = 8e-18 Identities = 53/72 (73%), Positives = 61/72 (84%) Frame = +3 Query: 122 SVFSNSFP*SFLLYNVLFGVETEWLLKIKIKMIKIELLM*Q*ILL*YYRLFLIFKIFNE* 181 +VF +F F +Y ++ + +WLLKIKIKMIKIELL+*Q*ILL*YYRLFLIFKIFNE* Sbjct: 33 TVFLKAF--FFTMYCLV--LRQKWLLKIKIKMIKIELLI*Q*ILL*YYRLFLIFKIFNE* 200 Query: 182 ESVLYMIMCML* 193 ESVLYMIMCML* Sbjct: 201 ESVLYMIMCML* 236 Score = 50.0 bits (117), Expect = 2e-05 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +2 Query: 122 SVFSNSFP*SFLLYNVLFGVETEWLLK 148 SVFSNSFP*SFLLYNVLFGVETE LK Sbjct: 20 SVFSNSFP*SFLLYNVLFGVETEVALK 100 >LQW200969.x1_1 TAGSMLISIF*QFSLKLSSLQCIVWC*DRSGS*KLKLK**K*NY*YSSKFYCDTIDYFLY LKYLTNENLSYI**CVCYNAF*TNVSCCRLTLLG*IKTVLKKKLYILHKKTEF*SQQH*S VKGNVITLL*FR*FAEIG*LELIVSSREKGWAAMCL*WG*KFT*RICFVKLLQVIKVNEM LFLIFVFKKYKYKFIFKEFFTSCVTYILLLLLPGIM*IIF*WLIWYEKQCISTFGLQCVN HVF*VTSIIFCDAIVYPYKASKQ*RDPGFPVVSRGSHQLTLVNSENTIGNLHEST*PAVG KKCGPNQ*RGMP*KTGRGRYNHMDSTRIKRHRREQRTGQNX >LQW200969.x1_2 RQAAC*SVFSNSFP*SFLLYNVLFGVETEVALKN*N*NDKNRITNIAVNFIVIL*TISYI *NI*RMRICLIYDNVYAIMHFKLMLVVAG*HY*VR*KLF*KRNFTFCTRKLSFKANNINL *KVML*LCSNFDNLLKLVN*NSL*AQGKKVGQPCAYSGGKNLHKEYVL*NFCRLLK*MRC YS*YLYLKNINISLFSKNFLQVVSLISCYFCYQA*CK*SFNGSSGMKNSVFLHLVYNV*I MCFR*HP*YSAMLLFILIRQANSKEIQGSLLCLEVVTS*L**TAKIPLATCTKAHNLLWV KSAGRINREVCHKKPAGGDITTWIAQELRGTGGNKGRAKT >LQW200969.x1_3 GRQHVDQYFLTVFLKAFFFTMYCLVLRQKWLLKIKIKMIKIELLI*Q*ILL*YYRLFLIF KIFNE*ESVLYMIMCML*CILN*C*LLQVNIIRLDKNCFEKETLHSAQEN*VLKPTTLIC KR*CYNSALISIIC*NWLIRTHCELKGKRLGSHVLIVGVKIYIKNMFCKTFAGY*SK*DV ILNICI*KI*I*VYFQRIFYKLCHLYPVTSATRHNVNNLLMAHLV*KTVYFYIWSTMCKS CVLGDIHNILRCYCLSL*GKQTVKRSRVPCCV*R*SPVNFSKQRKYHWQLARKHITCCG* KVRAESIERYAIKNRQGEI*PHG*HKN*EAQAGTKDGPK >SEQUENCE 112 130-160 54% TO 3A5 note 112 and 119 almost same >SEQUENCE 112 130-160 54% TO 3A5 note 112 identical to seq 119 up to VDSQ MITPLDILSLETWILILTSFILIR LYIHKKWQVLKNLNIPHDQPTILGIG NLMDFIKNPEFLFMGYFDLKKKYGPIYG LTPTITITDPEILKKIFIKEFSTFPDRQ AYNWLTPTITITDPEILKKIFIKEFSTFPDRQ IALLDVNGKEMNSALTVVSGRKWKRIRNT IALLDVNGKEMNSALTVVSGRKWKRIRNT LSPTFSSSKLKEMFGIVEDCADSFVQNIGTINSDVDGRFDVSL LSPTFSSSKLKEMFGIVEDCADSFVQNIGTINSDVDGRFDVSL AFGRLTLDGICSSAFGVKVDSQ AFGRLTL AGNNGEESQVAKMARELLAFEFFRNPMLYVF LIFPWTEKIAEKFDYTIFPRKYVRYFARLIDSVVESKKEKK QRTDILQTMIDSQITEEDVKNGAVK QRTDILQTMIDSQITEEDVKNGAVK GVTKTEMKGNSIIMLLAGYETTSNAMVFLAYNLAVYKDAQHKCREEIEQVIAEH (0) GVTKTEMKGNSIIMLLAGYETTSNAMVFLAYNLAVYKDAQHKCREEIEQVIAEH (0) SIQGGLTYEAVQDLKYMTQCLNESMRLYSLVPA (2) YCERDITINGVTIPKGTLVNIPVFGMGRDEEFWNEPLTFNPDR (2) MLDMNEIDPMIFQPFGAGPRNCIG MRFALLEIKITFAKLLQKFHLDVCEDTP (?) APPLKVGFKTSMKPKETLYLKVKALET* KTSMKPKETLYLKVKALE cicl064a02 cinc014d12 LQW246577.y1 rciad101a04 ciad101a04 GCiWno1045_a14.g1 LQW143144.x1 ciht028d24 ciht017f19 rcinc014d12 APPLDVTFKMSLKPKDQIFLKVTKINE* (from new seq?) MITPLDILSLETWILILTSFILIRLYIHKKWQVLKNLNIPHDQPTILGIGNLM DFIKNPEFLFMGYFDLKKKYGPIYGAYNW LTPTITITDPEILKKIFIKEFSTFPDRQIALLDVNGKEMNSALTVVSGRKWKRIRNT LSPTFSSSKLKEMFGIVEDCADSFVQNIGTINSDVDGRFDVSLAFGRLTLDGICSSAFGV KVDSQAGNNGEESQVAKMARELLAFEFFRNPMLYVFLIFPWTEKIAEKFDYTIFPRKYVR YFARLIDSVVESKKEKKQRTDILQTMIDSQITEEDVKNGAVKGVTKTEM GGLTYEAVQDLKYMTQCLNESMRLYSLAPA (?) NSRSCERDITINGVTILLKG frameshift TLVNIPVFGMGRDEEF frameshift WDDPLTVNPD LQW130334.x1 130-160 LQW217417.y1 130-160 LQW233888.x1 130-160 LQW269716.x1 130-160 LQW277627.x1 130-160 LQW68739.x1 130-160 LQW130430.x01 cicl064a02 cinc014d12 LQW99601.y1 opp end no match LQW4864.y1 opp end = exon 4 LQW43767.x1 opp end no match LQW160323.y1 opp end no match LQW29339.x1 opp end = frameshifted PKG WXXP region LQW246577.y1 rciad101a04 I-helix with retained intron seq ciad101a04 I-helix retained intron seq LQW246577.y1 LQW246577.y1.phd.1 LQW246577.x1 12:23:45 2001 TEMPLATE: LQW246577 DIRECTION: rev Length = 914 Score = 111 bits (274), Expect = 3e-24 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = +2 Query: 67 GVTKTEMKGNSIIMLLAGYETTSNAMVFLAYNLAVYKDAQHKCREEIEQVIAEH 120 GVTKTEMKGNSIIMLLAGYETTSNAMVFLAYNLAVYKDAQHKCREEIEQVIAEH Sbjct: 401 GVTKTEMKGNSIIMLLAGYETTSNAMVFLAYNLAVYKDAQHKCREEIEQVIAEH 562 Score = 54.7 bits (129), Expect = 3e-07 Identities = 26/27 (96%), Positives = 27/27 (99%) Frame = +2 Query: 42 QRTDILQTMIDSQITEEDVKNGAVKGV 68 QRTDILQTMIDSQITEEDVKNGAVKG+ Sbjct: 83 QRTDILQTMIDSQITEEDVKNGAVKGL 163 >LQW246577.y1_2 *VWKTHCKIFTLV*N*KNE*NALFYLPQRTDILQTMIDSQITEEDVKNGAVKGLYVSK** NHIYQYKHKPKDTEFKAQCCYNCVCVYSYTSHITHRSSTLFTNGFLN*WYHKKKKKNIYL ERYIHGFNNRLNAGVTKTEMKGNSIIMLLAGYETTSNAMVFLAYNLAVYKDAQHKCREEI EQVIAEHVSWLYAYLPNPW*WLEQWFLNWGGV*HSKGGATTFLNKVYMSHYSSV*TLNTR QHS*LNSNFSLLNS*CYDSASI*EYAVNES*YAENV*DSYFKSVNALLIKVLASATPEPG KKGAX >LQW217417.x1_4 ATVNPGAAWIGSTSNAMVFLAENLAVYKDAQHKCREEIEQVIAEHVSXLYAYLPNPW*WL EQWFLNWGGVSHSEGGREKVYKIKCYMSHYSSVQKV*IRRTQKLN*NSKPLSLFLNLLHM LNDEVSIPIMM*IIAV*IAIMS*LIARQNNRYYDAINPYYFVTNSLPG*EKTWQI*G*TM QM*TERLFDFTFALIAIMCFTQ*YRYSQPRGRGLKHVQYVRFGCGGLWQKLVEHH**FNK KGGASLLRSLLGGVLQKV*EPLG*STVV >GCiWno1045_a14.g1 CHROMAT_FILE: GCiWno1045_a14.g1 PHD_FILE: GCiWno1045_a14.g1.phd.1 CHEM: term DYE: big TIME: Fri Jan 4 11:31:37 2002 TEMPLATE: GCiWno1045_a14 DIRECTION: rev Length = 876 Score = 111 bits (276), Expect = 5e-24 Identities = 58/78 (74%), Positives = 59/78 (75%), Gaps = 4/78 (5%) Frame = +2 Query: 61 FDFTFALIAIMCFTQ-YRYSQPRGRGLKHVQYVRFGCGGLWQKLVEHH--FNKKXXXXXX 117 FDFTFALIAIMCFTQ YRYSQPRGRGLKHVQYVRFGCGGLWQKLVEHH FNKK Sbjct: 23 FDFTFALIAIMCFTQ*YRYSQPRGRGLKHVQYVRFGCGGLWQKLVEHH**FNKKGGASLL 202 Query: 118 XXXXXXXXQKV-EPLGST 134 QKV EPLG + Sbjct: 203 RSLLGGVLQKV*EPLGQS 256 Score = 64.0 bits (153), Expect = 1e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 134 TVVGGLTYEAVQDLKYMTQCLNESMRLYSLAPA 166 ++ GGLTYEAVQDLKYMTQCLNESMRLYSL PA Sbjct: 540 SIQGGLTYEAVQDLKYMTQCLNESMRLYSLVPA 638 >GCiWno1045_a14.g1 ATCGATTCGAGCTCGGTACCCATTTGACTTCACTTTTGCGTTGATCGCGATAATGTGTTTTACGCAATAATACAGATACA GTCAACCAAGGGGGCGAGGTTTAAAGCATGTCCAATATGTCAGGTTTGGCTGTGGTGGATTATGGCAGAAATTAGTTGAA CACCACTGATAATTTAACAAAAAGGGGGGCGCAAGTTTGTTGAGATCTTTATTGGGGGGGGTGCTTCAAAAAGTTTAAGA GCCCCTCGGTCAGAGCAAATATCTCTTAGCTAAAGGAATAAGCGTTCAAGCTTGATATTATAGTTATGCGTTTATTTCTT AAAGCATTTAACCTGCGTTGCTCCAACCCAGTGGTCATCAATGGATAGTTTAAGTTGTTAGTCATGCAGGGAAAAATTTA CTTACAAAAGTGAGTATTTGGTTATTTGAAAGCCGGCATGAGATGTATGAAACAGAACACCCCTGTTATAACAACTGTCG TTCTTACTCTACTTGTATAAATGTCCAACATTCCTAACATTGTAATGTTTATCATGATATCCATACAGGGCGGATTGACT TATGAAGCTGTGCAGGATTTGAAATATATGACTCAGTGTCTCAATGAATCTATGAGGCTTTATTCGCTTGTACCTGCGTG AGTGTTTTATATGGATAGTGAATAATTATGAATAATTTGCCAATTTAAAATACAACATTCTTGGCAGCAACAGCTTTGCC CTACTTTGGTTCCCAGACATGATCGTAATGCAGTAATAGTCTTCTGCATAAAGTGTATAGCTGCCCTGATGTCTTGCTAG ATGGAAGATGANACTTTGGTTCAATAAAGTGAAACTTCTTCCTAGAAAGAAATGTTTAGGCAGCTTTATCATGTTT >_3 downstream seq CFIWIVNNYE*FANLKYNILGSNSFALLWFPDMIVMQ**SSA*SV*LP*CLARWKMXLWF NKVKLLPRKKCLGSFIMF LQW246577.x1 LQW246577.x1.phd.1 LQW246577.y1 12:23:21 2001 TEMPLATE: LQW246577 DIRECTION: fwd Length = 1006 Score = 187 bits (469), Expect = 6e-47 Identities = 98/126 (77%), Positives = 105/126 (82%), Gaps = 10/126 (7%) Frame = -1 Query: 7 NNYE*FANLKYNILGSNSFALLWFPDMIVMQ**SSA*SV*LP*CLARWKMXLWFNKVKLL 66 +NY+ K +ILGSNSFALLWFPDMIVMQ**SSA*SV*LP*CLARWKM LWFNKVKLL Sbjct: 787 DNYD-ICRFKNDILGSNSFALLWFPDMIVMQ**SSA*SV*LP*CLARWKMKLWFNKVKLL 611 Query: 67 PRKK--------CLGSFIM--FRYCERDITINGVTIPKGTLVNIPVFGMGRDEEFWDDPL 116 PRK+ C +FI RYCERDITINGVTIPKGTLVNIPVFGMGRDEEFW++PL Sbjct: 610 PRKEMFRQLIHVC*HTFIFSNSRYCERDITINGVTIPKGTLVNIPVFGMGRDEEFWNEPL 431 Query: 117 TFNPDR 122 TFNPDR Sbjct: 430 TFNPDR 413 >LQW246577.x1 >lcl|LQW246577.x1 CHROMAT_FILE: LQW246577.x1 PHD_FILE: LQW246577.x1.phd.1 CHEM: term DYE: ET TIME: Mon Aug 27 12:23:21 2001 TEMPLATE: LQW246577 DIRECTION: fwd CCAGTGCTTTAATTTCAAGAAGTGCAAATCTCATTCCAATACAGTTACGTGGACCAGCACCAAATGGTTGAAATATCATT GGATCAATCTCATTCATGTCCAACATTCTGTACAAACAAAACATTTCTTGCATTAATTGGGTTAATTCCAATATTTGCAG TAAGTGTAAATATAGATAATCTTCTTTTTTTCTCACACTAAAAAAGACTAGTGATAAAATACATAACAAATTATAACACA GTAGGGGTTCGTTTACAATTCGTAAAACAAACATTTTCATATTAATATTAAGGATTTAAATCACTATTAACCAATACGTA CACAGCATAATATAACAAGGTATTCCATGTAAAGTTACCGTTCCTATACACCGGTGTTTTCACTATATTGTGCAAACATA ATCACATACTTACCTATCTGGGTTAAAAGTCAAAGGTTCATTCCAAAACTCTTCATCTCTTCCCATTCCAAACACTGGGA TATTTACGAGTGTCCCTTTAGGAATGGTCACCCCATTTATTGTAATGTCGCGTTCACAGTATCTTGAATTACTAAATATA AAGGTGTGTCAGCAAACATGAATAAGCTGCCTAAACATTTCTTTTCTAGGAAGAAGTTTCACTTTATTGAACCAAAGTTT CATCTTCCATCTAGCAAGACATCAGGGCAGCTATACACTTTATGCAGAAGACTATTACTGCATTACGATCATGTCTGGGA ACCAAAGTAGGGCAAAGCTGTTGCTGCCAAGAATGTCGTTTTTAAATCGGCAAATATCATAATTATCACTATCATATAAA NATCAAGCAGTACAGCGAATAAGCTATGATTCTGAGAACTGGTCTTATTCAATCTGGCAGTCTAGTAACGCCGTTGATAT GTAACTCAGTGGAATGGCCTTACGCAGAAAAACGGTAAGGGGCGCAAAAAGGGCAACACCCAGAGAAACCGAAAAACAGC GGGGGGGTCTACGTACTTCTTTCTGCACCCTATATATCNNNNGNGT >LQW246577.x1_5 TXXIYRVQKEVRRPPRCFSVSLGVALFAPLTVFLRKAIPLSYISTALLDCQIE*DQFSES *LIRCTA*XLYDSDNYDICRFKNDILGSNSFALLWFPDMIVMQ**SSA*SV*LP*CLARW KMKLWFNKVKLLPRKEMFRQLIHVC*HTFIFSNSRYCERDITINGVTIPKGTLVNIPVFG MGRDEEFWNEPLTFNPDR*VCDYVCTI**KHRCIGTVTLHGIPCYIMLCTYWLIVI*ILN INMKMFVLRIVNEPLLCYNLLCILSLVFFSVRKKEDYLYLHLLQILELTQLMQEMFCLYR MLDMNEIDPMIFQPFGAGPRNCIGMRFALLEIKALX This is for intron boundary only LQW277627.x1 LQW277627.x1.phd.1 LQW277627.y1 13:01:23 2001 TEMPLATE: LQW277627 DIRECTION: fwd Length = 926 Score = 95.2 bits (233), Expect = 3e-19 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +3 Query: 89 RNTLSPTFSSSKLKEMFGIVEDCADSFVQNIGTINSDVDGRFDVSL 134 RNTLSPTFSSSKLKEMFGIVEDCADSFVQNIGTINSDVDGRFDVSL Sbjct: 447 RNTLSPTFSSSKLKEMFGIVEDCADSFVQNIGTINSDVDGRFDVSL 584 >LQW277627.x1 >lcl|LQW277627.x1 CHROMAT_FILE: LQW277627.x1 PHD_FILE: LQW277627.x1.phd.1 CHEM: term DYE: ET TIME: Fri Aug 31 13:01:23 2001 TEMPLATE: LQW277627 DIRECTION: fwd NGCAGTGCATTACTCGAAACTCAGGACAGACTAAACTTTCTGTCCTGAGTTTTAAAGTAGGATGATTGAATCAGTTGTAT TCTAGCTGTCTTGACCTGAAATGTTAAAGCTTTTTAAATAAAACAGTCAAATATCTTTAATTTTGTAAAGATTTTATTGC ATGAATAAACACAGCACATTTAATCCTTTGGATGCCTAATTTATAAAACTTTTACAGTTATACACAACAAACAAAACATT CCAAAATTTTTGACAAATTGTATCTAGTTAAGGAAAGTTTCACAACACTCCTCTACTGGCCTGTTCATTCCAACCATATT AACTTAACTATAAAAGAAAAAAGTAATCATACTTCATCTTAAAATTAATTTATTAGTTTTTAAAAAACTGTAATACTATA AAAGGGCAAATTATTTTCAACAGCTGTATCTAACTTGTGTATTTCCAGGAACACCCTCTCTCCCACATTCTCATCATCAA AGTTGAAAGAAATGTTTGGTATAGTTGAAGATTGTGCCGATAGTTTTGTTCAAAACATTGGAACGATAAACTCAGATGTT GACGGAAGATTTGACGTTTCATTGTGAGTTGGACAGTTTATTTTATTCTATTCTTTGTGGGTGAGGTCCTATAGAGTGAT D V S L AAACATGGGACCTGAGGTTTAGGCAAGAGTTACCCACTACCCGCCATCCAGGCTGATTACACACACTGAGTGGAGATTGA GGTTGCTAGAAAACAAATCTATTCAATGCAAACAATTAATATCTTACACAGTTATTGTTAATATATCTATATTTCTAATT TGGTCCAAATCGCGTTATATTGATAATAAGTCAATTTGCAATTGGACACGGAGGAATTCCACTGGGTCTGCCCGTTGCCA TCGGTATTTCAGAAACCGTTGACATCTTAGGAATAAAGGGGGTAAA >GCiWno391_k20.b1 CHROMAT_FILE: GCiWno391_k20.b1 PHD_FILE: GCiWno391_k20.b1.phd.1 CHEM: term DYE: big TIME: Wed Oct 10 11:27:13 2001 TEMPLATE: GCiWno391_k20 DIRECTION: fwd Length = 926 Score = 57.8 bits (137), Expect = 1e-07 Identities = 25/34 (73%), Positives = 29/34 (84%) Frame = +1 Query: 15 LILTSFILIRLYIHKKWQVLKNLNIPHDQPTILG 48 L T+F+ RLYIHK+WQVLK+LNIPHD PTILG Sbjct: 550 LCSTAFLSYRLYIHKRWQVLKDLNIPHDPPTILG 651 Score = 49.6 bits (116), Expect = 4e-05 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 1 MITPLDILSLETWILILTSFILIR 24 MITPLDILSLETWILILTSFILIR Sbjct: 30 MITPLDILSLETWILILTSFILIR 101 >GCiWno391_k20.b1 TTAAAATAATCCTGATATTTCCACCAGCCATGATTACTCCTCTTGATATTTTATCGTTGGAAACTTGGATTTTAATCCTG ACTTCATTCATTCTTATCAGGTTTGGAAAGTTTGGTATTTATAATAAATATCATACAGTCATAATATTTTTGTAATACTA TATTTACCAAGTAGTAAAATACCTTGTATTCTAAAATAACATGTCCGTTTTACATTGTTTATGGCTATTAAAAGTCAAAA AGTAAATGTAAATGAAATAAATACGTTAAAAGGTTGGTGTTAAGATGCTTTAGGAATATGCAACTTATTTATTTCTATTT GTACAACAACAGTAAGTAACATGGCTGTTCTGTTTATGAGTTTCCGTGTATGTAACTTTAAGGGTTGTTATTTTTCTAGA TTATTGACAATCAATTATGGACCAATGTTTGAGCAATTAACAATAAGTGTTTGCACAACAAACCATCAGTGGCAGCTTTG AGCTTCAAACCCGTACATCGACGAACATGTACCCACCCAACTTTTTATCATTAAGCTCCTCCATTAAATCTCTGTTCAAC TGCATTTCTTTCATACAGACTGTACATCCACAAAAGATGGCAAGTGCTAAAGGACCTTAACATACCACATGATCCACCTA CAATACTGGGGGGTTGGAAACATGAGCAAATTCTTTAAAGATTCTGATGCAGTGAGTTCTACTGAAGTTCTGTATTGAGC CAAATCTGGCATGAATCCTAGGTCTATGACAAGCACCTTACACAAATATAGCTATACATGTACAGATTATATTGGGTACC GACTCGAATCGATATGTT >GCiWno563_p24.g1 CHROMAT_FILE: GCiWno563_p24.g1 PHD_FILE: GCiWno563_p24.g1.phd.1 CHEM: term DYE: big TIME: Wed Oct 24 10:36:30 2001 TEMPLATE: GCiWno563_p24 DIRECTION: rev Length = 938 Score = 53.9 bits (127), Expect = 2e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 204 QAGNNGEESQVAKMARELLAFEFFRNPMLYVF 235 QA NNG+ESQVAKMARE LA E F+NPM++VF Sbjct: 315 QAANNGKESQVAKMAREFLAIEIFKNPMVFVF 220 Score = 47.6 bits (111), Expect = 1e-04 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -2 Query: 183 AFGRLTLDGICSSAFGVKVDSQ 204 AFGRLTLDGICSSAFGVKVDSQ Sbjct: 706 AFGRLTLDGICSSAFGVKVDSQ 641 >GCiWno563_p24.g1 CHROMAT_FILE: GCiWno563_p24.g1 PHD_FILE: GCiWno563_p24.g1.phd.1 CHEM: term DYE: big TIME: Wed Oct 24 10:36:30 2001 TEMPLATE: GCiWno563_p24 DIRECTION: rev Length = 938 Score = 66.0 bits (158), Expect = 5e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 1 QAANNGKESQVAKMAREFLAIEIFKNPMVFVF 32 QAANNGKESQVAKMAREFLAIEIFKNPMVFVF Sbjct: 315 QAANNGKESQVAKMAREFLAIEIFKNPMVFVF 220 >LQW4864.x1 >lcl|LQW4864.x1 CHROMAT_FILE: LQW4864.x1 PHD_FILE: LQW4864.x1.phd.1 CHEM: term DYE: ET TIME: Wed Mar 21 15:55:09 2001 TEMPLATE: LQW4864 DIRECTION: fwd CCAGTTGCTGTGACTTTCTAGATATTTAAAAATGTCAATATTATTACATCAATATTTTATCTGCTTTAAACTTCACCATC TCGAAGACACAACATTAGAATGATAAAACTTAGGTTTTTAAAGCGAATACACTTACACATTAATGTAGTACTGTTTACTA ACTTTTTCTAATTAACATTTTAAGAAGTGAATTTAAATATTAATGTAGTATTGTTCATTAACTTCTGCTCTTTCCACAGC GCATACAATTGGCTTACACCCTCCATAACGATAACTGATCCAGAAATTTTGAAAAAAATCTTTATTAAAGAGTTTTCTAC ATTTCCTGACAGGCAGGTGTGTTTTGTTATTAATTAATTATTACGCGAATATTTATTTGTGTTTAACTGAGCAATAACTG CGTGTCTAATAGCACACATGTTGGCTTTATACACCTCAATCTCGTTAGGAGTTTCACAGTGATTTTGTGTATGTTTGATA ATTTGCACAATCACCAATCTCATTAGTTATAACTATGTTTCAGGATCTGGTGCCTCGAAATTATAACAGACAAAATCAAT TTCCACCAATTGTATATTAAATTATAAATAGATATATATTTCACATAAATGGCACCATCAGTCTCTCGATTAAATAGAAT CTACTGTTATGACATTAACTATTTAAGTTTCTTTGGAATCTGTTATTTGGTTATGATATTTCTATTGTGGGG LQW222170.x1 LQW222170.x1.phd.1 LQW222170.y1 11:22:35 2001 TEMPLATE: LQW222170 DIRECTION: fwd Length = 916 Score = 36.7 bits (83), Expect = 0.098 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 20/57 (35%) Frame = -2 Query: 18 YFDLKKKYGPIYG--------------------AYNWLTPTITITDPEILKKIFIKE 54 + +LK+K+GPIYG Y L+P + + DPEILK+I IKE Sbjct: 171 HLELKQKFGPIYG*GVRLYGLLIVVNKLLLFFSHYIGLSPHVYVGDPEILKQIMIKE 1 >LQW222170.x1 >lcl|LQW222170.x1 CHROMAT_FILE: LQW222170.x1 PHD_FILE: LQW222170.x1.phd.1 CHEM: term DYE: ET TIME: Mon Aug 27 11:22:35 2001 TEMPLATE: LQW222170 DIRECTION: fwd TTCTTTTATCATGATTTGCTTTAAAATTTCTGGGTCACCAACATAAACATGTGGGCTTAAACCAATGTAATGACTGAAAA ACAAAAGTAGCTTGTTAACAACTATAAGTAAACCATATAACCGTACACCTTACCCATAAATTGGCCCAAACTTTTGTTTC AATTCTAAGTGTCTCTTATAGCCCTGTCAAGGTAAAATTTACAAAATTGTTTTGTGCAACATTAAATGAAAATAATAGTT TACTGCATTTTTTATGGTCATTCTTGAGTTGGATTGAATTACTCAGTTCTATCATAGCGGTCAATGGTGTACTCTGACAA ATAAGTTAGCATTGTGCAATAAATTGGTGTTTTTGATAAACATGGAAAATTGATAAAGGTTTTAGGAGTTAGGGAAATGT TAAGAAACCTTTCATCTTGGTTTTCTTTAAATAGTTGAAACTTCAATGGTATTCTACACAGTATGTATTGTATAAAAACA AGAGTTATTTCGTGATAAAGTAACTTATTATATTTGGGTTTAACAAACTAAAACGATGGATATCTACCAACATATAATAA CGATATAATACATCATAATAAACCTAAAGTAAACACTGTACAACCTAACTATACTGCAGTATCAATTAAACTAACTGGTG ACTGTGCATACAACACGGCACGACAAAAGCGTTAATGACTCGGTGCAGGCAGCAGGAATAAAAGCGTCAGAATGTTATCA AGGTGAGACGAGTTAGCGGTAAAATATACCACAATGTTGTCATAGAGATCCATTAGCAAAGCAATAACGGCCATTGATCT TAAAATAGTTAAATTGTACTTTTAAGTTATTGGTAAGGGCTGGAAAACTAGATACGCCAATTGATCATAGAATCTAAAGA TCGCGTAAATTTAAATTGCATTTCACCCGATTTTGG >GCiWno563_p24.g1 CCTTGTTAAGCAAATAGATGGCCAGGCTATATTTGTCCTTCCGTTGTATGCTTGGAACACTGGGCCTACCAAGTTGCATG TGAAGCACATACCATTCAGCCACTTGAAAGCAGTTTGGGCGTTAGGGTAATGGGTCAAATTTGGCCTAAATTCTAGGTTT TCAATCAGGACCTTACCCATATAGAATGCCGACCCCTTACAATACAGCTGATACTTACGAAACACAAACACCATCGGGTT CTTAAATATTTCAATTGCAAGAAACTCGCGAGCCATTTTTGCCACTTGGGACTCTTTACCATTATTTGCTGCCTGTAAAT AAATGGGGAATAATCTGTGTATAAACCCATATACGCTGGCCTGGCAAATTTAAATAATTAGATAGAGAGCAATATATGGC ATGTAAAATGTATGAGAACTAAATTCCATGTAAAAATATATACATAGTAACATGTAATAGACACCCATCTCCAATATTTT ATTTATTGTCTTCATGAGCATAATTATGTCACAGAAATAGAAGACAAGTTAATAAACATATTTTTTAAATGCAGCGATTT CAGCAAGAACATTAGTAATATGATGTCCCCATATTTTCTATTATAAGCTTAACACATTGAATATATTGTGGCAAGAATAC CTGGGAGTCAACTTTGACACCGAATGCTGAAGAACAAATCCCATCCAATGTTAGTCGTCCAAATGCTCTGAAAAGTGTTG TATTAATTATTTATGTTTATAAATAAATGTAACTTAGCCATTCTTACGTGGTGGGGAAAAAACAGTCATTTTAACACTGG NNTGTTCTTTCAATATACNNNCTGTACCTAAATAAAGTATCATGTATTTATTTAATTTGNGTGTGAATACTATNTTTGGG GGATTNNNTGTGTATGTACAGCTGACATTNCGAGAATCCATAAGGACAATTAGCTGAA >_4 QLIVLMDSRNVSCTYTXNPPXIVFTXKLNKYMILYLGTXXILKEXXSVKMTVFSPPRKNG *VTFIYKHK*LIQHFSEHLDD*HWMGFVLQHSVSKLTPRYSCHNIFNVLSL**KIWGHHI TNVLAEIAAFKKYVY*LVFYFCDIIMLMKTINKILEMGVYYMLLCIYFYMEFSSHTFYMP YIALYLII*ICQASVYGFIHRLFPIYLQAANNGKESQVAKMAREFLAIEIFKNPMVFVFR KYQLYCKGSAFYMGKVLIENLEFRPNLTHYPNAQTAFKWLNGMCFTCNLVGPVFQAYNGR TNIAWPSICLTR >_5 SANCPYGFSXCQLYIHXXSPKXSIHTQIK*IHDTLFRYXXYIERTXQC*NDCFFPTT*EW LSYIYL*T*IINTTLFRAFGRLTLDGICSSAFGVKVDSQVFLPQYIQCVKLIIENMGTSY Y*CSC*NRCI*KICLLTCLLFL*HNYAHEDNK*NIGDGCLLHVTMYIFLHGI*FSYILHA IYCSLSNYLNLPGQRIWVYTQIIPHLFTGSK*W*RVPSGKNGSRVSCN*NI*EPDGVCVS *VSAVL*GVGILYG*GPD*KPRI*AKFDPLP*RPNCFQVAEWYVLHMQLGRPSVPSIQRK DKYSLAIYLLNKX >_6 FS*LSLWILXMSAVHTXXIPQX*YSHXN*INT*YFI*VQXVY*KNXPVLK*LFFPHHVRM AKLHLFININN*YNTFQSIWTTNIGWDLFFSIRCQS*LPGILATIYSMC*AYNRKYGDII LLMFLLKSLHLKNMFINLSSISVT*LCS*RQ*IKYWRWVSITCYYVYIFTWNLVLIHFTC HILLSI*LFKFARPAYMGLYTDYSPFIYRQQIMVKSPKWQKWLASFLQLKYLRTRWCLCF VSISCIVRGRHSIWVRS*LKT*NLGQI*PITLTPKLLSSG*MVCASHATW*AQCSKHTTE GQI*PGHLFA*QG >GCiWno563_p24.g1 CCTTGTTAAGCAAATAGATGGCCAGGCTATATTTGTCCTTCCGTTGTATGCTTGGAACACTGGGCCTACCAAGTTGCATG TGAAGCACATACCATTCAGCCACTTGAAAGCAGTTTGGGCGTTAGGGTAATGGGTCAAATTTGGCCTAAATTCTAGGTTT TCAATCAGGACCTTACCCATATAGAATGCCGACCCCTTACAATACAGCTGATACTTACGAAACACAAACACCATCGGGTT CTTAAATATTTCAATTGCAAGAAACTCGCGAGCCATTTTTGCCACTTGGGACTCTTTACCATTATTTGCTGCCTGTAAAT AAATGGGGAATAATCTGTGTATAAACCCATATACGCTGGCCTGGCAAATTTAAATAATTAGATAGAGAGCAATATATGGC ATGTAAAATGTATGAGAACTAAATTCCATGTAAAAATATATACATAGTAACATGTAATAGACACCCATCTCCAATATTTT ATTTATTGTCTTCATGAGCATAATTATGTCACAGAAATAGAAGACAAGTTAATAAACATATTTTTTAAATGCAGCGATTT CAGCAAGAACATTAGTAATATGATGTCCCCATATTTTCTATTATAAGCTTAACACATTGAATATATTGTGGCAAGAATAC CTGGGAGTCAACTTTGACACCGAATGCTGAAGAACAAATCCCATCCAATGTTAGTCGTCCAAATGCTCTGAAAAGTGTTG TATTAATTATTTATGTTTATAAATAAATGTAACTTAGCCATTCTTACGTGGTGGGGAAAAAACAGTCATTTTAACACTGG NNTGTTCTTTCAATATACNNNCTGTACCTAAATAAAGTATCATGTATTTATTTAATTTGNGTGTGAATACTATNTTTGGG GGATTNNNTGTGTATGTACAGCTGACATTNCGAGAATCCATAAGGACAATTAGCTGAA >rcibd048p03 this has the KFH motif not found in seq 119 = KFY but it is not the right seq Length = 761 This may be a third seq does not match 119 either Score = 188 bits (473), Expect = 2e-47 Identities = 86/98 (87%), Positives = 91/98 (92%) Frame = -3 Query: 1 NSRYCERDITINGVTIPKGTLVNIPVFGMGRDEEFWNEPLTFNPDRMLDMNEIDPMIFQP 60 NSRYCERDITI+G+TI KG V IPV+GMGRDEEFW +PL F P+RMLDMNEIDPMIFQP Sbjct: 654 NSRYCERDITIHGLTIKKGITVQIPVYGMGRDEEFWEDPLVFKPERMLDMNEIDPMIFQP 475 Query: 61 FGAGPRNCIGMRFALLEIKITFAKLLQKFHLDVCEDTP 98 FGAGPRNCIGMRFALLEIKITFAKLLQKFHLDVCEDTP Sbjct: 474 FGAGPRNCIGMRFALLEIKITFAKLLQKFHLDVCEDTP 361 >rcibd048p03_4 = seq 125 VIAKHGGLTYEAMNDLKYIMQCLNESLRLYPPAPMNSRYCERDITIHGLTIKKGITVQIP VYGMGRDEEFWEDPLVFKPERMLDMNEIDPMIFQPFGAGPRNCIGMRFALLEIKITFAKL LQKFHLDVCEDTPAAPIDVSFKSGMRTKQDLFLKVTARE**L*TCLQMK*CLIWLFVDQA YLSIHRSYK*CMFLIILDAGCYML*FFSVSNYLALDATMECCSVLVLFV*STTG*CLII* FSVNIAYSALHSN >rcicl064a02 does not match p450 seq outside coding region ACNAAATACCCAGCAATGGTTAATGTAATAATAGATTGAAATTGAAGAATGGCAGACTGGAATTTNATTTCCTCATATTC ACAGTAAACTGCATGATACGTNCTTAATTATACAATACAGTTGGGCCGGGTGTTATATTTACGCAACACAACAATTTATT CAATCTTTATGCGTTAAGTTAATGTGGGTAAACTTTATTAATAAATCTTAAAGCATAGTCAACTGCTACAAACATGAGAC AAATCCTATTGCGAAGCAAGTTAGGGGCTGTGGTTTATAAGCCAGAGTTGACCCATTACTTAAGATCATGTAACACCACA TGCCTTCACAGTAGTTACATTGCTGAAACGAAATAAGTCTTAATCATTCACTTTTACATGATATAAAATTCACATGAAAT AAAATTCATGTCATTTTAGTTCAAAACAAGATATCAAAATTGAATTTGAAAAATGAAACCCAAAATCATAATGAAAACAT ACAGATTTTTTATATACTGTTTTGTAAGGGTGAGACCTAAGAAACAGTTTTTCAAAATTAGCCATGGTAGCAATAGAAGC AGAATAGTGGTTTAAATTGCAATGAAAATTATCGTATTAAAAGTACAGAGTTAAAACAATCATTTGATAAAACTTGGCCA ATTAAAGACAGAATAATTACAGAATTACAGTTAGAAGATAATACACCAG >rcinc014d12 does not match p450 seq outside coding region TTTGGGTTAAATTGACATTTATTGCAGAGATTAAACAAATAAACACAAATTACCACAGCAATGGTTAATGTAATAATAGA TTGAAATTGAAGAATGGCAGACTGGAATTTCATTTCCTCATATTCACAGTAAACTGCATGATACGTCACTTAATTATACA ATACAGTTGGGCCGGGTGTTATATTTACGCAACACAACAATTTATTCAATCTTTATGCGTTAAGTTAATGTGGGTAAACT TTATTAATAAATCTTAAAGCATAGTCAACTGCTACAAACATGAGACAAATCCTATTGCGAAGCAAGTTAGGGGCTGTGGT TTATAAGCCAGAGTTGACCCATTACTTAAGATCATGTAACACCACATGCCTTCACAGTAGTTACATTGCTGAAACGAAAT AAGTCTTAATCATTCACTTTTACATGATATAAAATTCACATGAAATAAAATTCATGTCATTTTAGTTCAAAACAAGATAT CAAAATTGAATTTGAAAAATGAAACCCAAAATCATAATGAAAACATACAGATTTTTTATATACTGTTTTGTAAGGGTGAG ACCTAAGAAACAGTTTTTCAAAATTAGCCATGGTAGCAATAGAAGCAGAATAGTGGTTTAAATTGCAATGAAAATTATCG TATTAAAAGTACAGAGTTAAAACAATCATTTGATAAAACTTGGCCAATTAAAGACAGAATAATTACAGAATTACAGTTAG AAGATAATACACCAGTAAAGATGGAACTACTCTAATGCTTTAACTTTCNAGTAGAGAGTTTCCTTTGGNTTCATGCTGGT TTTGATCCAACTTTTAA >_6 KSWIKTSMXPKETLYXKVKALE*FHLYWCIIF*L*FCNYSVFNWPSFIK*LF*LCTFNTI IFIAI*TTILLLLLPWLILKNCFLGLTLTKQYIKNLYVFIMILGFIFQIQF*YLVLN*ND MNFISCEFYIM*K*MIKTYFVSAM*LL*RHVVLHDLK*WVNSGL*TTAPNLLRNRICLMF VAVDYALRFINKVYPH*LNA*RLNKLLCCVNITPGPTVLYN*VTYHAVYCEYEEMKFQSA ILQFQSIITLTIAVVICVYLFNLCNKCQFNPX >_4 GVLSSNCNSVIILSLIGQVLSNDCFNSVLLIR*FSLQFKPLFCFYCYHG*F*KTVS*VSP LQNSI*KICMFSL*FWVSFFKFNFDILF*TKMT*ILFHVNFISCKSE*LRLISFQQCNYC EGMWCYMILSNGSTLAYKPQPLTCFAIGFVSCL*QLTML*DLLIKFTHINLTHKD*INCC VA*I*HPAQLYCIIKXVSCSLL*I*GNXIPVCHSSISIYYYINHCWVFX >_5 WCIIF*L*FCNYSVFNWPSFIK*LF*LCTFNTIIFIAI*TTILLLLLPWLILKNCFLGLT LTKQYIKNLYVFIMILGFIFQIQF*YLVLN*NDMNFISCEFYIM*K*MIKTYFVSAM*LL *RHVVLHDLK*WVNSGL*TTAPNLLRNRICLMFVAVDYALRFINKVYPH*LNA*RLNKLL CCVNITPGPTVLYN*XRIMQFTVNMRKXNSSLPFFNFNLLLH*PLLGIXX >_6 LVYYLLTVIL*LFCL*LAKFYQMIVLTLYF*YDNFHCNLNHYSASIATMANFEKLFLRSH PYKTVYKKSVCFHYDFGFHFSNSILISCFELK*HEFYFM*ILYHVKVND*DLFRFSNVTT VKACGVT*S*VMGQLWLINHSP*LASQ*DLSHVCSS*LCFKIY**SLPTLT*RIKIE*IV VLRKYNTRPNCIV*LXTYHAVYCEYEEXKFQSAILQFQSIITLTIAGYXV >rciht028d24_5 V*LFCL*LAKFYQMIVLTLYF*YDNFHCNLNHYSASIATMGNFEKLFLRSHPYKTVYKNL YVFIMILGFIFQI*F*YLVLN*NDMNFISCEFYIM*K*MIKTYFVSAM*LL*RHVVLHDL K*WVNSGL*TTAPNLLRNRICLMFVAVDYALRFINKVYPH*LNA*RLNKLLCCVNITPGP TVLYN*VTYHAVYCEYEEMKFHSAILQFQSIFLFLFFPLLLKYKPAPQT*RICNYYINHC CGNLCLFV*YLQ*X rcibd002e09 3' UTR rciht028d24 3' UTR >cibd002e09_1 N-term MITPLDILSLETWILILTSFILIRLYIHKKWQVLKNLNIPHD QPTILGIGNLMDFIKNPEFLFMGYFDLKKKYGPIYGAYNWLTPTITITDPEILKKIFIKE FSTFPDRQIALLDVNGKEMNSALTVVSGRKWKRIRNTLSPTFSSSKLKEMFGIVEDCADS FVXNIGTINSXVDGIFDASLAFGRL >ciht028d24_3 ALLEIKITFAKLLQKFHLDVCEDTPAPPLKVGFKTSMKPKETLYLKVKALET*SSSIFTG VLSSNCNCVIILSLIGQVLSNDCFNSVLLIR*FSLQFKPLFCFYCYHG*F*KTVS*VSPL QNSI*KSVCFHYDFGFHFSNLILISCFELK*HEFYFM*ILYHVKVND*DLFRFSNVTTVK ACGVT*S*VMGQLWLINHSP*LASQ*DLSHVCSS*LCFKIY**SLPTLTQRIKI >LQW143144.x1_1 QVVTRGNGFKARRCYHCGRMCPWARHLTAIAPTQWSLMGCLNY*PYIKKNPKKNKK**SL TK*HTW*LVSWHEVLNPCDNDCRFPATRG*SKLHSFIHSFINNNFSLFYL*KVKNLRISF KLKIKKYYLFIKNVLNFSV*SFVTYQSNYSFCLYRMLDMNEIDPMIFQPFGAGPRNCIGM RFALLEIKITFAKLLQKFHLDVCEDTPVSET**LXWEECFRDYXLSLMSYVYS*CIRFAF YERSKHIKDRVNR*KSLSTNQERSLT*YISIVGLLSC*SVTSRRIVGQVKENPAVLYFLY FV*CXXX >LQW143144.x1_2 KW*PEVMGSRLVAVTIVGVCVLGQDT*RQLLQPSGH*WVV*IISHT*KKIQKKIKNNNHS QSNIHGNS*AGTRC*TRVITTVVFRLREDKVSYIHSFIHSLITIFLYFIYKK*KISVFPL SSKLKSIIYLLKMC*IFLFKVLSHINQIILFVCTECWT*MRLIQ*YSSHSVLVHVTVLE* DLHFLKLKSLSQNFCRNFISMFVKIPL*VKLSDYXGKNALGTXILA*CLMYILNVLDLLF MNGLNI*KIE*IDRSRCRLIRKGLLHDTYLSSVFCHVEVLLPEE*LGRLRKIPRFCISFI SFNVXXX >LQW143144.x1_3 SGNQR*WVQGSSLLPLWAYVSLGKTLNGNCSNPVVTNGLSKLLAIHKKKSKKK*KIIITH KVTYMVTRKLARGVKPV**RLSFSGYARIK*VTFIHSFIH**QFFFILFIKSKKSPYFL* AQN*KVLFIY*KCAEFFCLKFCHISIKLFFLFVQNVGHE*D*SNDIPAIRCWST*LYWNE ICTS*N*NHFRKTSAEISSRCL*RYPCE*NLVTXLGRML*GLXS*LNVLCIFLMY*ICFL *TV*TYKR*SESIEVVVD*SGKVSYMIHIYRRSFVMLKCYFQKNSWAG*GKSRGSVFPLF RLMXXX new seq? = seq 125 >cibd048p03 Length = 678 Score = 308 bits (781), Expect = 2e-83 Identities = 147/224 (65%), Positives = 180/224 (79%) Frame = +3 Query: 1 MITPLDILSLETWILILTSFILIRLYIHKKWQVLKNLNIPHDQPTILGIGNLMDFIKNPE 60 MITPLDILSLETWILILTSFILIRLYIHK+WQVLK+LNIPHD PTILG+GN+ F K+ + Sbjct: 6 MITPLDILSLETWILILTSFILIRLYIHKRWQVLKDLNIPHDPPTILGVGNMSKFFKDSD 185 Query: 61 FLFMGYFDLKKKYGPIYGAYNWLTPTITITDPEILKKIFIKEFSTFPDRQIALLDVNGKE 120 + + +LK+K+GPIYG Y L+P + + DPEILK+I IKEF FPDRQ + NGKE Sbjct: 186 AGYKRHLELKQKFGPIYGHYIGLSPHVYVGDPEILKQIMIKEFHIFPDRQKNFQNANGKE 365 Query: 121 MNSALTVVSGRKWKRIRNTLSPTFSSSKLKEMFGIVEDCADSFVQNIGTINSDVDGRFDV 180 N LT +SG++WKR+R+TLSPTF+SSKLKEMFGIVEDCADSFVQNIGTINSD +GRF Sbjct: 366 FNDNLTAISGKQWKRVRDTLSPTFTSSKLKEMFGIVEDCADSFVQNIGTINSDSNGRFQP 545 Query: 181 SLAFGRLTLDGICSSAFGVKVDSQAGNNGEESQVAKMARELLAF 224 ++ F ++ +D ICS+AFGV VDSQ+ G+E +V KMA EL + Sbjct: 546 AVVFSKVAIDSICSAAFGVNVDSQSKPQGQEPEVVKMALELFNY 677 6 MITPLDILSLETWILILTSFILIRLYIHKRWQVLKDLNIPHDPPTILGVGNMSKFFKDSD 185 186 AGYKRHLELKQKFGPIYGHYIGLSPHVYVGDPEILKQIMIKEFHIFPDRQKNFQNANGKE 365 366 FNDNLTAISGKQWKRVRDTLSPTFTSSKLKEMFGIVEDCADSFVQNIGTINSDSNGRFQP 545 546 AVVFSKVAIDSICSAAFGVNVDSQSKPQGQEPEVVKMALELFNY 677 >LQW143144.x1 >lcl|LQW143144.x1 CHROMAT_FILE: LQW143144.x1 PHD_FILE: LQW143144.x1.phd.1 CHEM: term DYE: ET TIME: Wed Aug 22 11:47:21 2001 TEMPLATE: LQW143144 DIRECTION: fwd CAAGTGGTAACCAGAGGTAATGGGTTCAAGGCTCGTCGCTGTTACCATTGTGGGCGTATGTGTCCTTGGGCAAGACACTT AACGGCAATTGCTCCAACCCAGTGGTCACTAATGGGTTGTCTAAATTATTAGCCATACATAAAAAAAAATCCAAAAAAAA ATAAAAAATAATAATCACTCACAAAGTAACATACATGGTAACTCGTAAGCTGGCACGAGGTGTTAAACCCGTGTGATAAC GACTGTCGTTTTCCGGCTACGCGAGGATAAAGTAAGTTACATTCATTCATTCATTCATTCATTAATAACAATTTTTCTTT ATTTTATTTATAAAAAGTAAAAAATCTCCGTATTTCCTTTAAGCTCAAAATTAAAAAGTATTATTTATTTATTAAAAATG TGCTGAATTTTTCTGTTTAAAGTTTTGTCACATATCAATCAAATTATTCTTTTTGTTTGTACAGAATGTTGGACATGAAT GAGATTGATCCAATGATATTCCAGCCATTCGGTGCTGGTCCACGTAACTGTATTGGAATGAGATTTGCACTTCTTGAAAT TAAAATCACTTTCGCAAAACTTCTGCAGAAATTTCATCTCGATGTTTGTGAAGATACCCCTGTGAGTGAAACTTAGTGAC TATNCTGGGAAGAATGCTTTAGGGACTATNATCTTAGCTTAATGTCTTATGTATATTCTTAATGTATTAGATTTGCTTTT TATGAACGGTCTAAACATATAAAAGATAGAGTGAATCGATAGAAGTCGTTGTCGACTAATCAGGAAAGGTCTCTTACATG ATACATATCTATCGTCGGTCTTTTGTCATGTTGAAGTGTTACTTCCAGAAGAATAGTTGGGCAGGTTAAGGAAAATCCCG CGGTTCTGTATTTCCTTTATTTCGTTTAATGTTNGNNNNN >cibd064d19 Length = 660 Score = 152 bits (379), Expect = 6e-36 Identities = 74/76 (97%), Positives = 76/76 (99%) Frame = +3 Query: 1 VTRTEMKGNALITLIAAYETTSNAMVFLAYNLAVYKDAQHKCREEIEQVIAKHGGLTYEA 60 VTRTEMKGNALITLIAAYETTSNAMVFLAYNLAVYKDAQHKCREEI+QVIA+HGGLTYEA Sbjct: 432 VTRTEMKGNALITLIAAYETTSNAMVFLAYNLAVYKDAQHKCREEIKQVIAEHGGLTYEA 611 Query: 61 VQDLKYMTQCLNESMR 76 VQDLKYMTQCLNESMR Sbjct: 612 VQDLKYMTQCLNESMR 659 >LQW222170.y1_1 KNN*AGTYXYTMLCTYRL**FKSLILI*KCLFYEL*TNLYCVKICYVFYH*SFLV*EKNK KNYLFTLTANIGINPINARNVLFVQNVGHE*D*SNDISTIWCWST*LYWNEICTS*N*NH FRKTSAEILSRCL*RYPCE*NLFILKTISC*TF*EKPF*LQKPHFGFFTKDLPIFQRHFV CLY*DT*SKCFVLCCPECQIHIKKFLLTHNHQQSCIHGNL*LAMRYLKHKTCDINNCCYP PHEDPESIRSIICNNGNCSGTPLKWIQTR*TRKSLLEVTLKIEYSSYRVYLNGICISPTG QLQDDNRPNELCITLCLPVMHV >LQW222170.y1_2 RTTEPEPTXILCCVRIGYSDLNP*Y*YENVCFTNCKRTSTVLKFVTYFITSLF*CEKKIK KIIYLHLLQILELTQLMQEMFCLYRMLDMNEIDPMIFQPFGAGPRNCIGMRFALLEIKIT FAKLLQKFYLDVCEDTPVSETYLF*RLLVVKLFKKNPFNYKSHTLVFLLKIYQYFKDILC AFIKTLKANASFYVVPNVRYILKNFS*HTITNKVAYMVTCNWP*GI*NIRPVI*TTVVTH HMRIQSQFVPLSVTMEIVRALR*SGSKPDKQGNLYLK*RLRLSIPLTGYTSTVSAYRLLA SYKMITDLTNYA*PFVCPSCT >LQW222170.y1_3 EQLSRNLLXYYAVYV*VIVI*ILNINMKMFVLRIVNEPLLC*NLLRILSLVFFSVRKK*K KLSIYTYCKYWN*PN*CKKCFVCTECWT*MRLIQ*YFNHLVLVHVTVLE*DLHFLKLKSL SQNFCRNFISMFVKIPL*VKLIYSKDY*LLNFLRKTLLTTKATLWFFY*RFTNISKTFCV PLLRHLKQMLRSMLSRMSDTY*KISPNTQSPTKLHTW*LVTGHEVFET*DL*YKQLLLPT T*GSRVNSFHYL*QWKLFGHSVKVDPNQINKEIST*SNA*D*VFLLPGIPQRYLHIAYWP VTR**PT*RIMHNPLFARHAR Opp end of LQW246577.y1 >LQW246577.x1_4 XXXYIGCRKKYVDPPAVFRFLWVLPFLRPLPFFCVRPFH*VTYQRRY*TARLNKTSSQNH SLFAVLLDXYMIVIIMIFADLKTTFLAATALPYFGSQT*S*CSNSLLHKVYSCPDVLLDG R*NFGSIK*NFFLEKKCLGSLFMFADTPLYLVIQDTVNATLQ*MG*PFLKGHS*ISQCLE WEEMKSFGMNL*LLTQIGKYVIMFAQYSENTGV*ER*LYMEYLVILCCVRIG***FKSLI LI*KCLFYEL*TNPYCVIICYVFYH*SFLV*EKKKIIYIYTYCKYWN*PN*CKKCFVCTE CWT*MRLIQ*YFNHLVLVHVTVLE*DLHFLKLKHW >LQW246577.x1_5 TXXIYRVQKEVRRPPRCFSVSLGVALFAPLTVFLRKAIPLSYISTALLDCQIE*DQFSES *LIRCTA*XLYDSDNYDICRFKNDILGSNSFALLWFPDMIVMQ**SSA*SV*LP*CLARW KMKLWFNKVKLLPRKEMFRQLIHVC*HTFIFS NSRYCERDITINGVTIPKGTLVNIPVFG MGRDEEFWNEPLTFNPDR*VCDYVCTI**KHRCIGTVTLHGIPCYIMLCTYWLIVI*ILN INMKMFVLRIVNEPLLCYNLLCILSLVFFSVRKKEDYLYLHLLQILELTQLMQEMFCLYR MLDMNEIDPMIFQPFGAGPRNCIGMRFALLEIKALX >LQW246577.x1_6 XXDI*GAERST*TPPLFFGFSGCCPFCAPYRFSA*GHSTELHINGVTRLPD*IRPVLRII AYSLYCLXFI****L*YLPI*KRHSWQQQLCPTLVPRHDRNAVIVFCIKCIAALMSC*ME DETLVQ*SETSS*KRNV*AAYSCLLTHLYI**FKIL*TRHYNKWGDHS*RDTRKYPSVWN GKR*RVLE*TFDF*PR*VSM*LCLHNIVKTPVYRNGNFTWNTLLYYAVYVLVNSDLNP*Y *YENVCFTNCKRTPTVL*FVMYFITSLF*CEKKRRLSIFTLTANIGINPINARNVLFVQN VGHE*D*SNDISTIWCWST*LYWNEICTS*N*STG >LQW277627.y1_4 KKKKRGLNPL*M*FLR*RHIAKLF*LQRLAPCISMTAKDSERLINYFPEKVRQIFARLID SVVESKKEKKQVSL*FQ*MRCMSVVTIK*LIINVVLLLKCY*TRSKKNELN**YSEEIYV STTSIICLSFK*NVCFQFFIIIKLI*SLILNLKK*MVYVWF*F*LSLENSL*DFYTCLKL KKRIKRIILFTTENRHLANND*FSNNRRRCEEWSSERFVCEQVMKPYLPI*AQTKGY*VQ GSMLL*LCVCVFLYKPHNTSLQHIVH*WVSQLMVSQKKEKKHLSRKIHTCLIXVQAQL >LQW277627.y1_5 EEKKTWFKPSINVIP*VKAHC*TLLTSATGTMYLHDRKRFRKVD*LFSRESTSDICKTYR FCC*K*KGKETSKFIISMNALHVSCYN*IINNKCCIVA*VLLNTQQKK*TQLIV*RRDIC FDN*HHLSLI*VECLFPVLYNN*INLIFNIKFKEMNGLCLVLILIKFGKLTVRFLHLFEI KKTNKTHYFIYHREQTSCKQ*LILK*QKKM*RMEQ*KVCM*ASDETIFTNISTNQRILSS RLNAAIIVCVCILIQAT*HIAPAHCSLMGFSIDGITKKRKKTFI*KDTYMFNXGPGSIX >LQW277627.y1_6 RKKNVV*TLYKCNSLGEGTLLNSSNFSDWHHVSP*PQKIQKG*LTIFPRKYVRYLQDLSI LLLKVKRKRNK*VYNFNECVACQLLQLNN***MLYCCLSATEHAAKKMNSTNSIAKRYMF RQLASSVSHLSRMFVSSSL**LN*FNL*Y*I*RNEWFMFGSNSN*VWKTHCKIFTLV*N* KNE*NALFYLPQRTDILQTMIDSQITEEDVKNGAVKGLYVSK**NHIYQYKHKPKDTEFK AQCCYNCVCVYSYTSHITHRSSTLFTNGFLN*WYHKKKKKNIYLERYIHV**XSRLNX LQW246577.y1 100% match to end of last seq continues gene LQW246577.y1.phd.1 LQW246577.x1 12:23:45 2001 TEMPLATE: LQW246577 DIRECTION: rev Length = 914 Score = 102 bits (251), Expect = 5e-22 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +3 Query: 1 RLNAAIIVCVCILIQAT*HIAPAHCSLMGFSIDGITKKRKKTFI*KDTYM 50 RLNAAIIVCVCILIQAT*HIAPAHCSLMGFSIDGITKKRKKTFI*KDTYM Sbjct: 228 RLNAAIIVCVCILIQAT*HIAPAHCSLMGFSIDGITKKRKKTFI*KDTYM 377 >LQW246577.y1_1 LSLENSL*DFYTCLKLKKRIKRIILFTTENRHLANND*FSNNRRRCEEWSSERFVCEQVM KPYLPI*AQTKGY*VQGSMLL*LCVCVFLYKPHNTSLQHIVH*WVSQLMVSQKKEKKHLS RKIHTWF**PFKCRGYKN*NERQQYNHVAGWI*NNI*RHGVPCI*PGCV*RCTTQMQRRD *TSHC*TCELVVCIFTKPLVVVRAVVLKLGGRVTFEGGCYNISK*SVYVSLQ*CLNVKYQ AAQLIK*QL*SVKLLML**CIHMRIRRQ*KLICGKRMRFLFQVCKRIAHKGTGECNTGTG EKGGX >LQW246577.y1_2 *VWKTHCKIFTLV*N*KNE*NALFYLPQRTDILQTMIDSQITEEDVKNGAVKGLYVSK** NHIYQYKHKPKDTEFKAQCCYNCVCVYSYTSHITHRSSTLFTNGFLN*WYHKKKKKNIYL ERYIHGFNNRLNAG VTKTEMKGNSIIMLLAGYETTSNAMVFLAYNLAVYKDAQHKCREEI EQVIAEH VSWLYAYLPNPW*WLEQWFLNWGGV*HSKGGATTFLNKVYMSHYSSV*TLNTR QHS*LNSNFSLLNS*CYDSASI*EYAVNES*YAENV*DSYFKSVNALLIKVLASATPEPG KKGAX >LQW246577.y1_3 KFGKLTVRFLHLFEIKKTNKTHYFIYHREQTSCKQ*LILK*QKKM*RMEQ*KVCM*ASDE TIFTNISTNQRILSSRLNAAIIVCVCILIQAT*HIAPAHCSLMGFSIDGITKKRKKTFI* KDTYMVLITV*MQGLQKLK*KATV*SCCWLDMKQHLTPWCSLHITWLCIKMHNTNAEKRL NKSLLNM*VGCMHIYQTLGSG*SSGS*TGGACNIRRGVLQHF*IKCICLITVVFKR*IPG STVN*IATLVC*TLNVMIVHPYENTPSMKVNMRKTYEIPISSL*THCS*RYWRVQHRNRG KRGH LQW246577.y1 LQW246577.y1.phd.1 LQW246577.x1 12:23:45 2001 TEMPLATE: LQW246577 DIRECTION: rev Length = 914 Score = 372 bits (945), Expect = e-102 Identities = 180/180 (100%), Positives = 180/180 (100%) Frame = +2 Query: 1 *VWKTHCKIFTLV*N*KNE*NALFYLPQRTDILQTMIDSQITEEDVKNGAVKGLYVSK** 60 *VWKTHCKIFTLV*N*KNE*NALFYLPQRTDILQTMIDSQITEEDVKNGAVKGLYVSK** Sbjct: 2 *VWKTHCKIFTLV*N*KNE*NALFYLPQRTDILQTMIDSQITEEDVKNGAVKGLYVSK** 181 Query: 61 NHIYQYKHKPKDTEFKAQCCYNCVCVYSYTSHITHRSSTLFTNGFLN*WYHKKKKKNIYL 120 NHIYQYKHKPKDTEFKAQCCYNCVCVYSYTSHITHRSSTLFTNGFLN*WYHKKKKKNIYL Sbjct: 182 NHIYQYKHKPKDTEFKAQCCYNCVCVYSYTSHITHRSSTLFTNGFLN*WYHKKKKKNIYL 361 Query: 121 ERYIHGFNNRLNAGVTKTEMKGNSIIMLLAGYETTSNAMVFLAYNLAVYKDAQHKCREEI 180 ERYIHGFNNRLNAGVTKTEMKGNSIIMLLAGYETTSNAMVFLAYNLAVYKDAQHKCREEI Sbjct: 362 ERYIHGFNNRLNAGVTKTEMKGNSIIMLLAGYETTSNAMVFLAYNLAVYKDAQHKCREEI 541 >LQW246577.y1 >lcl|LQW246577.y1 CHROMAT_FILE: LQW246577.y1 PHD_FILE: LQW246577.y1.phd.1 CHEM: term DYE: ET TIME: Mon Aug 27 12:23:45 2001 TEMPLATE: LQW246577 DIRECTION: rev TTAAGTTTGGAAAACTCACTGTAAGATTTTTACACTTGTTTGAAATTAAAAAAACGAATAAAACGCATTATTTTATTTAC CACAGAGAACAGACATCTTGCAAACAATGATTGATTCTCAAATAACAGAAGAAGATGTGAAGAATGGAGCAGTGAAAGGT TTGTATGTGAGCAAGTGATGAAACCATATTTACCAATATAAGCACAAACCAAAGGATACTGAGTTCAAGGCTCAATGCTG CTATAATTGTGTGTGTGTGTATTCTTATACAAGCCACATAACACATCGCTCCAGCACATTGTTCACTAATGGGTTTCTCA ATTGATGGTATCACAAAAAAAAGAAAAAAAACATTTATCTAGAAAGATACATACATGGTTTTAATAACCGTTTAAATGCA GGGGTTACAAAAACTGAAATGAAAGGCAACAGTATAATCATGTTGCTGGCTGGATATGAAACAACATCTAACGCCATGGT GTTCCTTGCATATAACCTGGCTGTGTATAAAGATGCACAACACAAATGCAGAGAAGAGATTGAACAAGTCATTGCTGAAC ATGTGAGTTGGTTGTATGCATATTTACCAAACCCTTGGTAGTGGTTAGAGCAGTGGTTCTTAAACTGGGGGGGCGTGTAA CATTCGAAGGGGGGTGCTACAACATTTCTAAATAAAGTGTATATGTCTCATTACAGTAGTGTTTAAACGTTAAATACCAG GCAGCACAGTTAATTAAATAGCAACTTTAGTCTGTTAAACTCTTAATGTTATGATAGTGCATCCATATGAGAATACGCCG TCAATGAAAGTTAATATGCGGAAAACGTATGAGATTCCTATTTCAAGTCTGTAAACGCATTGCTCATAAAGGTACTGGCG AGTGCAACACCGGAACCGGGGAAAAAGGGGGCAT SEQUENCE 119, 131 PKG TO END 46% TO 3A5 see seq 125 Length = 510 Minus Strand HSPs: Score = 162 (57.0 bits), Expect = 7.9e-14, P = 7.9e-14 Identities = 37/66 (56%), Positives = 45/66 (68%), Frame = -1 Query: 538 MISIQGGLTYEAVQDLKYMTQCLNESMRLYSLAPA*VFYMDLRIIMDNLPI*NTTFLAAT 359 +I+ GGLTYEAVQDLKYMTQCLNESMRLYSL PA Y + I ++ + I T + Sbjct: 351 VIAKHGGLTYEAVQDLKYMTQCLNESMRLYSLVPANGRYCERDITINGVTIPKGTLVN-- 408 Query: 358 ALPYFG 341 +P FG Sbjct: 409 -IPVFG 413 Score = 105 (37.0 bits), Expect = 4.5e-06, P = 4.5e-06 Identities = 25/47 (53%), Positives = 27/47 (57%), Frame = -1 Query: 172 SNSRSCERDITINGVTILLKGHS*ISQCLEWEEMKSSWDDPLTVNPD 32 +N R CERDITINGVTI KG + WDDPLT NPD Sbjct: 385 ANGRYCERDITINGVTIP-KGTLVNIPVFGMGRDEEFWDDPLTFNPD 430 >LQW29339.y1_4 L*CFS*YPYRVD*LMKLCRI*NI*LSVSMNL*GFIPLHLRECFIWTYE*LWIICQFKIRL SWQQQLCPTLVPRHDRNAVIVFCIKCMAALMFC*MEDETLVQ*SETSS*K*KCLGSLFMF GDPPLYGVIQDPVNATLQ*MG*PFS*RDTRKYPSVWNGKR*RVLGMTL*LLTQIVSM*LC CTIG >LQW29339.y1_5 IVMFLMISIQGGLTYEAVQDLKYMTQCLNESMRLYSLAPA*VFYMDLRIIMDNLPI*NTT FLAATALPYFGSQT*S*CSNSLLHKVYGCPDVLLDGR*NFGSIK*NFFLEIEMFRQLIHV W*PTFIWSNSRSCERDITINGVTILLKGHS*ISQCLEWEEMKSSWDDPLTVNPDSKYVIM LHNRX >LQW29339.y1_6 CNVSHDIHTGWIDL*SCAGFEIYDSVSQ*IYEALFPCTCVSVLYGLTNNYG*FANLKYDF LGSNSFALLWFPDMIVMQ**SSA*SVWLP*CFARWKMKLWFNKVKLLPRNRNV*AAYSCL VTHLYME*FKIL*TRHYNKWGDHSPKGTLVNIPVFGMGRDEEFLG*PFDC*PR**VCDYV AQ*V >cicl064a02_3 MITPLDILSLETWILILTSFILIRLYIHKKWQVLKNLNIPHDQPTILGIGNLM DFIKNPEFLFMGYFDLKKKYGPIYGAYXW LTPTITITDPEILKKIFIKEFSTFPDRQIAL LDVNGKEMNSALTVVSGRKWKRIRNTLSPTFSSSKLKEMFGIVEDCADSFVQNIGTINSD VDGRFDVSLAFGRLTLGWDLFFSIWCQS >cinc014d12 TCGGCACGAGGCTTACACCCACCATAACGATAACTGATCCAGAAATTTTGAAAAAAATCTTTATTAAAGAGTTTTCTACA TTTCCTGACAGGCAGATTGCTCTACTTGATGTAAATGGTAAAGAAATGAACTCAGCTTTGACTGTTGTGAGTGGAAGGAA ATGGAAAAGAATTAGGAACACCCTCTCTCCCACATTCTCATCATCAAAGTTGAAAGAAATGTTTGGTATAGTTGAAGATT GTGCCGATAGTTTTGTTCAAAACATTGGAACGATAAACTCAGATGTTGACGGAAGATTTGACGTTTCATTAGCATTTGGA CGACTAACGTTGGATGGGATTTGTTCTTCAGCATTTGGTGTCAAAGTTGACTCCCAGGCAGGAAATAATGGTGAAGAATC TCAAGTGGCAAAAATGGCTCGCGAGTTGCTTGCGTTTGAATTCTTCAGGAACCCAATGTTATATGTGTTTTTAATCTTCC CATGGACGGAAAAGATTGCAGAAAAGTTTGATTATACTATTTTCCCGAGAAAGTACGTCAGATATTTTGCAAGACTTATC GATTCTGTTGTTGAAAGTAAAAAGGAAAAGAAACAAAGAACAGACATCTTGCAAACAATGATTGATTCTCAAATAACAGA AGAAGATGTGAAGAATGGAGCAGTGAAAGGGGTTACAAAAACTGAAATG >cinc014d12_3 = seq 112 close to 113, 114 LTPTITITDPEILKKIFIKEFSTFPDRQIALLDVNGKEMNSALTVVSGRKWKRIRNT LSPTFSSSKLKEMFGIVEDCADSFVQNIGTINSDVDGRFDVSLAFGRLTLDGICSSAFGV KVDSQAGNNGEESQVAKMARELLAFEFFRNPMLYVFLIFPWTEKIAEKFDYTIFPRKYVR YFARLIDSVVESKKEKKQRTDILQTMIDSQITEEDVKNGAVKGVTKTEM >SEQUENCE 114 = seq 125 130-160 58% TO 3A5 366 RAHLSPTFTSSKLKEMFGIVQHCADSFVQNI 458 LQW173870.x1 >LQW173870.x1_1 ARMEKSEVFTNLVIIF*SSPVVLCFNRNI*VHFFYSRATLLFNHLVLYTSGICVSLHIYH ISSYIYTSSCVCV*ITQFSPHTWHSKCTILKITPAELCSFKSQWSFIQQINKLL*NFTPF STGHTFLQRLLLQS*KKCSV*FNIVPIVLFKTLER*TQIVMEDSSLQCKLYSTHFSIQSL G*PALPSRLFLFIF*SCVNLHAKGSKAKPDAT*SFVQRCEKWLAYLLSIIKNQYSYPNYI M*LVS*VQYNIGKDVI*AAHKSYCH*VSNISSLFIISLTFPVFQLPSLLGPSRNHRP*IL RVPTNIPKKX >LQW173870.x1_2 RGWKRVRYLLI*LLFFKAVLLFYVLIEIYRFIFFTVEPHCCLII*FCIHQVFVYHFIYII YHHIYIHHHVCVYKSPSFHRTLGTQSALYSKSHQQNFVVLNHNGHSSSK*INCYEISHLF PQGTPFSNVYFFKVERNVRYSSTLCR*FCSKHWNDKLR**WKIPACSVSYIQLTSVFSRW VNLHSQVGYFYSYFSLALICTPKVPKRNQMQPRVSSSAVKSG*RTCFQL*KTNTHTQTT* CNL*VEFSITSVKT*SKLHIRVTVTESVTLVPFS*YLSLSRSSNFPPF*VLVATTVHKFL EFQLISPKKX >LQW173870.x1_3 EDGKE*GIY*FSYYFLKQSCCSMF**KYIGSFFLQ*SHIAV*SFSSVYIRYLCITSYISY IIIYIYIIMCVCINHPVFTAHLALKVHYTQNHTSRTL*F*ITMVIHPANK*IVMKFHTFF HRAHLSPTFTSSKLKEMFGIVQHCADSFVQNIGTINSDSNGRFQPAV*VIFNSLQYSVVG LTCTPK*AIFIHILVLR*SARQRFQSETRCNLEFRPAL*KVVSVPAFNYKKPILIPKLHN VTCKLSSV*HR*RRDLSCT*ELLSLSQ*H*FPFHNISHFPGLPTSLPSRS*SQPPSINS* SSN*YPQKK >SEQUENCE 115, 128 I-HELIX 54% TO 4V2 350 RLAFLDVLLNAETEDGKSLSLNDIQEEVDTFMFEGHDTTAAAMTWTVYLIGRYPDI 517 518 QEKLHEEIDSVFHDDKEGVISNSQLQKLSYLERVIKESLRL 640 YPSVPFIGRVTTEECIIADHV IPVGTQVALFIESMHRNPAVWPDAEKFDPDRFTAENCVGRHPYAYIPFSAGPRNCVGQK 227 FAMMEEKVILAQILRRFSLVSHEKEEDLKKQADLILRSSKPLNITLTPRV* LQW8589.x1 LQW94078.y1 I-helix LQW38262.y1 K-helix LQW260313.x1 PKG TO HEME LQW15315.x1 EXXR TO HEME LQW183918.y1 EXXR TO HEME rcicl039o13 >rcicl039o13 GTGATNAGTTAGTGAAGTGTTAAAATTGAATTAAAACTAGGACATTGTAACCGCATAAATGACAAAGCACATAAATTACA TGGTGATTTATAATTGAAGAAAAATAATGATTTAAACCCGTGGTGTTAAAGTGATGTTCAGAGGTTTTGAAGATCGAAGG ATGAGATCCGCTTGCTTCTTGAGGTCCTCTTCCTTTTCATGAGAAACCAAGGAGAACCTCCGTAAGATCTGGGCCAAGAT AACTTTTTCCTCCATCATTGCAAACTTTTGCCCAACACAGTTGCGAGGGCCTGCAGAGAACGGAATGTAAGCATAAGGGT GACGACCGACACAATTTTCAGCTGTAAAGCGATCCGGATCAAATTTTTCTGCATCTGGCCACACAGCAGGATTGCGGTGC ATGCTTTCAATGAACAAAGCCACTTGTGTGCCAACAGGTATGACATGGTCGGCAATAACGCATTCCTCTGTGGTCACTCT GCCAATAAATGGAACAGATGGATATAACCTCAATGACTCCTTAATGACTCTTTCCAAGTAGGAAAGCTTCTGAAGCTGTG AATTGCTGATCACTCCTTCCTTATCATCATGAAACACAGAATCGATT IDSVFHDDKEGVISNSQLQKLSYLERVIKESLRLYPSVPFIGRVTTEECVIADHVIPVGT QVALFIESMHRNPAVWPDAEKFDPDRFTAENCVGRHPYAYIPFSAGPRNCVGQKFAMMEE KVILAQILRRFSLVSHEKEEDLKKQADLILRSSKPLNITLTPRV* >Ciona savignyi ortholog to seq 115 47% to 4V5 fugu 44% to 4V2 human 48% to 4v3 mouse 45% to 318A1 Drosophila ortholog to seq 115 (75%) and less to 134 (76%) 141 (69%) of intestinalis MAVTLLIILGAFVVPF ALYWRKILKEISNRHRINKLPSVNSPAYPLVGHSYMFPRNPDEMYDLITSWLKWVMREAK QKLAVVWLGPVPLVAIVHPDAAEVVLRSSKHMEKSFVYRFLHPWLGTGLLTSGGEKWKQR RRLITPSFHFNILLDFLEVMNEQSTKM LRNLDAAVQSGSKVNVGRAITMCALDIICETAMGRTVNAQSDQESEYVKALYR (2) ISDIIQQRQKSPALWWDLAFSKMAMGREHDATIDVLHRFTMNVISDRAQSKTEIKVGWIF (0) DTRRMAFLDVLLRAESEDGRSLSLSDIQEEVDTFMFEGHDTTAAAMTWTIYLIGRHPAIQARIHEELDD 553 552 VFGGDMGTITNSHLQKLSLLERTIKESLRMFPSVPFIGRVTTEECSVGSHSIPAGTQVA 376 375 IFIDSLHHNPSVWPDVDRFDPDRFLPENCVGRHPYSFIPFSAGPRNCIGQKFALMEEKVL 196 195 LTQILRKYSIHSHDEEEDLRKQADLILRSSTPLNISLTPRA* 70 This Savignyi sequence assembled from G126P66272R.T0/G126P66272RB11.T0.seq from file 5 beginning of exon 1 G126P601199R.T0/G126P601199RH11.T0.seq from file 10 most of exon 1 whole intron 1 G126P67007F.T0/G126P67007FB10.T0.seq from file 2 beginning of exon 2 G126P69843R.T0/G126P69843RF8.T0.seq from file 8 end of exon 2 whole intron 2 G126P600798R.T0/G126P600798RB7.T0.seq from file 11 beginning of exon 3 G126P601882R.T0/G126P601882RC8.T0.seq from file 10 most of exon 3 missing first 9 aa >SEQUENCE 116, 33 I-HELIX 56% TO 2E1 165 YAGTETSTSTILWGMIALINYPEIQEKLHKEI 260 LQW12243.y1 LQW76904.y1 I-HELIX >LQW12243.y1_1 RYIFYTNA*STCCFILLAFNNNKR*PQKN*PAEI*NCLKFHFRKNLSGCAWLIFFMLVQK QAQARYCGG*LHLSITQKYKRNFIKK*SMQQVSSFTAYILFTNFRCRGKVVSALACNPEV ISSSLVAATIVGICVLR*DT*RQLL*PSSH*WVVQIISQHKKKEKFQKNNYAHSNV*LAN NCNLLFR*RTSKVGPQG*ASITPSLYTRTLPLYGPYTTRYSTTN >LQW12243.y1_2 DIFFTLMLEVPVVLFF*LLIIIKDDHKKINQQKFKTV*NFILGRISQGVRG*SFLCWYRN KHKHDTVGDDCTYQLPRNTRETS*RNSQCNR*AHSLLTFYLQTSGVVAKWLARLPVTQR* *VQASSLLQLLAYVSLGKTLNGNCFNLVVTNGLSKLLANIKKKKNSKKIITHIVMYDWQI IATYYSGEELPRLDHKDELPLLQAFIQELYRCMALIPLGIQQQ >LQW12243.y1_3 IYFLH*CLKYLLFYSFSF****KMTTKKLTSRNLKLFEISF*EESLRVCVADLFYAGTET STSTILWGMIALINYPEIQEKLHKEIVNATGELIHCLHFIYKLPVSWQSG*RACL*PRGN KFKPRRCYNCWHMCP*VRHLTAIALT**SLMGCPNY*PT*KKRKIPKK*LRT**CMTGK* LQLIIQVKNFQGWTTRMSFHYSKPLYKNFTAVWPLYH*VFNNK >SEQUENCE 118, 140 N-TERM TO EXXR 381 AA 35% TO 3A5 no introns MYIPSFLSVETLVLLITSLVLVRIYIHKKWQFLKNINIPHIQPTILQLGTVRPFIGNSD WMMNSHEYCKRKLGKIYGAYLFLTPQITVADPDIIKQMYIKEFATFPTRQTSLTKINGK VMNTTILMTEGEQWKRIRNTLTPSFSTAKLKEMLGIMEDCCNHAINILIKTTQNDQ GKFEAKSVFGKLALDITCSAAFSVDTHPQELKDGQEPKIIKMVKQAFGFEISR SPLVMLCFMFPAFEEILCKLDYSIIPKDTVNYFANLTKSLIDQRKHSTVKPRVDLMQLMLNDQI SVEDVAKGKSKGLTQLEITSNSVLMVLAGYDTSANALTLLAYNLATHKHVHKKVHEEIDQ MLEKYGSLTYEALTSMKYLGMCLNETLRLYPPIAVNSRIPNRDITINEVFLPKGIQVIVP VYGMSRDEEIWEEPLKFKPERMEDMRSVDPMIFQPFGGGPRGCIGMRFAVLEIKLAIAKIL QDFDLDVCENTPKPPVQLEFKSTTLKPKGDIYLRVTPKSN* LQW229696.x1 N-TERM TO MID LQW149656.x1 N-TERM TO C-HELIX LQW150723.x1 C-HELIX TO EXXR AV997898 EST EXXR to heme LQW162676.x1 PERF to end >SEQUENCE 118, 140 WXXP TO END 48% TO 3A5 RDEEINQTLPLYPPIAVNSRIPNRDITINGVFLPKGIQVIVPVYGMS WEEPLKFKPERMEDMRSVDSMIFQPFGGGPRGCIGMRFAVLEIKLAIAKILQDFNLDVCENTPKP PVQLEFKSTTLKPKGDIYLRVTPKSN* LQW162676.x1 >GCiWno197_f23.g1 CHROMAT_FILE: GCiWno197_f23.g1 PHD_FILE: GCiWno197_f23.g1.phd.1 CHEM: term DYE: big TIME: Sun Sep 30 18:29:17 2001 TEMPLATE: GCiWno197_f23 DIRECTION: rev Length = 856 Score = 142 bits (354), Expect = 1e-33 Identities = 69/89 (77%), Positives = 75/89 (83%), Gaps = 3/89 (3%) Frame = +3 Query: 1 WEEPLKFKPERMEDMRSVDSMIFQPFGGGPRGCIGMRFAVLEIKLAIAKILQDFNLDVCE 60 WEEPLKFKPERMEDMRSVD+MIFQPFGGGPRGCIGMRFAVLEIKLAIAKILQDFNLDVCE Sbjct: 198 WEEPLKFKPERMEDMRSVDAMIFQPFGGGPRGCIGMRFAVLEIKLAIAKILQDFNLDVCE 377 Query: 61 NTPKPKM---VAIPTLHPKDGLPVHLQPR 86 NTPKP + TL PK + + + P+ Sbjct: 378 NTPKPPVQLEFKSTTLKPKGDIYLRVTPK 464 >GCiWno197_f23.g1 CTGGCCGTCGTTTTACTGGAAACAGCTATGACCTTGACTGCCTCGCAATGTACTGAAACCAGACATTACCGCTATACCCT CCTATTGCTGTAAACTCTCGAATCCCAAACCGTGACATCACTATTAATGGAGTCTTTTTACCAAAAGGTATTCAAGTTAT TGTCCCAGTTTATGGCATGAGCAGAGATGAGGAGATATGGGAGGAACCACTCAAATTCAAACCAGAGAGGATGGAAGACA TGAGATCAGTTGATGCCATGATTTTTCAACCATTTGGTGGAGGACCACGTGGCTGTATTGGAATGAGATTTGCCGTGTTG GAAATTAAGCTTGCAATTGCAAAAATTCTTCAGGACTTTAACCTTGATGTATGTGAAAATACCCCTAAGCCCCCTGTACA GTTAGAATTTAAATCCACAACACTGAAGCCAAAAGGGGATATTTACTTGCGAGTAACTCCCAAATCAAACTAGAATTCAA TTTCCAATGAACTGAATGAAGTATTTTGGTGTCATTTGATTATCCACCTCATAAACTGTATGGATATTTTATTGTTTTAA AATTTGATAATAATGATTTCTCATTGGTCAGTTTCAATCAAAACATAACAAACCTGGTGTGTTTTCTATATCGGCTGTTA TGTNTATACTGTAACTGACCACAAGTGAATCAAATTTATTTTTCAAATTTTTTTTTTTTAAATCTGAACCAAGTTTATTT ACCTAGATTTCTCATTGCTGGGATGTAAATAGAAGTAATTACCATAAATAGGTTTAATTGTGGAGGAATTCCTTGGACCA TTTTCTTTTTCCCCCAACTTATCTTGGCACTTAAAAATTAACTTGAGATTTACCCC >GCiWno197_f23.g1_1 LAVVLLETAMTLTASQCTETRHYRYTLLLL*TLESQTVTSLLMESFYQKVFKLLSQFMA* AEMRRYGRNHSNSNQRGWKT*DQLMP*FFNHLVEDHVAVLE*DLPCWKLSLQLQKFFRTL TLMYVKIPLSPLYS*NLNPQH*SQKGIFTCE*LPNQTRIQFPMN*MKYFGVI*LSTS*TV WIFYCFKI****FLIGQFQSKHNKPGVFSISAVMXIL*LTTSESNLFFKFFFFKSEPSLF T*ISHCWDVNRSNYHK*V*LWRNSLDHFLFPPTYLGT*KLT*DLPX >GCiWno197_f23.g1_2 WPSFYWKQL*P*LPRNVLKPDITAIPSYCCKLSNPKP*HHY*WSLFTKRYSSYCPSLWHE QR*GDMGGTTQIQTREDGRHEIS*CHDFSTIWWRTTWLYWNEICRVGN*ACNCKNSSGL* P*CM*KYP*APCTVRI*IHNTEAKRGYLLASNSQIKLEFNFQ*TE*SILVSFDYPPHKLY GYFIVLKFDNNDFSLVSFNQNITNLVCFLYRLLCXYCN*PQVNQIYFSNFFFLNLNQVYL PRFLIAGM*IEVITINRFNCGGIPWTIFFFPQLILALKN*LEIYP >GCiWno197_f23.g1_3 GRRFTGNSYDLDCLAMY*NQTLPLYPPIAVNSRIPNRDITINGVFLPKGIQVIVPVYGMS RDEEIWEEPLKFKPERMEDMRSVDAMIFQPFGGGPRGCIGMRFAVLEIKLAIAKILQDFN LDVCENTPKPPVQLEFKSTTLKPKGDIYLRVTPKSN*NSISNELNEVFWCHLIIHLINCM DILLF*NLIIMISHWSVSIKT*QTWCVFYIGCYVYTVTDHK*IKFIFQIFFF*I*TKFIY LDFSLLGCK*K*LP*IGLIVEEFLGPFSFSPNLSWHLKINLRFT >SEQUENCE 138 I-HELIX 42% TO 3A4 VMFPWTENIAKVFDYSLLPKDCLRYFARLAKTVKKNKANVEQ this seg LQW221105.y1_1 part of middle opp end of LQW221105.x1 from seq walk RVDILQTMINSEITDNEVKNGAIKG LTEIEVTANSLLMMFGGFETTASAMVFLAYNLAVYKDAQHKCREEIEQVIAKH (0?) LQW22624.y1 GCiWno302_f12.b1 Note this is not from this seq but from a related seq to MFPWTENIAKVFDYSLLPKDCLRYFARLAKT >cinc014d12 Length = 689 Score = 44.1 bits (102), Expect = 3e-04 Identities = 17/28 (60%), Positives = 23/28 (81%) Frame = +3 Query: 1 MFPWTENIAKVFDYSLLPKDCLRYFARL 28 +FPWTE IA+ FDY++ P+ +RYFARL Sbjct: 474 IFPWTEKIAEKFDYTIFPRKYVRYFARL 557 >cinc014d12 TCGGCACGAGGCTTACACCCACCATAACGATAACTGATCCAGAAATTTTGAAAAAAATCTTTATTAAAGAGTTTTCTACA TTTCCTGACAGGCAGATTGCTCTACTTGATGTAAATGGTAAAGAAATGAACTCAGCTTTGACTGTTGTGAGTGGAAGGAA ATGGAAAAGAATTAGGAACACCCTCTCTCCCACATTCTCATCATCAAAGTTGAAAGAAATGTTTGGTATAGTTGAAGATT GTGCCGATAGTTTTGTTCAAAACATTGGAACGATAAACTCAGATGTTGACGGAAGATTTGACGTTTCATTAGCATTTGGA CGACTAACGTTGGATGGGATTTGTTCTTCAGCATTTGGTGTCAAAGTTGACTCCCAGGCAGGAAATAATGGTGAAGAATC TCAAGTGGCAAAAATGGCTCGCGAGTTGCTTGCGTTTGAATTCTTCAGGAACCCAATGTTATATGTGTTTTTAATCTTCC CATGGACGGAAAAGATTGCAGAAAAGTTTGATTATACTATTTTCCCGAGAAAGTACGTCAGATATTTTGCAAGACTTATC GATTCTGTTGTTGAAAGTAAAAAGGAAAAGAAACAAAGAACAGACATCTTGCAAACAATGATTGATTCTCAAATAACAGA AGAAGATGTGAAGAATGGAGCAGTGAAAGGGGTTACAAAAACTGAAATG >cinc014d12_3 = seq 112 close to 113, 114 GTRLTPTITITDPEILKKIFIKEFSTFPDRQIALLDVNGKEMNSALTVVSGRKWKRIRNT LSPTFSSSKLKEMFGIVEDCADSFVQNIGTINSDVDGRFDVSLAFGRLTLDGICSSAFGV KVDSQAGNNGEESQVAKMARELLAFEFFRNPMLYVFLIFPWTEKIAEKFDYTIFPRKYVR YFARLIDSVVESKKEKKQRTDILQTMIDSQITEEDVKNGAVKGVTKTEM LQW173870.y1 search with hybrid seq to extend LQW173870.y1.phd.1 LQW173870.x1 11:57:58 2001 TEMPLATE: LQW173870 DIRECTION: rev Length = 1013 Score = 75.3 bits (182), Expect = 2e-13 Identities = 34/42 (80%), Positives = 38/42 (89%) Frame = -3 Query: 37 LMFPWTENIAKVFDYSLLPKDCLRYFARLAKTVVESKKEKKQ 78 +MFPWTENIAKVFDYSLLPKDCLRYFARLAKTV ++K +Q Sbjct: 669 VMFPWTENIAKVFDYSLLPKDCLRYFARLAKTVKKNKANVEQ 544 Score = 41.8 bits (96), Expect = 0.002 Identities = 18/25 (72%), Positives = 23/25 (92%) Frame = -3 Query: 78 QRTDILQTMIDSQITEEDVKNGAVK 102 QR DILQTMI+S+IT+ +VKNGA+K Sbjct: 144 QRVDILQTMINSEITDNEVKNGAIK 70 >LQW22624.y1 exact match >lcl|LQW22624.y1 CHROMAT_FILE: LQW22624.y1 PHD_FILE: LQW22624.y1.phd.1 CHEM: term DYE: ET TIME: Wed Mar 21 15:18:08 2001 TEMPLATE: LQW22624 DIRECTION: rev GTACACAGGCAGTAGATACAAATGACTTAATTGCATATTTTGCGACTAATTTCATCAGTTTCAATAGATTATGTTATGAT GTAATCGTCCATTAGTTCACAGACAGATTTACAGAATCTCAGACAAAGTCCGCATCCATATAGAATAGACATATGCATGC AAACAACTCACATGTTTAGCAATGACTTGTTCAATCTCTTCCCTGCATTTGTGTTGTGCATCTTTATACACAGCCAGGTT ATATGCAAGGAACACCATGGCACTTGCTGTAGTTTCAAAACCACCAAACATCATCAGAAGACTGTTGGCAGTCACTTCTA TTTCGGTCAAACCTACAAGGAAATAAATGATAAGGTAAACACAACATGTAAATTTATATGTAAAACACAACAAATTTTAA ACTAGCTTCTTAACATACTGTGACTCGATCCACAATGTTGTCACCAATTTGAGTGTGAACTTCCCTGCCAAG LTEIEVTANSLLMMFGGFETTASAMVFLAYNLAVYKDAQHKCREEIEQVIAKHVSCLHAYVYSIWMRTLSEIL >LQW260507.y1 match to dowstream seq of LQW22624.y1 (walk #1) >lcl|LQW260507.y1 CHROMAT_FILE: LQW260507.y1 PHD_FILE: LQW260507.y1.phd.1 CHEM: term DYE: ET TIME: Fri Aug 31 12:15:14 2001 TEMPLATE: LQW260507 DIRECTION: rev TGAAGAGAACTGAATTTAGCCGGTTCCATAGTACTCAGTTATTGTTTTCCTCAATGTCACTTTGATATTGGGCCAATTTT ACAAAGATACCTTAAGTTTCGTTGCCGGGTATACGTGTTAAGTTTGTGAGCCAAATAAGTAAAATCACGGCAATTTACAT GCAAAACTACAGCCAGATACATCAGTTTATGGTAATGTCATGCATCTATGTTTATATTTTTATATTTTAAACATGTTCTT TTATGTTTTTGGTTGGTAAACTTGATATTTTCTGGTTTTTTTACTCTTTAATCGATTGAGTGTTCAATAAAAGTTGATTA TTTTTGTGAGGTTTATTATTATGATAAAATATAACATTAGTAGAAAGCCATTTTCACGCGCAGAAGTGCTTGGTTTTTAA AAAATCGCAATATTTAAACGAAAAACAGCACCCAGCAATGATAAAATGCTATGCCGTGGGCTCCGTAATGGTGGCGTCAA TGACGTCATAGACGCGCGACAATGGAAAACAAGACTCGTTGTTTTACAATCCGTTTCCTAACTTGGTCTATACTAACTTT GGGATTACCAAATGACTTAAATAGCATATTTTGCCAACGACTAGTTTCATCAGTTTCAATAGATTATGTTATGATGCAAT CGTCCATTAGTTCACAGTCAGATTTAAGGAATTTCTCCGACACAGTTCTCATCCATATAGAATAGACATAAGCATGCAAC CAACTCACATGTTTAGCAATGACTTGTTTAATCTCTTCCCTGCATTTGTGTTGTGCATCTTTATACACAGCCAGGTTATA TGCAAGGAACACATGGCATTGCTGTAGTTTCAAAACCACAAGATCATCGAAGACTGTGGCAGTCATTTATTTTCGGTAAC CTACAGCAATTATTATCGTTACCCACTGTTATCTTTTTACACAACCATTTAACAACTTTAATACGGCGCCCCCAGTTTCC CATGGTTAATCCGCCAATTTGATCACCGGTAAGGTGAACAGACGAAAATTTGACACGTACGATTAAAGGAATACAAACGG GTGTTTGCAACACATTC >LQW260507.y1_4 NVLQTPVCIPLIVRVKFSSVHLTGDQIGGLTMGNWGRRIKVVKWLCKKITVGNDNNCCRL PKINDCHSLR*SCGFETTAMPCVPCI*PGCV*RCTTQMQGRD*TSHC*TCELVACLCLFY MDENCVGEIP*I*L*TNGRLHHNIIY*N**N*SLAKYAI*VIW*SQS*YRPS*ETDCKTT SLVFHCRASMTSLTPPLRSPRHSILSLLGAVFRLNIAIF*KPSTSARENGFLLMLYFIII INLTKIINFY*TLNRLKSKKTRKYQVYQPKT*KNMFKI*KYKHRCMTLP*TDVSGCSFAC KLP*FYLFGSQT*HVYPATKLKVSL*NWPNIKVTLRKTITEYYGTG*IQFSS >LQW260507.y1_5 ECVANTRLYSFNRTCQIFVCSPYR*SNWRINHGKLGAPY*SC*MVV*KDNSG*R**LL*V TENK*LPQSSMILWF*NYSNAMCSLHITWLCIKMHNTNAGKRLNKSLLNM*VGCMLMSIL YG*ELCRRNSLNLTVN*WTIAS*HNLLKLMKLVVGKICYLSHLVIPKLV*TKLGNGL*NN ESCFPLSRVYDVIDATITEPTA*HFIIAGCCFSFKYCDFLKTKHFCA*KWLSTNVIFYHN NKPHKNNQLLLNTQSIKE*KNQKISSLPTKNIKEHV*NIKI*T*MHDITIN*CIWL*FCM *IAVILLIWLTNLTRIPGNET*GIFVKLAQYQSDIEENNN*VLWNRLNSVLFX >LQW260507.y1_6 MCCKHPFVFL*SYVSNFRLFTLPVIKLAD*PWETGGAVLKLLNGCVKR*QWVTIIIAVGY RK*MTATVFDDLVVLKLQQCHVFLAYNLAVYKDAQHKCREEIKQVIAKHVSWLHAYVYSI WMRTVSEKFLKSDCELMDDCIIT*SIETDETSRWQNMLFKSFGNPKVSIDQVRKRIVKQR VLFSIVARL*RH*RHHYGAHGIAFYHCWVLFFV*ILRFFKNQALLRVKMAFY*CYILS** *TSQK*STFIEHSID*RVKKPENIKFTNQKHKRTCLKYKNINIDA*HYHKLMYLAVVLHV NCRDFTYLAHKLNTYTRQRNLRYLCKIGPISK*H*GKQ*LSTMEPAKFSSLX >LQW221105.x1 walk #2 matches end of >LQW260507.y1_6 >lcl|LQW221105.x1 CHROMAT_FILE: LQW221105.x1 PHD_FILE: LQW221105.x1.phd.1 CHEM: term DYE: ET TIME: Thu Aug 23 20:51:25 2001 TEMPLATE: LQW221105 DIRECTION: fwd TACCTACGAATCTACAGAGCCATTCTTTACTACATTTATAATCCAACATGAGTGGACATGCAGCTCCAAACTGCTTAGGT ACTAGCAGATAAGGTGTTCGCGTTTTCCTATTTCATAAAGACCCGTAAAGTACTAACTCAAGCAGAGGACCAAAAATAGT AACTCAGTATTGTTTTCCTCAATGTCACTTTGATATTGGGCCAATTTTACAAAGATACCTTAAGTTTCGTTGCCGGGTAT ACGTGTTAAGTTTGTGAGCCAAAAAGTAAAATCACGGCAATTTACATGCAAAACTACAGCCAGATACATCAGTTTATGGT AATGTTATGCGTTTTTGTTTATATTTTTATATTTTAAACATGTTCTTTTATGTTTTTGGTTGGTAAACTTGATATTTTCT GGTTTTTTTACTCTTTAATCGATTGAGTGTTCAATAAAAGTTGATTATTTTTGTGAGGTTTATTATTATGATAAAATATA ACATTAGTAGAAAGCCATTTTCACGCGCAGAAGTGCTTGGTTTTTAAAAAATCGCAATATTTAAACGAAAAACAGCACCC AGCAATGATAAAATGCTATGCCGTGGGCTCCGTAATGGTGGCGTCAATGACGTCATAGACGCGCGACAATGGAAAACAAG ACTCGTTGTTTACAATCCGGTTCCTAACTTGGTCTATACTAACTTTGGGGATTACCAATGACTAAATAGCAATTTTGCCA AGACTAGTTCCTCCGCTCATAGATCTGTCTGATGAATCGTCCTTAGTTCACGTCGATTTAGAATTTTCGACCAGCCTCTC CTTTGAAGACCTTGGTTGGCCATTCCGTTTTCCTGCCGTTAACCTTCCGGGGGGGGGGGGCTTATAAGGCGGGTTTCGGA ACCGTCTGTGTGGTGTTACCCAGCTGTGCGGGTGGCCTTTGTGACCAG >SEQUENCE 119, 131 PKG TO END 46% TO 3A5 see seq 125 MITPLDILSLETWILILTSFILIRLYIHKKWQVLKNLNIPHDQPTILGIG NLMDFIKNPEFLFMGYFDLKKKYGPIYGAYNW LTPTITITDPEILKKIFIKEFSTFPDRQIALLDVNGKEMNSALTVVSGRKWKRIRNT LSPTFSSSKLKEMFGIVEDCADSFVQNIGTINSDV DGRFDVSLAFGRLTLDGICSSAFGVKVDSQAANNGKESQVAKMAR EFLAIEIFKNPMVFVFLVFPWLGKVAKLFDYSVFPKKYIIYFSKLIDSVVETKKKKKQRT DILQTMIDSQITEEDVKNGAVKGVTRTEMKGNALITLIAAYETTS NAMVFLAYNLAVYKDAQHKCREEIEQVI AKHGGLTYEAVQDLKYMTQCLNESMRLYSLVPANG RYCERDITINGVTIPKGTLVNIPVFGMGRDEEFWDDPLTFNPDR MLDMNEIDPMIFQPFGAGPRNCIGMRFALLEIKITFAKLLQKF YLDVCEDTPAPPLEVTFKSGMRPKEMIHLKVTAVE* LQW71684.y1 HEME LQW222170.y1 HEME LQW143144.x1 HEME LQW246577.x1 PKG TO HEME LQW246577.y1 I-helix cibd002e09 rcigd043j06 cibd048n22 ciad066l13 cinc014d12 cibd064d19 >cibd048n22 Length = 701 Score = 102 bits (252), Expect = 7e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = +2 Query: 1 NSRYCERDITINGVTIPKGTLVNIPVFGMGRDEEFWDDPLTFNPDR 46 N RYCERDITINGVTIPKGTLVNIPVFGMGRDEEFWDDPLTFNPDR Sbjct: 257 NGRYCERDITINGVTIPKGTLVNIPVFGMGRDEEFWDDPLTFNPDR 394 cibd048n22 Length = 701 Score = 120 bits (298), Expect = 2e-27 Identities = 55/73 (75%), Positives = 65/73 (88%) Frame = +2 Query: 5 EVTANSLLMMFGGFETTASAMVFLAYNLAVYKDAQHKCREEIEQVIAKHGGLTYEAMNDL 64 E+ N+L+ + +ETT++AMVFLAYNLAVYKDAQHKCREEIEQVIAKHGGLTYEA+ DL Sbjct: 20 EMKGNALITLIAAYETTSNAMVFLAYNLAVYKDAQHKCREEIEQVIAKHGGLTYEAVQDL 199 Query: 65 KYIMQCLNESLRL 77 KY+ QCLNES+RL Sbjct: 200KYMTQCLNESMRL 238 >ciad066l13 GCTGTTAAAATATTCCTGATATTTCCCCAGCCTGATTACTCCTCTTGATATTTTATCGTTGGAAACTTGGATTTTAATCC TGACTTCATTCATTCTTATCAGATTATACATCCATAAGAAATGGCAAGTGTTAAAGAACTTAAACATTCCACATGACCAA CCTACTATACTTGGCATTGGAAATTTGATGGATTTCATTAAAAACCCTGAGTTTTTGTTTATGGGATATTTTGATTTGAA GAAAAAATACGGACCAATATATGGCGCATACAATTGGCTTACACCCACCATAACGATAACTGATCCAGAAATTTTGAAAA AAATCTTTATTAAAGAGTTTTCTACATTTCCTGACAGGCAGATTGCTCTACTTGATGTAAATGGTAAAGAAATGAACTCA GCTTTGACTGTTGTGAGTGGAAGGAAATGGAAAAGAATTAGGAACACCCTCTCTCCCACATTCTCATCATCAAAGTTGAA AGAAATGTTTGGTATAGTTGAAGATTGTGCCGATAGTTTTGTTCAAAACATTGGAACGATAAACTCAGATGTTGACGGAA GATTTGACGTTTCATTAGCATTTGGACGACTAACGTTGGATGGGATTTGTTCTTCAGCATTTGGTGT >ciad066l13_2 LLKYS*YFPSLITPLDILSLETWILILTSFILIRLYIHKKWQVLKNLNIPHDQPTILGIG NLMDFIKNPEFLFMGYFDLKKKYGPIYGAYNW LTPTITITDPEILKKIFIKEFSTFPDRQ IALLDVNGKEMNSALTVVSGRKWKRIRNTLSPTFSSSKLKEMFGIVEDCADSFVQNIGTI NSDVDGRFDVSLAFGRLTLDGICSSAFG >cinc014d12_3 GTRLTPTITITDPEILKKIFIKEFSTFPDRQIALLDVNGKEMNSALTVVSGRKWKRIRNT LSPTFSSSKLKEMFGIVEDCADSFVQNIGTINSDV DGRFDVSLAFGRLTLDGICSSAFGV KVDSQAGNNGEESQVAKMARELLAFEFFRNPMLYVFLIFPWTEKIAEKFDYTIFPRKYVR YFARLIDSVVESKKEKKQRTDILQTMIDSQITEEDVKNGAVKGVTKTEM >cibd064d19_3 CR*FCSNIGTVNSDGDGRFDVSLAFGRLTLDGICSSAFGVKVDSQAANNGKESQVAKMAR EFLAIEIFKNPMVFVFLVFPWLGKVAKLFDYSVFPKKYIIYFSKLIDSVVETKKKKKQRT DILQTMIDSQITEEDVKNGAVKGVTRTEMKGNALITLIAAYETTS NAMVFLAYNLAVYKDAQHKCREEIKQVIAEHGGLTYEAVQDLKYMTQCLNESMR >cibd048n22 TTCGGCACGAGGAAGGACTGAAATGAAGGGAAATGCTCTTATCACTTTGATAGCAGCTTATGAAACAACATCTAACGCCA TGGTGTTCCTTGCATATAACTTGGCTGTGTATAAAGATGCACAACACAAATGCAGGGAAGAGATTGAACAAGTCATTGCT AAACATGGTGGATTGACTTATGAAGCTGTGCAGGATTTGAAATATATGACTCAGTGTCTCAATGAATCTATGAGGCTTTA TTCGCTTGTACCTGCAAATGGAAGATACTGTGAACGCGACATTACAATAAATGGGGTGACCATTCCTAAAGGGACACTCG TAAATATCCCAGTGTTTGGAATGGGAAGAGATGAAGAGTTTTGGGATGACCCTTTGACTTTTAACCCAGATAGAATGTTG GACATGAATGAGATTGATCCAATGATATTTCAGCCATTTGGTGCTGGTCCACGTAACTGTATTGGAATGAGATTTGCACT TCTTGAAATTAAAATCACTTTCGCAAAACTTCTGCAGAAATTTTATCTCGATGTTTGTGAAGATACCCCTGCACCCCCTT TGGAAGTTACTTTCAAATCTGGAATGAGACCAAAAGAAATGATTCATTTGAAAGTTACAGCAGTAGAATAACTTGCACTT AATGGTGTCATTACTGTTGTATTATCTTGTAATCGCATATGTAGCTTTATAGCTTTGTAGA >cibd048n22_2 SARGRTEMKGNALITLIAAYETTSNAMVFLAYNLAVYKDAQHKCREEIEQVIAKHGGLTY EAVQDLKYMTQCLNESMRLYSLVPANGRYCERDITINGVTIPKGTLVNIPVFGMGRDEEF WDDPLTFNPDRMLDMNEIDPMIFQPFGAGPRNCIGMRFALLEIKITFAKLLQKFYLDVCE DTPAPPLEVTFKSGMRPKEMIHLKVTAVE* >rcigd043j06 TTCGGGTTAAATTGACATTTATTGCAGATTTTAAACTAATAAACACAAAATTTTTCCCAAACACATAAGAATGGAAGAAT TTTTTCCAAAAGCATTTTAGTAAAATGTTAAAATAACAAAATGTACTTTTTCAAATGCAATACTAAAGAATATATAGCAG TTTAAAAAAACAAATAAAATGTCACCAAACAAAGTTAATTTTTATAGATATACAGAATAACCCATAGGTCAAATGCAGGG AAGCTAAACTGGTCATGAATTCACAGCTAAAATATGAAATTTAGGAGTGACAAGGATTTATCAAACTAATGACTTCTTAT TTATCTTATGCATGTCATTACATGATTTTACTTATTGCTCAATTGCAAAGATCATATGAATTAAAACAACAAAGAGAGAA TTATCGAGCAAATGATGGGTAAAATATGCTGGGATTATAAAATATAATCACCACAAATAATCTACAAAGCTATAAAGCTA CATATGCGATTACNAGATAATACAACAGTAATGACACCATTAAGTGCAAGTTATTCTACTGCTGTAACTTTCAAATGAAT CATTTCTTTTGGTCTCATTCCAGATTTGAAAGTAACTTCTAAAGGGGGTGCAGGGGTATCTTCACAAACATCGAGATAAA ATTTCTGCAGAAGTTTTGCGAAAGTGATTTTAATTTCAAGAAGTGCAAATCTCATTCCNATACAGTTACGTG >SEQUENCE 122, 121 HEME 60% TO 4A11 part of 121 DSDGKGLSDSEIRAEVDTFMFEGHDTTA SGISWTFYCLAMHPEHQEKCFQEIEKVMADRTDIEWNDLSNLPHLTLCIKESLRQ YPPVPIIFRKLNKDIEVDGKTIVKDTNVVLHIYALHHHEEFWKDPH IFDPSRFTQENMKSMNSYAYVPFSAGPRNCIGQRFAMNEIKIAVAQVLSKF QLKPDLSKKIQHSVDVIYRATTGLYLKAERRV LQW60228.x1 LQW36432.y1 heme rcign077p24 rcign078n05 rcigd021n08 LQW157967.y1 LQW157967.y1.phd.1 LQW157967.x1 12:51:25 2001 TEMPLATE: LQW157967 DIRECTION: rev Length = 987 Score = 108 bits (266), Expect = 2e-23 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -2 Query: 1 DVILHIYALHHHEEFWKDPHIFDPSRFTQENMKSMNSYAYVPFSAGP 47 DVILHIYALHHHEEFWKDPHIFDPSRFTQENMKSMNSYAYVPFSAGP Sbjct: 176 DVILHIYALHHHEEFWKDPHIFDPSRFTQENMKSMNSYAYVPFSAGP 36 >LQW157967.y1 >lcl|LQW157967.y1 CHROMAT_FILE: LQW157967.y1 PHD_FILE: LQW157967.y1.phd.1 CHEM: term DYE: ET TIME: Wed Aug 22 12:51:25 2001 TEMPLATE: LQW157967 DIRECTION: rev TAATCGAGCTCGGTCTGTATGTTGTTGAAACTTACTGGGCCAGCAGAGAAAGGTACATAAGCATAACTATTCATGCTTTT CATGTTTTCCTGCGTGAACCGACTTGGATCAAATATATGAGGATCCTTCCAAAACTCCTCGTGATGATGTAATGCATAAA TATGTAGAATTACATCGGTGTCTGGGAAATTAATAAATGTGACTTATTTATTCTTAATTTTCAGCCATAATAAAAAAAAC AATCTTGGACCCATAAAGTAACATATGTGGTAACTCGTAAACTGGCAAAAGTGTATGAAACAGAACACCCAAGTTAAAAC AACTGTCGCTTCCCAGCCACACCAGGATAAAGCAAGTTACATTCATTCATGTATTTAATTCCTAAATAAAGCAATTCTTA TCATTTAAAATTTAACTGCATATCCCTACCTTTCACAATGGTCTTCCCATCAACTTCAATATCTTTGTTAAGTTTACGGA AAATGATTGGAACTGGTGGATATTGGCGCAAACTTTCTTTGATGCATAATGTAAGGTGGGGAAGGTTGGACAGATCATTC CTGGCCAATAGAAGAACAACAGTTTTATTTATGGAAGAACACAAGGACTAAACTATATGATATAGTAGGAAGGGGGAAGT TGGGACACCTTTAGTACATAATATTCAAATATCCTGACCGTGTTTTAAACAATTAACGTTGGTCTGTGGGAGTCGTGAGG ATACGGTTTTATAATTCTTTGAATGTGTTCGGTTGCTATAAATGGGGCGAGAAATAAAACAAGAGTATCCATCTTCCCCA TTCTACTGTTTCGTGAAGATTGTAAGAATTTCAAAAAAGATTAGTGGCTATTTTAGATTTATGTGTGATCAGATCAAATT AATGGGACTAGGTTAGAATAAATTTCAAATAAACTAATGATGGGAAAATAAAGAAATGGAGGGGGGAAAAGGTAACAGTT GCAAAAATGGGAAACAGTAGAATTTGA >_4 SNSTVSHFCNCYLFPPPFLYFPIISLFEIYSNLVPLI*SDHT*I*NSH*SFLKFLQSSRN SRMGKMDTLVLFLAPFIATEHIQRIIKPYPHDSHRPTLIV*NTVRIFEYYVLKVSQLPPS YYII*FSPCVLP*IKLLFFYWPGMICPTFPTLHYASKKVCANIHQFQSFSVNLTKILKLM GRPL*KVGICS*ILNDKNCFI*ELNT*MNVTCFILVWLGSDSCFNLGVLFHTLLPVYELP HMLLYGSKIVFFIMAEN*E*ISHIY*FPRHRCNSTYLCITSSRGVLEGSSYI*SKSVHAG KHEKHE*LCLCTFLCWPSKFQQHTDRARL >_5 KFYCFPFLQLLPFPPSISLFSHH*FI*NLF*PSPINLI*SHINLK*PLIFFEILTIFTKQ *NGEDGYSCFISRPIYSNRTHSKNYKTVSSRLPQTNVNCLKHGQDI*ILCTKGVPTSPFL LYHIV*SLCSSINKTVVLLLARNDLSNLPHLTLCIKESLRQYPPVPIIFRKLNKDIEVDG KTIVKGRDMQLNFK**ELLYLGIKYMNECNLLYPGVAGKRQLF*LGCSVSYTFASLRVTT YVTLWVQDCFFYYG*KLRINKSHLLISQTPM*FYIFMHYIITRSFGRILIYLIQVGSRRK T*KA*IVMLMYLSLLAQ*VSTTYRPSSIX >_6 QILLFPIFATVTFSPLHFFIFPSLVYLKFILT*SH*FDLITHKSKIATNLF*NSYNLHET VEWGRWILLFYFSPHL*QPNTFKEL*NRILTTPTDQR*LFKTRSGYLNIMY*RCPNFPLP TISYSLVLVFFHK*NCCSSIGQE*SVQPSPPYIMHQRKFAPISTSSNHFP*T*QRY*S*W EDHCER*GYAVKF*MIRIALFRN*IHE*M*LALSWCGWEATVVLTWVFCFIHFCQFTSYH ICYFMGPRLFFLLWLKIKNK*VTFINFPDTDVILHIYALHHHEEFWKDPHIFDPSRFTQE NMKSMNSYAYVPFSAGPVSFNNIQTELDX >rcign078n05 ATGTTACAATGAGTAAATGAACACACGGTTTCAAAGGGAAACAATAATCATGTTGTGTTTGTGATGTGAATAATTTGTGA CGTCGTCATTGATGACATTATTACGCTTAATAAACCCATCACCTCCCAGCTAGGCAGGCACGCTAACCAACTGTTCCACG GCATTGCCTTAGCCAAAGACAAACCAGCCCACAATGACAGTAGTGTTGAGCACCCAACACAGTGTCTTGTGGTTATGGTA GCACTCTATCAATCAACCCAATGCTATTGATCAATGCATAATACAACATCGTAATTAATTACAACATCAACAAAAAATAT TGGCTGTATACATTAAGCAGCACACACTGAACAAAACAATGTTAGAAATTTTTGTGAATATATTATTTTGAAGAAACAGA CCGTAAAGGCAGTCTTATTCTTCTAAACTCTGCGTTCAGCTTTTAAATAAAGTCCAGTTGTAGCTCTGTAAATCACATCT ACTGAATGCTGGATCTTTTTAGATAAATCTGGTTTAAGTTGGAATTTCCTTAATACTTGCGCCACAGCAATCTTAATTTC ATTCATAGCGAAACGCTGACCAATGCAGTTCCTTGGGCCAGCAGAGAAAGGTACATAAGCATAACTATTCATGCTTTTCA TGTTTTCCTGCGTGAACCGACTTGGATCAAATATATGAGGATCCTTCCAAAACTCCTCGTGATGATGTAATGCATAAATA TGTAGAATTACATCG >rcign078n05_4 RCNSTYLCITSSRGVLEGSSYI*SKSVHAGKHEKHE*LCLCTFLCWPKELHWSAFRYE*N *DCCGASIKEIPT*TRFI*KDPAFSRCDLQSYNWTLFKS*TQSLEE*DCLYGLFLQNNIF TKISNIVLFSVCCLMYTANIFC*CCN*LRCCIMH*SIALG*LIECYHNHKTLCWVLNTTV IVGWFVFG*GNAVEQLVSVPA*LGGDGFIKRNNVINDDVTNYSHHKHNMIIVSL*NRVFI YSL*H >rcign078n05_5 M*FYIFMHYIITRSFGRILIYLIQVGSRRKT*KA*IVMLMYLSLLAQGTALVSVSL*MKL RLLWRKY*GNSNLNQIYLKRSSIQ*M*FTELQLDFI*KLNAEFRRIRLPLRSVSSK*YIH KNF*HCFVQCVLLNVYSQYFLLML*LITMLYYALINSIGLIDRVLP*PQDTVLGAQHYCH CGLVCLWLRQCRGTVG*RACLAGR*WVY*A**CHQ*RRHKLFTSQTQHDYCFPLKPCVHL LIVTX >rcign078n05_6 DVILHIYALHHHEEFWKDPHIFDPSRFTQENMKSMNSYAYVPFSAGPRNCIGQRFAMNEI KIAVAQVLRKFQLKPDLSKKIQHSVDVIYRATTGLYLKAERRV*KNKTAFTVCFFKIIYS QKFLTLFCSVCAA*CIQPIFFVDVVINYDVVLCIDQ*HWVD**SATITTRHCVGCSTLLS LWAGLSLAKAMPWNSWLACLPSWEVMGLLSVIMSSMTTSQIIHITNTT*LLFPFETVCSF THCNX >SEQUENCE 125, 113, 213, 138 PKG TO WXXP 44% TO 3A4 opp ends of EST add seq 138 to this set even though it does not have a substantial overlap MITPLDILSLETWILILTSFILIRLYIHKRWQVLKDLNIPHDPPTILGVGNMSKFFKDS DAGYKRHLELKQKFGPIYGHYIGLSPHVYVGDPEILKQIMIKEFHIFPDRQKNFQNANGK EFNDNLTAISGKQWKRVR (?) DTLSPTFTSSKLKEMFGIVEDCADSFVQNIGTINSDSNGRFQPAV (0?) VFSKVAIDSICSAAFGVNVDSQ (?) SKPQGQEPEVVKMALELFNY small gap of about 9 aa VMFPWTENIAKVFDYSLLPKDCLRYFARLAKTVKKNKANVEQ this seg LQW221105.y1_1 part of middle RVDILQTMINSEITDNEVKNGAIKG LTEIEVTANSLLMMFGGFETTASAMVFLAYNLAVYKDAQHKCREEIEQVIAKH (0?) GGLTYEAMNDLKYIMQCLNESLRLYPPAPMNSRYCERDITIHGLTIKKGITVQIP VYGMGRDEEFWEDPLVFKPERMLDMNEIDPMIFQPFGAGPRNCIGMRFALLEIKITFAKL LQKFHLDVCEDTPAAPIDVSFKSGMRTKQDLFLKVTARE* LQW32560.x1 WXXP LQW225559.y1 PKG LQW225559.y1 PKG rcibd048p03 LQW257567.x1 LQW257567.x1.phd.1 LQW257567.y1 11:18:31 2001 TEMPLATE: LQW257567 DIRECTION: fwd Length = 882 Score = 78.8 bits (191), Expect = 7e-15 Identities = 36/45 (80%), Positives = 38/45 (84%) Frame = +2 Query: 24 KNPMVFVFVMFPWTENIAKVFDYSLLPKDCLRYFARLAKTVKKNK 68 K + VMFPWTENIAKVFDYSLLPKDCLRYFARLAKTVK+ K Sbjct: 551 KKHFFYYSVMFPWTENIAKVFDYSLLPKDCLRYFARLAKTVKRTK 685 Score = 32.1 bits (71), Expect = 0.82 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +2 Query: 13 MALELFNYEIFKNPMVFVF 31 +ALELFNY +FKNP +F Sbjct: 41 LALELFNYPLFKNPFFLIF 97 >LQW257567.x1 >lcl|LQW257567.x1 CHROMAT_FILE: LQW257567.x1 PHD_FILE: LQW257567.x1.phd.1 CHEM: term DYE: ET TIME: Mon Aug 27 11:18:31 2001 TEMPLATE: LQW257567 DIRECTION: fwd GGGCAGTGCAGCTGNATGCTGCAGTCGACTCTAAGGATCCCTGGCTTTGGAACTTTTTAACTACCCACTCTTTAAGAATC CATTCTTTCTTATATTCCGTAAGTATGTTGAATTTGAGGGTCGGGTGCTGTAAAAACGTAGCAGACAAAAACCAAGTACA ACTAATTGTATAAAAAAACTTGTATTTCGCTTAAATGGCATCGTCAGTCTCTTATTCCAATAGAATGGTTTAACTTGTTT AATTTAGTTTCTTTCAATCATGGTTTATCTTCATATGCTTGGTCAATTGGTAAGGCAAAACACAGACACAGTGGTTTATT ATACACATGTGTGGTGTCCTTTAACACCCCGTGCAACACCTAGAAGTTACCAAGCATGAAACTTGTTTATGTTTTAAATT TCACCAGTCTAAGAAAAAATGGACATAACCCATATAAACATGCCCTATGAATAATAAAAAAAAATCAATTAACAAAAGTA AAACAGCGTTATATAAATTGGCCTTACCCCATCAATAACACCTCTGCTTACTTGGCGTAAAAAATTTGCCAAAAAACATT TTTTTTATTATTCAGTGATGTTTCCATGGACGGAAAACATTGCTAAAGTATTTGATTACAGTCTTTTACCAAAAGATTGT TTGCGTTATTTTGCCCGGCTAGCTAAAACTGTGAAAAGAACAAAGCAAATGTCGAACAGGTTTGTTGCTTTACTATATGT TCAAAGGGTGACAAATACTTTCAATCTTCGCCTACTATGCTGTTAGTAAATTAAATATGGTTGTCCGTGTAACAGACAAG TCTAGCATAAATCCTAGATTTCTTTGTCAGCCGGATACTTAATCTTAAACTATAATTATTGGCTCTTTTAAGCCTCCGCA TA >rcibd048p03 Length = 761 Score = 102 bits (252), Expect = 7e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -3 Query: 5 NSRYCERDITIHGLTIKKGITVQIPVYGMGRDEEFWEDPLVFKPER 50 NSRYCERDITIHGLTIKKGITVQIPVYGMGRDEEFWEDPLVFKPER Sbjct: 654 NSRYCERDITIHGLTIKKGITVQIPVYGMGRDEEFWEDPLVFKPER 517 >rcibd048p03 ATTAGAGTGCAGTGCACTATAGGCTATATTGACAGAAAATCAAATAATCAAACATTACCCTGTGGTACTTCACACAAACA ATACTAAAACTGAACAGCATTCCATGGTGGCATCTAATGCTAAATAATTACTTACGGAAAAAAACTAAAGCATGTAACAT CCTGCGTCTAAAATTATTAGGAACATACATCATTTGTAACTTCTATGAATTGACAAATATGCCTGATCGACGAACAACCA AATTAAGCATTATTTCATTTGCAAACAAGTTTAAAGTTATCATTCCCTTGCTGTAACTTTGAGGAAGAGATCTTGCTTTG TTCTCATTCCACTCTTGAATGAAACGTCAATTGGAGCAGCAGGGGTATCTTCACAAACATCGAGATGAAATTTCTGCAGA AGTTTTGCGAAAGTGATTTTAATTTCAAGAAGTGCAAATCTCATTCCAATACAGTTACGTGGACCAGCACCGAATGGCTG GAATATCATTGGATCAATCTCATTCATGTCCAACATTCTTTCTGGTTTAAACACAAGGGGATCTTCCCAAAACTCTTCAT CTCTTCCCATCCCATACACCGGGATCTGGACGGTGATTCCTTTCTTGATTGTCAAGCCATGGATAGTAATATCACGCTCA CAGTATCGGGAGTTCATAGGAGCAGGTGGATAAAGTCTCAATGATTCATTCAGACATTGCATTATGTATTTCAAATCATT CATTGCCTCGTATGTCAACCCACCATGTTTAGCAATGACTT VIAKHGGLTYEAMNDLKYIMQCLNESLRLYPPAPMNSRYCERDITIHGLTIKKGITVQIP VYGMGRDEEFWEDPLVFKPERMLDMNEIDPMIFQPFGAGPRNCIGMRFALLEIKITFAKL LQKFHLDVCEDTPAAPIDVSFKSGMRTKQDLFLKVTARE* >SEQUENCE 113 130-160 58% TO 3A5 RDTLSPTFTSSKLKEMFGIVEDCADSFVQNI LQW194229.y1 130-160 LQW279069.y1 130-160 LQW194229.y2 >SEQUENCE 213, 125 VIAKHGGLTYEAMNDLKYIMQCLNESLRLYPPAPMNSRYCERDITIHGLTIKKGITVQIP VYGMGRDEEFWEDPLVFKPERMLDMNEIDPMIFQPFGAGPRNCIGMRFALLEIKITFAKL LQKFHLDVCEDTPAAPIDVSFKSGMRTKQDLFLKVTARE* LQW238151.y1 EXXR >rcibd048p03 Length = 761 Score = 58.2 bits (138), Expect = 2e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 1 LTYEAMNDLKYIMQCLNESLRLYPPA 26 LTYEAMNDLKYIMQCLNESLRLYPPA Sbjct: 738 LTYEAMNDLKYIMQCLNESLRLYPPA 661 >rcibd048p03 ATTAGAGTGCAGTGCACTATAGGCTATATTGACAGAAAATCAAATAATCAAACATTACCCTGTGGTACTTCACACAAACA ATACTAAAACTGAACAGCATTCCATGGTGGCATCTAATGCTAAATAATTACTTACGGAAAAAAACTAAAGCATGTAACAT CCTGCGTCTAAAATTATTAGGAACATACATCATTTGTAACTTCTATGAATTGACAAATATGCCTGATCGACGAACAACCA AATTAAGCATTATTTCATTTGCAAACAAGTTTAAAGTTATCATTCCCTTGCTGTAACTTTGAGGAAGAGATCTTGCTTTG TTCTCATTCCACTCTTGAATGAAACGTCAATTGGAGCAGCAGGGGTATCTTCACAAACATCGAGATGAAATTTCTGCAGA AGTTTTGCGAAAGTGATTTTAATTTCAAGAAGTGCAAATCTCATTCCAATACAGTTACGTGGACCAGCACCGAATGGCTG GAATATCATTGGATCAATCTCATTCATGTCCAACATTCTTTCTGGTTTAAACACAAGGGGATCTTCCCAAAACTCTTCAT CTCTTCCCATCCCATACACCGGGATCTGGACGGTGATTCCTTTCTTGATTGTCAAGCCATGGATAGTAATATCACGCTCA CAGTATCGGGAGTTCATAGGAGCAGGTGGATAAAGTCTCAATGATTCATTCAGACATTGCATTATGTATTTCAAATCATT CATTGCCTCGTATGTCAACCCACCATGTTTAGCAATGACTT VIAKHGGLTYEAMNDLKYIMQCLNESLRLYPPAPMNSRYCERDITIHGLTIKKGITVQIP VYGMGRDEEFWEDPLVFKPERMLDMNEIDPMIFQPFGAGPRNCIGMRFALLEIKITFAKL LQKFHLDVCEDTPAAPIDVSFKSGMRTKQDLFLKVTARE* >cibd048p03 CAGCCATGATTACTCCTCTTGATATTTTATCGTTGGAAACTTGGATTTTAATCCTGACTTCATTCATTCTTATCAGACTG TACATCCACAAAAGATGGCAAGTGCTAAAGGACCTTAACATACCACATGATCCACCTACAATACTGGGGGTTGGAAACAT GAGCAAATTCTTTAAAGATTCTGATGCAGGCTATAAGAGACATTTAGAATTGAAACAAAAGTTTGGGCCAATTTATGGTC ATTACATTGGTTTAAGTCCACATGTTTATGTTGGTGACCCAGAAATTTTAAAGCAAATCATGATAAAAGAATTTCATATA TTTCCAGATAGACAGAAAAACTTTCAAAACGCAAATGGTAAAGAGTTCAATGACAATCTAACTGCTATCAGTGGTAAGCA ATGGAAAAGAGTGAGGGACACCCTTTCTCCAACGTTTACTTCTTCAAAGTTGAAAGAAATGTTTGGTATAGTTGAAGATT GTGCCGATAGTTTTGTTCAAAACATTGGAACGATAAACTCAGATAGTAATGGAAGATTCCAGCCTGCAGTTGTATTTTCC AAAGTTGCGATAGATTCAATTTGTTCTGCAGCCTTTGGTGTGAATGTCGACTCACAGTCAAAACCACAAGGACAGGAACC TGAAGTAGTTAAGATGGCTTTGGAACTTTTTAACTACC >cibd048p03_3 AMITPLDILSLETWILILTSFILIRLYIHKRWQVLKDLNIPHDPPTILGVGNMSKFFKDS DAGYKRHLELKQKFGPIYGHYIGLSPHVYVGDPEILKQIMIKEFHIFPDRQKNFQNANGK EFNDNLTAISGKQWKRVRDTLSPTFTSSKLKEMFGIVEDCADSFVQNIGTINSDSNGRFQ PAVVFSKVAIDSICSAAFGVNVDSQSKPQGQEPEVVKMALELFNY >SEQUENCE 126 223-247 68% TO 3A5 accidental match on opp strand of another gene like cathepsisn B 224 IILFQFLTHLFYLNVTLFPKKTIS 129 LQW279264.y1 >ciad039e08_3 HNKAKLQRSLSLLLLIDNTFSVLNMKLLVLLSAFVLSECYVISKEDNFNAIVKTVNKANT TWKASLNFDPTYYVPEDLKLLCGVKEDKHGYSKLETSYHNLEGIKIPNQFDSRKQWPHCP SISYIRDQGSCGSCWAFGAVEAMSDRYCIRSNGKIQVEISAEDLLSCCGFECGDGCNGGI SWKCLEILEQ* >SEQUENCE 130, 146, almost identical to 158 I-HELIX 60% TO 4A11 KGLTEREIRDEVDTFLFEGHDTTASGIAWSLYCLAANEEYQEKCREEIEQVVGSKDALEW 62 QDLSKLPFVTMFIKEVLRL YPPVFAVARRTKQPVKFPRGFGGDQFNVGDEQ (0)LPKSDCSRVVDAPLNIGIPIMTLHRNEQVWEDAK VFDPYRFSTENCAKRSPYAYLPFSAGPRNCIGQNFAMAELKTVLVRTLLKY KLYVDNECPDPKMSPMIVLKSLNGIYIKFRKI LQW152517.x1 I-HELIX LQW251090.y1 I-HELIX GCiWno319_k22.g1 C-term >rcicl077k01 Length = 631 Length = 631 Score = 186 bits (468), Expect = 9e-47 Identities = 90/94 (95%), Positives = 92/94 (97%), Gaps = 1/94 (1%) Frame = -3 Query: 23 GHDTTASGIAWSLYCLAANEEYQEKCREEIEQVVGSKDALEW-DLSKLPFVTMFIKEVLR 81 GHDTTASGIAWSLYCLAANEEYQEKCREEIEQVVGSKDALEW DLSKLPFVTMFIKEVLR Sbjct: 629 GHDTTASGIAWSLYCLAANEEYQEKCREEIEQVVGSKDALEWQDLSKLPFVTMFIKEVLR 450 Query: 82 LYPPVFAVARRTEQPVKFPRGFGGDQFNVDDEQV 115 LYPPVFAVARRT+QPVKFPRGFGGDQFNV DEQ+ Sbjct: 449 LYPPVFAVARRTKQPVKFPRGFGGDQFNVGDEQL 348 >GCiWno162_e12.g1 CHROMAT_FILE: GCiWno162_e12.g1 PHD_FILE: GCiWno162_e12.g1.phd.1 CHEM: term DYE: big TIME: Fri Sep 28 15:12:16 2001 TEMPLATE: GCiWno162_e12 DIRECTION: rev Length = 870 Score = 122 bits (303), Expect = 7e-28 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = -3 Query: 1 KGLTEREIRDEVDTFLFEGHDTTASGIAWSLYCLAANEEYQEKCREEIEQVVGSKDAL 58 KGLTEREIRDEVDTFLFEGHDTTASGIAWSLYCLAANEEYQEKCREEIEQVVGSKDAL Sbjct: 487 KGLTEREIRDEVDTFLFEGHDTTASGIAWSLYCLAANEEYQEKCREEIEQVVGSKDAL 314 >GCiWno162_e12.g1_4 GV*GGGGKGISLCIWKKG*GGFXMDIIGWGKMGDVREIRDEYXGXC*EN*EGLSKVGRIX FYNYXNVFXLXXNXXXKXXKXCXXXXQTF*HTLLQNSHL*LWVVTLTAKAGTYLTFNLKL CVCRMMMGKV*LSAKYGTKWTLFCLKVTTLRLAALLGHYIVLQLMRNIKKNVGKKLSKLW DQKMPWNGEISIDSSLLKFGNKACKICM*ARSIKAAVRYHVYKRSTSTLSTGVCSCEKN* TTG*ISARIWW*SIQCRR*TGNGQCIIGWGEDGSTFSFHSASTWARDDVH >GCiWno162_e12.g1_5 GLGRGGKGDKFVYMEKRVGWFXNGYNRVGENGRC*GDKR*IXWXVLRELRGVK*SWXNXV L*LXKCFXFXXKXXXKIXKXXXXXTPNLLTYTFAE*PSLAVGGNFNCESRNLLNI*LKAL CL*DDDGKGLTEREIRDEVDTFLFEGHDTTASGIAWSLYCLAANEEYQEKCREEIEQVVG SKDALEW*DQY*QFVIEIRK*SM*NLYVGKIYQSCRSLPCL*KKYFDFIHRCLQLREELN NRLNFREDLVVINSMSTMNR*WTMYNRVGGGWEHLFIPFSLNLGQRRRPX >GCiWno162_e12.g1_6 GFREGGERG*VCVYGKKGRVVFXWI**GGGKWEMLGR*EMNXVVGVKRIKRG*VKLXEXG FIIIXMFXVXXXXXXXNXKKXVXXXXKPFNIHFCRIAIFSCGW*L*LRKQELT*HLT*SF VFVG**WERFN*ARNTGRSGHFSV*RSRHYG*RHCLVIILSCS**GISRKM*GRN*ASCG IKRCLGMVRSVLTVRY*NSEIKHVKFVCRQDLSKLPFVTMFIKEVLRLYPPVFAVARRTE QPVKFPRGFGGDQFNVDDEQVMDNV**GGGRMGAPFHSIQPQPGPETTSX >sequence 6 1 accession 46% to 1A1 45% to 2F1 KLDDRKKLPCTCAFIQETLRLHSIGSLNAPHKVSRDTEVKGYKIPAGTM LQW51418.x1 LQW275834.y1 EXXR cits048p05 GCiWno835_m11.b1 >SEQUENCE 6, 132, 225 WXXP 65% TO 4F8 very close to seq 222, 224 only 2 diffs with 225 LCVIVRELLLAGNETTGSQLAWLLLALMHFPKWQDRIHQ EIVDNIGENGVLKLDDRKKLPCTCAFIQETLRLHSIGSLNAPHKVSRDTEVKGYKIPAGTM (0?) VMSNVFAIHTDPKVWTDPETFDPSRHLNETGSFINSSKMSPFSLGPRQCIGKTIAENKMFLYFGN ICQKFRIVSETPTPITLHEGQSGFVFSPKEHKVIAIAYSSK* LQW268539.x1 LQW268539.x1 perf rcign070g03 rcign034p06 look for C-term on minus strand >rcign034p06 TTTTGTATTGCGTATAAGCGGATATGACACAGCGTATGGCGATTGGTACGATAGAAATGTATGCAGAGTATATTCTGTAA GCTGTATATATAGCTGTTGAGTATAGCAGTGGCATTTACTTTGACGAGTAAGCTATTGCAATCACTTTATGTTCTTTCGG GGAAAACACAAATCCACTTTGGCCCTCATGCAGAGTAATTGGAGTTGGTGTTTCGGAAACAATTCGAAACTTTTGGCAGA TGTTTCCAAAGTAAAGAAACATTTTGTTTTCTGCAATTGTCTTTCCAATACATTGCCGTGGTCCAAGTGAAAAAGGAGAC ATCTTGCTGGAATTGATAAAACTTCCTGTTTCATTGAGGTGTCTTGATGGATCGAATGTTTCGGGATCCGTCCATACTTT TGGGTCCGTGTGAATAGCAAAGACATTGCTCATGACCATTGTGCCAGCTGGTATTTTGTACCCCTTCACCTCGGTGGTCA CGTGATACTTTATGAGGTGCATTCAGAGAACCGATAGAGTGAAGCCGCAACGTCTCTTGGATAAATGCGCAAGTGCAAGG AAGCTTTTTACGATCGTCAAGTTTTAAAACTCCGTTCTCACCGATATTGTCGACAATTTCTTGGTGTATGCGATCTTGCC ATTTAGGAAAGTGCATTAGGGCAAGTAGCAGCCAAGCTAATTGAGAACCAGTGGTTTCATTCCCTGCTAGAAGAAGTTCA CGTACTATCACACATAACTGTAGTTCATCAAAAGATGAGTGATGACCTTCTTTCNTTCATTTCGAAGAGAAATGCATCGA C >rcign034p06_4 VDAFLFEMXERRSSLIF**TTVMCDST*TSSSRE*NHWFSISLAATCPNALS*MARSHTP RNCRQYR*ERSFKT*RS*KASLHLRIYPRDVAASLYRFSECTS*SIT*PPR*RGTKYQLA QWS*AMSLLFTRTQKYGRIPKHSIHQDTSMKQEVLSIPARCLLFHLDHGNVLERQLQKTK CFFTLETSAKSFELFPKHQLQLLCMRAKVDLCFPRKNIK*LQ*LTRQSKCHCYTQQLYIQ LTEYTLHTFLSYQSPYAVSYPLIRNTK >rcign034p06_5 RCISLRNEXKKVITHLLMNYSYV**YVNFF*QGMKPLVLN*LGCYLP*CTFLNGKIAYTK KLSTISVRTEF*NLTIVKSFLALAHLSKRRCGFTLSVL*MHLIKYHVTTEVKGYKIPAGT MVMSNVFAIHTDPKVWTDPETFDPSRHLNETGSFINSSKMSPFSLGPRQCIGKTIAENKM FLYFGNICQKFRIVSETPTPITLHEGQSGFVFSPKEHKVIAIAYSSK*MPLLYSTAIYTA YRIYSAYISIVPIAIRCVISAYTQYKX >rcign034p06_6 SMHFSSK*XKEGHHSSFDELQLCVIVRELLLAGNETTGSQLAWLLLALMHFPKWQDRIHQ EIVDNIGENGVLKLDDRKKLPCTCAFIQETLRLHSIGSLNAPHKVSRDHRGEGVQNTSWH NGHEQCLCYSHGPKSMDGSRNIRSIKTPQ*NRKFYQFQQDVSFFTWTTAMYWKDNCRKQN VSLLWKHLPKVSNCFRNTNSNYSA*GPKWICVFPERT*SDCNSLLVKVNATAILNSYIYS LQNILCIHFYRTNRHTLCHIRLYAIQX >rcign070g03 Length = 742 Score = 75.3 bits (182), Expect = 1e-13 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +2 Query: 1 ILQLLSYYQQVMSNVFAIHTDPKVWTDPETFDPSR 35 ILQL SYYQQVMSNVFAIHTDPKVWTDPETFDPSR Sbjct: 497 ILQLSSYYQQVMSNVFAIHTDPKVWTDPETFDPSR 601 >rcign070g03 ACTCTTGTGTATTCGACACTGCTGTGTATACAGTATAAAAGCACCGTAGGCATATTAAAACCAGATTAACAAGCCAATGA AACACACAAAAATTTCGCTGACAACTTAATCCTGCCGCATATTTAGAATTGGTCGCGGCAATATACAACAATATAAAAGA AAGTTTTAACAGGTGAGAACGGAGTTTTAAAACTTGACGATCGTAAAAAGCTTCCTTGCACTTGCGCATTTATCCAAGAG ACGTTGCGGCTTCACTCTATCGGTTCTCTGAATGCACCTCATAAAGTATCACGTGACACCGAGGTGAAGGGGTACAAAAT ACCAGCTGGCACAATGGTAACCTTCATACGTTGTTGTTCGCTCTTACTAACATAGCTTTAGCTTGTGTCTCCAGTGTTAA CCAGTGAAAGCGGCATGCATTGGTTTAAAATTGATTGCGTATTTGCCGTGCTGAACTCTATAAAATTATTTAAAGACCGT AAAACTACCCCTTAAAATTTTACAGTTGTCGTCATATTATCAACAGGTCATGAGCAATGTCTTTGCTATTCACACGGACC CAAAAGTATGGACGGATCCCGAAACATTCGATCCATCAAGACACCTCAATGAAACAGGAAGTTTTATCAATTCCAGCAAG ATGTCTCCTTTTTCACTTGGACCACGGCAATGTATTGGAAAGACAATTGCAGAAAACAAAATGTTTCTTTACTTTGGAAA CATCTGCCAAAAGTTTCGAATT >rcign070g03_1 TLVYSTLLCIQYKSTVGILKPD*QANETHKNFADNLILPHI*NWSRQYTTI*KKVLTGEN GVLKLDDRKKLPCTCAFIQETLRLHSIGSLNAPHKVSRDTEVKGYKIPAGTMVTFIRCCS LLLT*L*LVSPVLTSESGMHWFKIDCVFAVLNSIKLFKDRKTTP*NFTVVVILSTGHEQC LCYSHGPKSMDGSRNIRSIKTPQ*NRKFYQFQQDVSFFTWTTAMYWKDNCRKQNVSLLWK HLPKVSNX >rcign070g03_2 LLCIRHCCVYSIKAP*AY*NQINKPMKHTKISLTT*SCRIFRIGRGNIQQYKRKF*QVRT EF*NLTIVKSFLALAHLSKRRCGFTLSVL*MHLIKYHVTPR*RGTKYQLAQW*PSYVVVR SY*HSFSLCLQC*PVKAACIGLKLIAYLPC*TL*NYLKTVKLPLKILQLSSYYQQVMSNV FAIHTDPKVWTDPETFDPSRHLNETGSFINSSKMSPFSLGPRQCIGKTIAENKMFLYFGN ICQKFRI >rcign070g03_3 SCVFDTAVYTV*KHRRHIKTRLTSQ*NTQKFR*QLNPAAYLELVAAIYNNIKESFNR*ER SFKT*RS*KASLHLRIYPRDVAASLYRFSECTS*SIT*HRGEGVQNTSWHNGNLHTLLFA LTNIALACVSSVNQ*KRHALV*N*LRICRAELYKII*RP*NYPLKFYSCRHIINRS*AMS LLFTRTQKYGRIPKHSIHQDTSMKQEVLSIPARCLLFHLDHGNVLERQLQKTKCFFTLET SAKSFE >Ciona savignyi ortholog of seqs 134 and 141 50% to 4v2 human 48% to 4V5 fugu 71% to seq 115 79% to seq 134 76% to seq 141 probable ortholog to 134 and 141 but not 115 another seq matches 115 better see above MAVALFCIVVLLAVIAVLNRREIARLVKNRILLSSIPTMRERAYPIIGHSYLLGGDPAKFFEFI STGAKAMVTELKEQIAVIWLGPVPVIVVCHPAAAEVILRSSKHMEKSYLYEFLKPWLGTG LLTSGGEKWKQRRRLITPSFHFNILQDFLEVMNEQSATMIRTLEGKRTAGSAINVGKAIT MCALDIICETAMGQTVNAQENDDSDYVKSLYR (2) ISELIQLRQKTPTLWWDAAFSRMKVGKEQESLLRTLHGFTRDVIIERAKTKDSKKCRGDAF (0) NPKRLAFLDVLLHAETEDGKTLSLNDIQEEVDT FMFEGHDTTAAAMTWAIYALGRHPEIQQKVHEELDSVFEDDR (2) FGAITNAQLQKLSYLERVIKESLR MFPSVPMFARVLSEDCKLGGYSVPKGTQAIIFGYTIHHHPGIWEDEERFEPDRFLAENCV GRHPYAYIPFSAGPRNCIGQKFAMMEEKVVLCHLLRRYSVISHDKEEDLLINADLILRSSTPLNITLKPR* This Savignyi seq is made up of G126P67669F.T0/G126P67669FD8.T0.seq from file 5 beginning of exon 1 G126P602587F.T0/G126P602587FA4.T0.seq from file 15 end of ETAM exon 1 G126P608331R.T0/G126P608331RE4.T0.seq from file 21 walk 1 in intron 1 G126P613496R.T0/G126P613496RC5.T0.seq from file 31 walk 2 in intron 1 meets exon 2 G126P600175F.T0/G126P600175FH10.T0.seq from file 11 walk 1 in intron 2 G126P607061F.T0/G126P607061FC4.T0.seq from file 21 walk 2 in intron 2 G126P607509F.T0/G126P607509FE4.T0.seq from file 27 walk 3 in intron 2 meets exon 3 G126P618715R.T0/G126P618715RB11.T0.seq from file 40 walk 1 in intron 3 meets exon 4 G126P66797F.T1/G126P66797FH2.T1.seq from file 5 finishes exon 4 >Cs4V5b MAVTLLIILGAFVVPF ALYWRKILKEIS NRHRINKLPSVNSPAYPLVGHSYMFPRNPDEMYDLITSWLKWVMREAK QKLAVVWLGPVPLVAIVHPDAAEVVLRSSKHMEKSFVYRFLHPWLGTGLLTSGGEKWKQR RRLITPSFHFNILLDFLEVMNEQSTKM LRNLDAAVQSGSKVNVGRAITMCALDIICETAMGRTVNAQSDQESEYVKALYR (2) ISDIIQQRQKSPALWWDLAFSKMAMGREHDATIDVLHRFTMNVISDRAQSKTEIKVGWIF (0) DTRRMAFLDVLLRAESEDGRSLSLSDIQEEVDTFMFEGHDTTAAAMTWTIYLIGRHPAIQARIHEELDD 553 552 VFGGDMGTITNSHLQKLSLLERTIKESLRMFPSVPFIGRVTTEECSVGSHSIPAGTQVA 376 375 IFIDSLHHNPSVWPDVDRFDPDRFLPENCVGRHPYSFIPFSAGPRNCIGQKFALMEEKVL 196 195 LTQILRKYSIHSHDEEEDLRKQADLILRSSTPLNISLTPRA* 70 >seq 115 ortholog to Cs4v5b N-term 69% MALTLFILIGALAVTIAVYWKKIKEQFR 3 KRQLINKLPTIMETAYPLVGHSYLFPKSAEELFVFITGRLNWVMTEAVEKIAVLWLGPIPL 185 186 IGVVHPEAAEVILRSSKHIEKSFVYTFVHPWLGTGLLTSGGEKWKQRRRLITPSFHFNIL 365 366 QEFLEVMNEQSKKMVDKLDASIASGSKIYVGKAITMCALDIICETAMGQTVNAQDHQDSE 545 546 YVKALYRISDLVQFRQRTPALWWDAVFSRSKLGIEHDTILCTLHGFTRNVITERAQGKGKKEIE NPRRLAFLDVLLNAETEDGKSLSLNDIQEEVDTFMFEGHDTTAAAMTWTVYLIGRYPDIQEKLHEEI DSVFHDDKEGVISNSQLQKLSYLERVIKESLRL YPSVPFIGRVTTEECVIADHVIPVGTQVALFIES MHRNPAVWPDAEKFDPDRFTAENCVGRHPYAYIPFSAGPRNCVGQKFAMMEEKVILAQIL RRFSLVSHDKEEDLKKQADLILRSSKPLNITLTPRV* cibd004e09 citb063e06 >rcitb063e06 Length = 785 Score = 172 bits (432), Expect = 4e-43 Identities = 85/86 (98%), Positives = 85/86 (98%) Frame = -1 Query: 15 ETEDGKSLSLNDIQEEVDTFMFEGHDTTAAAMTWTVYLIGRYPDIQEKLHEEIDSVFHDD 74 ETEDGKSLSLNDIQEEVDTFMFEGHDTTAAAMTWTVYLIGRYPDIQEKLHEEIDSVF DD Sbjct: 785 ETEDGKSLSLNDIQEEVDTFMFEGHDTTAAAMTWTVYLIGRYPDIQEKLHEEIDSVFQDD 606 Query: 75 KEGVISNSQLQKLSYLERVIKESLRL 100 KEGVISNSQLQKLSYLERVIKESLRL Sbjct: 605 KEGVISNSQLQKLSYLERVIKESLRL 528 >rcitb063e06 TGTACATATTAGAAACTATACAGTGATTAGTTTAGTGAAGTGTTAAAATTGAATTAAAACTAGGACATTGTAACCGCATA AATGACAAAGCACATAAATTACATAGTGATTTATAATTGAAGAAAAATAATGATTTAAACCCGTGGTGTTAAAGTGATGT TCAGAGGTTTTGAAGATCGAAGGATGAGATCCGCTTGCTTCTTGAGGTCCTCTTCCTTGTCATGAGAAACCAAGGAGAAC CTCCGTAAGATCTGGGCCAAGATAACTTTTTCCTCCATCATTGCAAACTTTTGCCCAACACAGTTGCGAGGGCCTGCAGA GAACGGAATGTAAGCATAAGGGTGACGACCGACACAATTTTCAGCTGTAAAGCGATCCGGATCAAATTTTTCTGCATCTG GCCACACAGCAGGATTGCGGTGCATGCTTTCAATGAACAAAGCCACTTGTGTGCCAACAGGGATGACATGGTCGGCAATA ACGCATTCCTCTGTGGTCACTCTGCCAATAAATGGAACAGATGGATATAACCTCAATGACTCCTTAATGACTCTTTCCAA GTAGGAAAGCTTCTGAAGCTGTGAATTGCTGATCACTCCTTCCTTATCATCTTGAAACACAGAATCGATTTCTTCATGGA GTTTTTCTTGTATATCTGGATAACGACCGATGAGATAAACAGTCCATGTCATAGCAGCAGCAGTTGTGTCATGACCTTCA AACATAAAAGTATCCACTTCCTCTTGGATATCGTTGAGCGAAAGACTTTTTCCGTCTTCTGTTTC >_4 NRRRKKSFAQRYPRGSGYFYV*RS*HNCCCYDMDCLSHRSLSRYTRKTP*RNRFCVSR** GRSDQQFTASEAFLLGKSH*GVIEVISICSIYWQSDHRGMRYCRPCHPCWHTSGFVH*KH APQSCCVARCRKI*SGSLYS*KLCRSSPLCLHSVLCRPSQLCWAKVCNDGGKSYLGPDLT EVLLGFS*QGRGPQEASGSHPSIFKTSEHHFNTTGLNHYFSSIINHYVIYVLCHLCGYNV LVLIQF*HFTKLITV*FLICT >_5 KQKTEKVFRSTISKRKWILLCLKVMTQLLLL*HGLFISSVVIQIYKKNSMKKSILCFKMI RKE*SAIHSFRSFPTWKESLRSH*GYIHLFHLLAE*PQRNALLPTMSSLLAHKWLCSLKA CTAILLCGQMQKNLIRIALQLKIVSVVTLMLTFRSLQALATVLGKSLQ*WRKKLSWPRSY GGSPWFLMTRKRTSRSKRISSFDLQNL*TSL*HHGFKSLFFFNYKSLCNLCALSFMRLQC PSFNSILTLH*TNHCIVSNMYX >_6 ETEDGKSLSLNDIQEEVDTFMFEGHDTTAAAMTWTVYLIGRYPDIQEKLHEEIDSVFQDD KEGVISNSQLQKLSYLERVIKESLRLYPSVPFIGRVTTEECVIADHVIPVGTQVALFIES MHRNPAVWPDAEKFDPDRFTAENCVGRHPYAYIPFSAGPRNCVGQKFAMMEEKVILAQIL RRFSLVSHDKEEDLKKQADLILRSSKPLNITLTPRV*IIIFLQL*ITM*FMCFVIYAVTM S*F*FNFNTSLN*SLYSF*YVX LQW8589.x1 CHEM: term DYE: ET TIME: Wed Mar 21 16:02:50 2001 TEMPLATE: LQW8589 DIRECTION: fwd Length = 641 Score = 84.3 bits (205), Expect = 1e-15 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 216 RISDLVQFRQRTPALWWDAVFSRSKLGIEHDTILCTLH 253 RISDLVQFRQRTPALWWDAVFSRSKLGIEHDTILCTLH Sbjct: 108 RISDLVQFRQRTPALWWDAVFSRSKLGIEHDTILCTLH 221 GAAAACATTGATTCAGTATGAAAATTGTAACTTGGTTTCCCACTATTGATAAGATGGTAAAAACTAACAGAAGTTCACAG AAAAATATAAATAAACCCATGTTTTGCAGAATATCTGATTTGGTCCAGTTTCGCCAGAGGACACCAGCATTGTGGTGGGA CGCTGTGTTTTCAAGATCAAAGCTCGGCATAGAGCATGACACCATTCTCTGCACACTGCACGGTTTTACAAGAAATGTGA TAACTGAACGAGCTCAGGGGAAAGGAAAGAAAGAAATAGAGGTATTGTGTATAAAAATGGCAGTGAGGCTTGTGTAATTC TTCCATGTATTTAATCACAGAACCCACGAAGATTGGCATTTCTTGATGTTCTTTTAAACGCCGAAACAGAAGACGGAAAA AGTCTTTCGCTCAACGATATCCAAGAGGAAGTGGATACTTTTATGTTTGAAGGTCATGACACAACTGCTGCTGCTATGAC ATGGACTGTTTATCTCATCGGTCGTTATCCAGATATACAAGAAAAACTCCATGAAGAAATCGATTCTGTGTTTCATGATG ATAAGGAAGGAGTGATCAGCAATTCACAGCTTCAGAAGCTTTCCTACTTGGAAAGAGTCATTAAGGAGTCATTGAGGTTA T >_1 ENIDSV*KL*LGFPLLIRW*KLTEVHRKI*INPCFAEYLIWSSFARGHQHCGGTLCFQDQ SSA*SMTPFSAHCTVLQEM**LNELRGKERKK*RYCV*KWQ*GLCNSSMYLITEPTKIGI S*CSFKRRNRRRKKSFAQRYPRGSGYFYV*RS*HNCCCYDMDCLSHRSLSRYTRKTP*RN RFCVS***GRSDQQFTASEAFLLGKSH*GVIEVX >_2 KTLIQYENCNLVSHY**DGKN*QKFTEKYK*THVLQNI*FGPVSPEDTSIVVGRCVFKIK ARHRA*HHSLHTARFYKKCDN*TSSGERKERNRGIVYKNGSEACVILPCI*SQNPRRLAF LDVLLNAETEDGKSLSLNDIQEEVDTFMFEGHDTTAAAMTWTVYLIGRYPDIQEKLHEEI DSVFHDDKEGVISNSQLQKLSYLERVIKESLRLX >_3 KH*FSMKIVTWFPTIDKMVKTNRSSQKNINKPMFCRISDLVQFRQRTPALWWDAVFSRSK LGIEHDTILCTLHGFTRNVITERAQGKGKKEIEVLCIKMAVRLV*FFHVFNHRTHEDWHF LMFF*TPKQKTEKVFRSTISKRKWILLCLKVMTQLLLL*HGLFISSVVIQIYKKNSMKKS ILCFMMIRKE*SAIHSFRSFPTWKESLRSH*GY LQW183918.x1 LQW183918.x1.phd.1 LQW183918.y1 11:50:46 2001 TEMPLATE: LQW183918 DIRECTION: fwd Length = 752 Score = 129 bits (322), Expect = 5e-30 Identities = 66/77 (85%), Positives = 70/77 (90%) Frame = +2 Query: 1 ALTLFILIGALAVTIAVYWKKIKEQFRKRQLINKLPTIMETAYPLVGHSYLFPKSAEELF 60 ALTLFILIGALAVTIAVYWK IKEQFRKRQLINKLP+IMETAYPLVGHSYL KSAEELF Sbjct: 482 ALTLFILIGALAVTIAVYWKTIKEQFRKRQLINKLPSIMETAYPLVGHSYLVTKSAEELF 661 Query: 61 VFITGRLNWVMTEAVEK 77 V T RL+ VMTEAV++ Sbjct: 662 VSFTARLHCVMTEAVKR 712 LQW179082.y1 LQW179082.y1.phd.1 LQW179082.x1 12:51:52 2001 TEMPLATE: LQW179082 DIRECTION: rev Length = 776 Score = 90.1 bits (220), Expect = 4e-18 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -2 Query: 45 LVGHSYLFPKSAEELFVFITGRLNWVMTEAVEKIAVLWLGPIPL 88 L+GHS LFPKSAEELFVFITGRLNWVMTEAVEKIAVLWLGPIPL Sbjct: 775 LIGHSNLFPKSAEELFVFITGRLNWVMTEAVEKIAVLWLGPIPL 644 >cibd004e09 GGAAACGGCAACTAATCAACAAGCTTCCAACCATTATGGAAACTGCTTATCCTCTAGTTGGTCATAGCTACCTGTTTCCT AAAAGTGCAGAAGAGCTGTTTGTGTTTATTACTGGAAGGCTAAATTGGGTTATGACAGAGGCTGTAGAAAAGATAGCAGT TTTGTGGCTTGGGCCAATTCCTCTTATAGGTGTGGTACACCCAGAAGCTGCAGAGGTGATTTTACGAAGTTCAAAACACA TAGAAAAGTCATTTGTGTACACCTTTGTTCACCCATGGCTTGGGACTGGTTTGCTTACTTCTGGCGGGGAAAAATGGAAA CAAAGAAGAAGACTGATCACTCCCAGCTTCCATTTTAACATCCTACAGGAGTTCTTAGAAGTTATGAATGAACAGTCCAA GAAAATGGTAGACAAGCTGGATGCCAGTATAGCATCTGGGTCTAAAATTTATGTTGGAAAAGCAATAACAATGTGTGCGC TTGACATCATTTGTGAAACAGCAATGGGACAAACAGTCAACGCACAGGACCATCAAGATTCTGAATATGTTAAAGCATTA TACAGAATATCTGATTTGGTCCAGTTTCGCCAGAGGACACCAGCATTGTGGTGGGACGCTGTGTTTTCAAGATCAAAGCT CGGCATAGAGCATGACACCATTCTCTGCACACTGCAC >intestinalis seq 134, 141 ortholog to Cs4v5a 75% only 63% to Cs4v5b MAVALLLIIVVTCVIALHYRKGIARHFKNRLMLSRLPSLPDPAYPLIGHAYLLRGDPS RFFEFVTETTNAMVTEVNEKIGILWLGPVPLMVVCHPEAAEVVLRSSKHMEKSYLYKFLHP WLGTGLLTSGGEKWKQRRRLITPSFHFNILQDFLEVMNEESGKLINN LKKKLKSGVKVDVGKAVTMCALDIICETAMGQTVNAQENDDSSYVRALYR (2?) ISELIQLRQKTPTLWWDPAFSRMKLGKEHENLLSILHGFTRDVITKRAKTRDQKIVE (0) NPRRMAFLDVLLHAETEDGKTLSLNDIQEEVDTFMFEGHDTTAAAMTWAIYVIGRHPDIQ 217 KKIHEELDAVFGEDRGGTITNNQLQKLSYLERVIKECLRLYPSVPFYARVLSEDCKVGDY 397 MVPKGTQTVIFAHTIHHHPYVWEDPEKFDPDRFLAENCVKRHPYAYIPFSAGPRNCIGQK 577 FALMEEKVILSKLLHNYFVVSHDKKEDLVINGDLILRSSTPLNITLEARK* 730 GCiWno569_o18.b1 rcitb090l20 LQW243861.y1 C-HELIX TO ETAM LQW232477.x1 C-HELIX LQW179082.y1 c-helix LQW150167.y1 >rcitb090l20 Length = 819 Score = 98.3 bits (241), Expect = 5e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = +2 Query: 1 FALMEEKVILSKLLHNYFVVSHDKKEDLVINGDLILRSSTPLNITLEAR 49 FALMEEKVILSKLLHNYFVVSHDKKEDLVINGDLILRSSTPLNITLEAR Sbjct: 578 FALMEEKVILSKLLHNYFVVSHDKKEDLVINGDLILRSSTPLNITLEAR 724 >rcitb090l20 AATTGTTTTTTTTGTTTTAAGATTCAAATACTTGTAGAACCCGAGACGAATGGCGTTTCTTGACGTACTCCTGCACGCTG AAACAGAAGACGGCAAAACGCTCTCACTTAACGACATTCAAGAGGAAGTGGATACGTTCATGTTTGAAGGACACGATACA ACAGCGGCTGCCATGACGTGGGCGATCTACGTCATAGGCCGACATCCTGATATACAAAAAAAGATCCACGAGGAACTAGA TGCTGTTTTCGGAGAGGATAGAGGAGGCACAATCACTAACAACCAACTTCAGAAGCTTTCTTACTTGGAAAGAGTGATTA AAGAATGTCTACGGTTATACCCGTCTGTGCCGTTCTATGCGCGAGTCTTGAGTGAGGATTGCAAGGTCGGAGATTACATG GTACCGAAAGGAACACAGACTGTGATCTTTGCCCACACAATCCACCACCATCCTTATGTGTGGGAAGATCCAGAAAAATT TGATCCCGATCGTTTCCTAGCAGAAAATTGTGTTAAGCGCCATCCCTACGCTTACATTCCGTTTTCAGCCGGCCCACGTA ACTGCATCGGTCAGAAATTTGCTCTCATGGAAGAAAAAGTTATCTTGTCCAAGCTTTTGCATAATTACTTCGTTGTTTCA CATGACAAGAAAGAAGATCTTGTGATAAATGGAGACCTTATTCTTCGCTCGTCTACCCCACTTAACATTACATTAGAAGC CCGCAAATAAAAAAATAATGATATCACTTTTTCACGTACTTCTTCAGTTTAAAATAAAGATGTAAATTTTATAATTTGAT TGCTTTAGTGCAATTAAAG >citb064m01 Length = 655 Score = 78.4 bits (190), Expect = 4e-15 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 18 EKWKQRRRLITPSFHFNILQDFLEVMNEESGKLINN 53 EKWKQRRRLITPSFHFNILQDFLEVMNEESGKLINN Sbjct: 399 EKWKQRRRLITPSFHFNILQDFLEVMNEESGKLINN 506 >citb064m01 AAAGCGAAATGGCAGTTGCGTTGCTGTTAATAATTGTTGTGACTTGTGTTATTGCTTTGCACTACCGGAAGGGTATTGCT CGCCATTTTAAAAACAGACTGATGTTGAGCCGACTTCCCTCGTTGCCAGATCCGGCATACCCTTTAATTGGTCATGCCTA CCTGCTTCGAGGAGATCCATCTCGGTTTTTCGAGTTTGTCACCGAAACCACAAACGCAATGGTAACTGAAGTAAACGAAA AAATCGGTATCTTGTGGCTTGGTCCAGTACCTCTTATGGTAGTTTGCCACCCCGAAGCAGCAGAGGTGGTTTTAAGGAGT TCAAAACACATGGAGAAGTCTTACCTGTACAAATTCCTTCACCCATGGCTTGGTACTGGCTTACTGACGTCTGGAGGGGA AAAGTGGAAACAACGAAGGAGACTGATCACCCCGTCTTTTCACTTTAACATACTTCAGGACTTCCTCGAAGTAATGAACG AAGAGTCAGGCAAGTTAATTAATAATTTGGAAAAGAAATTAAAATCGGGCGTGAAAGTTGACGTCGGAAAAGCGGTGACA ATGTGCGCTTTGGATATTATTTGTGAAACTGCAATGGGACAAACAGTGAACGCACAGGAAAATGACGACTCAAGTTACGT AAGAGCATTGTATAG >_1 KAKWQLRCC**LL*LVLLLCTTGRVLLAILKTD*C*ADFPRCQIRHTL*LVMPTCFEEIH LGFSSLSPKPQTQW*LK*TKKSVSCGLVQYLLW*FATPKQQRWF*GVQNTWRSLTCTNSF THGLVLAY*RLEGKSGNNEGD*SPRLFTLTYFRTSSK**TKSQAS*LIIWKRN*NRA*KL TSEKR*QCALWILFVKLQWDKQ*THRKMTTQVT*EHCIX >_2 KRNGSCVAVNNCCDLCYCFALPEGYCSPF*KQTDVEPTSLVARSGIPFNWSCLPASRRSI SVFRVCHRNHKRNGN*SKRKNRYLVAWSSTSYGSLPPRSSRGGFKEFKTHGEVLPVQIPS PMAWYWLTDVWRGKVETTKETDHPVFSL*HTSGLPRSNERRVRQVN**FGKEIKIGRES* RRKSGDNVRFGYYL*NCNGTNSERTGK*RLKLRKSIV* >_3 SEMAVALLLIIVVTCVIALHYRKGIARHFKNRLMLSRLPSLPDPAYPLIGHAYLLRGDPS RFFEFVTETTNAMVTEVNEKIGILWLGPVPLMVVCHPEAAEVVLRSSKHMEKSYLYKFLH PWLGTGLLTSGGEKWKQRRRLITPSFHFNILQDFLEVMNEESGKLINNLEKKLKSGVKVD VGKAVTMCALDIICETAMGQTVNAQENDDSSYVRALY LQW243861.y1 LQW243861.y1.phd.1 LQW243861.x1 12:06:08 2001 TEMPLATE: LQW243861 DIRECTION: rev Length = 973 Score = 31.7 bits (70), Expect(2) = 0.001 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 1 ATFRISELIQLRQKT 15 ATFRISELIQLRQKT Sbjct: 731 ATFRISELIQLRQKT 775 AAAAGATAGAATCGAGCTCGGTACCAACTCCGCCTCACATGGCTTGGTACTGGCTTACTGACGTCTGGAGGGGAAAAGTG GAAACAACGAAGGAGACTGATCACCCCGTCTTTTCACTTTAACATACTTCAGGACTTCCTCGAAGTAATGAACGAAGAGT CAGGCAAGTTAATTAATAATTTGAAAAAGAAATTAAAATCGGGCGTGAAAGTTGACGTCGGAAAAGCGGTGACAATGTGC GCTTTGGATATTATTTGTGAAACTGCAATGGGACAAACAGTGAACGCACAGGAAAATGACGACTCAAGTTACGTAAGAGC ATTGTATAGGTATGTAATGGGAACTTTTATAGCAAACGTTATGTGCAAATTATATAGTGACCTGTATAGCTTTATTTAAG GGCAAACAGTAAACCTCGCCCGTACGTTACGTCTTTGTGACTTCGGTGAATGCTGCTGCCTATAAAACAATGCTGCCTTC GCAGAGCATTTAATAATTAAACGGTAATTAAACAAACTTTTATTGCGCGTCACATGATCAATGGGCAAACAGGGTATCGT CACGCACTCAAGGTTAAGAAAATAGTGACTTTTCCCACAGAAACTCCTATAGTATTTGCTACAACTCACCCATATTTTGT GTGTTTAACCATGTACATTATACAGACAACTATATTTACACTACATGCCACAAATCTACGGGTTGTTTTTATACAAATAA ACTGACATAGGCTACTTTTAGAATCTCGGAACTTATACAACTTCGTCAAAAGACCCGAAACTGTGGTGGGATCCGCGTTT CTCGCATGAACTCGGAAAGAGCCGAAACTGGTCAGAATTTACCGGTTTCCCTGAGTATAGAAAGGGGAACCGAACGGAAT GTGTGTGCGACGAAAGGTCTGGGTAATAATTGTACCGAAAGGTTGGAGCCGCGACAACGACCCTAACAAGAGCCTTAGCA AGGGGGGGTGGCC >_1 KR*NRARYQLRLT WLGTGLLTSGGEKWKQRRRLITPSFHFNILQDFLEVMNEESGKLINN LKKKLKSGVKVDVGKAVTMCALDIICETAMGQTVNAQENDDSSY VRALYRYVMGTFIANV MCKLYSDLYSFI*GQTVNLARTLRLCDFGECCCL*NNAAFAEHLIIKR*LNKLLLRVT*S MGKQGIVTHSRLRK**LFPQKLL*YLLQLTHILCV*PCTLYRQLYLHYMPQIYGLFLYK* TDIGYF*NLGTYTTSSKDPKLWWDPRFSHELGKSRNWSEFTGFPEYRKGNRTECVCDERS G**LYRKVGAATTTLTRALARGGGX >_2 KDRIELGTNSASHGLVLAY*RLEGKSGNNEGD*SPRLFTLTYFRTSSK**TKSQAS*LII *KRN*NRA*KLTSEKR*QCALWILFVKLQWDKQ*THRKMTTQVT*EHCIGM*WELL*QTL CANYIVTCIALFKGKQ*TSPVRYVFVTSVNAAAYKTMLPSQSI**LNGN*TNFYCASHDQ WANRVSSRTQG*ENSDFSHRNSYSICYNSPIFCVFNHVHYTDNYIYTTCHKSTGCFYTNK LT*ATFRISELIQLRQKTRNCGGIRVSRMNSERAETGQNLPVSLSIERGTERNVCATKGL GNNCTERLEPRQRP*QEP*QGGVA >_3 KIESSSVPTPPHMAWYWLTDVWRGKVETTKETDHPVFSL*HTSGLPRSNERRVRQVN**F EKEIKIGRES*RRKSGDNVRFGYYL*NCNGTNSERTGK*RLKLRKSIV*VCNGNFYSKRY VQII**PV*LYLRANSKPRPYVTSL*LR*MLLPIKQCCLRRAFNN*TVIKQTFIARHMIN GQTGYRHALKVKKIVTFPTETPIVFATTHPYFVCLTMYIIQTTIFTLHATNLRVVFIQIN *HRLLLESRNLYNFVKRPETVVGSAFLA*TRKEPKLVRIYRFP*V*KGEPNGMCVRRKVW VIIVPKGWSRDNDPNKSLSKGGW >GCiWno569_o18.b1 AGTTCCTCGTGGATCTTTTTTTGTATATCAGGATGTCGGCCTATGACGTAGATCGCCCACGTCATGGCAGCCGCTGTTGT ATCGTGTCCTTCAAACATGAACGTATCCACTTCCTCTTGAATGTCGTTAAGTGAGAGCGTTTTGCCGTCTTCTGTTTCAG CGTGCAGGAGTACGTCAAGAAACGCCATTCGTCTCGGGTTCTACAAGTATTTGAATCTTAAAACAAAATAAAACAATTTA TCGTGTCAGGCAAACCTCCACAATTTTCTGGTCTCGGGTTTTCGCGCGTTTCGTGATGACGTCACGTGTAAAACCGTGTA AAATACTGAGCAAGTTTTCGTGCTCTTTTCCGAGTTTCATGCGAGAAAACGCTGGATCCCACCACAGTGTTGGGGTCTTT TGACGAAGCTGTATAAGTTCCGAGATTCTAAAAGTAGCCTATGTCAGTTTATTTGTATAAAAACAACCCGTAGATTTGTA GCATGTAGTGTAAATATAGTTTGTCTGTATAATGTACATGGTTAAGCACACAGAATATGGGTAAGTTGTAGCAAATACTA CAGGAGTTTCTGTGGGAAAAGTCACTATTTTCTAAACCTTGAGTGCGTGACGATACCCTGTTTGCCCATTGATCATGTGA CGCGCAATAAAAGTTTGTTTAATTACCGGTTAATTATTAAATGCTCTGCGAAGGCAGCATTGTTTTATAGGCAGCAGCAT TCACCGAAGTCACAAAGACGTAACGTACGGGCGAGGTTTACTGTTTGCCCTTAAATAAGCTTACAGGTCACTATATAATT TGCACATAACGTTTGCTATTAAAGNTCCCATTACATACCTATACAATGCTCTTNACGTACTTGAGTCGTCATTNTCCTGT GCNGTCA >_4 TAQXNDDSSTXRALYRYVMGXLIANVMCKLYSDL*AYLRANSKPRPYVTSL*LR*MLLPI KQCCLRRAFNN*PVIKQTFIARHMINGQTGYRHALKV*KIVTFPTETPVVFATTYPYSVC LTMYIIQTNYIYTTCYKSTGCFYTNKLT*ATFRISELIQLRQKTPTLWWDPAFSRMKLGK EHENLLSILHGFTRDVITKRAKTRDQKIVEVCLTR*IVLFCFKIQILVEPETNGVS*RTP AR*NRRRQNALT*RHSRGSGYVHV*RTRYNSGCHDVGDLRHRPTS*YTKKDPRGT >_5 DXTGX*RLKYVKSIV*VCNGXFNSKRYVQII**PVSLFKGKQ*TSPVRYVFVTSVNAAAY KTMLPSQSI**LTGN*TNFYCASHDQWANRVSSRTQGLENSDFSHRNSCSICYNLPIFCV LNHVHYTDKLYLHYMLQIYGLFLYK*TDIGYF*NLGTYTASSKDPNTVVGSSVFSHETRK RARKLAQYFTRFYT*RHHETRENPRPENCGGLPDTINCFILF*DSNTCRTRDEWRFLTYS CTLKQKTAKRSHLTTFKRKWIRSCLKDTIQQRLP*RGRSTS*ADILIYKKRSTRNX >_6 *XHRXMTTQVRXEHCIGM*WXL**QTLCANYIVTCKLI*GQTVNLARTLRLCDFGECCCL *NNAAFAEHLIINR*LNKLLLRVT*SMGKQGIVTHSRFRK**LFPQKLL*YLLQLTHILC A*PCTLYRQTIFTLHATNLRVVFIQIN*HRLLLESRNLYSFVKRPQHCGGIQRFLA*NSE KSTKTCSVFYTVLHVTSSRNARKPETRKLWRFA*HDKLFYFVLRFKYL*NPRRMAFLDVL LHAETEDGKTLSLNDIQEEVDTFMFEGHDTTAAAMTWAIYVIGRHPDIQKKIHEEL >SEQUENCE 136 I-HELIX 58% TO 4X1 MKAIARFPFPALVRFVSTCPAHQRAAWSKKASQEDLSYAKPFEAVPEPNSY (?) PVIGTALEYTPLNNFNPSYVGEHWIERHKELGPIYKENILPG (?) VTETMVFTSSPQNTEIMFRNEERCPFRDPLGPVAKIRDERNEYHGLTNSNGEDWWR (?) VRQIVNQHFLQNTAVWKYAEAHRNVSKDFLKFIDRNMDEKNE (?) VPNFGKALNRWSFEGAGVFTLKRRLGAL Missing two exons here ICSEKVILMTEFLVAGIDTTSNSAAFLLYALASNQEAQERLREEVREVNRMDTIDGK (?) LLHNMKYLQACLRETQRMFPFVNSSPRRFRKDLVLSGYLIPAG (?) HPHSDTSNTVNSRNPEYYDDPNTFIPERWLETKS (?) FKPYIRFIMSGPFGLGMRMCPGRKFSIQELQLLLITLLSNY RVEYHHDPIKVAFRLVSFPSQAPQFKFTKLKN* LQW255639.x1 I-helix LQW255639.y1 N-term cibd010k11 N-term GCiWno222_h01.b1 GCiWno169_b19.g1 GCiWno939_o24.b1 GCiWno939_o24.g1 GCiWno843_g06.g1 GCiWno777_i20.b1 GCiWno822_c05.g1 GCiWno115_g04.b1 part of ci204 for comp PQVFSTLPDDNEVLLRSEEKISHREPVEFVVSARKLLGWSIGLPFDVGEDWYK LRKVVNQHFLKNSIVWSHSKQQHEVAEEFVDYIGQNLDENNE VPHFQDLLQKWALESTAVFCFGVRLGVF DKSVDDDLNIIIDTNRKKFELIMKGIFSAPLWKFYNTKLMK (0) KFNKVQIEQLHAIRRQQIKAFTEFPVDQKLIESLQFY ICSSEIEVLIIDLLSGGVDTTSNSAVFVLYLLSMNPDKQEVLRKEILEALKTGKTDGK LQW267132.x1 LQW267132.x1.phd.1 LQW267132.y1 12:35:52 2001 TEMPLATE: LQW267132 DIRECTION: fwd Length = 876 Score = 58.6 bits (139), Expect = 8e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 1 VPNFGKALNRWSFEGAGVFTLKRRLG 26 VPNFGKALNRWSFEGAGVFTLKRRLG Sbjct: 435 VPNFGKALNRWSFEGAGVFTLKRRLG 358 >LQW267132.x1_4 RSHGQPSERGGNRCHGWPRFLSYCRNRTKE*VIW*IRYMLDFVRNSCF*PKYVTYTHKVI YVVTVKQARSV*NKTPVL*RLWLPRQVRILNYFLVQFTNSRLLKIEITNETHMCVYLF*S IEEKHFTNFWTKNSHFYAV*DLKR*F*VPNFGKALNRWSFEGAGVFTLKRRLGKFCLLIN FIFI*FIGSLKIKDKKTTFLIIHFFVWVFVENVWLARHWLARLPLAKRLPIQDSTLPPFV *IMSHTLKNKEYSPQIFNV**LVSWHEVYETEHPCYNDCRFH*CFLQICCTA >LQW267132.x1_5 VPWATFRKGWKPVPWMAKIFKLLPEQDERMSDLVN*IHA*LR*KLVFLTEIRYIHSQSYI CCNC*ASTKCMKQNTRVITTMVAPPSEDIKLFFSSVYKFPAFKNRDNK*DAHVRLFVLID RRKALH*LLDQKLALLCSMRFKTLILGSEFWKSIKPLVL*RSRRFYFEKTAG*VLFVD*F YFYLIYWVT*NKG*KNYFFNNSFFCLGLCGKRVVGTTLVSAFASSQEVTDSRLDAATICL NYEPYIKKQRILTTNF*RLVTRKLARGV*NRTPVL*RLSISLMLSADLLHCX >LQW267132.x1_6 GPMGNLPKGVETGAMDGQDF*VIAGTGRKNE*FGKLDTCLTSLETRVFNRNTLHTLTKLY ML*LLSKHEVYETKHPCYNDYGCPAK*GY*TIF*FSLQIPGF*K*R*QMRRTCAFICFDR *KKSTSLTFGPKTRTFMQYEI*NVNFRFRILEKH*TVGPLKEQAFLL*KDGWVSFVC*LI LFLFDLLGHLK*RIKKLLF**FIFLFGSLWKTCGWHDIG*RVCL*PRGYRFKTRRCHHLS KL*AIH*KTKNTHHKFLTSSNS*AGTRCMKQNTRVITTVDFIDAFCRFAALP LQW199445.x1 LQW199445.x1.phd.1 LQW199445.y1 13:55:24 2001 TEMPLATE: LQW199445 DIRECTION: fwd Length = 870 Score = 48.8 bits (114), Expect = 7e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 1 HSDTSNTVNSRNPEYYDDPN 20 HSDTSNTVNSRNPEYYDDPN Sbjct: 792 HSDTSNTVNSRNPEYYDDPN 733 LQW21632.x1 CHEM: term DYE: ET TIME: Wed Mar 21 15:36:41 2001 TEMPLATE: LQW21632 DIRECTION: fwd Length = 394 Score = 42.2 bits (97), Expect = 7e-04 Identities = 17/18 (94%), Positives = 18/18 (99%) Frame = +1 Query: 3 DTSNTVNSRNPEYYDDPN 20 +TSNTVNSRNPEYYDDPN Sbjct: 229 NTSNTVNSRNPEYYDDPN 282 >LQW21632.x1 >lcl|LQW21632.x1 CHROMAT_FILE: LQW21632.x1 PHD_FILE: LQW21632.x1.phd.1 CHEM: term DYE: ET TIME: Wed Mar 21 15:36:41 2001 TEMPLATE: LQW21632 DIRECTION: fwd TTAGTTATAACATGGGTGTCTCNTATAGTATACCTCATGCTCACTGTCGAGTTATAACCATAAGTGTCTTCTATACACCT CATGCTCACTGTCGAGTTATAACATGGGTGTCTTATACAACAGACACACATGATGTATTTATACACCTCATGCTCACTTT CACTGTAATATACCCCATATGTTACCCTAAAGTAAAATTCACTATAAATTCTAGGCACCCACATTCTGAACACATCAAAC ACAGTAAACAGCAGGAACCCTGAGTATTACGACGACCCAAACACTTTTATTCCTGAACGTCGGTTGGAAACTAAATCAGT GACGGAAAGACAAAGGGAAAGGTAAGAGAATTGAATGTGACTTATTAACTGATTTATGCTGGAACTTATTATTG >LQW267132.x1 >lcl|LQW267132.x1 CHROMAT_FILE: LQW267132.x1 PHD_FILE: LQW267132.x1.phd.1 CHEM: term DYE: ET TIME: Fri Aug 31 12:35:52 2001 TEMPLATE: LQW267132 DIRECTION: fwd GGCAGTGCAGCAAATCTGCAGAAAGCATCAATGAAATCGACAGTCGTTATAACACGGGTGTTCTGTTTCATACACCTCGT GCCAGCTTACGAGTTACTAGACGTTAAAAATTTGTGGTGAGTATTCTTTGTTTTTTAATGTATGGCTCATAATTTAGACA AATGGTGGCAGCGTCGAGTCTTGAATCGGTAACCTCTTGGCTAGAGGCAAACGCGCTAACCAATGTCGTGCCAACCACAC GTTTTCCACAAAGACCCAAACAAAAAAATGAATTATTAAAAAAGTAGTTTTTTTATCCTTTATTTTAAGTGACCCAATAA ATCAAATAAAAATAAAATTAATCAACAAACAAAACTTACCCAGCCGTCTTTTCAAAGTAAAAACGCCTGCTCCTTCAAAG GACCAACGGTTTAATGCTTTTCCAAAATTCGGAACCTAAAATTAACGTTTTAAATCTCATACTGCATAAAAGTGCGAGTT TTTGGTCCAAAAGTTAGTGAAGTGCTTTTCTTCTATCGATCAAAACAAATAAACGCACATGTGCGTCTCATTTGTTATCT CTATTTTTAAAAGCCGGGAATTTGTAAACTGAACTAAAAAATAGTTTAATATCCTCACTTGGCGGGGCAACCATAGTCGT TATAACACGGGTGTTTTGTTTCATACACTTCGTGCTTGCTTAACAGTTACAACATATATAACTTTGTGAGTGTATGTAAC GTATTTCGGTTAAAAACACGAGTTTCTAACGAAGTCAAGCATGTATCTAATTTACCAAATCACTCATTCTTTCGTCCTGT TCCGGCAATAACTTAAAAATCTTGGCCATCCATGGCACCGGTTTCCACCCCTTTCGGAAGGTTGCCCATGGGACCG >LQW267132.y1 >lcl|LQW267132.y1 CHROMAT_FILE: LQW267132.y1 PHD_FILE: LQW267132.y1.phd.1 CHEM: term DYE: ET TIME: Fri Aug 31 12:36:15 2001 TEMPLATE: LQW267132 DIRECTION: rev GTCGAGCCGGTACCTGATCGTGTTGTAAACAATTACAACGCTCTTTTAGAGTCGTGCGGATACGGTTATATAACTTTCTA AGTATCCCCTTNTTTACTACCTAACGAGACGATAAAAAAATGAAGAACAAGTTTTATCTTACCCCATCTTACTAAATATT TAAGCAACGAAGAGAAGCAAAATAGCAGAAAAACGACCAACACGCGTTAGGTTAAAGGTGTGAGAAAGAGTGTCAGTTAA AAGAACGCGGTTGTAAAAATAGGAATTCGCATTATGTTTATAACATTGAAATATATTTATACGAATAAAGTAGCATGTTA TGCAAGTGATATTACGCAGCGAAATTGCATCGACGCGCATGAGCGGAAATGGTATATGACGTATTATTGCAATACAATAC GTCATAAGGTAAAGGTATAGGGGACATTAGTTGGTAAATGAACAAGCAAATTACAAATTGTTATCAGTTCGAGCGACATG CGTCCAGGCTATAGGGTAAAAGGTAAATACGGTGCGAAAAATAGGATTATACAGTTTATTAAGGCAGTAGAATGTATTTA AGTTTACATGTTGTAGTTATATAGTAGTATGGAGTAAGATGGATCCGTTAGCACGTAATATCCCATATTTCGTAATCGGG TTTTAAACAATTAACAACGTTCTTTTAATAGTCAGGACAATACGGTTGTATAATTCTGTAAAAACTCTTTGTTTACTATT TAATGTATTTTTTGATGCAGATTTGTGTTATAACTTTTTGTTGACATATGAAAGCGATCGCACGATTTCCGTTTCCAGCT CTGTTAAGGTTGTTCGAATTGACCCACCAACAGAGAGCACTGGAGTAACAAGCGTCGCAGAAGGTCCCTCATCAAGTGAC GTGAATGTACTGGTTGCGTATACACGGGGTTTTTACAAAG LQW255639.x1 LQW255639.x1.phd.1 LQW255639.y1 11:56:12 2001 TEMPLATE: LQW255639 DIRECTION: fwd Length = 850 Score = 112 bits (277), Expect = 5e-25 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 1 ICSEKVILMTEFLVAGIDTTSNSAAFLLYALASNQEAQERLREEVREVNRMDTIDGK 57 ICSEKVILMTEFLVAGIDTTSNSAAFLLYALASNQEAQERLREEVREVNRMDTIDGK Sbjct: 265 ICSEKVILMTEFLVAGIDTTSNSAAFLLYALASNQEAQERLREEVREVNRMDTIDGK 95 >LQW255639.x1_4 VMEMYTFPN*ATFRANSSGEQNSRILRDRIYQVK*HLPTQFLVLVRQISRYILKKKYVCV CFFC*VTVLLNTYKLFIKYNSKFMILFYMGEVL**GSTRDLETRFTVQANYN*NPLESRL *LCSWARHLTTIFPTCGFLNCWPKN*KNTKSLIPNTCGNS*ADRRCMKQNTHNIATVITP PHKDK*VTFIHLLTLFAVKR*Y**LSS**LVLTRHQTVLHFSYMLSLLTKKRKNDLEKKS GKLIEWTQLTER*TKCCIYISYPRVVGH*QLL*HRSSVSYTSW >LQW255639.x1_5 CNGDVYFSELGNLQGKQFRGAEF*NT*G*DLSSEVTSTHPVSSIS*ANFEIYTKKEICVC LFFLLGNCFIEHI*VIYKV*Q*IYDSILYG*GPMIGFNKGPGN*VYGTS*L*LKSSRI*I MTVFLGETFDHNFSNMWFPKLLAQKLKKY*KFNPQYMR*LVSRQEVYETEHP*YSNCHYP TTQR*ISYIHSFVNIICSEKVILMTEFLVAGIDTTSNSAAFLLYALASNQEAQERLREEV REVNRMDTIDGKVN*MLYIYILSSRGRALTVVIT*EFCFIHLVX >LQW255639.x1_6 *WRCILFRIRQPSGQTVPGSRILEYLGIGFIK*SNIYPPSF*Y*LGKFRDIY*KRNMCVF VFFAR*LFY*THISYL*SITVNL*FYSIWVRSYDRVQQGTWKLGLRYKLIIIKIL*NLDY DCVLGRDI*PQFFQHVVS*IVGPKIKKILKV*SPIHAVTRKQTGGV*NRTPII*QLSLPH HTKINKLHSFIC*HYLQ*KGDIND*VLSSWY*HDIKQCCISLICSRF*PRSARTT*RRSQ GS**NGHN*RKGKLNVVYIYLILAW*GTDSCYNIGVLFHTPRG LQW199445.x1 LQW199445.x1.phd.1 LQW199445.y1 13:55:24 2001 TEMPLATE: LQW199445 DIRECTION: fwd Length = 870 Score = 83.9 bits (204), Expect = 2e-16 Identities = 39/47 (82%), Positives = 42/47 (88%) Frame = -3 Query: 8 VKRNIHKCVAKDTKHPDDNYNFTKIKYKLPNVAKLMVNF*SFHKLEN 54 +K N KCVAKDTKHP NYNFTKIKYKLP+VAKLMVNF*SFHKL+N Sbjct: 160 LKANTIKCVAKDTKHPHHNYNFTKIKYKLPHVAKLMVNF*SFHKLKN 20 >LQW199445.x1_4 QSIKPPAHFPEKPQRSVR*FTIF*HPHSDTSNTVNSRNPEYYDDPNTFIPERWLETKSVT ERQRER*EN*M*LIN*FMLELII*M*LIYPCMVGQ*QSL*LIGAIFNTACLPLSYES*NK CNLFIPACSRGGAMTVVINRGVLFHTHCARLLFVQHCG*FFSVFFMHAFKQPISKN*FIQ CLA*AQVSSLENGA*LQY*LAYQFICMCSFDFLFDILKSLQK*NNFRIINIAKQSLL*KQ IPLSVLPRTLNIHIIITTLLKSNTNCHM*QN*WLIFNHFIN*KMQLPAVS >LQW199445.x1_5 EY*TPSSLPGKTPKVRKVIHYILAPTFGHIKHSKQQEP*VLRRPKHFYS*TLVGN*ISDG KTKGKVRELNVTY*LIYAGTYYLNVTYLSLHGGAMTVAITYRCHI*HCVPAFKL*IIE*M *LIYPCMFAWRRNDSCYK*GRSVSYTLCPLTVCATLWVIFFRFFYACL*TTH**ELVHSV SCLSTSELTGKWSLTTILACLSVYMHV*F*FFV*HFKKLAEMK*FQNHKHC*TKLTLKAN TIKCVAKDTKHPHHNYNFTKIKYKLPHVAKLMVNF*SFHKLKNAAACRFX >LQW199445.x1_6 RVLNPQLTSRKNPKGP*GNSLYFSTHIRTHQTQ*TAGTLSITTTQTLLFLNVGWKLNQ*R KDKGKGKRIECDLLTDLCWNLLFECNLFIPAWWGNDSRYNL*VPYLTLRACL*VMNHRIN VTYLSLHVRVAAQ*QLL*IGAFCFIHIVPAYCLCNIVGDFFPFFLCMPLNNPLVRTSSFS VLLKHK*AHWKMELDYNISLPISLYACVVLIFCLTF*KACRNEIISES*TLLNKAYFKSK YH*VCCQGH*TSTS*LQLY*NQIQIATCSKING*FLIIS*TEKCSCLPFL >f_GECi44_j12 Length = 911 Score = 51.9 bits (122), Expect = 2e-06 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = +1 Query: 35 KPYIRFIMSGPFGLGMRMCPGRKF 58 KPYIRFIMSGPF GMRMCPGRKF Sbjct: 469 KPYIRFIMSGPFCFGMRMCPGRKF 540 >f_GECi44_j12_1 QRQVHTYVKRNIHKCVAKDTKHPDDNYNFTKIKYKLPNVAKLMVNF*SFHKLENCLNIPN LFNNAT*EQAFSVVACNSKCTKQSKNIFIFKLFFLKSLKTNTTVHSLFLNITVQKPKNLF KKNLKFPVFILYFAWQTVHLHGAFRHLNRPSKKF*FKPYIRFIMSGPFCFGMRMCPGRKF FFKKFNILWTLYF*LSC*V*S*PHKSCISSCFFSHPKPPSSSLPNLKNLI*YLGGSLCLP FGLKFFETHWPCLHLWGLLPHKKIEI*HFF*LGKLPCFFKNFTTFFFKTTNIFVKNKF*N SYLX >f_GECi44_j12_2 SGKCTPMLKGTSISVLPRTLNIQMIITTLLKSNTNCQM*QN*WLIFNHFINLKTV*IYQI FSTMLHKNRPFLLLHVIQNVRNNLKTYLYLNFSF*NL*KLTQQYILFF*T*PFKNLRIFL KKI*NFPYLFFILHGKQYICMAHSDT*TDPLKSFNSSLILGL*CLDLFALVCECVLVGNF SLKNSTSFGHYIFNYRVEYNHDPIKVAFRLVFFPIPSPPVQVYQT*KT*SNIWGGHCAYL LA*NSLKPIGRAFTCGDFYPTKKLKFNIFFN*GNYHVFLKILPHFFLKQQIFLLKTNSKI LTFX >f_GECi44_j12_3 AASAHLC*KEHP*VCCQGH*TSR**LQLY*NQIQIAKCSKING*FLIIS*T*KLFKYTKS FQQCYIRTGLFCCCM*FKMYETI*KHIYI*TFLFKIFKN*HNSTFSFSKHNRSKT*ESF* KKSKISRIYSLFCMANSTFAWRIQTLKQTL*KVLIQALY*VYNVWTFLLWYANVSWSEIF L*KIQHPLDTIFLTIVLSIIMTP*KLHFVLFFFPSQAPQFKFTKLKKLDLIFGGVTVLTF WLKIL*NPLAVPSPVGTFTPQKN*NLTFFLIREITMFF*KFYHIFF*NNKYFC*KQILKF LPF >f_GECi44_j12 CAGCGGCAAGTGCACACCTATGTTAAAAGGAACATCCATAAGTGTGTTGCCAAGGACACTAAACATCCAGATGATAATTA CAACTTTACTAAAATCAAATACAAATTGCCAAATGTAGCAAAATTAATGGTTAATTTTTAATCATTTCATAAACTTGAAA ACTGTTTAAATATACCAAATCTTTTCAACAATGCTACATAAGAACAGGCCTTTTCTGTTGTTGCATGTAATTCAAAATGT ACGAAACAATCTAAAAACATATTTATATTTAAACTTTTCTTTTTAAAATCTTTAAAAACTAACACAACAGTACATTCTCT TTTTCTAAACATAACCGTTCAAAAACCTAAGAATCTTTTTAAAAAAAATCTAAAATTTCCCGTATTTATTCTTTATTTTG CATGGCAAACAGTACATTTGCATGGCGCATTCAGACACTTAAACAGACCCTCTAAAAAGTTTTAATTCAAGCCTTATATT AGGTTTATAATGTCTGGACCTTTTTGCTTTGGTATGCGAATGTGTCCTGGTCGGAAATTTTTCTTTAAAAAATTCAACAT CCTTTGGACACTATATTTTTAACTATCGTGTTGAGTATAATCATGACCCCATAAAAGTTGCATTTCGTCTTGTTTTTTTT CCCATCCCAAGCCCCCCAGTTCAAGTTTACCAAACTTAAAAAACTTGATCTAATATTTGGGGGGGTCACTGTGCTTACCT TTTGGCTTAAAATTCTTTGAAACCCATTGGCCGTGCCTTCACCTGTGGGGACTTTTACCCCACAAAAAAATTGAAATTTA ACATTTTTTTTAATTAGGGAAATTACCATGTTTTTTTAAAAATTTTACCACATTTTTTTTTAAAACAACAAATATTTTTG TTAAAAACAAATTCTAAAATTCTTACCTTTT >r_GECi44_j12 CCTTTGACACTGATATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGATT TTATAAGTCTATGTCAGTCGTAGTACAGAGCTTGTAAGATGTCCGGTGTCGCGGAAATCCGGTTCCCATCGGCTACTGCG CATGCGCAGACACAGGACATTTTTATCAGAAATCTATCTGGTTTCGAACGAAGATTACTTGAATATATACATGTTTTTAG ATAGTTTATTTTATCTAATGTGAAAATTTATGTTTTATCGTCCTTTTTTGTTATTGATGACGTGTTAACGGTAGAGGTCA CTGATGGTCATACGTCATAATGTATAATTTAAGGTAAAATACAGCATCAATTTTTTATTAAGAAGATCAATCTTTAAAAA GAAATGTACAAAATATGTTGCATCCAACAATTAACTGTTATTTTTAGTCGGAACCAGAGTATTAGATTTCTCAAAAAATA AGTTATAAGTAGCCAATGGGAACCAGATTTCCGGGGAACCAGATTTCCACGACACCCGGGCTTAATATTAGTGTGTATGA ATAAATGTAACCCTGCTTCATGTGAATAAATGTAACCTGGCCGAAAACCGTCAGTCGTTATAACACAAGTGTTCTGTTTC ATATACAACTTGTGACAGGCTTGACAGCCTCACCGCTTGAGCATATTTTCATTTTGTTGTTGCCACCCGAAAGTAACCTT ATCCATAAATAAATTGCTTTTTCCTTTAAAAAACGTTANTTCCCGCACCTAAAATTGTTNCTCTTTTTTAACTTGGAGAG CACTTTTCACTTCTATAAAAAGAAAATTTTTCTTTTTTTTTTTAGACCCGAATGGGCCCATTGGGAATCCCTAAAAACCG ATTCCCGGAACTCCCAAAAAAATTCTT >GCiWno222_h01.b1 GTGGTATAGCTGTTTCCGAAAACACGGCCGATCTGGTATAGCATGTTTCCGTAAAACGACGGCCAATCATGGTCATACTC TGTTTACAGGTAAAACAACTGATACTGCATAAAAGTGCGAGTTTTTGGTCAAAAGTAGTGAAGTACATGCTGTGCTTTTC TCCTATCGATCAAAACAAATAAACGCACATGTGCGTCTCATTTGTTATCTCTATTTTTAAAAGCCGGGAATTTGTAAACT GAACTAAAAAATAGTTTAATATCCTCACTTGGCGGGGCAACCATAGTCGTTATAACACGGGTGTTTTGTTTCATACACTT CGTGCTTGCTTAACAGTTACAACATATATAACTTTGTGAGTGTATGTAACGTATTTTGTTAAAAAAAAACGAGTTTTCTA ACGAAGTACAAGCATGTAATCTAATTTTACCCAAATCACCTCATTCTTTTCGTCCATGTTTCGGTCAATAAACTTTAAGA AATCTTTGGACACATTCCTATGCGCTTCCGCGTATTTCCACACCGCCGTGTTTTGGAGAAAGTGTTGATTCACGATTTGG CGGACCTGGTGTGGTTGGGAAGTAGTTTANCAATGGTTTACAACTTCTAACCCAAAGGTTTGTGTTTTAAGCTCGTCGCT GCTACCATAATCTACCTATTTATTCATTTACTCATTCACTCTTATCCGTTTACTTACCCTTCCACAATCTTCCCCATTAG AATAATCAAAGCCGGGTAACTCGTTCCGTTCCATCTCGAATTTTTGCTACAGGACCCCAGCGGGTAACAAAAACGGCATC TCTCCTTCGTTACCAAACATAATTTCTGGGTTTCTGGGCGAAAAACGTGACCCCCATCGGTTCAAGGACTCCCTATGTTT AATTAAATGAAAAAGTTCCTTTCCGGTTAAATAAAGAAGTTTTTGCCTTTGC >GCiWno222_h01.b1_4 KGKNFFI*PERNFFI*LNIGSP*TDGGHVFRPETQKLCLVTKERCRFCYPLGSCSKNSRW NGTSYPALIILMGKIVEG*VNG*E*MSK*INR*IMVAATSLKHKPLG*KL*TIXKLLPNH TRSAKS*INTFSKTRRCGNTRKRIGMCPKIS*SLLTETWTKRMR*FG*N*ITCLYFVRKL VFF*QNTLHTLTKLYML*LLSKHEVYETKHPCYNDYGCPAK*GY*TIF*FSLQIPGF*K* R*QMRRTCAFICFDR*EKSTACTSLLLTKNSHFYAVSVVLPVNRV*P*LAVVLRKHAIPD RPCFRKQLYH >GCiWno222_h01.b1_5 QRQKLLYLTGKELFHLIKHRESLNRWGSRFSPRNPEIMFGNEGEMPFLLPAGVL*QKFEM ERNELPGFDYSNGEDCGRVSKRIRVNE*MNK*VDYGSSDELKTQTFGLEVVNHX*TTSQP HQVRQIVNQHFLQNTAVWKYAEAHRNVSKDFLKFIDRNMDEKNEVIWVKLDYMLVLR*KT RFFLTKYVTYTHKVIYVVTVKQARSV*NKTPVL*RLWLPRQVRILNYFLVQFTNSRLLKI EITNETHMCVYLF*SIGEKHSMYFTTFDQKLALLCSISCFTCKQSMTMIGRRFTETCYTR SAVFSETAIPX >GCiWno222_h01.b1_6 AKAKTSLFNRKGTFSFN*T*GVLEPMGVTFFAQKPRNYVW*RRRDAVFVTRWGPVAKIRD GTERVTRL*LF*WGRLWKGK*TDKSE*VNE*IGRLW*QRRA*NTNLWVRSCKPLXNYFPT TPGPPNRESTLSPKHGGVEIRGSA*ECVQRFLKVY*PKHGRKE*GDLGKIRLHACTSLEN SFFFNKIRYIHSQSYICCNC*ASTKCMKQNTRVITTMVAPPSEDIKLFFSSVYKFPAFKN RDNK*DAHVRLFVLIDRRKAQHVLHYF*PKTRTFMQYQLFYL*TEYDHDWPSFYGNMLYQ IGRVFGNSYTT >rcibd010k11 TATTTTTCTTATTACAAATAAGTTACACCTTATTCAATATTTATACAATACAGTGAAGCATCAAATTTATGCAAATAATA TTGAATTACCGATGTATATTTTAACGTACACCCCTCAATAAAAATAAAATTTACAGACAAAAACATAAATTTAAAAAAAA ATATTGGAAATATTTTACTGGCGAATTTTCCTACCATAGAAACTTCCACATTGCATTAATCAGTAAACATTACAACCAAT AAGTTCGATTTGTTTCATAGGAATGTGTGTCTAACTATCCCTGCCTCCCCTGTGTTTTAAAGAGTTTGGCGACTATGAAA AGACCAATTTTTTTGCACGGCACTAATCAGTAAACAATAAACGTAAAATTTAGATTTGTTTTACAAAAATTTGTGTCTGA AAAAATGTGTACATGTTTAAAGAAATGGTATTTCCCTATTATAAAATGATAGTTCTATTTTTTGTGGGTAAAGTCCCACA GTGAGGCACGCCATGGGTTCAAGGATTTAAGCCAGAGTTAGCACATTACCCCACAAATATTAGATCAGTTTTTAAGCTTG GTGAACTTGAACTGGGGGGCTTGGGATGGGAAAGAGACGAGACGAAATGCAACTTTTATGGGGTCATGATGATACTCAAC ACGATAGTTGGATAATAGAGTGATCAGAAGTAGTTGTAATTCTTGAATGGAGAATTTCCGACCAGGACACATTCGCATAC CAAGTCCAAAAGGT >rcibd010k11_5 PFGLGMRMCPGRKFSIQELQLLLITLLSNYRVEYHHDPIKVAFRLVSFPSQAPQFKFTKLKN* cibd010k11 Length = 677 Score = 87.8 bits (214), Expect = 2e-17 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +1 Query: 11 PVIGTALEYTPLNNFNPSYVGEHWIERHKELGPIYKEN 48 PVIGTALEYTPLNNFNPSYVGEHWIERHKELGPIYKEN Sbjct: 172 PVIGTALEYTPLNNFNPSYVGEHWIERHKELGPIYKEN 285 MKAIARFPFPALVRFVSTCPAHQRAAWSKKASQEDLSYAKPFEAVPEPNSYPVI GTALEYTPLNNFNPSYVGEHWIERHKELGPIYKENILPGVTETMVFTSSPQNTEIMFRNE ERCPFRDPLGPVAKIRDERNEYHGLTNSNGEDWWRVRQIVNQHFLQNTAVWKYAEAHRNV SKDFLKFIDRNMDEKNEVPNFGKALNRWSFEGAGVFTLKRRLGAL >LQW255639.x1 >lcl|LQW255639.x1 CHROMAT_FILE: LQW255639.x1 PHD_FILE: LQW255639.x1.phd.1 CHEM: term DYE: ET TIME: Mon Aug 27 11:56:12 2001 TEMPLATE: LQW255639 DIRECTION: fwd CCACGAGGTGTATGAAACAGAACTCCTATGTTATAACAACTGTCAGTGCCCTACCACGCGAGGATAAGATATATATATAC AACATTTAGTTTACCTTTCCGTCAATTGTGTCCATTCTATTAACTTCCCTGACTTCTTCTCTAAGTCGTTCTTGCGCTTC TTGGTTAGAAGCGAGAGCATATAAGAGAAATGCAGCACTGTTTGATGTCGTGTCAATACCAGCTACTAAGAACTCAGTCA TTAATATCACCTTTTCACTGCAAATAATGTTAACAAATGAATGAATGTAACTTATTTATCTTTGTGTGGTGGGGTAATGA CAGTTGCTATATTATGGGTGTTCTGTTTCATACACCTCCTGTCTGCTTACGAGTTACCGCATGTATTGGGGATTAAACTT TTAGTATTTTTTTAATTTTTGGGCCAACAATTTAGGAAACCACATGTTGGAAAAATTGTGGTCAAATGTCTCGCCCAAGA ACACAGTCATAATCTAGATTCTAGAGGATTTTAATTATAATTAGCTTGTACCGTAAACCTAGTTTCCAGGTCCCTTGTTG AACCCTATCATAGGACCTCACCCATATAGAATAGAATCATAAATTTACTGTTATACTTTATAAATAACTTATATGTGTTC AATAAAACAGTTACCTAGCAAAAAAAACAAACACACACATATTTCTTTTTTAGTATATATCTCGAAATTTGCCTAACTAA TACTAGAAACTGGGTGGGTAGATGTTACTTCACTTGATAAATCCTATCCCTAAGTATTCTAGAATTCTGCTCCCCGGAAC TGTTTGCCCTGAAGGTTGCCTAATTCGGAAAAGTATACATCTCCATTACA >LQW255639.x1_4 VMEMYTFPN*ATFRANSSGEQNSRILRDRIYQVK*HLPTQFLVLVRQISRYILKKKYVCV CFFC*VTVLLNTYKLFIKYNSKFMILFYMGEVL**GSTRDLETRFTVQANYN*NPLESRL *LCSWARHLTTIFPTCGFLNCWPKN*KNTKSLIPNTCGNS*ADRRCMKQNTHNIATVITP PHKDK*VTFIHLLTLFAVKR*Y**LSS**LVLTRHQTVLHFSYMLSLLTKKRKNDLEKKS GKLIEWTQLTER*TKCCIYISYPRVVGH*QLL*HRSSVSYTSW >LQW255639.x1_5 CNGDVYFSELGNLQGKQFRGAEF*NT*G*DLSSEVTSTHPVSSIS*ANFEIYTKKEICVC LFFLLGNCFIEHI*VIYKV*Q*IYDSILYG*GPMIGFNKGPGN*VYGTS*L*LKSSRI*I MTVFLGETFDHNFSNMWFPKLLAQKLKKY*KFNPQYMR*LVSRQEVYETEHP*YSNCHYP TTQR*ISYIHSFVNIICSEKVILMTEFLVAGIDTTSNSAAFLLYALASNQEAQERLREEV REVNRMDTIDGKVN*MLYIYILSSRGRALTVVIT*EFCFIHLVX >LQW255639.x1_6 *WRCILFRIRQPSGQTVPGSRILEYLGIGFIK*SNIYPPSF*Y*LGKFRDIY*KRNMCVF VFFAR*LFY*THISYL*SITVNL*FYSIWVRSYDRVQQGTWKLGLRYKLIIIKIL*NLDY DCVLGRDI*PQFFQHVVS*IVGPKIKKILKV*SPIHAVTRKQTGGV*NRTPII*QLSLPH HTKINKLHSFIC*HYLQ*KGDIND*VLSSWY*HDIKQCCISLICSRF*PRSARTT*RRSQ GS**NGHN*RKGKLNVVYIYLILAW*GTDSCYNIGVLFHTPRG >LQW255639.y1 >lcl|LQW255639.y1 CHROMAT_FILE: LQW255639.y1 PHD_FILE: LQW255639.y1.phd.1 CHEM: term DYE: ET TIME: Mon Aug 27 11:56:38 2001 TEMPLATE: LQW255639 DIRECTION: rev GGCCGGTACCTGCTACAGAACAAACAGTTACCAGTTATTGGTACTGCATTGGAATATACGCCTTTAAACAACTTTAACCC TTCGTACGTCGGTGAACACTGGATTGAAAGGCATAAGGAATTGGGACCGATTTATAAAGAGAACATTTTGCCAGGTATAT GAATGAATGAATGAATGTAACTAATTTATCCTCGTGATAAATTAGTGGCGCGCAATGACAGTCGTTATAACACGGGTGTT CTGTTTTACATACTTCGTGCTCACTTACGAGTTATAAATGAATGAATGAATGAATGAATGAATGAATGAATGAATGAATG AATGAATGAATGTAACTTATATCCTCGCGTGGCGGAGAAACGACATTCGTTATAACACGGGTGTTCTGTTATTTTTTCTC AAGTAGTTTTTACTCGAAAATTGGTTTTCCGACTGTCGTTTTGCTGTTAATTCCCTTCTCTTTGTTGTTTTAATTAATCT GATCTTAGTTTCTGTATTCAAAAAGATAAATAAAGATTGTGGTATTATGTTAACCAAACTACAAGGCAAAAAACTACTTT ATTTAAACCGTATAGTAACTTTTCTATTTTAATTAAACATAGGAGTCACTGAAACGATGGTGTTCACGTCTTCGCCCCAG AACACAGAAATTATGTTTCGTAACGAGGAGAGATGCCCGTTTCGTGACCCGCTGGGTCCTGTAGCAAAAATACAAGATGA ACGGGACGAGTACCCGGCTTGACTAATCCTATGGGGACCATGCCGACGGTAGTAACCAATTCACTGAATCGTACTGAAAC TCCGGACTTGGTCACGAAAAGCTTAACAGACCCTGGTTAAATTACCCCGGCAGGATTCACCAAGGTGGCCACAGATAACT CTCCAAACGGGCGAAACCAAACTAAGGTCAATACTGATCCAAGCGGCACGTTGGAAGACATGGCTAAACACAGAGAGACG CATTGTGTAGAACACACCCTCACCTCCGTAATAGTACCCTCCGAGC >LQW255639.y1_1 from op end of clone GRYLLQNKQLPVIGTALEYTPLNNFNPSYVGEHWIERHKELGPIYKENILPGI*MNE*M* LIYPRDKLVARNDSRYNTGVLFYILRAHLRVINE*MNE*MNE*MNE*MNECNLYPRVAEK RHSL*HGCSVIFSQVVFTRKLVFRLSFCC*FPSLCCFN*SDLSFCIQKDK*RLWYYVNQT TRQKTTLFKPYSNFSILIKHRSH*NDGVHVFAPEHRNYVS*RGEMPVS*PAGSCSKNTR* TGRVPGLTNPMGTMPTVVTNSLNRTETPDLVTKSLTDPG*ITPAGFTKVATDNSPNGRNQ TKVNTDPSGTLEDMAKHRETHCVEHTLTSVIVPSEX >LQW255639.y1_2 AGTCYRTNSYQLLVLHWNIRL*TTLTLRTSVNTGLKGIRNWDRFIKRTFCQVYE*MNECN *FILVIN*WRAMTVVITRVFCFTYFVLTYEL*MNE*MNE*MNE*MNE*MNVTYILAWRRN DIRYNTGVLLFFLK*FLLENWFSDCRFAVNSLLFVVLINLILVSVFKKINKDCGIMLTKL QGKKLLYLNRIVTFLF*LNIGVTETMVFTSSPQNTEIMFRNEERCPFRDPLGPVAKIQDE RDEYPA*LILWGPCRR**PIH*IVLKLRTWSRKA*QTLVKLPRQDSPRWPQITLQTGETK LRSILIQAARWKTWLNTERRIV*NTPSPP**YPPS >LQW255639.y1_3 PVPATEQTVTSYWYCIGIYAFKQL*PFVRR*TLD*KA*GIGTDL*REHFARYMNE*MNVT NLSS**ISGAQ*QSL*HGCSVLHTSCSLTSYK*MNE*MNE*MNE*MNE*M*LISSRGGET TFVITRVFCYFFSSSFYSKIGFPTVVLLLIPFSLLF*LI*S*FLYSKR*IKIVVLC*PNY KAKNYFI*TV**LFYFN*T*ESLKRWCSRLRPRTQKLCFVTRRDARFVTRWVL*QKYKMN GTSTRLD*SYGDHADGSNQFTESY*NSGLGHEKLNRPWLNYPGRIHQGGHR*LSKRAKPN *GQY*SKRHVGRHG*TQRDALCRTHPHLRNSTLR >SEQUENCE 143, 228 PKG TO PERF SIMILAR TO SEQ 111 51% TO 3A7 496 IPKHTCIMPSYHTIHFDPKFWKNPNEFDP 410 DEV7930.y1 >SEQUENCE 144 MID 236-262 59% TO 3A5 probable accidental hit 248 LSLSLFDLLNFLSLQVNRCNRSRLN 174 DEV43033.y1 >sequence 145, 120, 123, 197 TYEYLKAWVGYGILTSNGERFQRQKKLLVTAFHQDLIKQ (2) YSPVFTKATDRLIEKWTEKQNQSVELFEDISLLTLDCILICAMSTDLDCQRIG (2) MISSING 144-241 246(0) DESGEGLTDQEIREQVDTFLFAGHDTTAS (1) ggt 332 248(1)agct AICWFLYNLACNPEYQDKCREEVKEVMEGRKDVQM (2) atgt (2) agg FDIGNMTYLTMCMKESMRLYAPVPFIGRKIKNKLNVHRPN GASDVTLDADVTVIPHLFTLHRNPEIWDDPE (0) VYDPERFNTKNASRLHPYAYIPFSAGPR (2) ICIGQNFALVEMKLTVAKLLLNYEFYVDEDIPKPQPIPNVVLRSQNGLYVKFRKI* rcilv33h16 EST C-term 44 aa cilv33h16 EST C-term 18 aa rcilv11j04 EST C-term 18 aa cilv11j04 EST C-term 17 aa LQW170001.y1 C-HELIX TO MID LQW269742.y1 C-helix DEV6564.y1 c-helix DEV17916.y1 C-HELIX LQW242052.x1 mid LQW215469.y1 MID 2 DIFFS DEV25428.y1 mid 2 DIFFS DEV17005.x1 MID 2 DIFFS DEV50591.x2 I-helix LQW166049.x1 I-HELIX LQW170001.x1 I-HELIX ONE DIFF LGJ635.y1 I-helix ONE DIFF LQW54892.x1 I helix LQW54892.y1 PERF LQW242052.y1 J-helix LQW184887.x1 k-helix DEV50591.y1 k-helix DEV22119.x1 K-HELIX LQW144095.y1 k-helix to perf DEV58478.x1 K-helix to PERF LQW77486.x1 K-helix to PKG LQW260830.y1 PERF LQW27594.x1 PERF LQW61890.x1 PERF LQW197647.x1 PERF LQW56717.y1 HEME LQW161428.y1 HEME LQW2418.x1 HEME >27. CYP4F2 NM_001082 alternative 2nd exon MSQLSLSWLGLCDVAASPWLLLLLVGASWLLAHVLAWTYAFYDN CRRLRCFPQPPRRNWFWGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLC HPDIIRSVINASAAIAPKDKF FYSFLEPWLGDGLLLSAGDKWSRHRRMLTPAFHFNIL KPYMKIFNESVNIMHAKWQLLASEGSACLDMFEHISLMTLDSLQKCVFSFDSHCQEKP SEYIAAILELSALVSKRHHEILLHIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRR TLPSQGVDDFLQAKAKSKTLDFIDVLLLSK SKSEGKHLDFLDILLLTR savignyi DEDGKKLSDEDIRAEADTFMFEGHDTTA SVSPGSCTTLQSTQNTRSVCRQEVQELLKDREPKEIEWDDLAHLPFLTMCMKESLRCI PPVPVISRHVTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPENI KERSPLAFIPFSAGPRNCIGQTFAMAEMKVVLALTLLAFRVLPDHTEPRRSRSWSCAQ RADFGCGWSP >34. CYP4V2 formerly CYP4AH1 AC012525 Homo sapiens chromosome 4 MAGLWLGLVWQKLLLWGAASAVSLAGASLVLSLLQRVASYARKWQQMRPIPTVARAYPLVGHALLMKPDGR EFFQQIIEYTEEYRHMPLLKLWVGPVPMVALYNAENVEG ILTSSKQIDKSSMYKFLEPWLGLGLLT STGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKHINQEAFNCFFYITLCALDIIC ETAMGKNIGAQSNDDSEYVRAVYR MSEMIFRRIKMPWLWLDLWYLMFKEGWEHKKSLQILHTFTNSV IAERANEMNANEDCRGDGRGSAPSKNKRRAFLDLLLSVTDDEGNRLSHEDIREEVDTFMFE GHDTTAAAINWSLYLLGSNPEVQKKVDHELDDV KSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSED YFLTAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQG RHPYAYVPFSAGPRNCIG QKFAVMEEKTILSCILRHFWIESNQKREELGLEGQLILRPSNGIWIKLKRRNADER* >CIONA SAVIGNYI BEST MATCHES TO ABOVE SEQUENCE TYQYLTGFVGYGLLTSNGVRWQRQKALLSTAFHQDLLK YSPVFTSATDTLIEKWGKKQNRSVELFEDISLLTLDCILICAMSTDLDCQRIG EDEKGLTDIEIKDEVDTFLFEGHDTTSSG IAWALYHLAKYSEFQAKCREELTEVLGDRKYVEW IREIMEDRKNVQL FDVGEMSYLTMCIKESMRLYSPIPFIGRKIKNKLNVHRPNGASDVTLDADVTVIPHLFTLHRNPEIWDDPEV >SEQUENCE 146 672 DPKDNLAYRFIKPWIGDGLLVSHGSKWRRNRHLLTKAFHFDILKQF 535 (?) 445 KTMLEKWSRKCDGSTVEVFRPVSLMTLDSMLQCAIS 338 637 LSKLPFVTMFIKEVLRLYPPVFAVARRTEQPVKFP 533 DEV22920.x01 C-HELIX TO MID DEV22920.y1 K-HELIX LQW193399.x1 C-HELIX TO MID LQW223280.x1 K-helix LQW223280.y1 mid DEV54197.y1 mid DEV8162.x1 c-helix LQW23885.x1 C-HELIX LQW271226.y1 mid >SEQUENCE 147 MLEKWKRHSGQSYDVYGDVSNLTLDTMMQCAMSTDTDSGGEDG GYINAVHELTLLVMERVYNPLHMIDWIYHFSSNGR 124 DEV2967.y1 mid LQW2266.x2 mid LQW2266.x1 mid DEV55306.y1 C-helix LQW280645.x1 C-helix DEV28559.y1 c-helix >sequence 159 71% to 4T5 only 1 hit in JGI none in Japan cannot extend 71% to seq 148 417 TAPKNDLGYRFIRTWIGDGLLTSKGKKWFRNRRLLTPAFHYKVLKP 280 >LQW144281.y1 >lcl|LQW144281.y1 CHROMAT_FILE: LQW144281.y1 PHD_FILE: LQW144281.y1.phd.1 CHEM: term DYE: ET TIME: Wed Aug 22 12:52:57 2001 TEMPLATE: LQW144281 DIRECTION: rev CGGATAAATCGAGTCGGTACCAATATGTTTAATCAAATATTCAGTCATAAAACTTTCACATGTTTGTTACCTACTTACAT GATGCTGCTATTTTATAGTGCACAACCTTTTTATAATAGGTACACAGATTCGACTAAATTTGGTGCAGCTGTTTCAGTGG TTCTCATACTTTTTTAAAGGATGGTATACACTACATAACAAGCCTAGCAAACATTTTTAAATGGTTCATAAGGAAACCAC TAAACTATATATAAAGAGAGTATTTTCCTTGTTTGCTTACGGTTTTAAAACTTTGTAGTGGAAAGCAGGTGTTAATAGTC TCCTATTACGAAACCATTTTTTCCCTTTACTGGTTAGTAAGCCATCACCTATCCATGTTCTTATGAAACGATAGCCAAGA TCATTCTTCGGGGCTGTTTAAGAAACGTATTTATTAATTAACTTGTAATGTTGATATATGTTAGCATTTGGACATGCTGT TTAATTTGATACGGAGTGGCCTAGAAACCTCAAATATATATATATATGTATGTGTTTACATTATACTATGTTTATAGACA CAAACTAAAACACATTTTATTATTTATTAACTTGTAATGTTGTAACATGTTAGCATTTAGAAATGTGTTTATTTTGCTGA AGTCTGGCTGTTTAATATATATATATATGTATATATTGTATGTGTTTGCATTATACTATGTTTATAGACACAAACTAAAA CACATGTAAAAGTAATTGTCATGCACAAAGGTATATTAGGGAGCTAAACTTCATAAAACGCAGGGATGTTAATCATGCAA GACTGGCTTAATGTACCTTCTTATTAAATAACTCTACTTATTGGTGGTATATTACTAAACATGCGGGCCGAAATCTCCGA TAGCGGAAGTCGAN >LQW144281.y1_4 XDFRYRRFRPACLVIYHQ*VELFNKKVH*ASLA*LTSLRFMKFSSLIYLCA*QLLLHVF* FVSINIV*CKHIQYIHIYIY*TARLQQNKHISKC*HVTTLQVNK**NVF*FVSINIV*CK HIHIYIYLRFLGHSVSN*TACPNANIYQHYKLINKYVS*TAPKNDLGYRFIRTWIGDGLL TSKGKKWFRNRRLLTPAFHYKVLKP*ANKENTLFIYSLVVSL*TI*KCLLGLLCSVYHPL KKYENH*NSCTKFSRICVPIIKRLCTIK*QHHVSR*QTCESFMTEYLIKHIGTDSIYP >LQW144281.y1_5 RLPLSEISARMFSNIPPISRVI**EGTLSQSCMINIPAFYEV*LPNIPLCMTITFTCVLV CVYKHSIMQTHTIYTYIYILNSQTSAK*THF*MLTCYNITS**IIKCVLVCVYKHSIM*T HTYIYIFEVSRPLRIKLNSMSKC*HISTLQVN**IRFLNSPEE*SWLSFHKNMDR*WLTN Q*REKMVS**ETINTCFPLQSFKTVSKQGKYSLYI*FSGFLMNHLKMFARLVM*CIPSFK KV*EPLKQLHQI*SNLCTYYKKVVHYKIAASCK*VTNM*KFYD*IFD*TYWYRLDLSX >LQW144281.y1_6 STSAIGDFGPHV**YTTNK*SYLIRRYIKPVLHD*HPCVL*SLAP*YTFVHDNYFYMCFS LCL*T*YNANTYNIYIYIYIKQPDFSKINTFLNANMLQHYKLINNKMCFSLCL*T*YNVN TYIYIYI*GF*ATPYQIKQHVQMLTYINITS*LINTFLKQPRRMILAIVS*EHG*VMAY* PVKGKNGFVIGDY*HLLSTTKF*NRKQTRKILSLYIV*WFPYEPFKNVC*ACYVVYTIL* KSMRTTETAAPNLVESVYLL*KGCAL*NSSIM*VGNKHVKVL*LNI*LNILVPTRFIR >SEQUENCE 148 like 4T5 42% to 4B1 human 44% to 4T5 MAWTSVGGIVTTTAVGDFLLVACIVVVIKSFIIPAVRGYQDAKKRARSVGEVKKHWLYGSVKM (0) FPQNEEGLMKRVASSFEKPVWTVNWFGPYISEVVIHHADLAITLLSSS (1) APKNNLVYGFFHPWIGDGLLTSSGRKWQRNRRLLTPAFHFSILKP (2) YTNVSNACVRVMLDKWSKKVGTSMEIYLDVNLMTLDTILQCAMSTKSDCQNRS (2) KKNEYIEAVHDVSKYIMSRVHKPLLHIDWIYWLTAEGRKFKQLVKVLHDQSEK (0) VIRERRKTLENRKFEEESSGKKRLDFLDILLHTK (0) Missing exon 7 here GIAWALYNLAVNVDCQDKCREELKSVVGDKENIEW (2) EDLSKLSYLTLCIKESLRLCPPVPFIGRELNEPLKF RSKLKEPNETTIDAHSNIALHIFTLHRNVHVWDSPE (?) EFIPERFKPENMKGRSPHAYLPFSAGPR (2?) NCIGQNFAMNEMKIAIGQTLRRFKVIPDESSPKPSITPQVVLRPKDGIFIKLMKI* Note last two exon are based on savignyi match not overlaps to rest of seq. LQW261744.y1 J-helix TO K-helix LQW261744.x1 C-helix LQW250581.y1 EXXR to WXXP LQW114672.x01 c-helix GCiWno812_i09.b1 GCiWno812_i09.g1 exons 1 and 2 GCiWno112_f13.b1 exons 1 and 2 GCiWno1023_j03.g1 Try opp ends of these GCiWno812_i09.g1 no GCiWno112_f13.b1 no r_GECi37_l17 no GCiWno812_i09.b1 no GCiWno348_j03.g1 exon 6 b1 not found GCiWno581_b24.b1 g1 not found GCiWno735_f18.g1 GCiWno449_j12.g1 LQW147407.y1 no LQW197010.y1 no LQW212657.x1 IYILRELS*SKKNLKRLMTVFLS*IKR*SENGEKPLENRKFEEESSGKKRLDFLDILLHT KVCLFCNNGGYDVTILFLNKIVGKL*ENNKFVKVYGYQAH LQW130161.x01 no LQW158098.y1 no LQW114672.x01 no >LQW250581.y1 >lcl|LQW250581.y1 CHROMAT_FILE: LQW250581.y1 PHD_FILE: LQW250581.y1.phd.1 CHEM: term DYE: ET TIME: Mon Aug 27 11:07:29 2001 TEMPLATE: LQW250581 DIRECTION: rev GGGGGACTCGAAACTCGANGNCTGNNGTTANCCNNAANNTGNTGNGAGGTNTGTTCTAATNNGACAAANTGTCGGGAAGA ATTGAAAAGTGTGGTTGGTGATAAGAGAATATTGAATGGTGAGATTGATATGCTGGAACTACAGTTAATATATAGGTGCA ATGTCTTGGTAGTAAGCATGAGGTGTATGAGTACACCATGTGTGTCTGGTGTATAAGAAGACACCCATGTTATAGCTTGA CAGTGAGCATGAGGTGTATAAGAAGACACCCATGTTATAGCTTGACAGTGAGCATGAGGTGTATGAATACACCGTGCATG TCTGGTGTGTAAGAAGACACCCACGATATATTATAACTCAACAGTGAGCATGAGGTGTATGAATACACCATGTGTCTCTT ATATATAAACAGACACCTATGTTATAACTTGTATCCATAAATACAAATTCCAAAATAAATAAAGCAACTTACCCGCAGGG AGGATTTATCGAAGTTAAGTTATCTCACGTTATGCATCAAAGAAAGTCTTCGTTTATGTCCTCCTGTCCCATTTATCGGA AGGGAACTAAATGAACCACTCAAGTTCCGAAGCAAACTTAAAGAACCAAATGAAACAACGATTGACGCACACTCGAACAT CGCGCTTCACATTTTTACACTGCATAGGAATGTTCATGTCTGGGACTCTCCTGAGGTAAGAATATATCATCTATTTTAAA GTTGCAAAACATCGAAACTTAAATATCGATTGAAGCGCTATTGTATCATACCTGGTAAGCCGTAAGCGGCTCAATGTGTA TGACACAGTCTTTGCGTTATACGACTGTCGTCATTATCATTCAGCAGCTTAAGTACAGATAACTCTGACACAGATTGGCG ATTACCTGGCAGCCTGGGATATTAGGACTGAACTCGAGTCGACTTCAGTCACTTAAGAATCCAGAATTCCAAAAGTACGA ATATAGGAGCCCGCCACCTTCGGCCGAAAGCGGTTAAACCAAACGGGCCCATCACATTATGGCGTAAAC GTRNSXXXVXXXXXXGXF*XDKXSGRIEKCGW**ENIEW*D*YAGTTVNI*VQCLGSKHE VYEYTMCVWCIRRHPCYSLTVSMRCIRRHPCYSLTVSMRCMNTPCMSGV*EDTHDIL*LN SEHEVYEYTMCLLYINRHLCYNLYP*IQIPK*IKQLTRREDLSKLSYLTLCIKESLRLCP PVPFIGRELNEPLKFRSKLKEPNETTIDAHSNIALHIFTLHRNVHVWDSPEVRIYHLF*S CKTSKLKYRLKRYCIIPGKP*AAQCV*HSLCVIRLSSLSFSSLSTDNSDTDWRLPGSLGY *D*TRVDFSHLRIQNSKSTNIGARHLRPKAVKPNGPITLWRK >LQW158098.x1_4 QTLFRSKPLLI*LISGSPLRKKVKQLVKVLHDQSEKV*YLISINLH*IFELFLIYVLKF* *MEY*S*YLKLINE***LTG**VTML*ITSLYFIVYCETSFRKQ*EPLKKCRKKY*ITI* NTIDG*KINDLSTF*ESLVEVKKI*KG**RYFYLK*KGNQRTEKNFGK*EI*RRKFWEET PGFS*YSLAYKGLFVL*QWWL*CHNTFFE*DCGKIIRK*QFGKSFRNLQQIVLFTKLTLR LADELGKYTSFFNFFSDMRCYYSVTNKIYLLXCRF >LQW158098.x1_5 PNIIPIQTVAHMTDIWLTPKEES*TVSKSSARSIRKGIISYIYKLALNI*TISYLCTEVL INGILKLIFKINK*IIIINRVMSNYVVNHFIIFHSVL*NFI*KAIRTFKKV*KKILNYNL KYYRWIKNK*SIYILRELS*SKKNLKRLMTVFLS*IKR*SENGEKLWKIGNLKKKVLGRN AWIFLIFSCIQRFVCFVTMVVMMSQYFF*IRLWENYKKITIW*KFQEFATNCLVYQVDAS SGRRTGKIHFVF*LFF*YEMLLLCYKQNLLAALPFX >LQW158098.x1_6 KHYSDPNRCSYD*YLAHP*GRKLNS**KFCTINQKRYNILYL*TCIEYLNYFLFMY*SFN KWNIKVNI*N**MNNNN*QGNE*LCCKSLHYIS*CTVKLHLESNKNL*KSVEKNIKLQFK IL*MDKK*MIYLHFKRA*LK*KKFKKVNDGIFILNKKVIRERRKTLENRKFEEESSGKKR LDFLDILLHTKVCLFCNNGGYDVTILFLNKIVGKL*ENNNLVKVSGICNKLSCLPS*RFV WQTNWENTLRFLTFFLI*DVITLLQTKFTCCXAVX LQW250581.y1 LQW250581.y1.phd.1 LQW250581.x1 11:07:29 2001 TEMPLATE: LQW250581 DIRECTION: rev Length = 1029 Score = 162 bits (406), Expect = 1e-39 Identities = 77/79 (97%), Positives = 78/79 (98%) Frame = +3 Query: 33 IEWLTRREDLSKLSYLTLCIKESLRLCPPVPFIGRELNEPLKFRSKLKEPNETTIDAHSN 92 I+ LTRREDLSKLSYLTLCIKESLRLCPPVPFIGRELNEPLKFRSKLKEPNETTIDAHSN Sbjct: 459 IKQLTRREDLSKLSYLTLCIKESLRLCPPVPFIGRELNEPLKFRSKLKEPNETTIDAHSN 638 Query: 93 IALHIFTLHRNVHVWDSPE 111 IALHIFTLHRNVHVWDSPE Sbjct: 639 IALHIFTLHRNVHVWDSPE 695 LQW261744.y1 LQW261744.y1.phd.1 LQW261744.x1 12:48:40 2001 TEMPLATE: LQW261744 DIRECTION: rev Length = 994 Score = 104 bits (257), Expect = 3e-22 Identities = 50/52 (96%), Positives = 51/52 (97%) Frame = -2 Query: 33 IEWLTRREDLSKLSYLTLCIKESLRLCPPVPFIGRELNEPLKFRSKLKEPNE 84 I+ LTRREDLSKLSYLTLCIKESLRLCPPVPFIGRELNEPLKFRSKLKEPNE Sbjct: 183 IKQLTRREDLSKLSYLTLCIKESLRLCPPVPFIGRELNEPLKFRSKLKEPNE 28 Score = 79.2 bits (192), Expect = 1e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 1 GIAWALYNLAVNVDCQDKCREELKSVVGDKENIEW 35 GIAWALYNLAVNVDCQDKCREELKSVVGDKENIEW Sbjct: 582 GIAWALYNLAVNVDCQDKCREELKSVVGDKENIEW 478 >LQW261744.y1 >lcl|LQW261744.y1 CHROMAT_FILE: LQW261744.y1 PHD_FILE: LQW261744.y1.phd.1 CHEM: term DYE: ET TIME: Fri Aug 31 12:48:40 2001 TEMPLATE: LQW261744 DIRECTION: rev GGGGGACTAGAATGAGCCGGTCCGGTGTTCATTTGGTTCTTTAAGTTTGCTTCGGAACTTGAGTGGTTCATTTAGTTCCC TTCCGATAAATGGGACAGGAGGACATAAACGAAGACTTTCTTTGATGCATAACGTGAGATAACTTAACTTCGATAAATCC TCCCTGCGGGTAAGTTGCTTTATTTATTTTGGAATTTGTATTTATGGATACAAGTTATAACATAGGTGTCTGTTTATATA TAAGAGACACATAGTGTATTCATACACCTCATGCTCACTGTTGAGTTATAATATATCGTGGGTGTCTTCTTACACACCAG ACATGCACGGTGTATTCATACACCTCATGCTCACTGTCAAGCTATAACATGGGTGTCTTCTTATACACCAGACACACATG GTGTACTCATACACCTCATGCTCACTACCAAGACATTGCACCTATATATTAACTGTAGTTCCAGCATATCAATCTCACCA TTCAATATTCTCTTTATCACCAACCACACTTTTCAATTCTTCCCGACATTTGTCTTGACAATCCACATTGACAGCAAGGT TATACAAAGCCCAGGCTATTCCTGTGGATTAACAACAATGTATAACATCCATGATTATATCTATATATAAAGAGTGTGTT TTATACAATAAATGGAACTTAATTTTCCTGACTAATGACAGTTGTTTTACTTTTAAACTTATAATGCAAGATTGGTAGTT TTTATTACCTAGGTGGGTAATTGTCTTAATAGAAAAGGCATATTTATTAGATTGAAGCCAAGTTTTTTTAAAGATAATAT TTGTATCAAATTACCACAATGTATGTCCAAAGGCATGTTATCAGAATTCCTCTTTATTTGTACTAGCGAGTATGGATTTT TACATTTTTTACCATTATGTTCACGTGGATATGCGCAAGAAGAAGTCACTATGAAAAGATTCTCACCAAAAATGAATGGA GGGAGCTTAAACAGTCTTGCCAAGAAATAATTTA >GCiWno1023_j03.g1 CHROMAT_FILE: GCiWno1023_j03.g1 PHD_FILE: GCiWno1023_j03.g1.phd.1 CHEM: term DYE: big TIME: Fri Jan 4 10:46:23 2002 TEMPLATE: GCiWno1023_j03 DIRECTION: rev Length = 844 Score = 36.7 bits (83), Expect(2) = 6e-04 Identities = 14/30 (46%), Positives = 24/30 (79%) Frame = +1 Query: 37 DQDGVGLTNDEINDEVITFFSAGHETVSTG 66 D++G+GL++ EI +EV TF + GH+T ++G Sbjct: 145 DENGIGLSDVEIENEVDTFLNEGHDTTASG 234 Score = 26.6 bits (57), Expect(2) = 6e-04 Identities = 11/13 (84%), Positives = 12/13 (91%) Frame = +2 Query: 24 KRLDFLDILLHTK 36 K +DFLDILLHTK Sbjct: 32 KYIDFLDILLHTK 70 >GCiWno1023_j03.b1 this seq = seq 151, 152 error in 151? Or adjacent gene? CATTTCTGTGGCTGTATTATAACGCAAGTGATATTCTAGCCAATCTATAGTCACCAAAATTGGCTTAAACCGCACTTCGT TAAACGACGCAACACTCGGCTGCCGTCATGCGGTTAGGAAAATTGAGTTATTCCAGATTTAAAACGTGTTTTTTCGTGAA CAACTGGTATTGATATAAAAAATATAAAACGCGATAGGCCTAATATTTTAAATGAAAATATTTTAAACTTCACCAATAAA TATAAAAAGGCAATATCGGCAGAAGTGTTCACAAACAAAACACATAGCGAAGCTTGCTATATTACAACAGCATTGCAACA CCCTATTGTAAATTACGACCGTGATTTTACCTTGAACCTGCCGAGAAAGGAAGGAAGGCGTGAGGCGACCGTTTCTTTAT GTTGTCCTGGGTAAATCGATCTGGGTTAAAAACCTGTGATATATTGTAGTGTTATTGTTAAGTAAGTTAATTCGCCAAAA ACAAGCTTTTCGTTGCTTTAAACCCCCATACCTTGTGATTATATTAACCTTATGATTTCTTATAGTTATCGTTTTATATT TGACGTGTAAGATGGGATAGTGTTAACGCCTATACATGAAAATGTCTTTGTTTATTACCAAATGGAACGAGAAAATAGAA AGAAACGTTCCCCATCTTGCCCCACCTTTCTATATAAATTTCCCTTTCCGAGAGATTAATAAAAAAAACAACTAAGCCCT GTCGCTAACAAGGTGAATTAAAAGTTTAATTTTACAGCAGCGTAAATGAACTATGTACCTACCTCAATTTCGGGAGAATT TAATAATATAGTAAACTGGGGGGAAGAAAGGAACTTCTTAACCAATAATA >GCiWno1023_j03.g1 this seq = seq 152 AGATTCAGCTCGGTACCGTTACAGGAAAGGAAAATATATTGACTTTCTGGACATTTTGCTGCATACTAAAGTAAGTAAAA CGCACTTATGTACACATAAAGTGTTGCCTTATACGTTTTCAACTAAAAAAGAACATTTTTCTAGGACGAAAATGGAATAG GACTTTCAGATGTGGAAATTGAAAACGAGGTTGATACGTTTTTAAACGAAGGACATGATACTACAGCAAGCGGTAATGAG TGAATAAATTAAACTTATTTTATTCTAGTGTGAGGGGGAAAACGGCGGTCGGTATAACCATAGTATACTGAAGTGACTTC AGTATACTATGGTATAACACGGGAATTGTTATTCAGACCACTCGTTGCCGCTTTCCAGTTATACACCGTATATTGTGGAG GAATTTGCTTTTTAATTTTTTCGCTTATTGGCGCCACTTTAAAAAGCGCACGTTGGATATAGAATGTAAAAATAATATAA TAATGCATTGGGAAGAAGGACACCTTTAGTACATAATTATTATCCAAACATCCTGATCGTGTTTTAAACAATTAACAACG GTCTATGGGAGTTGCGATGATACAGTTTTATAATTTTTCAAATGCTTTTTGTTTTCTACCAAATGGGACGGTAAAATGGG AAAAGGTGTTCCATCTTCTCCCACCCTGTTATGTATAAAATTTAACCTATTATAAATAAGTAACATACGTGATGTGAATC TTCCTAATGACGGTAAACTCCAGGCATCTTCATGGTCGTTGTACATGGTGGCTCAACCTCCCGAATATCAACAAAATGCA GAGACCAACTANAAGAAAGTCTGGAAAAACAAGAAAAACATTGT Region before I-helix with part of seq 129 for fill KKVIRERRKTLENRKFEEESSGKKRLDFLDILLHTKDQDGVGLTNDEINDEVITFFSAGHETV STGIAWALYNLAVNVDCQDKCREELKSVVGDKENIEW >SEQUENCE 146 related but different can aid in identifying the N-term MLLPDYLEFSLSLYSIGAVCVVVFLYKSRKLIGRFLKERRIRKELTKEIDGPQPHWLFGHLNL LQPNEETILKTCEQTQKYPKLGMVWFGPALAYLMVFHPHVVRPVLNVE HPKDNLAYRFIKPWIGDGLLVSHGSKWRRNRHLLTKAFHFDILK QYTKVFDACCKTMLEKWSRKCDGSTVEVFRPVSLMTLDSMLQCAIS 338 LSKLPFVTMFIKEVLRLYPPVFAVARRTEQPVKFP 533 >GCiWno581_b24.b1 CHROMAT_FILE: GCiWno581_b24.b1 PHD_FILE: GCiWno581_b24.b1.phd.1 CHEM: term DYE: big TIME: Wed Oct 24 12:48:55 2001 TEMPLATE: GCiWno581_b24 DIRECTION: fwd Length = 903 Score = 106 bits (261), Expect = 1e-22 Identities = 50/53 (94%), Positives = 51/53 (95%) Frame = -2 Query: 1 YTNVSNACVRVMLDKWSKKVGTSMEIYLDVNLMTLDTILQCAMSTKSNCQTER 53 YTNVSNACVRVMLDKWSKKVGTSMEIYLDVNLMTLDTILQCAMSTKS+CQ R Sbjct: 452 YTNVSNACVRVMLDKWSKKVGTSMEIYLDVNLMTLDTILQCAMSTKSDCQNRR 294 >GCiWno581_b24.b1 ATTGAAATGTGTGTTNTTTTTCACATAAGCTACATATTGATTTACTTATCCACGCACCGGAATAGCTTCATTAACTTGAC TGTAGGTTTGGAAGTGGCAACCATGGATAAGTTATAAGTTAAGTTCCCACCCAAGAGATAAGTTAAGTTCTCACCCACGA GAATATAAGTAACTAAACCAACCAAAAGTCATGTATGCTTATCCACACACTGCAATAGCTTCAGCAACTCGACTGTGGGC ATGGTAGCAGCACTAGCAAGTAGCAACTATGTATAGGCCACTTAAATAACTCACCTCCTATTTTGACAGTCACTTTTAGT TGACATAGCACATTGTAGTATGGTGTCTAATGTCATAAGGTTTACATCCAAGTAAATCTCCATTGATGTCCCCACTTTCT TGCTCCATTTATCCAGCATAACTCTTACACAAGCGTTAGATACATTGGTATACCTGTCAAACAGAAAGGCAAAACATAAT GTTCATGTTTAAAGGTTCATAGATTATAAATAAAATGCATTTGTATACTCAACACAGCAACAAAGATTGTATATTAAAAT TTGTATTCTTTCTTTTAACTTTTTGCAAGTGGCATGAGGTGTATGAAACAGAAAACCCATGTTATAACAACTGTTGTTGC CTACTATGCAAGGATAACACAAGTTCATCTTTTCCCTACAGGGCTTTGTGTTGAACTTGTTCAGATGGGGACAAGTTTGG CAGCCATCAGCATAGTAGAACAGAACTCACGGTTTAAGAATACTGAAATGAAATGCTGGGGTGAGTANTCGTCGGTTTCC CTGCCATTTTTTTCACTACTTGGAAGTACGCATCTCCATCCAGGATGAAAAAAACCTTTCCAGGTTGGTTTTAGGGCTGG TTAAAATTATTTAAAAATCCCTG For comp >CYP4T5 Scaffold_15094 Length = 4295 50% to 4B1 and 4A14 lower case = human Scaffold_9071 64% to 4a14 exon 12 Scaffold_8637 LKG81295.x1 exon 9 first 6 aa missing off the end LKG81295.y1 LKB129582.y1 exon 5 LKU50005.y1 exon 5 runs off end LKB5549.y1 exons 2 and 3 LKU98995.x1 part of exon 2 78% to CYP4T2 Dicentrarchus labrax 508 MEITRALVVLGWSHFYQLLALFCLAIVLYKLTVLLMLKRALIRNFESFPGPPGHWLFGNILE 693 (0) 902 FKQDGNDLDKLVKFGQKYPYCFPLWFGPFVCFLNIHHPEYVKTILAST 1045 (1) 1142 EPKDDLAYSFIQNWI 1186 (1) 1291 GNGLLVSQGQKWFRHRRLLTPGFHYDVLKPYVKLMAHSTKTML 1419 (0) 1673 DKWESYAKTNKPLEVFEYVSLMTLDTILNCAFSYDSNCQTER 1798 (2) 2267 KNTYIKAVYELSNLINLRFRIFPYHNDLIFYLSPHGFRYRKACMVAHSHT 2416 (1) 2521 EEVIKKRREALKKEKELERIQAKRNLDFLDILLFAK 2638 (0) 3171 DENQQGLLDEDIRAEVDTFMFEGHDTTASGISFLLYNLACHPKHQKLCRKEIMQVLHGKDTMDW 3362 (2) 3457 EDLNKIPYTTMCIKESLRMHPPVPGISRKTTKPITFFDGRTLPA 3588 (1) 392 ESRIGTSVFGIHRNASLWENPNV 457 (1) fdhwrflpenvskrsphafvpfsagpr NCIGQNFAMNEMKVVIAMTLLKYELLEEPTLKPKIIPRLVLRSLNGIHIKIKNANQN* >GCiWno112_f13.b1 GTGGGTCTAGCTGTTTCCGTAAAACGACGGCCGATCTGGTCATAGCTGTTTCCAGTAAAACGACGGCGCGTCATAGTCAT ATCTGAAAGCCGTATAGAACTACTCACCAGACGCTGGACAACAAAGTAATAGCAAGATCTGCGTGATGTATTACGACTTC ACTTATGTACGGACCAAACCAATTCACTGTCCAGACAGGTTTCTCAAAACTAGAAGCAACTCTCTTCATGAGACCTTCTT CATTTTGTGGAAACTGTTTAAAAAAAATATTTTGGATTAAAAAAATGTAAGTTTGAATACTTGCTTTTAAAGTACATTGT CCACTCTGTTAGTTTAGATTCAACAAACATAACTGAACTTAAATTTTAAGTAGAAGCAATTGTAATTAGTGTTTTGCCCT AATTAACACAAGTGAGCAGTATTAAGCCTTGAACCCAGTATCTTCTGGTTACAATACCAGAGCCAACAAATCAATGTAAC TTATTAATCCTAGTGTGGCAGGACAATGTTAGTCGTAATAACACAAGTATTCTACTTCTGTTTCATACACCTCGTGCACG CTTACAAGTTACCACATATCTTGCTTTGTGATTGATTTGTAAAAAATACTTTTAACATGCAAATAACTACACAGCACGTA CCATCTTAACACTCCCATACAACCAGTGTTTCTTTACTTCCCCAACACTCCTAGCTCGTTTCTTAGCATCCTGGTATCCT CTTACAGCAGGGATTATAAAACTCTTAATGGACACCACTATACATGCCACTAGTAAGAAGTCACCAACCGCAGTTGTGGG TACAATCCCGCCTACACTGGTCCAAGCCATTTTATCTGCCTTTACAAACATTTACAGGGATAAAATCATTATATAAGTAA CTTAAGTTCCCATTCCCAGGGATATAAACGGACCAACCAACCCATCGGNATGCCTGCTTATACCCATAACCTGGAATACC TTTAAAAAT >GCiWno112_f13.b1_4 IFKGIPGYGYKQAXRWVGWSVYIPGNGNLSYLYNDFIPVNVCKGR*NGLDQCRRDCTHNC GW*LLTSGMYSGVH*EFYNPCCKRIPGC*ETS*ECWGSKETLVVWEC*DGTCCVVICMLK VFFTNQSQSKICGNL*ACTRCMKQK*NTCVITTNIVLPH*D**VTLICWLWYCNQKILGS RLNTAHLC*LGQNTNYNCFYLKFKFSYVC*I*TNRVDNVL*KQVFKLTFF*SKIFFLNSF HKMKKVS*RELLLVLRNLSGQ*IGLVRT*VKS*YITQILLLLCCPASGE*FYTAFRYDYD APSFYWKQL*PDRPSFYGNS*TH >GCiWno112_f13.b1_5 F*RYSRLWV*AGXPMGWLVRLYPWEWELKLLI**FYPCKCL*RQIKWLGPV*AGLYPQLR LVTSY*WHV*WCPLRVL*SLL*EDTRMLRNELGVLGK*RNTGCMGVLRWYVLCSYLHVKS IFYKSITKQDMW*LVSVHEVYETEVEYLCYYD*HCPATLGLISYIDLLALVL*PEDTGFK A*YCSLVLIRAKH*LQLLLLKI*VQLCLLNLN*QSGQCTLKASIQTYIFLIQNIFFKQFP QNEEGLMKRVASSFEKPVWTVNWFGPYISEVVIHHADLAITLLSSVW*VVLYGFQI*L*R AVVLLETAMTRSAVVLRKQLDPX >GCiWno112_f13.b1_6 FLKVFQVMGISRHXDGLVGPFISLGMGT*VTYIMILSL*MFVKADKMAWTSVGGIVPTTA VGDFLLVACIVVSIKSFIIPAVRGYQDAKKRARSVGEVKKHWLYGSVKMVRAV*LFAC*K YFLQINHKARYVVTCKRARGV*NRSRILVLLRLTLSCHTRINKLH*FVGSGIVTRRYWVQ GLILLTCVN*GKTLITIAST*NLSSVMFVESKLTEWTMYFKSKYSNLHFFNPKYFF*TVS TK*RRSHEESCF*F*ETCLDSELVWSVHK*SRNTSRRSCYYFVVQRLVSSSIRLSDMTMT RRRFTGNSYDQIGRRFTETARPT >GCiWno112_f13.g1 ACTGGCCGTCTTTCTACTGAAAACACATTTTATACTTAATACTGTTCGTATAATTTGATACAGGGCAGGGGTTGTCTTGA TTGTTAGCCAAACAATACAAATATATAGTAATCATCACCAAAAAACACATACGTAGTAACTCGTAAGCAGGCACGAAGTG TACGAAACAGAACATCCTTGTTATAAAGATTGTCGCTGCCACCACGCAAGGATATATAAATCAGTTACATTCATTTATGT CTGTTGTTTCAGTTGTTGTTGAGCTTCAAGTCTGGCCTTTCACACAAGGTGTAAAACTTTTTAATATCCAAATTACATTG CATATCATACCAGCCGAGCTCGCTGCGCGAGACCACACAGTTTTCCTGCATTATGTTATCGTTTGGTTCTCCGGCATACC ATCTGGTTTGCTGTGGAGCTACCGGTGTCCAGTCATCCCATACCCATTCTCCTTCTTTATCTTTATCAGTCAACCCGATC CAGTATCTATTGCTGTTTACCTCCAGCTTGGCGTATTGGCTCGTAATATTCCTGCAGCATAAACGCATGTATAATGCATG CTGAGTAGTTTATGTCAGTTAGAGAACACCCGTGTTATAAACAGAACACTTTGGCTTGTAGTTACATATACGTAGTAACT CGTAAGCGTGAACGAAAGTGTGAAACTAAACACCCGTGTTATATAACGACTTTCGTTGCACCCGCACGCGAGAATAAATA GGTTCTCATTACAGTTACTTACACTCTAACAGTATGGGTCAATGTCTTCGTTTATTATCAAACCAACCACCCAACTGTTC ACAAGCATAAGGTTGCGGGACTATGGAATCGTTTTTATCTTGGTAGGAGCTTGGTATAAG >LQW212657.x1_1 NGSAAS*CHTWVCCVE*CLDLRYKILTSF**NLMLVT*LFIFHDWHRH*LAVCG*ADMTF GWFSHLYQCGCELG*LIYGCHFHAHSRVAEGIAAYGDKQA*RLVGLVVYILVDGNLLLQ* FNPCKCFV*ADKMAWTSVGGIVTTTAVGDFLLVACIVVVIKSI*IPGSKRIPGC*ETS*E CWGSEETLVVWECKDGTCCVVLRMSTQYSHNSITEHDMWYLVSVPRRV*HRTRILVYYAL H*LPHTTTTYIHRRSCVVPDNMRQATMPFSFGTHYPLLNSSSRSHHLHATQSHLTTLTSR HSTSPPPRPTTPLRPX >LQW212657.x1_2 TAVQLHNVIRGCVVWNSVLI*GIKY*QASNET*CWLLSCSFSMIGTGTNLQCVDKQT*LS VGLVIYISVGVNLDDLSMVATSMPTVELLKVLQHMGISRHDDWLVWSFISLWMGTYFYND LILVNVLYRQIKWLGPV*AGL*PQLRLVTSY*WHV*WLSLKVFESLVVRGYQDAKKRARS VGEVKKHWLYGS VKMVRAV*FSACPHSILTTQSQSTICGTL*ACHDVYDTELEYLCTTHY IDCHTRLLRTFIVAPVLYPTICVRLPCPSHSAPTTRS*TRRLALTTCTPHSPT*PHLRRD TPLLHPHGPQPHSAH >LQW212657.x1_3 RQCSFIMSYVGVLCGIVS*FEV*NIDKLLMKLDVGYLVVHFP*LAQALTCSVWISRHDFR LV*SFISVWV*TWMTYLWLPLPCPQSSC*RYCSIWG*AGMTIGWFGRLYPCGWELTFTMI *SL*MFCIGR*NGLDQCRRDCNHNCGW*LLTSGMYSGCH*KYLNPW**EDTRMLRNELGV LGK*RNTGCMGV*RWYVLCSSPHVHTVFSQLNHRARYVVPCKRATTCMTQNSNTCVLRTT LTATHDYYVHSSSLLCCTRQYASGYHALLIRHPLPAPKLVVSLSPPARHTVPLNHTYVAT LHFSTPTAHNPTPP >GCiWno812_i09.b1 CHROMAT_FILE: GCiWno812_i09.b1 PHD_FILE: GCiWno812_i09.b1.phd.1 CHEM: term DYE: big TIME: Thu Dec 6 14:21:21 2001 TEMPLATE: GCiWno812_i09 DIRECTION: fwd Length = 843 Score = 102 bits (251), Expect = 9e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -3 Query: 1 APKNNLVYGFFHPWIGDGLLTSSGRKWQRNRRLLTPAFHFSILKP 45 APKNNLVYGFFHPWIGDGLLTSSGRKWQRNRRLLTPAFHFSILKP Sbjct: 571 APKNNLVYGFFHPWIGDGLLTSSGRKWQRNRRLLTPAFHFSILKP 437 >GCiWno812_i09.b1 TTTTAGTTGACATAGCACATTGTAGTATGGTGTCTAATGTCATAAGGTTTACATCCAAGTAAATCTCCATTGATGTCCCC ACTTTCTTGCTCCATTTATCCAGCATAACTCTTACACAAGCGTTAGATACATTGGTATACCTGTCAAACAGAAAGGCAAA ACATAATGTTCATGTTTAAAGGTTCATAGATTATAAATAAAATGCATTTGTATACTCAACACAGCAACAAAGATTGTATA TTAAAATTTGTATTCTTTCTTTTAACTTTTTGCAAGTGGCATGAGGTGTATGAAACAGAAAACCCATGTTATAACAACTG TTGTTGCCTACTATGCAAGGATAACACAAGTTCATCTTTTCCCTACAGGGCTTTGTGTTGAACTTGTTCAGATGGGGACA AGTTTGGCAGCCATCAGCATAGTAGAACAGAACTCACGGTTTAAGAATACTGAAATGAAATGCTGGGGTGAGTAGTCGTC GGTTTCGCTGCCATTTTCTTCCACTACTTGTAAGTAACCCATCTCCAATCCAAGGATGAAAAAAACCATATACAAGGTTG TTTTTAGGGGCTGGATAAAAAGTAATATAAAAAAGTAACATGAATAGCATTATTTTTATTTCTTGTATTAGATATTAGAT TGAGTAGTAAAGATAAATACTTAAAATGCAAGCTTTTAAAGTGGTTTATTTACAAGATAGCCATGTTATAACTACACAGT GAACATGAGGTGTATCGTGTATGAATACGCCATGTCTGCCTGGTGTATAAAATGACACCAATAATATACCTCGACAGTGA GCATGAGGTGTATGAATACCACATGTTGTGTCTGGTGTTTAAA >GCiWno812_i09.b1_4 FKHQTQHVVFIHLMLTVEVYYWCHFIHQADMAYSYTIHLMFTV*L*HGYLVNKPL*KLAF *VFIFTTQSNI*YKK*K*CYSCYFFILLFIQPLKTTLYMVFFILGLEMGYLQVVEENGSE TDDYSPQHFISVFLNREFCSTMLMAAKLVPI*TSSTQSPVGKR*TCVILA**ATTVVITW VFCFIHLMPLAKS*KKEYKF*YTIFVAVLSIQMHFIYNL*TFKHEHYVLPFCLTGIPMYL TLV*ELCWINGARKWGHQWRFTWM*TL*H*TPYYNVLCQLK >GCiWno812_i09.b1_5 *TPDTTCGIHTPHAHCRGILLVSFYTPGRHGVFIHDTPHVHCVVITWLSCK*TTLKACIL SIYLYYSI*YLIQEIKIMLFMLLFYITFYP APKNNLVYGFFHPWIGDGLLTSSGRKWQRN RRLLTPAFHFSILKP*VLFYYADGCQTCPHLNKFNTKPCREKMNLCYPCIVGNNSCYNMG FLFHTPHATCKKLKERIQILIYNLCCCVEYTNAFYL*SMNL*T*TLCFAFLFDR YTNVSN ACVRVMLDKWSKKVGTSMEIYLDVNLMTLDTILQCAMSTKX >GCiWno812_i09.b1_6 LNTRHNMWYSYTSCSLSRYIIGVILYTRQTWRIHTRYTSCSLCSYNMAIL*INHFKSLHF KYLSLLLNLISNTRNKNNAIHVTFLYYFLSSP*KQPCIWFFSSLDWRWVTYK*WKKMAAK PTTTHPSISFQYS*TVSSVLLC*WLPNLSPSEQVQHKAL*GKDELVLSLHSRQQQLL*HG FSVSYTSCHLQKVKRKNTNFNIQSLLLC*VYKCILFIIYEPLNMNIMFCLSV*QVYQCI* RLCKSYAG*MEQESGDINGDLLGCKPYDIRHHTTMCYVN*X >GCiWno812_i09.b1 CHROMAT_FILE: GCiWno812_i09.b1 PHD_FILE: GCiWno812_i09.b1.phd.1 CHEM: term DYE: big TIME: Thu Dec 6 14:21:21 2001 TEMPLATE: GCiWno812_i09 DIRECTION: fwd Length = 843 Score = 102 bits (251), Expect = 4e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -3 Query: 1 APKNNLVYGFFHPWIGDGLLTSSGRKWQRNRRLLTPAFHFSILKP 45 APKNNLVYGFFHPWIGDGLLTSSGRKWQRNRRLLTPAFHFSILKP Sbjct: 571 APKNNLVYGFFHPWIGDGLLTSSGRKWQRNRRLLTPAFHFSILKP 437 Score = 39.9 bits (91), Expect = 0.022 Identities = 20/46 (43%), Positives = 26/46 (56%) Frame = -3 Query: 46 YVKLMAHSTKTMLDKWESYAKTNKPLEVFEYVSLMTLDTILNCAFS 91 Y + + MLDKW K +E++ V+LMTLDTIL CA S Sbjct: 139 YTNVSNACVRVMLDKWSK--KVGTSMEIYLDVNLMTLDTILQCAMS 8 >GCiWno812_i09.g1 TCAGCTCGACCATGCCCACAGTCGAGTTGCTGAAGGTATTGCAGCGTATGGGGATAAGCAGGCATGACGATTGGTTGGTT TGGTCGTTTATATCCTTGTGGATGGGAACTTAAGTTACTTATATAATGATTTAATCCTTGTAAATGTTTTGTATAGGCAG ATAAAATGGCTTGGACCAGTGTAGGCGGGATTGTAACCACAACTGCGGTTGGTGACTTCTTACTAGTGGCATGTATAGTG GTTGTCATTAAGAGTTTTATAATCCCTGCTGTAAGAGGATACCAGGATGCTAAGAAACGAGCTAGGAGTGTTGGGGAAGT AAAGAAACACTGGTTGTATGGGAGTGTTAAGATGGTACGTGCTGTGTAGTTATTTGCATGTTAAAAGTATTTTTTACAAA TCAATCACAAAGCAAGATATGTGGTAACTTGTAAGCGTGCACGAGGTGTATGAAACAGAAGTAGAATACTTGTGTTATTA CGACTAACATTGTCCTGCCACACTAGGATTAATAAGTTACATTGATTTGTTGGCTCTGGTATTGTAACCAGAAGATACTG GGTTCAAGGCTTAATACTGCTCACTTGTGTTAATTAGGGCAAAACACTAATTACAATTGCTTCTACTTAAAATTTAAGTT CAGTTATGTTTGTTGAATCTAAACTAACAGAGTGGACAATGTACTTTANAAGCAAGTATTCAAACTTACATTTTTTTAAT CCAAAATATTTTTTTTAAACAGTTTCCACAAAATGAAGAAGGTCTCATGAAGAGAGTTGCTTCTAGTTTTGAGAAACTGT CTGGACAGTGGAATTGNNTTGGTCCGTACATAAGTGAAGTCGTAATACATCACGCAGATCTTGCTATTA >LQW197010.y1 >lcl|LQW197010.y1 CHROMAT_FILE: LQW197010.y1 PHD_FILE: LQW197010.y1.phd.1 CHEM: term DYE: ET TIME: Wed Aug 22 13:29:01 2001 TEMPLATE: LQW197010 DIRECTION: rev CTGAGCCTGAACCCANCTCNTGCATGCTTACAAGTTACACATATCTTGCTTTGTGATTGATTTGTAAAAATACTTTTAAC ATGCAAATAACTACACAGCACGTACCATCTTAACACTCCCGATAGAACCAGTGTTTCTTCACTTCCCCAACACTCCTAGC TCGTTTCTTAGCATCCTGGTATCCTCTTACAGCAGGGATTAAAAAACTTTTAATGACAACCACTATACATGCCACTAGTA AGAAGTCACCAACCGCAGTTGTGGTTACAATCCCGCCTACACTGGTCCAAGCCATTTTATCTGCCTATACAAAACATTTA CAAGGATTAAATCATTGTAAAAGTAAGTTCCCATCCACAAGGATATAAACGACCAAACCAACCAATCGTCATGCCTGCTT ATCCCCATATGCTGCAATACCTTCAGCAACTCGACTGTGGGCATGGAAGTGGCAACCATAGATAAGTCATCCAAGTTCAC ACCCACACTGATATAAATGACTAAACCAACCGAAAGTCATGTCTGCTTATCCACACACTGCAAGTTAGTGCCTGTGCCAA TCATGGAAAATGAACAACTAAGTAAACCAACATCAAGTTTCATTAGAAGCTTGTCAATATTTTATACCTCAAATCAAGAC ACTATTCCACACAACACACCCACGTATGACATTATGCAATACAAGTATACCTATTTGCACAGCATTGCACACATTTGCTT GCCATGATTAGAACAGGCGTAACCGGTACCGGTTGCAAACATGTGCTCACATCTGTATTATCAGCTCTGTCACAACTAAC GGTGCAGCACTATCATGTAACTCTTATCGTCGGCGCATGGTGGTATATGGTGCTATTGCCCACATAGACGTGGAACCGAA TCTAAGTTACGGAAATACCCTTTCCTTCGAACAATCATAGGGGAATTCCGAACGCCGTACCCTCGGTCCAGTTCACCAGT ATCCCTCATAGGAAGCGACATTATAAAGCATAGGAGAAATG >LQW197010.x1 >lcl|LQW197010.x1 CHROMAT_FILE: LQW197010.x1 PHD_FILE: LQW197010.x1.phd.1 CHEM: term DYE: ET TIME: Wed Aug 22 13:28:02 2001 TEMPLATE: LQW197010 DIRECTION: fwd GAGGCAGGGTTGTCTTGATTGTTAGCCAAACAATACAAATATATAGTAATCATCACCAAAAAACACATACGTAGTAACTC GTAAGCAGGCACGAAGTGTACGAAACAGAACATCCTTGTTGTAAAGATTGTCGCTGCCACCACGCAAGGATATATAAATC AGTTACATTCATTTATGTCTGTTGTTTCAGTTGTTGTTGAGCTTCAAGTCTGGCCTTTCACACAAGGTGTAAAACTTTTT AATATCCAAATTACATTGCATATCATACCAGCCGAGCTCGCTGCGCGAGACCACACAGTTTTCCTGCATTATGTTATCGT TTGGTTCTCCGGCATACCATCTGGTTTGCTGTGGAGCTACCGGTGTCCAGTCATCCCATACCCATTCTCCTTCTTTATCT TTATCAGTCAACCCGATCCAGTATCTATTGCTGTTTACCTCCAGCTTGGCGTATTGGCTCGTAATATTTCTGCAGCATAA ACGCATGTATAATGCATGCTGAGTAGTTTATGTCAGTTAGAGAACACCCGTGTTATAAACAGAACACTTTGGCTTGTAGT TACATATACGTAGTAACTCGTAAGCGTGAACGAAAGTGTGAAACTAAACACCCGTGTTATATAACGACTTTCGTTGCACC GCCACGCGAGAATACATAGGTCCCATTACAGTTACTTACACTCTAACAGTATGGTCATTTCTCCGTATATAATAACCAGC CACCAAGTCTTCAAAGCATCAGTGCGGGACTAGAATCGGTTATCTGGTAGAGGTTGTTTAGTATCGTCCCAGGTGGACCA ATGCTCCAATTACCGGGATAATGACGTATACCTCATGTGGGAAGCAGAGGTTACAGCGTGACATAAGGGACCCGGTAAGT TAAAGCTATACCGGCAGGAAAAACTTCCGGTGCCAGCCACGAAGAAGGAAAACTATGAGGCACCATAATAA >LQW212657.x1_1 NGSAAS*CHTWVCCVE*CLDLRYKILTSF**NLMLVT*LFIFHDWHRH*LAVCG*ADMTF GWFSHLYQCGCELG*LIYGCHFHAHSRVAEGIAAYGDKQA*RLVGLVVYILVDGNLLLQ* FNPCKCFV*ADKMAWTSVGGIVTTTAVGDFLLVACIVVVIKSI*IPGSKRIPGC*ETS*E CWGSEETLVVWECKDGTCCVVLRMSTQYSHNSITEHDMWYLVSVPRRV*HRTRILVYYAL H*LPHTTTTYIHRRSCVVPDNMRQATMPFSFGTHYPLLNSSSRSHHLHATQSHLTTLTSR HSTSPPPRPTTPLRPX >LQW212657.x1_2 TAVQLHNVIRGCVVWNSVLI*GIKY*QASNET*CWLLSCSFSMIGTGTNLQCVDKQT*LS VGLVIYISVGVNLDDLSMVATSMPTVELLKVLQHMGISRHDDWLVWSFISLWMGTYFYND LILVNVLYRQIKWLGPV*AGL*PQLRLVTSY*WHV*WLSLKVFESLVVRGYQDAKKRARS VGEVKKHWLYGS VKMVRAV*FSACPHSILTTQSQSTICGTL*ACHDVYDTELEYLCTTHY IDCHTRLLRTFIVAPVLYPTICVRLPCPSHSAPTTRS*TRRLALTTCTPHSPT*PHLRRD TPLLHPHGPQPHSAH >LQW212657.x1_3 RQCSFIMSYVGVLCGIVS*FEV*NIDKLLMKLDVGYLVVHFP*LAQALTCSVWISRHDFR LV*SFISVWV*TWMTYLWLPLPCPQSSC*RYCSIWG*AGMTIGWFGRLYPCGWELTFTMI *SL*MFCIGR*NGLDQCRRDCNHNCGW*LLTSGMYSGCH*KYLNPW**EDTRMLRNELGV LGK*RNTGCMGV*RWYVLCSSPHVHTVFSQLNHRARYVVPCKRATTCMTQNSNTCVLRTT LTATHDYYVHSSSLLCCTRQYASGYHALLIRHPLPAPKLVVSLSPPARHTVPLNHTYVAT LHFSTPTAHNPTPP MAWTSVGGIVTTTAVGDFLLVACIVVVIKSFLIPAVRGYQDAKKRARSVGEVKKHWFYGSVKMVRA >GCiWno112_f13.b1 CHROMAT_FILE: GCiWno112_f13.b1 PHD_FILE: GCiWno112_f13.b1.phd.1 CHEM: term DYE: big TIME: Tue Sep 11 23:08:21 2001 TEMPLATE: GCiWno112_f13 DIRECTION: fwd Length = 969 Score = 46.1 bits (107), Expect = 8e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 1 DAKKRARSVGEVKKHWLYGS 20 DAKKRARSVGEVKKHWLYGS Sbjct: 710 DAKKRARSVGEVKKHWLYGS 651 >GCiWno812_i09.g1 CHROMAT_FILE: GCiWno812_i09.g1 PHD_FILE: GCiWno812_i09.g1.phd.1 CHEM: term DYE: big TIME: Wed Dec 5 19:47:10 2001 TEMPLATE: GCiWno812_i09 DIRECTION: rev Length = 869 Score = 46.1 bits (107), Expect = 8e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 1 DAKKRARSVGEVKKHWLYGS 20 DAKKRARSVGEVKKHWLYGS Sbjct: 286 DAKKRARSVGEVKKHWLYGS 345 LQW212657.y1 LQW212657.y1.phd.1 LQW212657.x1 13:48:15 2001 TEMPLATE: LQW212657 DIRECTION: rev Length = 1022 Score = 106 bits (263), Expect = 2e-23 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 1 YIEAVHDVSKYIMSRVHKPLLHIDWIYWLTAEGRKFKQLVKVLHDQSEK 49 YIEAVHDVSKYIMSRVHKPLLHIDWIYWLTAEGRKFKQLVKVLHDQSEK Sbjct: 731 YIEAVHDVSKYIMSRVHKPLLHIDWIYWLTAEGRKFKQLVKVLHDQSEK 585 >LQW212657.y1 >lcl|LQW212657.y1 CHROMAT_FILE: LQW212657.y1 PHD_FILE: LQW212657.y1.phd.1 CHEM: term DYE: ET TIME: Wed Aug 22 13:48:15 2001 TEMPLATE: LQW212657 DIRECTION: rev ATGAGCCTGGTACCCGTAAACTTTTACAAATTTGTTATTTTCTTATAATTTTCCCACAATCTTATTCAAAAAAAGTATTG TGACATCATAACCACCATTGTTACAAAACAAACAAACCTTTGTATGCAAGAGAATATCAAGAAAATCCAGGCGTTTCTTC CCAGAACTTTCTTCTTCAAATTTCCTATTTTCCAAAGGTTTTTCTCCGTTCTCTGATTACCTTTTTATTTAAGATAAAAA TACCGTCATTAACCTTTTTAAATTTTTTTTACTTCAACTAAGCTCTCTTAAAATGTAGATAGATCATTTATTTTTTATCC ATCTATAGTATTTTAAATTGTAATTTAATATTTTTTTCTACACTTTTTTAAAGGTTCTTATTGCTTTCTAAATGAAGTTT CACAGTACACTATGAAATATAATGAAGTGATTTACAACATAGTTACTCATTACCCTGTTAATTATTATTATTCATTTATT AATTTTAAATATTAACTTTAATATTCCATTTATTAAAACTTCAGTACATAAATAAGAAATAGTTCAAATATTCAATGCAA GTTTATAGATATAAGATATTATACCTTTTCTGATTGATCGTGCAGAACTTTTACTAACTGTTTAAACTTTCTTCCTTCAG CGGTGAGCCAGTATATCCAGTCAATATGAAGCAAAGGTTTATGGACTCGCGACATAATGTATTTGGAAACATCATGAACT GCTTCAATGTATTCGTTCTTCTTACTGTCAATCAAACGCAATAAGTGACTCTCTTAGTAAGTCCATCTTATAAACGTGTT GTCACCTTTGTGTACATCGTGGATGATCAGGCCATAGTCGAAAGGGTAAATCTTTTTATAACTGCTGGATTTGACATTCT TTGAATGGTGTCTACATAGCCAATGGGTGTATCACCCGGAAGACTACATCCGGCGCGGGGGCGGAAATACTTGGCCCAGA AGATTCCCCAAATAATCAAGTGTCCACAGAACGGGGAGAACATGATCCGGACAGGTGGCCTT >LQW212657.x1 >lcl|LQW212657.x1 CHROMAT_FILE: LQW212657.x1 PHD_FILE: LQW212657.x1.phd.1 CHEM: term DYE: ET TIME: Wed Aug 22 13:10:56 2001 TEMPLATE: LQW212657 DIRECTION: fwd AACGGCAGTGCAGCTTCATAATGTCATACGTGGGTGTGTTGTGTGGAATAGTGTCTTGATTTGAGGTATAAAATATTGAC AAGCTTCTAATGAAACTTGATGTTGGTTACTTAGTTGTTCATTTTCCATGATTGGCACAGGCACTAACTTGCAGTGTGTG GATAAGCAGACATGACTTTCGGTTGGTTTAGTCATTTATATCAGTGTGGGTGTGAACTTGGATGACTTATCTATGGTTGC CACTTCCATGCCCACAGTCGAGTTGCTGAAGGTATTGCAGCATATGGGGATAAGCAGGCATGACGATTGGTTGGTTTGGT CGTTTATATCCTTGTGGATGGGAACTTACTTTTACAATGATTTAATCCTTGTAAATGTTTTGTATAGGCAGATAAAATGG CTTGGACCAGTGTAGGCGGGATTGTAACCACAACTGCGGTTGGTGACTTCTTACTAGTGGCATGTATAGTGGTTGTCATT AAAAGTATTTGAATCCCTGGTAGTAAGAGGATACCAGGATGCTAAGAAACGAGCTAGGAGTGTTGGGGAAGTGAAGAAAC ACTGGTTGTATGGGAGTGTAAAGATGGTACGTGCTGTGTAGTTCTCCGCATGTCCACACAGTATTCTCACAACTCAATCA CAGAGCACGATATGTGGTACCTTGTAAGCGTGCCACGACGTGTATGACACAGAACTCGAATACTTGTGTACTACGCACTA CATTGACTGCCACACACGACTACTACGTACATTCATCGTCGCTCCTGTGTTGTACCCGACAATATGCGTCAGGCTACCAT GCCCTTCTCATTCGGCACCCACTACCCGCTCCTAAACTCGTCGTCTCGCTCTCACCACCTGCACGCCACACAGTCCCACT TAACCACACTTACGTCGCGACACTCCACTTCTCCACCCCCACGGCCCACAACCCCACTCCGCCCAC >GCiWno348_j03.g1 CHROMAT_FILE: GCiWno348_j03.g1 PHD_FILE: GCiWno348_j03.g1.phd.1 CHEM: term DYE: big TIME: Fri Oct 5 11:45:35 2001 TEMPLATE: GCiWno348_j03 DIRECTION: rev Length = 682 Score = 38.7 bits (88), Expect = 0.012 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 1 KKVIRERRKTLENRKFEEE 19 KKVIRERRKTLEN KFEEE Sbjct: 129 KKVIRERRKTLENSKFEEE 73 >GCiWno348_j03.g1 TGGCCGTCGATCTCTGGAAACAGCTTGACATGACTGGACGATGATAACTGGAAGCGTTATTACCCTGAACTGTTCTTCTT CAAATTTGCTATTTTCCAAAGTTTTTCTCCGTTCTCTGATTACCTTTTTATTTAAGATAAAAATACGGTCATTAACCTTT TTAAATTTTTTTTTACTTCAACTAAGCTCTCTTAAAATGTAGATAGATCATTTATTTTTTATCCATCTATAGTATTTTAA AGTTTCACAGTACACTATGAAATATAATGAAGTGATTTACAACATAGTTACTCATTACCCTGTTAATTATTATTATTCAT TTATTAATTTTAAATATTAACTTTAATATTCCATTTATTAAAACTTCAGTACATAAATAAGAAATAGTTTAAATTTTCAA TGCAAGTTTATAGATATAAGATATTATACCTTTTCTGATTGATCGTGCAGAACTTTTACTAACTGTTTAAACTTTCTTCC TTCAGCAGTGAGCCAGTATATCCAGTCAATATGAAGCAAAGGTTTATGGACTCGCGACATAATGTATTTGGAAACATCAT GAACTGCTTCAATGTATTCGTTCTTCTTACTGTCAATCAAACACAATAAGTGACTAACTTAGTAAGTCCTATCGTTATTA ACGTGTTGTCAACTTTATGTGTAAAATCGTTATGATGATTCA >GCiWno348_j03.g1_4 ESS*RFYT*S*QHVNNDRTY*VSHLLCLIDSKKNEYIEAVHDVSKYIMSRVHKPLLHIDW IYWLTAEGRKFKQLVKVLHDQSEKV*YLISINLH*KFKLFLIYVLKF**MEY*S*YLKLI NE***LTG**VTML*ITSLYFIVYCETLKYYRWIKNK*SIYILRELS*SKKKFKKVNDRI FILNKKVIRERRKTLENSKFEEEQFRVITLPVIIVQSCQAVSRDRRP >GCiWno348_j03.g1_5 *IIITILHIKLTTR**R*DLLS*SLIVFD*Q*EERIH*SSS*CFQIHYVASP*TFASY*L DILAHC*RKKV*TVSKSSARSIRKGIISYIYKLALKI*TISYLCTEVLINGILKLIFKIN K*IIIINRVMSNYVVNHFIIFHSVL*NFKIL*MDKK*MIYLHFKRA*LK*KKI*KG**PY FYLK*KGNQRTEKNFGK*QI*RRTVQGNNASSYHRPVMSSCFQRSTAX >GCiWno348_j03.g1_6 NHHNDFTHKVDNTLITIGLTKLVTYCV*LTVRRTNTLKQFMMFPNTLCRESINLCFILTG YTGSLLKEESLNS**KFCTINQKRYNILYL*TCIENLNYFLFMY*SFNKWNIKVNI*N** MNNNN*QGNE*LCCKSLHYIS*CTVKL*NTIDG*KINDLSTF*ESLVEVKKNLKRLMTVF LS*IKR*SENGEKLWKIANLKKNSSG**RFQLSSSSHVKLFPEIDGX >LQW158098.x1_4 QTLFRSKPLLI*LISGSPLRKKVKQLVKVLHDQSEKV*YLISINLH*IFELFLIYVLKF* *MEY*S*YLKLINE***LTG**VTML*ITSLYFIVYCETSFRKQ*EPLKKCRKKY*ITI* NTIDG*KINDLSTF*ESLVEVKKI*KG**RYFYLK*KGNQRTEKNFGK*EI*RRKFWEET PGFS*YSLAYKGLFVL*QWWL*CHNTFFE*DCGKIIRK*QFGKSFRNLQQIVLFTKLTLR LADELGKYTSFFNFFSDMRCYYSVTNKIYLLXCRF >LQW158098.x1_5 PNIIPIQTVAHMTDIWLTPKEES*TVSKSSARSIRKGIISYIYKLALNI*TISYLCTEVL INGILKLIFKINK*IIIINRVMSNYVVNHFIIFHSVL*NFI*KAIRTFKKV*KKILNYNL KYYRWIKNK*SIYILRELS*SKKNLKRLMTVFLS*IKR*SENGEKLWKIGNLKKKVLGRN AWIFLIFSCIQRFVCFVTMVVMMSQYFF*IRLWENYKKITIW*KFQEFATNCLVYQVDAS SGRRTGKIHFVF*LFF*YEMLLLCYKQNLLAALPFX >LQW158098.x1_6 KHYSDPNRCSYD*YLAHP*GRKLNS**KFCTINQKRYNILYL*TCIEYLNYFLFMY*SFN KWNIKVNI*N**MNNNN*QGNE*LCCKSLHYIS*CTVKLHLESNKNL*KSVEKNIKLQFK IL*MDKK*MIYLHFKRA*LK*KKFKKVNDGIFILNKKVIRERRKTLENRKFEEESSGKKR LDFLDILLHTKVCLFCNNGGYDVTILFLNKIVGKL*ENNNLVKVSGICNKLSCLPS*RFV WQTNWENTLRFLTFFLI*DVITLLQTKFTCCXAVX >_1 YGQGSC*LLCCPALVRIHKTFLSYSYTPLLSYNIVVFLNTRHTCCIHTPHAHCRGILLVS FYTPGRHGVFIHDTPHVHCVVITWLSCK*TTLKDCILSIYLYYSI*YLIQEIKIMLFMLL FYITFYPAPKNNLVYGFIHPWIGDGLLTSSGRKWQRNRHLLTPAFHFSILKP*DLFYYAD GCQTCHHLNKFNTKPCREKMNLCHPCIIGNNSCYNIGVLFHTPYITANTSNK**N*IYNF VDGEYKCYIITITLTDLCCLRWQNPEQSE*IAEMTQGQQGQ*ELNNQQEAKRHGQATKSN QSRVQREQKRX >_2 TARAAADYFVVQLW*EYIKLFYHTHTPHC*ATILLFS*TPDTHVVFIHLMLTVEVYYWCH FIHQADMAYSYTIHLMFTV*L*HGYHVNKPL*KIAF*VFIFTTQSNI*YKR*K*CYSCYF FILLFIQPLKTTLYMVLFILGLEMGYLQVVEENGSETDIYSPQHFISVFLNREICSTMLM AAKLVTI*TSSTQSPVGKR*TCVILA**ATTVVIT*VYCFIHLISLQTRQINNKIKYTTL *TVSINAI**LSL*LTYVALGGRIQNKASK*RK*HRGNKDNEN*ITSRKQSATDRPRKAT NHAYNANRNGX >_3 RPGQLLITLLSSSGENT*NFFIILIHPTVKLQYCCFLKHQTHMLYSYTSCSLSRYIIGVI LYTRQTWRIHTRYTSCSLCSYNMAIM*INHFKRLHFKYLSLLLNLISNTRDKNNAIHVTF LYYFLSSP*KQPCIWFYSSLDWRWVTYK*WKKMAAKPTSTHPSISFQYS*TVRSVLLC*W LPNLSPSEQVQHKAL*GKDELVSSLHNRQQQLL*HRCTVSYTLYHCKHVK*IIKLNIQLC RR*V*MLYNNYHFN*PMLP*VAESRTKRVNSGNDTGATRTMRTK*PAGSKAPRTGHEKQP ITRTTRTETD >LQW158098.y1_3 SLDRNTGLYGSVKMVRAV*LFAC*KYFYKSITKQDMW*LVSVHEVYETEVEYLCYYD*HC PATLGLISYIHSLALVL*PEDTGFKA*YCSLVLIRAKH*LQLLLLKI*VQLCLLNLN*QS GQCTLKASIQTYFFLIQSNFFKQFPQNEEGLMKRVASSFEKPVWTVNWFGPYISEVVIHH ADLAITLLSSSGEDT*SFFIIPIHPTVKLQYCCFLKHQTHMLYSYTSCSLSRYIIGVFYT PGRHGVFIHDTPHVTV*FYMPISNNHLKLLQVYLTIIYLSEKICSVFNYFQPKTVWFPGG GPLEMARYHLETVKGSLKGNSGS >r_GECi37_l17 Length = 851 Score = 181 bits (455), Expect = 2e-45 Identities = 80/81 (98%), Positives = 80/81 (98%) Frame = -2 Query: 1 LLCCPALVRIHKTFLSYSYTPLLSYNIVVFLNTRHTCCIHTPHAHCRGILLVSFYTPGRH 60 LLCCPALVRIHKTFLSYSYT LLSYNIVVFLNTRHTCCIHTPHAHCRGILLVSFYTPGRH Sbjct: 319 LLCCPALVRIHKTFLSYSYTSLLSYNIVVFLNTRHTCCIHTPHAHCRGILLVSFYTPGRH 140 Query: 61 GVFIHDTPHVHCVVITWLSCK 81 GVFIHDTPHVHCVVITWLSCK Sbjct: 139 GVFIHDTPHVHCVVITWLSCK 77 LQW250581.y1 LQW250581.y1.phd.1 LQW250581.x1 11:07:29 2001 TEMPLATE: LQW250581 DIRECTION: rev Length = 1029 Score = 81.9 bits (199), Expect = 7e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +3 Query: 1 RSKLKEPNETTIDAHSNIALHIFTLHRNVHVWDSPEV 37 RSKLKEPNETTIDAHSNIALHIFTLHRNVHVWDSPEV Sbjct: 588 RSKLKEPNETTIDAHSNIALHIFTLHRNVHVWDSPEV 698 >LQW250581.y1 >lcl|LQW250581.y1 CHROMAT_FILE: LQW250581.y1 PHD_FILE: LQW250581.y1.phd.1 CHEM: term DYE: ET TIME: Mon Aug 27 11:07:29 2001 TEMPLATE: LQW250581 DIRECTION: rev GGGGGACTCGAAACTCGANGNCTGNNGTTANCCNNAANNTGNTGNGAGGTNTGTTCTAATNNGACAAANTGTCGGGAAGA ATTGAAAAGTGTGGTTGGTGATAAGAGAATATTGAATGGTGAGATTGATATGCTGGAACTACAGTTAATATATAGGTGCA ATGTCTTGGTAGTAAGCATGAGGTGTATGAGTACACCATGTGTGTCTGGTGTATAAGAAGACACCCATGTTATAGCTTGA CAGTGAGCATGAGGTGTATAAGAAGACACCCATGTTATAGCTTGACAGTGAGCATGAGGTGTATGAATACACCGTGCATG TCTGGTGTGTAAGAAGACACCCACGATATATTATAACTCAACAGTGAGCATGAGGTGTATGAATACACCATGTGTCTCTT ATATATAAACAGACACCTATGTTATAACTTGTATCCATAAATACAAATTCCAAAATAAATAAAGCAACTTACCCGCAGGG AGGATTTATCGAAGTTAAGTTATCTCACGTTATGCATCAAAGAAAGTCTTCGTTTATGTCCTCCTGTCCCATTTATCGGA AGGGAACTAAATGAACCACTCAAGTTCCGAAGCAAACTTAAAGAACCAAATGAAACAACGATTGACGCACACTCGAACAT CGCGCTTCACATTTTTACACTGCATAGGAATGTTCATGTCTGGGACTCTCCTGAGGTAAGAATATATCATCTATTTTAAA GTTGCAAAACATCGAAACTTAAATATCGATTGAAGCGCTATTGTATCATACCTGGTAAGCCGTAAGCGGCTCAATGTGTA TGACACAGTCTTTGCGTTATACGACTGTCGTCATTATCATTCAGCAGCTTAAGTACAGATAACTCTGACACAGATTGGCG ATTACCTGGCAGCCTGGGATATTAGGACTGAACTCGAGTCGACTTCAGTCACTTAAGAATCCAGAATTCCAAAAGTACGA ATATAGGAGCCCGCCACCTTCGGCCGAAAGCGGTTAAACCAAACGGGCCCATCACATTATGGCGTAAAC GTRNSXXXVXXXXXXGXF*XDKXSGRIEKCGW**ENIEW*D*YAGTTVNI*VQCLGSKHE VYEYTMCVWCIRRHPCYSLTVSMRCIRRHPCYSLTVSMRCMNTPCMSGV*EDTHDIL*LN SEHEVYEYTMCLLYINRHLCYNLYP*IQIPK*IKQLTRREDLSKLSYLTLCIKESLRLCP PVPFIGRELNEPLKFRSKLKEPNETTIDAHSNIALHIFTLHRNVHVWDSPEVRIYHLF*S CKTSKLKYRLKRYCIIPGKP*AAQCV*HSLCVIRLSSLSFSSLSTDNSDTDWRLPGSLGY *D*TRVDFSHLRIQNSKSTNIGARHLRPKAVKPNGPITLWRK savignyi ortholog to seq 148 69% vs 55% to the best intestinalis seq match best intestinalis match to C-term is seq 151 but his is not the ortholog to this seq because 148 and 151 overlap and are different 367 LTLRDDLSKLPYLTMCIKESLRLYPPVPFIGRELKEPLQFQSDFNKTKQTTIEAKSQVAL 546 547 HIFSLTENVHVWESP 591 EYNPERFNPENIKGRSPHAYLPFSAGPR (2?) NCIGQNFALNELKISIGQTIRRFKLYTDETTPKPIIKPALVLRPTNGIHIKFQTV* LQW156737.y1 = seq 110, 121 possible C-term based on match to savignyi seq LQW156737.y1.phd.1 LQW156737.x1 12:34:29 2001 TEMPLATE: LQW156737 DIRECTION: rev Length = 874 Score = 81.5 bits (198), Expect = 1e-15 Identities = 36/56 (64%), Positives = 46/56 (81%) Frame = +3 Query: 28 RNCIGQNFALNELKISIGQTIRRFKLYTDETTPKPIIKPALVLRPTNGIHIKFQTV 83 RNCIGQNFA+NE+KI+IGQT+RRFK+ DE++PKP I P +VLRP +GI IK + Sbjct: 528 RNCIGQNFAMNEMKIAIGQTLRRFKVIPDESSPKPSITPQVVLRPKDGIFIKLMKI 695 Score = 58.6 bits (139), Expect = 1e-08 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 1 EYNPERFNPENIKGRSPHAYLPFSAGPRNCIG 32 E+ PERF PEN+KGRSPHAYLPFSAGPR IG Sbjct: 235 EFIPERFKPENMKGRSPHAYLPFSAGPR*NIG 330 EFIPERFKPENMKGRSPHAYLPFSAGPR NCIGQNFAMNEMKIAIGQTLRRFKVIPDESSPKPSITPQVVLRPKDGIFIKLMKI LQW199395.x1 LQW199395.x1.phd.1 LQW199395.y1 13:54:53 2001 TEMPLATE: LQW199395 DIRECTION: fwd Length = 925 Score = 79.2 bits (192), Expect = 7e-15 Identities = 35/56 (62%), Positives = 45/56 (79%) Frame = +2 Query: 28 RNCIGQNFALNELKISIGQTIRRFKLYTDETTPKPIIKPALVLRPTNGIHIKFQTV 83 RNCIGQNFA+NE+KI+IGQT+R+FK+ DE+ PKP I P +VLRP +GI IK + Sbjct: 461 RNCIGQNFAMNEMKIAIGQTLRKFKVIPDESFPKPSITPQVVLRPKDGIFIKLMEI 628 Score = 58.6 bits (139), Expect = 1e-08 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 1 EYNPERFNPENIKGRSPHAYLPFSAGPRNCIG 32 E+ PERF PEN+KGRSPHAYLPFSAGPR IG Sbjct: 168 EFIPERFKPENMKGRSPHAYLPFSAGPR*NIG 263 >sequence 151 Length = 54 Score = 212 (74.6 bits), Expect = 1.4e-20, P = 1.4e-20 Identities = 36/52 (69%), Positives = 47/52 (90%) Query: 2 YNPERFNPENIKGRSPHAYLPFSAGPRNCIGQNFALNELKISIGQTIRRFKL 53 +NP+RF +NIK RSPHA+LPFSAG RNCIGQNFA+NE+KI++GQ IR+++L Sbjct: 3 FNPDRFTQDNIKKRSPHAFLPFSAGSRNCIGQNFAMNEMKIAVGQIIRKYEL 54 YTDETTPKPIIKPALVLRPTNGIHIKFQTV Y D T ALVLR TNGI IK YIDDDTPDTVMETALVLRSTNGIMIKIRKI comp to seq 121 end Query: 1 RNCIGQNFALNELKISIGQTIRRFKLYTDETTPKPIIKPALVLRPTNGIHIKFQTV 56 RNCIGQNFA+NE+KI+IGQT+RRFK+ DE++PKP I P +VLRP +GI IK + Sbjct: 527 RNCIGQNFAMNEMKIAIGQTLRRFKVIPDESSPKPSITPQVVLRPKDGIFIKLMKI 360 >scf/ciona01/G126/seq_dir/hrs/G126P602314F.T0/G126P602314FD11.T0.seq 730 file 16 Length = 730 Plus Strand HSPs: Score = 86 (30.3 bits), Expect = 3.6e-16, Sum P(3) = 3.6e-16 Identities = 15/16 (93%), Positives = 16/16 (100%), Frame = +2 Query: 13 KGRSPHAYLPFSAGPR 28 +GRSPHAYLPFSAGPR Sbjct: 197 RGRSPHAYLPFSAGPR 244 Score = 80 (28.2 bits), Expect = 3.6e-16, Sum P(3) = 3.6e-16 Identities = 14/14 (100%), Positives = 14/14 (100%), Frame = +1 Query: 1 EYNPERFNPENIKG 14 EYNPERFNPENIKG Sbjct: 160 EYNPERFNPENIKG 201 Score = 75 (26.4 bits), Expect = 3.6e-16, Sum P(3) = 3.6e-16 Identities = 14/14 (100%), Positives = 14/14 (100%), Frame = +3 Query: 28 RNCIGQNFALNELK 41 RNCIGQNFALNELK Sbjct: 489 RNCIGQNFALNELK 530 >scf/ciona01/G126/seq_dir/hrs/G126P602314F.T0/G126P602314FD11.T0.seq 730 0 730 ABI ACTGGCNGANNTACTGATTTCCATNNCGCCACTGGTGGTGGNNAATTCTT CATGTCTGGGNAATCCCCCAATGTGAGATATAAGTATTTTAAGTTTTAAA ATATATAATAGATGCCGGTGGTAGTATATCAAACCACGATCAGGGTGAAT TTTTTTCAGGAATACAACCCTGAGAGATTTAATCCAGAAAACATCAAGGG GGAGATCTCCACATGCTTATCTTCCATTTTCCGCGGGTCCAAGGTGAATT ACTTAGATATTAAAAAAACATATTCTGCGGGTATTACCAAATTATATTGA AGATATTTATTTAACTGAAACGGGTGTTTCAACTCATATTTATGATTTTT CGTTTTAAACTTGTGAGATTAAGCTGTGCTATATTTACTTTACGTTTTAC TTACTTTTTATCACATCCACGTCAATAAAAATAATCGTGTTCAGTCTACC GTTCAACACTAATTTTATGTTGGTTTATTTTTTCAATCAGAAACTGCATT GGTCAGAACTTTGCGTTGAATGAACTGAAGATTTCGATCGGACAAACGAT CCGCAGATTCAAGTTATACACGGATGAAACGACTCCAAAGCCGATTATCA AACCAGCCCTTGTGCTGCGACCAACAAATGGCATCCATATTAAATTTCAA ACCGTCTAAATACTTTAACTTTAATGTTATGCATCTTTTATACACNCAAA TTAATCTTGTGTTAACTCGCTGCAACTTAT >_1 TGXXTDFHXATGGGXFFMSGXSPNVRYKYFKF*NI**MPVVVYQTTIRVNFFQEYNPERF NPENIKGEISTCLSSIFRGSKVNYLDIKKTYSAGITKLY*RYLFN*NGCFNSYL*FFVLN L*D*AVLYLLYVLLTFYHIHVNKNNRVQSTVQH*FYVGLFFQSETALVRTLR*MN*RFRS DKRSADSSYTRMKRLQSRLSNQPLCCDQQMASILNFKPSKYFNFNVMHLLYTQINLVLTR CNLX >_2 LAXXLISXXPLVVXNSSCLGNPPM*DISILSFKIYNRCRW*YIKPRSG*IFFRNTTLRDL IQKTSRGRSPHAYLPFSAGPR*IT*ILKKHILRVLPNYIEDIYLTETGVSTHIYDFSF*T CEIKLCYIYFTFYLLFITSTSIKIIVFSLPFNTNFMLVYFFNQKLHWSELCVE*TEDFDR TNDPQIQVIHG*NDSKADYQTSPCAATNKWHPY*ISNRLNTLTLMLCIFYTXKLILC*LA ATY >_3 WXXY*FPXRHWWWXILHVWXIPQCEI*VF*VLKYIIDAGGSISNHDQGEFFSGIQP*EI* SRKHQGGDLHMLIFHFPRVQGELLRY*KNIFCGYYQIILKIFI*LKRVFQLIFMIFRFKL VRLSCAIFTLRFTYFLSHPRQ*K*SCSVYRSTLILCWFIFSIRNCIGQNFALNELKISIG QTIRRFKLYTDETTPKPIIKPALVLRPTNGIHIKFQTV*IL*L*CYASFIHXN*SCVNSL QL >scf/ciona01/G126/seq_dir/hrs/G126P67434R.T0/G126P67434RE9.T0.seq 753 file 7 Length = 753 Plus Strand HSPs: Score = 108 (38.0 bits), Expect = 1.4e-05, P = 1.4e-05 Identities = 20/28 (71%), Positives = 21/28 (75%), Frame = +1 Query: 1 EYNPERFNPENIRGEISTCLSPFSAGPR 28 EYNPERFNPENI+G PFSAGPR Sbjct: 382 EYNPERFNPENIKGRSPHAYLPFSAGPR 465 >scf/ciona01/G126/seq_dir/hrs/G126P67434R.T0/G126P67434RE9.T0.seq 753 0 753 ABI AATTTTGACGCTGAAACTCCATGTGGTGGNAATTCAATACCATCATATAT ACTATATAAAAATGATTAACACTTAGGGACGATTTGAGCAAGCTGCCCTA TCTTACAATGTGCATCAAGGAAAGCTTACGTTTGTATCCACCTGTCCCGT TCATCGGACGTGAGCTAAAAGAACCGCTTCAGTTTCAAAGTGATTTCAAT AAGACGAAGCAGACAACAATTGAAGCAAAATCCCAAGTTGCTCTTCATAT TTTCTCACTGCACAGAAAACGTTCATGTCTGGGAATCCCCCAATGTGAGA TATAAGTATTTTAAGTTTTAAAATATATAATAGATGCCGGTGGTAGTATA TCAAACCACGATCAGGGTGAATTTTTTTCAGGAATACAACCCTGAGAGAT TTAATCCAGAAAACATCAAGGGGAGATCTCCACATGCTTATCTTCCATTT TCCGCGGGTCCAAGGTGAATTACTTAGATATTAAAAAAACATATTCTGCG GGTATTACCAAATTATATTGAAGATATTTATTTAACTGAAACGGGTGTTT CAACTCATATTTATGATTTTTCGTTTTAAACTTGTGAGATTAAGCTGTGC TATATTTACTTTACGTTTTACTTACTTTTTATCACATCCACGTCAATAAA AATAATCGTGTTCAGTCTACCGTTCAACACTAATTTATGTTTGGTTTATT TTTTCAATAGAAACTGCATTGGTCAGAACTTTGCGTTGAATGAACTGAAG ATN >_1 NFDAETPCGGNSIPSYILYKND*HLGTI*ASCPILQCASRKAYVCIHLSRSSDVS*KNRF SFKVISIRRSRQQLKQNPKLLFIFSHCTENVHVWESPNVRYKYFKF*NI**MPVVVYQTT IRVNFFQEYNPERFNPENIKGRSPHAYLPFSAGPR*IT*ILKKHILRVLPNYIEDIYLTE TGVSTHIYDFSF*TCEIKLCYIYFTFYLLFITSTSIKIIVFSLPFNTNLCLVYFFNRNCI GQNFALNELKX >_2 ILTLKLHVVXIQYHHIYYIKMINT*GRFEQAALSYNVHQGKLTFVSTCPVHRT*AKRTAS VSK*FQ*DEADNN*SKIPSCSSYFLTAQKTFMSGNPPM*DISILSFKIYNRCRW*YIKPR SG*IFFRNTTLRDLIQKTSRGDLHMLIFHFPRVQGELLRY*KNIFCGYYQIILKIFI*LK RVFQLIFMIFRFKLVRLSCAIFTLRFTYFLSHPRQ*K*SCSVYRSTLIYVWFIFSIETAL VRTLR*MN*R >_3 F*R*NSMWWXFNTIIYTI*K*LTLRDDLSKLPYLTMCIKESLRLYPPVPFIGRELKEPLQ FQSDFNKTKQTTIEAKSQVALHIFSLHRKRSCLGIPQCEI*VF*VLKYIIDAGGSISNHD QGEFFSGIQP*EI*SRKHQGEISTCLSSIFRGSKVNYLDIKKTYSAGITKLY*RYLFN*N GCFNSYL*FFVLNL*D*AVLYLLYVLLTFYHIHVNKNNRVQSTVQH*FMFGLFFQ*KLHW SELCVE*TED >scf/ciona01/G126/seq_dir/hrs/G126P66152F.T0/G126P66152FE6.T0.seq 762 file 4 >scf/ciona01/G126/seq_dir/hrs/G126P66992R.T0/G126P66992RH4.T0.seq 721 file 2 721 ABI Length = 721 Query: 1 LTRREDLSKLSYLTLCIKESLRLCPPVPFIGRELNEPLKFRSKLKEPNETTIDAHSNIAL 60 LT R+DLSKL YLT+CIKESLRL PPVPFIGREL EPL+F+S + +TTI+A S +AL Sbjct: 367 LTLRDDLSKLPYLTMCIKESLRLYPPVPFIGRELKEPLQFQSDFNKTKQTTIEAKSQVAL 546 Query: 61 HIFTLHRNVHVWDSP 75 HIF+L NVHVW+SP Sbjct: 547 HIFSLTENVHVWESP 591 >scf/ciona01/G126/seq_dir/hrs/G126P66992R.T0/G126P66992RH4.T0.seq 721 0 721 ABI GTAATTGNGTNNTAAAACCNCACTGNGGTGGATTCAAATCCCTTCGATGA GAATTGTCAAGATAAATGCCGTGAAGAACTGCGTAGAGTAGTTGGGGAAA AAGAAAATTTGATTGGTTTGTAGCTATATCGATTTTCATTGAATGCTGTG TGCAGATTGAAATACATATCAACCGATTATGTCACGTAGAAACGTATTTT AAATACTTAAATCAGATAAAAGTTCCCAACAGACAAAGTTAAATTTTCGG CTGAGTAATTGAAAAGGTAAATAACGTATAATGCTTCTTCTATTACATGG ATTGTACATAAATAACCAAATGCGATTAAGGTAAAAAATACCATCATATA TACTATATAAAAATGATTAACACTTAGGGACGATTTGAGCAAGCTGCCCT ATCTTACAATGTGCATCAAGGAAAGCTTACGTTTGTATCCACCTGTCCCG TTCATCGGACGTGAGCTAAAAGAACCGCTTCAGTTTCAAAGTGATTTCAA TAAGACGAAGCAGACAACAATTGAAGCAAAATCCCAAGTTGCTCTTCATA TTTTCTCACTGACAGAAAACGTTCATGTCTGGGAATCCCCCAATGTGAGA TATAAGTATTTTAAGTTTTAAAATATATAATAGATGCCGGTGGTAGTATA TCAAACCACGATCAGGGTGAATNTTTTTCAGGAATACAACCCTGAGAGAT TTAATCCAGAAAACATCAGGG >_1 VIXX*NXTXVDSNPFDENCQDKCREELRRVVGEKENLIGL*LYRFSLNAVCRLKYISTDY VT*KRILNT*IR*KFPTDKVKFSAE*LKR*ITYNASSITWIVHK*PNAIKVKNTIIYTI* K*LTLRDDLSKLPYLTMCIKESLRLYPPVPFIGRELKEPLQFQSDFNKTKQTTIEAKSQV ALHIFSLTENVHVWESPNVRYKYFKF*NI**MPVVVYQTTIRVNXFQEYNPERFNPENIR X >SEQUENCE 147, 149, 153, 163 MTLFEAASEVVFLNRGFVLSSLISEVVLLIAIVAVTKVYLV PAIRYYKRGLLYTKQGCSPPRHWLWGHLTVFPLSHDGMLKRLRTTAQYAGMFVSWAGPFT YWIETQHPTTCAVLANSSAPKAEFLYGCLRPWIGDGLLTSKGSKWKRNRRLLTPAFHFEI LKPYLNIFNKSSYAMLEKWKRHSGQ SYDVYGDVSNLTLDTMMQCAMSTDTDSGGEDGGYGYINAVHELTLLVMERVYNP LHMIDWIYHFSSNGRRFRKLVDFVHETSETIIKERKKELETLVQEDNDNASTATNNELSS FKKRGTKHLDFLDILLQTKDENGNGLTLKEIRDEVDTFLFEGHDTTASGIAWCLYNLAKH PEYQQRCREEVLEEVGEKEKIEWED 19 LSKLTYLAMCIKESLRLNPPVFCVGRELNEDLTFNDKYTPCKKMKVESGNTVLMQIMSMH 198 199 RNPHVWENPE 231 (0) 297 VYDPERFSAENMKNRHSMSFLAFSAGP 383 156 RNCIGRNFAMNELRVVIGQTLRQYKLWCDDDTPEPKMQPNIILRSANGIHIKFK DEV60930.x1.g9 heme DEV60930.x1.g8 WXXP to end DEV60930.x1 heme DEV60930.x01 LQW75432.y1 after heme LQW210893.x1 EXXR to heme DEV60934.x1.g9 heme rcilv031p09 rcilv067p11 >rcilv031p09 TGCCCATGCTTTATTTTGGTTTAAATGATNAATTCGATTTCTTAACACCATTGCCAAATCTTTATAACGTCTATAGTTTA CACTGGTTTAAATTTTATGTGAATTCCATTCGCAGATCTCAGGATAATATTTGGTTGCATCTTAGGCTGAGGTGTATCAT CATCACACCATAATTTGTATTGTCGCAATGTTTGGCCAATCACAACTCGTAGCTCGTTCATGGCGAAATTTCGACCAATG CAATTTCTCGGACCAGCAGAAAACGCTAAGAATGACATTGAATGGCGATTTTTCATGTTTTCTGCAGAAAATCTTTCGGG GTCATAGACTTCAGGATTCTCCCAAACGTGTGGATTTCTGTGCATGGACATTATCTGCATGAGTACAGTGTTTCCAGACT CAACCTTCATTTTCTTACACGGCGTGTACTTGTCATTAAACGTAAGATCTTCGTTTAGTTCGCGGCCAACACAGAATACT GGTGGATTAAGTCGAAGACTTTCTTTTATACACATGGCTAAGTAAGTCAGTTTCGAAAGGTCCTCCCATTCTATTTTTTC TTTTTCACCGACCTCTTCAAGAACTTCTTCTCTGCATCTTTGTTGATACTCAGGATGCTTCGCTAGATTGTACAAGCACC AGGCTATACCGCTTGCTGTCGTATCATGACCT GHDTTASGIAWCLYNLAKHPEYQQRCREEVLEEVGEKEKIEWEDLSKLTYLAMCIKESLR LNPPVFCVGRELNEDLTFNDKYTPCKKMKVESGNTVLMQIMSMHRNPHVWENPEVYDPER FSAENMKNRHSMSFLAFSAGPRNCIGRNFAMNELRVVIGQTLRQYKLWCDDDTPQPKMQP NIILRSANGIHIKFKPV* >rcilv067p11 TNTTTTGGTTTAATGATCAAATTCGATTTCTTAACACCATTGCCAAATCTTTATAACGTCTATAGTTTACACTGGTTTAA ATTTTATGTGAATTCCATTCGCAGATCTCAGGATAATATTTGGTTGCATCTTAGGCTCAGGTGTATCATCATCACACCAT AATTTGTATTGTCGCAATGTTTGGCCAATCACAACTCGTAGCTCGTTCATGGCGAAATTTCGACCAATGCAATTTCTCGG ACCAGCAGAAAACGCTAAGAATGACATTGAATGGCGATTTTTCATGTTTTCTGCAGAAAATCTTTCGGGGTCATAGACTT CAGGATTCTCCCAAACGTGTGGATTTCTGTGCATGGACATTATCTGCATGAGTACAGTGTTTCCAGACTCAACCTTCATT TTCTTACACGGCGTGTACTTGTCATTAAACGTAAGATCTTCGTTTAGTTCGCGGCCAACACAGAATACTGGTGGATTAAG TCGAAGACTTTCTTTTATACACATGGCTAAGTAAGTCAGTTTCGAAAGGTCCTCCCATTCTATTTTTTCTTTTTCACCGA CCTCTTCAAGAACTTCTTCCCTGCATCTTTGTTGATACTCAGGATGCTTCGCTAGATTGTACAAGCACCAGGCTATACCG CTTGCTGTCGTATCATGACCT GHDTTASGIAWCLYNLAKHPEYQQRCREEVLEEVGEKEKIEWEDLSKLTYLAMCIKESLR LNPPVFCVGRELNEDLTFNDKYTPCKKMKVESGNTVLMQIMSMHRNPHVWENPEVYDPER FSAENMKNRHSMSFLAFSAGPRNCIGRNFAMNELRVVIGQTLRQYKLWCDDDTPEPKMQP NIILRSANGIHIKFKPV* >cilv031p09 TGGAAACGACATTCTGGCCGTCGTATGACGTATATGGTGACGTCAGTAACCTTACACTGGATACCATGATGCAGTGTGCC ATGTCGACGGACACTGACAGTGGAGGTGAAGACGGAGGATACGGCTACATTAATGCTGTCCACGAGTTGACGTTGCTAGT TATGGAGAGAGTTTACAATCCACTACACATGATTGACTGGATCTACCATTTTTCATCTAACGGAAGACGCTTTCGAAAAC TAGTCGACTTCGTTCACGAAACATCCGAAACGATTATTAAAGAAAGGAAGAAAGAGCTTGAAACACTCGTCCAAGAAGAC AATGATAATGCCTCAACTGCCACCAACAACGAATTATCCAGCTTCAAAAAAAGAGGAACAAAACATTTGGATTTTCTTGA TATCCTTTTACAAACAAAAGATGAAAACGGCAATGGACTGACTCTTAAAGAAATCCGTGACGAGGTAGATACGTTTCTTT TCGAAGGTCATGATACGACAGCAAGCGGTATAGCCTGGTGCTTGTACAATCTAGCGAAGCATCCTGAGTATCAACAAAGA TGCAGAGAAGAAGTTCTTGAAGAGGTCGGTGAAAAAGAAAAAATAGAATGGGAGGACCTTTCGAAACTGACTT ETTFWPSYDVYGDVSNLTLDTMMQCAMSTDTDSGGEDGGYGYINAVHELTLLVMERVYNP LHMIDWIYHFSSNGRRFRKLVDFVHETSETIIKERKKELETLVQEDNDNASTATNNELSS FKKRGTKHLDFLDILLQTKDENGNGLTLKEIRDEVDTFLFEGHDTTASGIAWCLYNLAKH PEYQQRCREEVLEEVGEKEKIEWEDLSKLT >cilv067p11 TTGCACGTTTCAGTGCACAACCTTTGCTTGTGCTGCATGCGTGCCTGGGAGGCAAGAAAATGACCCTCTTCGAAGCGGCT TCAGAGGTAGTTTTTCTGAATCGTGGGTTTGTACTTTCAAGTTTAATCAGCGAAGTGGTCTTGTTGATTGCGATAGTAGC AGTTACAAAGGTCTACCTAGTGCCAGCGATACGTTATTATAAGCGTGGTTTGTTGTACACCAAGCAAGGCTGTTCTCCTC CAAGGCACTGGCTATGGGGACATCTTACAGTATTCCCACTAAGCCACGATGGGATGTTAAAACGATTAAGAACAACAGCT CAATATGCCGGAATGTTCGTATCCTGGGCTGGACCTTTTACATACTGGATTGAAACTCAACACCCGACGACTTGCGCCGT TCTAGCAAACAGTTCAGCACCCAAAGCTGAATTCCTATACGGATGTCTTCGTCCATGGATTGGAGATGGTCTGTTGACAA GCAAAGGCAGCAAATGGAAGAGAAACAGAAGGCTTCTAACGCCTGCCTTTCATTTCGAGATACTTAAACCATACCTCAAC ATTTTCAACAAATCCTCTTATGCAATGTTGGAAAAATGGAAACGACATTCTGGCCAGTCGTATGACGTGTATGGTGACGT CAGTAACCTTACACTGGATACCATGATGCAGTGTGCCATGTCGACGGACACTGACAG ARFSAQPLLVLHACLGGKKMTLFEAASEVVFLNRGFVLSSLISEVVLLIAIVAVTKVYLV PAIRYYKRGLLYTKQGCSPPRHWLWGHLTVFPLSHDGMLKRLRTTAQYAGMFVSWAGPFT YWIETQHPTTCAVLANSSAPKAEFLYGCLRPWIGDGLLTSKGSKWKRNRRLLTPAFHFEI LKPYLNIFNKSSYAMLEKWKRHSGQSYDVYGDVSNLTLDTMMQCAMSTDTD >SEQUENCE 150, 53 TSLQEEELIVIVRDLFSAGSETSSNSILWILIVLLHHPHHAKKCIQEIDDVMG HREKMPFTCAVIQETFRYRTVAPIGLQHYAQATVELGGLRIPQGQG VYSNIWGVHNDPVAWPNPS EFDPYRHINKDGKFVLSNNIMTFSIGPRSCPGEALAKLEIFMFVTKILQKF NVRASPNNPPSLDGVNCLQFTPLSCEVILTER* LQW67603.x1 I helix DEV58996.x1 I-helix DEV58996.x2 I-helix LQW91337.x1 I-helix GCiWno550_b13.b1 GCiWno876_c15.b1 GCiWno466_k04.g1 GCiWno935_o16.b1 sequence 53 2 accessions 495 to 2C18 VYSNIWGVHNDPVAWPNPSEFDPYRHINKDGKFVLSNNIMTFSIGPRSCPGEALAKLEIFMFVTKILQKFNV RASPNNPPSLDGVNCLQFTPLSCEVILTER* LQW229409.x1 LQW274980.x1 GCiWno209_g02.g1 GCiWno935_o16.b1 >GCiWno209_g02.b1 TCGGATCATAGCTGTTTGCCAGTAAAACGACTGCACGATCATGGTGCATACTTGCTTCCAGGACCAATAACAGCTTTTTA TGAATGTTCCATGTTACCCTAATTTACTATATCTAATTGTTATCGCAGTTTTATCTTTATGTTCTTACGTCAAACATTGT AAGTCGCGTTGTTTGTGGAAGACGATACGATTTTGAGGACGAGAAATATCACCAAGTTTTAATCAATCTACAAAAAATGT AAGTTAGAATGTAACTTTCATTAAATCTATAGACCCAATACAAGGTTTACATTTAGTTTGGGTGACGCGAAAGATGCACC GTTCACACTTCTCATTGATTTTTTTCCTGGTCTTAAACACCTGCCTTGGTTTCGTGGGGCTAATAACAGGATGATCGAAC GAATAAAAAACTGGTTAGGTGAGAATGTGTTTACATATAAAAGCTGTTTGTGGTGTTATATATTATGCAGCATATTATTA AGAGAACCATATATTTATCCAAGAACATAGTAAAGATCACGTTGAAGAACACAAGAAAACCTTTGATAAAAACAATCTTC GCGACTTGATTGACTCATTCCTACACGAACAAGCATATGGGAAAACGGAAAACAAGAACGTATATACAGTAAGTTACGTT GTATGCAATATAAATAAGAAACATTTTGAAAACGCATTATAGTGTATTGAAATAACGTTACGTCGTTACAGGAGGAAGAA CTGATTGTTATCGTCCGTGATCTATTTTCTGCTGGCTCTGAAACCAGTAGTAACTCTATACTGTGGATATTGATAGTTCT ACTGCATCATCCACACCATGCANAAAATGTATACAAGAAATCGACGATGTTATGGGGTAGCGCTTTTAATTCA >GCiWno209_g02.g1 ATGGCCCGTNCGTTTCTACTGGACAAACANCTATGAACCATGNACTGGACCGTTCGATTGCACTGGGAAACACCAATCAT CATGACTGACACGTCATCGCTCCGTTAAAATAACCTCACACGACAATGGAGTAAACTGTAGGCAGTTAACACCATCCAAA GACGGCGGGTTATTAGGAGATGCTCTGACATTAAACTTTTGCAAAATTTTTGTGACAAACATAAAGATTTCCAATTTTGC CAAGGCCTCTCCCGGGCAACTGCGTGGTCCAATTGAAAATGTCATTATATTGTTACTGAGAACGAATTTTCCATCTTTGT TTATGTGTCTGTACGGGTCAAACTCAGAAGGGTTTGGCCAAGCTACCGGGTCGTTGTGAACTCCCCAAATGTTGGAGTAA ACCTGGTAGAAACATGACTGTTAAGGAACGATCAGTAGGTTAACTATAGTTAAAACTCATGTTTACCATTGTTCCTTGAG GAATAACGTAACCACCTAATTCGACAGTAGCTTGTGCATAATGTTGTAATCCAATTGGGGCAACAGTTCTGTATCGAAAA GTCTCTTGAATCACCGCGCAAGTAAACGGCATCTTTTCCCTATGTTGGCTGCTTGGAGCTCCATTGGGACCTTTTTAAAT AATATAGTAGAGTGGGAGAAGACGGGACCCCTTAAGTTTAATATTACTCANAATATATATACGACTTTGNGAGTACACCA CGAATTATTACTACCATACATTTATCAAGTGACGACACTTCANAAAAGCGTANTAAAGTGGGGGAAAGATGGGATCACCT ANCTTNTTATTTCATTTTCTCGNCCTATTTGGTGGGTAACAAAGAAACGTTCAAGAATCATANAACCGTATCCCTACGAC TNCCATAGACCATTGTN >GCiWno209_g02.g1_4 XNGLWXS*GYGXMILERFFVTHQIGRENEIXX*VIPSFPHFXTLX*SVVT**MYGSNNSW CTXKVVYIX*VILNLRGPVFSHSTILFKKVPMELQAANIGKRCRLLAR*FKRLFDTELLP QLDYNIMHKLLSN*VVTLFLKEQW*T*VLTIVNLLIVP*QSCFYQVYSNIWGVHNDPVAW PNPSEFDPYRHINKDGKFVLSNNIMTFSIGPRSCPGEALAKLEIFMFVTKILQKFNVRAS PNNPPSLDGVNCLQFTPLSCEVILTER*RVSHDDWCFPVQSNGPVHGS*XFVQ*KRTGH >GCiWno209_g02.g1_5 QWSMXVVGIRXYDS*TFLCYPPNRXRK*NXKXGDPIFPPLXYAFXKCRHLINVW***FVV YSQSRIYIXSNIKLKGSRLLPLYYII*KGPNGAPSSQHREKMPFTCAVIQETFRYRTVAP IGLQHYAQATVELGGYVIPQGTMVNMSFNYS*PTDRSLTVMFLPGLLQHLGSSQRPGSLA KPF*V*PVQTHKQRWKIRSQ*QYNDIFNWTTQLPGRGLGKIGNLYVCHKNFAKV*CQSIS **PAVFGWC*LPTVYSIVV*GYFNGAMTCQS**LVFPSAIERSSXWFIXVCPVETXGPX >GCiWno209_g02.g1_6 TMVYGSRRDTVX*FLNVSLLPTK*XEKMK*XXR*SHLSPTLXRFXEVSSLDKCMVVIIRG VLXKSYIYXE*Y*T*GVPSSPTLLYYLKRSQWSSKQPT*GKDAVYLRGDSRDFSIQNCCP NWITTLCTSYCRIRWLRYSSRNNGKHEF*L*LTY*SFLNSHVSTRFTPTFGEFTTTR*LG QTLLSLTRTDT*TKMENSFSVTI**HFQLDHAVARERPWQNWKSLCLSQKFCKSLMSEHL LITRRLWMVLTAYSLLHCRVRLF*RSDDVSVMMIGVSQCNRTVQXMVHXCLSSRNXRAX >GCiWno466_k04.g1_2 TAYQTTFLKSCFTGATFDNSQKQILQYYLTVFFHGQKKCSIDATLDITGKQVKECIT*FL KCEYYFVLLTYIYNNKFSYVTKLTRILNCLFLPCLFSNR*GYTCCANC*ITREFNI*YRM GKRRDAFST*HP*SYFIQLTMVYGSRRDTVL*FFERSLFTTK*DEKMK*KSR*SHLPPLY YASLKCRHLINVW***FVVLLQSRIYILSNIKLKGSRLLPLYYII*KGPNGAPSSQHREK MPFTCAVIQETFRYRTVAPIGLQHYAQATVELGGLRIPQGQGKHEF*LXVPX*SSLQXCF YRFX >GCiWno550_b13.b1_1 Q*VTLYAI*IRNILKRHYSVLK*RYVVTGGRTDCYRP*SIFCWL*NQ**LYTVDIDSSTA SSTPCKKMYTRNRRCYG*ALLNS**FIVLTDRNYLKNE*M*LTLSSRGRKITVVITRVFI HLVPAYELPCMLLCG*FLFLIFSFLLFMADSLTNPLVNFGLEQLLXKCLAQGTYAHNG*Q RPQTF*TPYTPLGKKRGGGVGPLXXXTXK*SPHPPHXPXXPPPTPHKTHS*QTYSNPXPH PXPPPXPTKLFD*CTPSCRSVLSRFRPPLDPPPPPAPRRPXX >GCiWno550_b13.b1_2 SKLRCMQYK*ETF*KGIIVY*NNVTSLQEEELIVIVRDLFSAGSETSSNSILWILIVLLH HPHHAKKCIQEIDDVMGKRF*IPNNLLF*LIEIT*KMNKCNLLYPRVAGKLQSL*HGCSY TSCQLTSYHVCYFVGDFCF*FFHFFYLWLIV*PTH**TLGWSNCCXSVLPKAHTPTMGSN GPKPFKPPIPLWEKKEGGGWAPXXXXQXNNHHTHHTXLXLPHPPPTKPTHNKPTQTHXPT PPPPXTPQSSSINVRPPAGVFSLASVLRLIPRLRPPRAAPX >GCiWno550_b13.b1_3 VSYVVCNINKKHFKKAL*CIEITLRRYRRKN*LLSSVIYFLLALKPVVTLYCGY**FYCI IHTMQKNVYKKSTMLWVSAFKFLIIYCFN**KLLKK*INVTYFILAWPENYSRYNTGVHT PRASLRVTMYVTLWVIFVFDFFISFIYG**FDQPISELWVGAIVV*VSCPRHIRPQWVAT APNLLNPLYPSGKKKRGGGGPPXXXHKXIITTPTTHXXXSPTHPPQNPLITNLLKPTPPP XPPPXPHKALRLMYALLQECSLSLPSSA*SPASARPAPPR >SEQUENCE 135, 151, 152 EXXR TP WXXP 47% TO 4B1 DENGIGLSDVEIENEVDTFLNEGHDTTA SGISWSLYMLAQHPEYQQKCRDELEEVLKDKEDIDWSNLTKLQYLTMCIKETLRI RPPVPAISRQLDQPLTFKSKTHNVPPTTLAKGSFAGVQIFSLHRNVHVWEEPE VFNPDRFTQDNIKKRSPHAFLPFSAGSRNCIGQNFAMNEMKIAVGQIIRKY ELYIDDDTPDTVMETALVLRSTNGIMIKIRKI* LQW232176.x1 rcilv086f16 GCiWno130_g19.b1 >rcilv086f16 GTATTTTCGTGAGAGTCAAATTGCGACGAACAGACGCGTGCCCATTTCATATATGCCTACGTGCTTAATAAACGACGATG AATTTAGTATGCGACGTAGTTAATTCTACCACGTATTAAATCGCTGACATTATTAATAATGAAGGTGCCTATAAAATTAA TGAAAACATTCCTATCAACATATAACGATTCCGAAGCCGTTTATTGACTTTTAAATTTTCCTTATTTTAATCATGATTCC GTTGGTTGACCGCAACACCAAGGCCGTCTCCATTACGGTGTCCGGAGTGTCATCGTCGATGTATAATTCGTATTTTCTTA TGATTTGCCCGACGGCAATCTTCATTTCGTTCATGGCAAAGTTCTGTCCAATACAGTTCCTTGAACCTGCCGAGAAAGGA AGGAAGGCGTGAGGCGACCGTTTCTTTATGTTGTCCTGGGTAAATCGATCTGGGTTAAAGACCTCTGGTTCTTCCCATAC ATGTACATTCCTATGCAATGAGAAGATCTGGACTCCTGCGAACGACCCCTTCGCTAATGTAGTTGGAGGGACGTTATGAG TTTTGCTTTTAAAAGTCAGGGGTTGATCTAGTTGGCGACTAATTGCTGGCACCGGTGGTCGAATTCTTAGCGTTTCCTTG ATACACATTGTCAGGTATTGTAACTTGGTCAGGTTTGACCAATCAATGTCTTCTTTGT KEDIDWSNLTKLQYLTMCIKETLRIRPPVPAISRQLDQPLTFKSKTHNVPPTTLAKGSFA GVQIFSLHRNVHVWEEPEVFNPDRFTQDNIKKRSPHAFLPFSAGSRNCIGQNFAMNEMKI AVGQIIRKYELYIDDDTPDTVMETALVLRSTNGIMIKIRKI* >sequence 151, 152, 135 note match to 148 may be wrong seq here MSFALANGVLTSTVVGDIALIFATLFVKLNYILPIAKLRQSSSNLEKQVGLGSFKKHWFF GHLRLFPPLEHGLLKRAQRTIQTPAWVTTWFGPLMSEATTHHSETAITLLASSAPKNEYV YKFLRPWLGDGLLVSNGKKWMRNRHLLTPAFHFSILKP (?) YAEISNNCIKTMIEKWTTKTNV AFDIYKDVNSMTLDTMLQCAMSFKIEGLKXR Missing one exon in middle VIRERKEELKKASEVSETVTEGSETAQVTRKGKYI DFLDILLHTK this part = seq 148 XENGIGLSDVEIENEVDTFLNEGHDTTAS (1?) this part = seq 148 GISWSLYMLAQHPEYQQKCRDELEEVLKDKEDIDWS (?) NLTKLQYLTMCIKETLRIRPPVPAISRQLDQPLTFKSKTHNVPPTTLAKGSFA GVQIFSLHRNVHVWEEPE (?) VFNPDRFTQDNIKKRSPHAFLPFSAGSR (?) NCIGQNFAMNEMKIAVGQIIRKYELYIDDDTPDTVMETALVLRSTNGIMIKIRKI* GCiWno136_l19.b1 LQW96414.x1 C-helix DEV54340.y1 C-helix DEV54340.x1 mid to I-helix DEV4899.x1 c-helix LQW140783.x1 C-helix DEV2486.y1 heme DEV28111.x1 heme LQW194622.x1 heme LQW57232.y1 heme DEV42408.y1 heme rcilv086f16 cilv086f16 GCiWno446_d04.b1 GCiWno446_d04.g1 GCiWno359_g08.g1 GCiWno392_o01.g1 GCiWno130_g19.b1 GCiWno440_l12.b1 DEV54340.x1 CHEM: term DYE: ET TIME: Fri May 4 12:32:55 2001 TEMPLATE: DEV54340 DIRECTION: fwd Length = 664 Score = 90.1 bits (220), Expect = 5e-18 Identities = 49/74 (66%), Positives = 56/74 (75%) Frame = -1 Query: 34 HMIDWIYHFSSNGRRFRKLVDFVHETSETVIRERKEELKKASEVSETVTEGSETAQVTRK 93 H+I ++ + L D+ ++ VIRERKEELKKASEVSETVTEGSETAQVTRK Sbjct: 388 HLIIHEEYYRTRSSARSHLCDYFNQ----VIRERKEELKKASEVSETVTEGSETAQVTRK 221 Query: 94 GKYIDFLDILLHTK 107 GKYIDFLDILLHTK Sbjct: 220 GKYIDFLDILLHTK 179 >_4 *NALSCTF*DSVMFCIFYVLSYSLGISASAEMQTWQQVSKRQHIQLFCTI*QSKPKI*VF VC*NISSRISTLHHCKDRVYKMKHFFILLSRPI**YTKNIIVPAVRQDHIYVTILTRLFG KERKN*KKQVRFQKRSLKDRKPHKLQGKENILTFWTFCCILR*VKRTYVHIKCCLIRFQL KKNIFLGRKWNRTFRCGN*KRG*YVFKRRT*YYSKR**VNE >_5 LKRSELYILRFSHVLHFLCFEL*FRNICICRNADMAASFKKATYTIVLYNLTK*TKNISV CMLKYFKSHKYPTPL*G*GI*DETFFHSPFSSHLIIHEEYYRTRSSARSHLCDYFNQVIR ERKEELKKASEVSETVTEGSETAQVTRKGKYIDFLDILLHTKVSKTHLCTHKVLPYTFST KKEHFSRTKME*DFQMWKLKTRLIRF*TKDMILQQAVMSE*X >_6 KTL*AVHFEIQSCSAFFMF*VIV*EYLHLQKCRHGSKFQKGNIYNCSVQFDKVNQKYKCL YAKIFQVA*VPYTIVRIGYIR*NIFSFSFLVPFDNTRRILSYPQFGKITFM*LF*PGYSG KKGRIEKSK*GFRNGH*RIGNRTSYKERKIY*LSGHFAAY*GK*NALMYT*SVALYVFN* KRTFF*DENGIGLSDVEIENEVDTFLNEGHDTTASGNE*MX LQW140783.y1 LQW140783.y1.phd.1 LQW140783.x1 11:38:47 2001 TEMPLATE: LQW140783 DIRECTION: rev Length = 460 Score = 119 bits (295), Expect = 4e-27 Identities = 60/60 (100%), Positives = 60/60 (100%) Frame = -3 Query: 1 *NALSCTF*DSVMFCIFYVLSYSLGISASAEMQTWQQVSKRQHIQLFCTI*QSKPKI*VF 60 *NALSCTF*DSVMFCIFYVLSYSLGISASAEMQTWQQVSKRQHIQLFCTI*QSKPKI*VF Sbjct: 329 *NALSCTF*DSVMFCIFYVLSYSLGISASAEMQTWQQVSKRQHIQLFCTI*QSKPKI*VF 150 >_4 PIKDTYAHNDSSDEPRTHYHCFTGSDSYTLKDK*ITVLHFII*LKRSELYILRFSHVLHF LCFEL*FRNICICRNADMAASFKKATYTIVLYNLTK*TKNISVCMLKYFKSHKYPTPL*G *GI*DETFFHSPFSSHLIIHEEDYRTRSSARSH >_5 AHQGHIRPQ**QRRASNPLPLLYRQ**LYA*G*MNNCITFHYLIKTL*AVHFEIQSCSAF FMF*VIV*EYLHLQKCRHGSKFQKGNIYNCSVQFDKVNQKYKCLYAKIFQVA*VPYTIVR IGYIR*NIFSFSFLVPFDNTRRRLSYPQFGKITX >_6 PSRTHTPTMIAATSLEPITTALQA VIAIRLRINE*LYYISLFN*NALSCTF*DSVMFCIF YVLSYSLGISASAEMQTWQQVSKRQHIQLFCTI*QSKPKI*VFVC*NISSRISTLHHCKD RVYKMKHFFILLSRPI**YTKKIIVPAVRQDHX >GCiWno136_l19.g1 TTGANCTTTTTATACGACTTGCGAGCTCGGTACCCTTGCTTTTTCCAATTCTTCCTTTCTTTCCCGATAACCTGGTTAAA ATAGTCACATAAATGTGATCTTGCCGAACTGCCGGTACGATGATATTCTTCGTGTATTATCAAATGGGACGAGAAAGGAG AATGAAAAAATGTTTCATCTTATATACCCTATCCTTATAATGGTGTAGGGTACTTATGCGACTTGAAATAGTTTAGCATA CAAACACATATTTTTAGTTAACTTTGTCAAATTGTACAGAACAATTGTATATGTTGCCTTTTTGAAACTTGCTGTCATCT CTGCATTTCTGCAGATGCAGATATTCTTAAACTATAACTCAAAACATAAAAAATGCAGAACATGACTGAATCTCAAAATG TACAGTCCAGAGCGTTTTAATTAAATGATGAAATGTAATACAGTTATTCATTTATCCTTAAGCGTATAGCTATCACTGCC TGTAAAGCAGTGGTAATGGGTTCGAGGCTCGTCGCTGCTACCATTGTGGGCGTATGTGTCCTTGATGGGCAGCAGGACAC TTAACAGCTCCAACATATTAGTGTTCACTCCTTGNGGAGGACACTCAAATTGCTCCAACCCAGTGTTCACTAATGGTTGG TCAAATTATCAGCCATACATAAAAAATTATAACCCACAATGTACCGTACATGCTGGAAACCCGGTACCTGGCACAAAGGT ATGATAACGCCTGTCGTTTTCCGGCCCCGCGAGGATAAAGAAAGTACATTCATTCATTGATTTATTCATTCATTCAACCT AACCTGTTTTGTTTGCTCGGGGGACCATCTTCTAAGGCCTGCTTTGGATTTTTGGTCCCCGCAAAAAAATCGGCCGCAAG ATCCCCCCCATAGTTTAAAAGGGGGACCACTCTATCCCTTGCCCTGGGGTAAAGGGGG >_4 PFTPGQGIEWSPF*TMGGILRPIFLRGPKIQSRP*KMVPRANKTG*VE*MNKSMNECTFF ILAGPENDRRYHTFVPGTGFPACTVHCGL*FFMYG**FDQPLVNTGLEQFECPPQGVNTN MLELLSVLLPIKDTYAHNGSSDEPRTHYHCFTGSDSYTLKDK*ITVLHFII*LKRSGLYI LRFSHVLHFLCFEL*FKNICICRNAEMTASFKKATYTIVLYNLTKLTKNMCLYAKLFQVA *VPYTIIRIGYIR*NIFSFSFLVPFDNTRRISSYRQFGKITFM*LF*PGYRERKEELEKA RVPSSQVV*KXQ >_5 PLYPRARDRVVPLLNYGGDLAADFFAGTKNPKQALEDGPPSKQNRLG*MNE*INE*MYFL YPRGAGKRQALSYLCARYRVSSMYGTLWVIIFYVWLII*PTISEHWVGAI*VSSXRSEH* YVGAVKCPAAHQGHIRPQW*QRRASNPLPLLYRQ**LYA*G*MNNCITFHHLIKTLWTVH FEIQSCSAFFMF*VIV*EYLHLQKCRDDSKFQKGNIYNCSVQFDKVN*KYVFVC*TISSR ISTLHHYKDRVYKMKHFFILLSRPI**YTKNIIVPAVRQDHIYVTILTRLSGKKGRIGKS KGTELASRIKXSX >_6 PPLPQGKG*SGPPFKLWGGSCGRFFCGDQKSKAGLRRWSPEQTKQVRLNE*INQ*MNVLS LSSRGRKTTGVIIPLCQVPGFQHVRYIVGYNFLCMADNLTNH**TLGWSNLSVLXKE*TL ICWSC*VSCCPSRTHTPTMVAATSLEPITTALQAVIAIRLRINE*LYYISSFN*NALDCT F*DSVMFCIFYVLSYSLRISASAEMQR*QQVSKRQHIQLFCTI*QS*LKICVCMLNYFKS HKYPTPL*G*GI*DETFFHSPFSSHLIIHEEYHRTGSSARSHLCDYFNQVIGKERKNWKK QGYRARKSYKKXX >cilv086f16 Length = 633 Score = 87.4 bits (213), Expect = 2e-17 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +1 Query: 1 YKFLRPWLGDGLLVSNGKKWMRNRHLLTPAFHFSILKP 38 YKFLRPWLGDGLLVSNGKKWMRNRHLLTPAFHFSILKP Sbjct: 361 YKFLRPWLGDGLLVSNGKKWMRNRHLLTPAFHFSILKP 474 >cilv086f16 ATGAGCTTTGCACTGGCAAACGGCGTGTTAACGTCAACTGTGGTGGGCGACATTGCTTTAATATTTGCAACACTGTTTGT GAAATTAAACTACATTTTGCCCATTGCAAAATTACGCCAATCTTCTAGCAATTTAGAAAAACAGGTTGGGCTTGGCTCCT TTAAAAAGCATTGGTTTTTCGGCCACCTACGCTTGTTTCCACCACTAGAACATGGTCTATTAAAACGAGCCCAACGTACC ATACAAACACCAGCTTGGGTGACAACATGGTTTGGACCTTTAATGTCAGAAGCAACTACTCATCACTCCGAAACAGCTAT AACACTCCTTGCTAGTTCAGCTCCCAAAAACGAATACGTTTACAAGTTTCTCCGCCCATGGTTGGGAGATGGTTTGTTAG TCAGCAATGGTAAGAAATGGATGCGAAATCGTCACCTGCTCACACCAGCTTTTCACTTCAGCATTCTTAAACCATACGCT GAAATTTCGAACAACTGCATTAAAACCATGATAGAAAAATGGACGACCAAGACCAACGTTGCTTTTGATATTTATAAAGA TGTCAACAGTATGACACTGGACACAATGCTACAATGCGCAATGTCGTTTAAGATAGAAGGATTGAAAGANAGA MSFALANGVLTSTVVGDIALIFATLFVKLNYILPIAKLRQSSSNLEKQVGLGSFKKHWFF GHLRLFPPLEHGLLKRAQRTIQTPAWVTTWFGPLMSEATTHHSETAITLLASSAPKNEYV YKFLRPWLGDGLLVSNGKKWMRNRHLLTPAFHFSILKPYAEISNNCIKTMIEKWTTKTNV AFDIYKDVNSMTLDTMLQCAMSFKIEGLKXR >rcilv086f16 GTATTTTCGTGAGAGTCAAATTGCGACGAACAGACGCGTGCCCATTTCATATATGCCTACGTGCTTAATAAACGACGATG AATTTAGTATGCGACGTAGTTAATTCTACCACGTATTAAATCGCTGACATTATTAATAATGAAGGTGCCTATAAAATTAA TGAAAACATTCCTATCAACATATAACGATTCCGAAGCCGTTTATTGACTTTTAAATTTTCCTTATTTTAATCATGATTCC GTTGGTTGACCGCAACACCAAGGCCGTCTCCATTACGGTGTCCGGAGTGTCATCGTCGATGTATAATTCGTATTTTCTTA TGATTTGCCCGACGGCAATCTTCATTTCGTTCATGGCAAAGTTCTGTCCAATACAGTTCCTTGAACCTGCCGAGAAAGGA AGGAAGGCGTGAGGCGACCGTTTCTTTATGTTGTCCTGGGTAAATCGATCTGGGTTAAAGACCTCTGGTTCTTCCCATAC ATGTACATTCCTATGCAATGAGAAGATCTGGACTCCTGCGAACGACCCCTTCGCTAATGTAGTTGGAGGGACGTTATGAG TTTTGCTTTTAAAAGTCAGGGGTTGATCTAGTTGGCGACTAATTGCTGGCACCGGTGGTCGAATTCTTAGCGTTTCCTTG ATACACATTGTCAGGTATTGTAACTTGGTCAGGTTTGACCAATCAATGTCTTCTTTGT KEDIDWSNLTKLQYLTMCIKETLRIRPPVPAISRQLDQPLTFKSKTHNVPPTTLAKGSFA GVQIFSLHRNVHVWEEPEVFNPDRFTQDNIKKRSPHAFLPFSAGSRNCIGQNFAMNEMKI AVGQIIRKYELYIDDDTPDTVMETALVLRSTNGIMIKIRKI* GCiWno440_l12.b1 CHROMAT_FILE: GCiWno440_l12.b1 PHD_FILE: GCiWno440_l12.b1.phd.1 CHEM: term DYE: big TIME: Fri Oct 12 10:00:56 2001 TEMPLATE: GCiWno440_l12 DIRECTION: fwd Length = 857 Score = 48.8 bits (114), Expect = 7e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 1 GISWSLYMLAQHPEYQQKCR 20 GISWSLYMLAQHPEYQQKCR Sbjct: 76 GISWSLYMLAQHPEYQQKCR 17 >GCiWno440_l12.b1 CTTCTTCTAGTTCGTCTCTGCATTTTTGTTGATATTCTGGATGTTGAGCCAACATGTACAACGACCATGAGATGCCTGGA GTTTACCGTCATTAGGAAGATTCACATCACGTATGTTACTTTTTTATAATATGTTAAATTTTATACATAACAGGGTGGGA GAAGATGGAACACATCTTCCTTTTTGTCGTCCCATTTGGTAGAAAACAAAAAACATTTGAAGAATTATAAAACTGTATCA TCGCAACTCCTATAGACCGTTGTTAATTGTTTAAAACACGATCAGATGTTTGGATAACATGTACTAAAGGCGCCCTTCTT CCCACGCATTATTATACTATTTTTACATTCTATATCCAACGTGCGCTTTTTAAAGTGACGCCAATAAGACCCCTCCGAAA AATTTAAAAAGCAAATTCCTCCACAATATACGGTGTATAACTGGTAAGCGACAACGAGTGGTCTGAATAACAATTCCCGT GTTATACCATAGTATACTGAAGTGACTTCAGTATACTATGGTTATACCGACCGCCATTTTCCCCCTCACACTAGAATAAA ATAAGTTTAATTCATTCACTCATTACCGCTTGCTGTAGTATCATGTCCTTCGTTTAAAAACGTATCAACCTCGTTTTCAA TTTCCACATCTGANAGTCCTATTCCATTNTCGTCCTAGAAAAATGTTCTTTNTTAGTTGAAAACGTATAANGGCACACTT TATGTGTACATAAGTGCGTTNTACTTACCTTAGTATGCAGCANAATGTCCAGAAAGTCAATATATTNTCCTTTCCTTGTA CTTGNGCGGTTTCCGATCCTTCAGTGACCGTTNCTGAAACCTNACNNTTGCTTTTCN >_4 KSXXXVSXTVTEGSETAQVQGKXNILTFWTXCCILR*VXRTYVHIKCAXIRFQLXKNIFL GRXWNRTXRCGN*KRG*YVFKRRT*YYSKR**VNELNLFYSSVRGKMAVGITIVY*SHFS ILWYNTGIVIQTTRCRLPVIHRILWRNLLFKFFGGVLLASL*KAHVGYRM*K*YNNAWEE GRL*YMLSKHLIVF*TINNGL*ELR*YSFIILQMFFVFYQMGRQKGRCVPSSPTLLCIKF NIL*KSNIRDVNLPNDGKLQASHGRCTCWLNIQNINKNAETN*KK >_5 EKQXXGFXNGH*RIGNRXSTRKGXYIDFLDIXLHTKVSXTHLCTHKVCXYTFSTXKEHFS RTXME*DXQMWKLKTRLIRF*TKDMILQQAVMSE*IKLILF*CEGENGGRYNHSILKSLQ YTMV*HGNCYSDHSLSLTSYTPYIVEEFAF*IFRRGLIGVTLKSARWI*NVKIV**CVGR RAPLVHVIQTSDRVLNN*QRSIGVAMIQFYNSSNVFCFLPNGTTKRKMCSIFSHPVMYKI *HIIKK*HT*CESS**R*TPGISWSLYMLAQHPEYQQKCRDELEEX >_6 XKAXVRFQXRSLKDRKPXKYKERXIY*LSGHXAAY*GKXNALMYT*SVPLYVFN*XRTFF *DXNGIGLSDVEIENEVDTFLNEGHDTTASGNE*MN*TYFILV*GGKWRSV*P*YTEVTS VYYGITRELLFRPLVVAYQLYTVYCGGICFLNFSEGSYWRHFKKRTLDIECKNSIIMRGK KGAFSTCYPNI*SCFKQLTTVYRSCDDTVL*FFKCFLFSTKWDDKKEDVFHLLPPCYV*N LTYYKKVTYVM*IFLMTVNSRHLMVVVHVGSTSRISTKMQRRTRRX rcilv086f16 Length = 698 Score = 113 bits (281), Expect = 9e-26 Identities = 53/54 (98%), Positives = 54/54 (99%) Frame = -3 Query: 1 QVFNPDRFTQDNIKKRSPHAFLPFSAGSRNCIGQNFAMNEMKIAVGQIIRKYEL 54 +VFNPDRFTQDNIKKRSPHAFLPFSAGSRNCIGQNFAMNEMKIAVGQIIRKYEL Sbjct: 465 EVFNPDRFTQDNIKKRSPHAFLPFSAGSRNCIGQNFAMNEMKIAVGQIIRKYEL 304 >rcilv086f16 GTATTTTCGTGAGAGTCAAATTGCGACGAACAGACGCGTGCCCATTTCATATATGCCTACGTGCTTAATAAACGACGATG AATTTAGTATGCGACGTAGTTAATTCTACCACGTATTAAATCGCTGACATTATTAATAATGAAGGTGCCTATAAAATTAA TGAAAACATTCCTATCAACATATAACGATTCCGAAGCCGTTTATTGACTTTTAAATTTTCCTTATTTTAATCATGATTCC GTTGGTTGACCGCAACACCAAGGCCGTCTCCATTACGGTGTCCGGAGTGTCATCGTCGATGTATAATTCGTATTTTCTTA TGATTTGCCCGACGGCAATCTTCATTTCGTTCATGGCAAAGTTCTGTCCAATACAGTTCCTTGAACCTGCCGAGAAAGGA AGGAAGGCGTGAGGCGACCGTTTCTTTATGTTGTCCTGGGTAAATCGATCTGGGTTAAAGACCTCTGGTTCTTCCCATAC ATGTACATTCCTATGCAATGAGAAGATCTGGACTCCTGCGAACGACCCCTTCGCTAATGTAGTTGGAGGGACGTTATGAG TTTTGCTTTTAAAAGTCAGGGGTTGATCTAGTTGGCGACTAATTGCTGGCACCGGTGGTCGAATTCTTAGCGTTTCCTTG ATACACATTGTCAGGTATTGTAACTTGGTCAGGTTTGACCAATCAATGTCTTCTTTGT >_4 KEDIDWSNLTKLQYLTMCIKETLRIRPPVPAISRQLDQPLTFKSKTHNVPPTTLAKGSFA GVQIFSLHRNVHVWEEPEVFNPDRFTQDNIKKRSPHAFLPFSAGSRNCIGQNFAMNEMKI AVGQIIRKYELYIDDDTPDTVMETALVLRSTNGIMIKIRKI*KSINGFGIVIC**ECFH* FYRHLHY**CQRFNTW*N*LRRILNSSSFIKHVGIYEMGTRLFVAI*LSRKY >_5 QRRH*LVKPDQVTIPDNVYQGNAKNSTTGASN*SPTRSTPDF*KQNS*RPSNYISEGVVR RSPDLLIA*ECTCMGRTRGL*PRSIYPGQHKETVASRLPSFLGRFKELYWTELCHERNED CRRANHKKIRIIHRR*HSGHRNGDGLGVAVNQRNHD*NKENLKVNKRLRNRYMLIGMFSL IL*APSLLIMSAI*YVVELTTSHTKFIVVY*ARRHI*NGHASVRRNLTLTKIX >_6 TKKTLIGQT*PSYNT*QCVSRKR*EFDHRCQQLVAN*INP*LLKAKLITSLQLH*RRGRS QESRSSHCIGMYMYGKNQRSLTQIDLPRTT*RNGRLTPSFLSRQVQGTVLDRTLP*TK*R LPSGKS*ENTNYTSTMTLRTP*WRRPWCCGQPTES*LK*GKFKSQ*TASESLYVDRNVFI NFIGTFIINNVSDLIRGRINYVAY*IHRRLLST*AYMKWARVCSSQFDSHENT >GCiWno392_o01.b1 TTGCATTCACTTGCATTCACTTGCATTCACTTGCATTCACTTGCATTCACTTGCATTCACTTGCATTCACTTGCATTCAC TTGCATTCACTTGCATTCACTTGCATTCACTTGCATTCACTTGCATTCACTTGCATTCACTTGCATTCACTTGCATTCAC TTGCATTCACTTGCATTCACTTGCATTCACTTGCATTCACTTGCATTCACTTGCATTTACTTGCATTTACTTGCATTTAC TTGCATTTACTTGCATTTACTTGCATTTATTGATAGATAAAAGCTATTTTAAATGCTATTTTCTACGCCATTTTTTTGCA ATACGTCCATCTACACACTTTCATATTCATCGTATAATATATTTATAATACCAGACAAAGAGAGTTGATATCTTTCATCA AAATACCCCTATTTCTCATCTTACCCCACGCTACTACACTTTTTTGGGACACAGAAGCAGTTATTGTAATTTTGTGGCGT AAGTTGGTTGTATGTAGGTATTTAGTTGATTAACATTTTACTGTTCGCTGTTTAGATTGAAAATAGCAGTGACCCCATCC TACTATGCGTTTTTTCTTAAAACTAAACCAAAAAAAAAAACAATTTCTCAGTTTGCCATATTATCACCAGACAGAAGAAT ACATACTTACAAGCTGTGCGTGATCTCTCCACCTTAACCCATGCAAGGATAAGTAATCCACTATTACATATTGAGTGGAT CTTCTGGCGATCTTCTACGGGACGAAAATACAAACCAGCCTTAGAGATTGTACACCACCAAACAAACCAGTNAGGTTGAT GAATAAATGAAGTAACCTTACTTTATTCCTCCCGTGGCCCGAAAACAACAGCCGTTATCTACCACTTTGGGCCAGGTAAC GGTGTACCAACATGTACCGTCCAT >GCiWno392_o01.g1 TGGACTCCTGCGAACGACCCCTTCGCTAATGTAGTTGGAGGGACGTTATGAGTTTTGCTTTTAAAAGTCAGGGGTTGATC TAGTTGGCGACTAATTGCTGGCACCGGTGGTCGAATTCTTAGCGTTTCCTTGATACACATTGTCAGGTATTGTAACTTGG TCAGGTCTGACCTGTGGAGAAATAATGTGCCAGAAAATTATGGATTTGTAATATTTTAGGAAACTGCAGAACTTAAGTCT AAATATATCGAGCAAACTGCAGACGGTTCTATAACCGTGCATTTGTATTTAAGTCGGACATAGTTTTGTATGATACTCAG ATAGGCAGTTATAGTGCGGCAGAAGCATAACTTTATTTAATCAACGTCTCTACTTATAATTTTGGTTTTAACAACTGTTG TTTTGCCGCTTCGTTTAAAATATTTCTAAATCTTCGCTACCGAAATCGAAGAGACAAATAAGAGTAAATTCATTAATATT AACATTAGTGATTACCAATCAATGTCTTCTTTGTCTTTCAGAACTTCTTCTAGTTCGTCTCTGCATTTTTGTTGATATTC TGGATGTTGAGCCAACATGTACAACGACCATGAGATGCCTGGAGTTTACCGTCATTANGAAGATTCACATCACGTATGTT ACTTATTTATANATATGTAAATTTTATACATAACAGGGNTGGGAGAAGATGGAACACATCTTCCTTTNTGTCGTNCCATT TGGTANAAAACAAAAAACATTTGAAGAATTATAAAACCGTATCATCGCAACTCCTATAGACCGTTGGTAATTGTTTAAAC ACGATCAGGATGTTTGGATACATGTACTAAAGGGGCCCTTCTTCCCAGCATTATTATTACATTTTTAACTTCTATATTCA ACGGGCGCTT >_4 g1 APVEYRS*KCNNNAGKKGPFSTCIQTS*SCLNNYQRSIGVAMIRFYNSSNVFCFXPNGTT XRKMCSIFSXPCYV*NLHXYK*VTYVM*IFXMTVNSRHLMVVVHVGSTSRISTKMQRRTR RSSERQRRH*LVITNVNINEFTLICLFDFGSEDLEIF*TKRQNNSC*NQNYK*RR*LNKV MLLPHYNCLSEYHTKLCPT*IQMHGYRTVCSLLDIFRLKFCSFLKYYKSIIFWHIISPQV RPDQVTIPDNVYQGNAKNSTTGASN*SPTRSTPDF*KQNS*RPSNYISEGVVRRSP >_5 SAR*I*KLKM***CWEEGPL*YMYPNILIVFKQLPTVYRSCDDTVL*FFKCFLFXTKWXD XKEDVFHLLPXLLCIKFTYX*ISNIRDVNLXNDGKLQASHGRCTCWLNIQNINKNAETN* KKF*KTKKTLIGNH*C*Y**IYSYLSLRFR*RRFRNILNEAAKQQLLKPKL*VETLIK*S YASAAL*LPI*VSYKTMSDLNTNARL*NRLQFARYI*T*VLQFPKILQIHNFLAHYFSTG QT*PSYNT*QCVSRKR*EFDHRCQQLVAN*INP*LLKAKLITSLQLH*RRGRSQESX >_6 KRPLNIEVKNVIIMLGRRAPLVHVSKHPDRV*TITNGL*ELR*YGFIILQMFFVXYQMXR XKGRCVPSSPXPVMYKIYIXINK*HT*CESS**R*TP GISWSLYMLAQHPEYQQKCRDEL EEVLKDKEDIDW*SLMLILMNLLLFVSSISVAKI*KYFKRSGKTTVVKTKIISRDVD*IK LCFCRTITAYLSIIQNYVRLKYKCTVIEPSAVCSIYLDLSSAVS*NITNP*FSGTLFLHR SDLTKLQYLTMCIKETLRIRPPVPAISRQLDQPLTFKSKTHNVPPTTLAKGSFAGVX >sequence 153 QIIKERKKELETLVQEDNDNASTATNNEISSFKKRGTKHLDFLDILLQTK (0) 94 DENGNGLTLKEIRDEVDTFLFEGHDTTASG 195 (?) 381 IAWCLYNLAKHPEYQQRCREEVLEEVGEKEKIEW 488 LQW65663.x1 I-helix LQW258198.y1 LQW272485.y1 I helix LQW134597.x1 I-helix 2 diffs LQW222478.y1 LQW279367.x1 VGVFLLLRVCFRDGSRVGLVSSFCLSGLGVFWALGQS*V*VF*GFMYSCRSSHVTSSYACWKMERHLAIV*GNGDVQYLTLEP*CSVPCRRALTVE*RRRVRNHYN*YVYLNTLILIRICKTLIPIFDTALF*RIDTRFI*L*IRLH*CCPRVDVASYGESLQSTTHD*LDLPFFI*RKTLSKTSRLRSRNIRNGKFLLYSVAV*IACVQIL*HYFFGCSFS*QILMTPT*SSMLCS*MKCKTLYMHFH*IPSVTVNNRPI*IYLYIYTFYLQCTFNLYE*HMVADY*TKGRKSLKHSSKKTMIMPQLPPTTNYSQRCSWLP CGGVPFVTGLFPGWVARGAGFLFLSVWTWSVLGSWPVLSLSFLRFHVFLSVLTCHILLCMLENGTTSGHCMR*WGRSVPYPGTMMQCAMSTSTDSGVKTEGKKSLQLIRIFKYTNTYTYM*NTYTDI*YCAFLTYRHKIHITLDTATLMLSTS*RC*LWREFTIHYT*LTGSTIFHLTEDAFEN*STSFTKHPKR*VPTLQCSCIDRLCTDIITLFFRLLIFLTNLNDTNVIVYAMLLNEM*NPVYAFPLNTERNS**SSYINLFIHLHILFTMYIQLI*VTYGRRLLNERKKELETLVQEDNDNASTATNNELFTTMQLAA LWGCSFCYGSVSGMGRAWGWFPLFVCLDLECFGLLASLESEFFEVSCIPVGPHMSHPLMHVGKWNDIWPLYEVMGTFSTLPWNHDAVCHVDEH*QWSEDGG*EIITTDTYI*IH*YLYVYVKHLYRYLILRFSNVSTQDSYNFRYGYINAVHELTLLVMERVYNPLHMIDWIYHFSSNGRRFRKLVDFVHETSETVSSYFTV*LYRSLVYRYYNIIFSVAHFLNKS**HQRDRLCYALK*NVKPCICISTKYRA*QLIIVLYKFIYTFTHSIYNVHSTYMSDIWSQIIKRKEERA*NTRPRRQ**CLNCHQQRIIHNDAAGC >sequence 155 probable new C-term seq like 110 MLLFYLQYAVYATVCAFAVFLLPSVFT (?) SLKRFYTVRKNLNSQWPGPKGNWFW GSSAKVIAEVQKDSAYYFTYIKEMTKQFPQGFRGQLGPIFLSLNAYHPNMVKAVLCAPAS DAPKLNRAYKMLFEWLGHGLLVLEDKVWFRHRRLLTPSFHFEVLKPYVKTMNESAHVMVE NWLGKTSENKVVEIEIFHSASLMTLDTILKCLMSYQSNCQEEKSTNTYVAKIYQLSNTV VKRMRDLNLFKRIDPIYYLTK NGKLYKKLCDDVHKFSESVIDRRKCDIGQPAHNGTRKHFDFLDTLLKARDSDGKGLSDSE IRAEVDTFMFEGHDTTASGISWTFYCLAMHPEHQEKCFQEIEKVMADRTDIEW NDLSNLPHLTLCIKESLRQYPPVPIIFRKLNKDIEVDGKTIVK DTDVILHIYALHHHEEFWKDPHIFDPS RFTQENMKSMNSYAYVPFSAGPRNCIGQRFAMNEIKIAVAQVLRKFQLKPDLSKKIQHSV DVIYRATTGLYLKAERRV* LQW33193.x1 mid LQW189185.x1 mid cigd021n08 cign077p24 rcigd021n08_4 rcign078n05 cilv018c11 LQW157967.y1 LQW157967.y1.phd.1 LQW157967.x1 12:51:25 2001 TEMPLATE: LQW157967 DIRECTION: rev Length = 987 Score = 112 bits (277), Expect = 2e-24 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -2 Query: 40 DTDVILHIYALHHHEEFWKDPHIFDPSRFTQENMKSMNSYAYVPFSAGP 88 DTDVILHIYALHHHEEFWKDPHIFDPSRFTQENMKSMNSYAYVPFSAGP Sbjct: 182 DTDVILHIYALHHHEEFWKDPHIFDPSRFTQENMKSMNSYAYVPFSAGP 36 Score = 86.6 bits (211), Expect = 9e-17 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -3 Query: 1 NLPHLTLCIKESLRQYPPVPIIFRKLNKDIEVDGKTIVKDTDVILH 46 NLPHLTLCIKESLRQYPPVPIIFRKLNKDIEVDGKTIVK D+ L+ Sbjct: 547 NLPHLTLCIKESLRQYPPVPIIFRKLNKDIEVDGKTIVKGRDMQLN 410 >GCiWno449_a02.b1_4 VICLESSHDRI**CGLSPXQ*TIFHPD*VLQN*QKSS*MIVNYVISF*KSPHLYAHHRVR FTEFITVTPSFKVLYTTLHVLIIFIVAYTKFHCFNFHLH*KYNCYLTHNIVKSFL**LTK XMLAVVCICTLYLQN*V*FLVCKFF*VCHILGFNNKLLFTCYIIRFKNLKL*TFCLRR*I NLLHQVVKMLLFYLQYAVYATVCAFAVFLLPSVFTR*ICHFNFSIQLSTINHMI*TYYVT SAGRHNVKIFETIKILFR*NYYCQYLTA*SDFTQCAKISTANGRSKR*RFWGS >GCiWno449_a02.b1_5 GNMSRIQP*SDLIMWIISXAINHFSS*LSATKLTKIKLNDC*LCYFVLKIAPSLCPS*GQ VHRIYHSYTKF*SVVHHXACVDYFHCCVYQVSLL*LSPTLKIQLLPHSQYCQIFPLMINQ THVGGCMYMYIVSAELSIVFGV*VFLGLPYTRL**QIIVYMLYYQI*KPKALNILFAQVN *SFTSSS*DVVVLPTICSVRNCLCICSVPVTICFHKVNMSFQFFNPT*YN*SYDINLLCY FCWKA*CKNL*NH*NII*IKLLLPIFNSLKRFYTVRKNLNSQWPVQKVTVLGQX >GCiWno449_a02.b1_6 *YV*NPAMIGSNNVDYLLCNKPFFILIKCYKIDKNQVK*LLTMLFRFENRPIFMPIIGSG SQNLSQLHQVLKCCTPXCMC*LFSLLRIPSFTALTFTYIENTTATSLTILSNLSFND*PN XCWRLYVYVHCICRTKYSFWCVSFSRSAIY*ALITNYCLHVILSDLKT*SFKHFVCAGKL IFYIK*LRCCCFTYNMQCTQLFVHLQCSCYHLFSQGEYVISIFQSNLVQLII*YKPTMLL LLEGIM*KSLKPLKYYLDKIITANI*QLEAILHSAQKSQQPMAGPKGNGFGAV >sequence 109, 124, 161 82% identical to 129, 156 MVAQSQLESILLQNGGGFIFQTLLADVLLFAALVFVTAKYVSPAVKHQFKMKKCGKEVGG PKGHWFYGDLLE (0) NGYDKTGLLNSGKRCEEFPAMCTQWLGPVQMNVQLHHPDVTKTVLSKS (1) HPKGYAYDKFLKPLLQDGLVTSKGDLWKRHRRLLTPIFHFDILKS (2) HVQIFNQNTTELLDWMEEASKSDVGGNLMIPCSNMAFNNVMECVMSQKCSAKEG (2) EISTYTGYVKSMSNMMFQRLSRPLLHSDTLFRVSKLGKRFSIAKKGIEDYASK (0) LIKERRAILSSNSPNSELTTTNIKDEVTGTSFNFTRRKGKMVDFLDILIQTK (0) DQDGVGLKNDEINDEVITFFSAGHETVSN (0) AISWGLYTLASNLDCQTRCREEIKSAVGDKETLEW (2) ADLSKLPYLTQCIKEAMRLFPTLHVISRQLSEDVTLSHRFNDYKPIIIPKGVCVAVNIFAMSRNPHIWEEPE (0) KFNPDRFTPENTSKRSPHAFIPFGAGPR (2) NCIGQNFGMQQIRVVLSKVLRKYEVYVDETLPKPEMSPGVTVQPKDGVFIKVRKLTTQ* from opp end of LQW228254.x1 DEV54467.y1 exon 1 end overlaps with LQW129919.x1 DEV52918.y1 exon 1 LQW130015.x01 exon 2 LQW129919.x1 exon 2 LQW240742.y1 exon 2, 3 DEV39580.x1 exon 2, 3 DEV3074.x1 exon 3, 4 LQW189535.y1 exon 3, 4 LQW32382.y1 exon 4 LQW169285.x1 exon 4 LQW260543.y1 exon 4 LQW32382.y1 exon 5 LQW110672.y01 exon 5 LQW228254.x1 exon 5, 6 LQW42259.y1 exon 5, 6 DEV2923.y1 exon 6 DEV54340.x1 exon 7 LQW27594.y1 exon 7 LGJ635.y1 exon 7 LQW170001.x1 exon 7 LQW56717.x1 exon 7 DEV41759.y1 exon 7, 8 LQW240742.x1 exon 8 LQW130015.y01 exon 8 LQW247230.y1 exon 8 LQW129919.y1 exon 8 LQW189535.x1 exon 8 LQW42259.x1 exon 9 LQW247230.y1 exon 9 LQW189535.x1 exon 9 LQW228254.y1 exon 10, 11 DEV2923.x1 exon 11 >sequence 129, 156 this gene has 11 exons 36% to 4X1 (in the CYP4 clan) 82% identical to 109, 124, 161 genes 109 and 129 are on the same clone DEV3074.y1 facing in the same direction gene 129 is upstream of gene 109 MVAQSQLESLLLQSGGGFIFQTLLADVLLFAALVFVTAKYVSPAVKHQVLLRKCAKEVGGPKGHWFYGDLLE (0) YGYDETGVWNSVKRCEEFPAMCSQWLGPAQMNVQLYHPDVTKTVLSKS (1) YPKSYAYNKFLKPLLRDGLVTSKGDLWKRHRRLLTPIFHFDILKS (2) HVQIFNQNSSRLLEWMEETSKSDVGRDVAVPDCDMAFSNVMECVMSKKSSDLTG (2) ETTRYTGYVQSVSAMMFQRLCQPILHSDSMFKVSGLGRRFAVAKKGIEDYANK (0) IIIERRAILSSNSPNSELTTTTVKDDVTGTSFNFNRRKGKMVDFLDILIQTK (0) DQDGVGLTNDEINDEVITFFSAGHETVSN (1) AITWSLYTLASNLDCQTRCREEIKSAVGDKETLEW (2) ADLSKLPYMTQCIKEAMRLFPTLHVVGRQLTEDVTLSHRFNDWKPVTLPKGSSIGVNIFAMNRNPHIWDEPE (0) KFDPERFSPDNTANRSPHAFIPFGAGPR (2) NCIGQNFGMQQIRVVLSKVLRKYEVYVDETLPKPVMVPGVAMQPKNGVYIKVRKLSKE* BP027414 EST exon 2 to 5, exons 3 and 4 not found in genomic sequences AV971626 EST BP010058 EST AV898888 EST BP023443 EST LQW141572.x1 exon 1 opp end no P450 CDS LQW240657.x1 exon 1 opp end no P450 CDS LQW191525.x1 exon 1 LQW145987.y1 exon 1, 2 opp end no P450 CDS LQW210569.x1 exon 1, 2 LQW240657.x1 exon 2 YGYDETGV LQW255687.y1 exon 5 LQW141572.y1 exon 5 LQW210569.y1 exon 5, 6 LQW191525.y1 exon 5, 6 LQW69638.x1 exon 6 LQW245540.x1 exon 7 walked here from end of LQW69638.x1 LQW5631.y1 exon 7 DEV25004.y1 exon 7 LQW32382.x1 exon 7 1 diff DEV41759.y1 exon 7 1 diff LQW216930.x1 exon 7 DEV55885.x1 exon 8 LQW216930.x1 exon 8 DEV25004.y1 exon 8 DEV22419.y1 exon 8, 9 DEV52918.x1 exon 9, 10 LQW255687.x1 exon 9 LQW216930.x1 exon 9 LQW69638.y1 exon 11 heme to end LQW169285.y1 exon 11 heme to end DEV3074.y1 exon 11 heme to end opposite end = exons 3,4 of seq 161 (gene cluster) LQW189535.y1 c-helix LQW189535.x1 J-HELIX TO PKG LQW129919.x1 c-helix LQW129919.y1 J-helix LQW240742.x1 J-helix LQW240742.y1 C-helix LQW42259.x1 EXXR TO WXXP LQW247230.y1 EXXR TO WXXP DEV2923.x1 HEME >scf/ciona01/G126/seq_dir/hrs/G126P60510F.T0/G126P60510FG11.T0.seq 722 exon 1 MVAQSQIELLLLQSGGGFVFQTLLADILLLVVLAVVSAKLVVPTVKHQIKLKKCADEVGGPKMHWFYGDLIK (0) YAYNEESVWNSIKRCDEFPAVCRQWLGPFQMNVQLYHPDVTKTILAKS (1?) >scf/ciona01/G126/seq_dir/hrs/G126P67089F.T0/G126P67089FA7.T0.seq 734 exon 8 AITWTLYTLASNLDCQTRCREEIQSALGEKSNVQW 309 >sequence 157 IYPNIWGVHNDPKSWPNPSKFDPYRHIDEKGNYRNSSNVIPFLIGPRTCVGEALARQEIF IFLVKILQKFEVEPVPGETPSIADGVNSVVFSPHSFNLILQER* LQW192043.x1 wxxp >GCiWno549_g03.g1 CHROMAT_FILE: GCiWno549_g03.g1 PHD_FILE: GCiWno549_g03.g1.phd.1 CHEM: term DYE: big TIME: Mon Oct 22 11:01:29 2001 TEMPLATE: GCiWno549_g03 DIRECTION: rev Length = 919 Score = 58.2 bits (138), Expect = 2e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = +1 Query: 1 NIWGVHNDPKSWPNPSKFDPYR 22 NIWGVHNDPKSWPNPSKFDPYR Sbjct: 295 NIWGVHNDPKSWPNPSKFDPYR 360 >GCiWno549_g03.g1 CGCTGCACGAACAACTGCGGGGTAATGATAAACCAATATTACTACAGCGTTTTTTAAAGTTATAAGCTCACCAGACCAGT ATACGAGAACAGGTTAAGTTATTTATATATCAAGATAAAGTGTCAAAAAATGGCCAATATTGTGTCGGCGTCGTACAATA TATACACCAACAAAAATACATATACATTGTAACTCATAAGCGGGCCAGAGGTGTATGAAACAGAACACCCGTGTTATAAA GACTGTCGTTGCACCTGAAACATTTATTAAACCAAAACATTTCAGATATACCCAAATATATGGGGCGTCCACAACGATCC TAAATCTTGGCCAAACCCATCAAAGTTTGACCCGTACAGACACATTGACGAAAAGGGGAATTACAGGAATTCAAGCAACG TAATTCCATTCTTGATTGGACCTCGTACTTGCGTGGGAGAAGCTTTGGCTCGACAGGAGATTTTTATATTTTTGGTAAAA ATTCTCCAAAAGTTTGAAGTCGAACCGGTGCCTGGTGAAACGCCTTCAATAGCTGATGGCGTCAACAGTGTGGTTTTCAG TCCCCACAGTTTCAACCTTATACTGCAAGAACGCTAAGGCTGAGCAAATCTGTAGTAATTACTAATTATCTAATTAGAAT TTTTGCTGCGAATTGTGTCCATGTATATATCCAACACCGTCAACAAAGTGATAGGAAGAATGAACTTACTTTGTCTCTTC TCTCACGTAGCATGCTGTACTATATGCTCTATATTTACTAAAAATAAAATAACTCTGCTGTATTCCCCTTTGCTGCACTT TACTAAAAACAAAACAATGGTGGCGCAAGGGACCCGTCTACACAATATTTGCTACATTACCCATGCATNNTTGGACATCT GCGCTTAAACCATAGTCCCTGGNTCCCCTGCAATGGGAT >sequence 130 95% to seq 158 >rcicl077k01 Length = 631 Score = 420 bits (1069), Expect = e-117 Identities = 200/209 (95%), Positives = 205/209 (97%) Frame = -3 Query: 23 GHDTTASGIAWSLYCLAANEEYQEKCREEIEQVVGSKDALEWQDLSKLPFVTMFIKEVLR 82 GHDTTASGIAWSLYCLAANEEYQEKCREEIEQVVGSKDALEWQDLSKLPFVTMFIKEVLR Sbjct: 629 GHDTTASGIAWSLYCLAANEEYQEKCREEIEQVVGSKDALEWQDLSKLPFVTMFIKEVLR 450 Query: 83 LYPPVFAVARRTEQPVKFPRGFGRDQLNVGDEQLPKSDCSRVVXAPLNIGIPIMTLHRNE 142 LYPPVFAVARRT+QPVKFPRGFG DQ NVGDEQLPKSDCSRVV APLNIGIPIMTLHRNE Sbjct: 449 LYPPVFAVARRTKQPVKFPRGFGGDQFNVGDEQLPKSDCSRVVDAPLNIGIPIMTLHRNE 270 Query: 143 QVWEDAKVFDPYRFSTENCAKRSPYAYLPFSAGPRNCIGQNFAMAELKTVLVRTLLRYKL 202 QVWEDAKVFDPYRFSTENCAKRSPYAYLPFSAGPRNCIGQNFAMAELKTVLVRTLL+YKL Sbjct: 269 QVWEDAKVFDPYRFSTENCAKRSPYAYLPFSAGPRNCIGQNFAMAELKTVLVRTLLKYKL 90 Query: 203 YVDNQCPDPKMSPMIVLKSLNGIHIKLKK 231 YVDN+CPDPKMSPMIVLKSLNGI+IK +K Sbjct: 89 YVDNECPDPKMSPMIVLKSLNGIYIKFRK 3 >sequence 158, 146 almost = seq 130 11 exons similar to 4T5 there is evidence for two different C-terminal seqs at 5 aa only this N-term is from a different gene that may be a pseudogene without a C-terminal MKSEISVDKGAVGDGLDSQVNSVYAWLSEVAPDSMTDDFEL NQEAISYLHEWIELEKHEKMTSDKLEQTIAREIVEHRAESQRLGKILSFVGLQPCDLSPK ATVSLKILTECATHLDVLVPNEVFLTTALSEFSLSLDKKEMQIAERENLQEDLQEGIAEI KVLNNTLQRELSELNEKLNDEMKNAEFLAKRTKVYQAKNMEYQKTI QRLSQEFKSLGFRSEISHEELVKRGDEI KDLQEKLKPLRLYLDSFQNLPADLTKARLKLHEETQNLSELEDTLNNTIINLNG WSLYCLAANEEYQEKCREEIEQVVGSKDALEWQDLSKLPFVTMFIKEVLRLYPPVFAVA RRTEQPVKFPRGFGRDQLNVGDEQLPKSDCSRVVXAPLNIGIPIMTLHRNEQVWEDAKVF DPYRFSTENCAKRSPYAYLPFSAGPRNCIGQNFAMAELKTVLVRTLLRYKLYVDNQCPDP KMSPMIVLKSLNGIHIKLKKI* MLLPDYLEFSLSLYSIGAVCVVVFLYKSRKLIGRFLKERRIRKELTKEIDGPQPHWLFGHLNL (0?) LQPNEETILKTCEQTQKYPKLGMVWFGPALAYLMVFHPHVVRPVLNVE (?) HPKDNLAYRFIKPWIGDGLLVSHGSKWRRNRHLLTKAFHFDILKQ (?) YTKVFDACCKTMLEKWSRKCDGSTVEVFRPVSLMTLDSMLQCAISCETECQQEG (?) NRNSNTYTDAVFTLTTIAMKRIFNPFCHVDWIFAMTKSGRQFKAAAKLIHEFDEK (?) VIRERRQENKKILGRSDDEDLTQEDLEKITSWRKSDGRYLDFLDMLILTR (?) DDDGKGLTEREIRDEVDTFLFEGHDTTASGIAWSLYCLAANEEYQEKCREEIEQVVGSKDALEW (?) QDLSKLPFVTMFIKEVLRLYPPVFAVARRTEQPVKFPRGFGRDQLNVGDEQ (?) LPKSDCSRVVXAPLNIGIPIMTLHRNEQVWEDAK (?) VFDPYRFSTENCAKRSPYAYLPFSAGP (?) RNCIGQNFAMAELKTVLVRTLLRYKLYVDNQCPDPKMSPMIVLKSLNGIHIKLKKI* ciad066m08_1 = seq 146 rciad066m08_4 = seq 130 seq 158 magenta too long vs human citb099l21 N-term cicl007c05 N-term citb099l21 N-term citb038b12 N-term cieg018p24 N-term LQW165994.x1 HEME TO END rcicl077k01 = seq 130 not 158 rciad066m08 C-term GCiWno480_g04.b1 in gap GCiWno480_g04.g1 in gap GCiWno38_h04.b1 >scf/ciona01/G126/seq_dir/hrs/G126P67830F.T0/G126P67830FH2.T0.seq 721 file 2 721 ABI Length = 721 Plus Strand HSPs: Score = 200 (70.4 bits), Expect = 8.2e-16, P = 8.2e-16 Identities = 37/44 (84%), Positives = 41/44 (93%), Frame = +1 Query: 1 QDLSKLPFVTMFIKEVLRLYPPVFAVARRTEQPVKFPRGFGRDQ 44 QDLSKLPFVTMFIKEVLRLYPPVFA+ARRT+ ++FPRGFG DQ Sbjct: 574 QDLSKLPFVTMFIKEVLRLYPPVFAIARRTQHAIQFPRGFGADQ 705 Evidence for walk from CQQEG to NRNS exons LQW271226.y1 sequence a LQW271226.y1.phd.1 LQW271226.x1 12:35:43 2001 TEMPLATE: LQW271226 DIRECTION: rev Length = 727 Score = 73.4 bits (177), Expect = 5e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 4 DGSTVEVFRPVSLMTLDSMLQCAISCETECQQEG 37 DGSTVEVFRPVSLMTLDSMLQCAISCETECQQEG Sbjct: 726 DGSTVEVFRPVSLMTLDSMLQCAISCETECQQEG 625 Score = 109 bits (271), Expect = 4e-24 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -2 Query: 38 NRNSNTYTDAVFTLTTIAMKRIFNPFCHVDWIFAMTKSGRQFKAAAKLIHE 88 NRNSNTYTDAVFTLTTIAMKRIFNPFCHVDWIFAMTKSGRQFKAAAKLIHE Sbjct: 330 NRNSNTYTDAVFTLTTIAMKRIFNPFCHVDWIFAMTKSGRQFKAAAKLIHE 178 >LQW271226.y1_4 DGSTVEVFRPVSLMTLDSMLQCAISCETECQQEG*IINLYDILHVR*TRK*NIVV*GKME HIFILFPRSVW**TNNIQRI*AVYRHNFHGPLLIV*NKIRIFR*YVLTVSHFTP*HYSVH IYGKHLSKI*F*NRNSNTYTDAVFTLTTIAMKRIFNPFCHVDWIFAMTKSGRQFKAAAKL IHEFDEKVYDY*RYKYLTEFKCILPDRDWYYTA*VIHNS*LVVINLLCNLKMTIIGVPAD VS >LQW271226.y1_5 *RFYGRSV*AS*SDDPGQYAAVCNIV*NRMPTRRVNN*PLRYTTRTVNT*VKHSSVGKDG THFYSISSFRLVVNK*HSTNLSRISSQLPRTVVNCLKQD*DI*IICANSVPFYPIALFCT HIW*TP**NIILKQEQQHLYRRGIHPNHNCYETNFQPILSR*LDFCDDKKWASV*SGGQT YSRI**KGI*LLTV*VLDRIQMYLA*SRLVLYSMSDTQLVTCCNKPAM*PENDNHWGTG* CIX >LQW271226.y1_6 TVLR*KCLGQLV**PWTVCCSVQYRVKQNANKKGK*LTFTIYYTYGKHVSET**CRERWN TFLFYFLVPFGSKQITFNEFKPYIVTTSTDRC*LFKTRLGYLDNMC*QCPILPHSTILYT YMVNTLVKYNSKTGTATLIQTRYSP*PQLL*NEFSTHFVTLTGFLR*QKVGVSLKRRPNL FTNLMKRYMIIDGIST*QNSNVSCLIATGIIQHE*YTTRNLL**TCYVT*K*QSLGYRLM YP Other seq a accessions LQW193399.x1 matches intron also DEV54197.y1 seq b this seq differs from above seq at two aa 130 vs 158? Check intron seq for diffs. CHEM: term DYE: ET TIME: Fri May 4 12:31:28 2001 TEMPLATE: DEV54197 DIRECTION: rev Length = 725 Score = 106 bits (261), Expect = 6e-23 Identities = 49/51 (96%), Positives = 49/51 (96%) Frame = -2 Query: 38 NRNSNTYTDAVFTLTTIAMKRIFNPFCHVDWIFAMTKSGRQFKAAAKLIHE 88 NRNSN YTDAVFTLTT AMKRIFNPFCHVDWIFAMTKSGRQFKAAAKLIHE Sbjct: 199 NRNSNAYTDAVFTLTTTAMKRIFNPFCHVDWIFAMTKSGRQFKAAAKLIHE 47 Score = 80.8 bits (196), Expect = 3e-15 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 1 RKCDGSTVEVFRPVSLMTLDSMLQCAISCETECQQEG 37 RKCDGSTVEVFRPVSLMTLDSMLQCAISCETECQQEG Sbjct: 606 RKCDGSTVEVFRPVSLMTLDSMLQCAISCETECQQEG 496 Intron seqs differ >LQW223280.y1_1 *PDLISTYKQSVFPNTISCMQCAV*LITYTQVH*SFRCMLQNNVRKVVAEM*RFYGRSV* AS*SDDPGQYAAVCNIV*NRMPTRRVNN*PLRYTI HVR*TRK*NIVGWGKMGHIFILFSH SIW**TNNIQRI*AVYRHNSHGPLLIV*NKIRIFG*YVLTVSHFTP*HYSVHIYGKHLSK I*FYNRNSNAYTDAVFTLTTTAM KRIFNPFCHVDWIFAMTKSGRQFKAAAKLIHEFDEKV YDY*RYKYLTEFKFILPDREWYIQHE*YTLVTVGITCYVFCNEHPWLTLCVMSVIX >LQW223280.y1_2 SRTSFRHINSQYFPTLLAACNAQYS**RIHRYTKVFDACCKTMLEKWSRKCDGSTVEVFR PVSLMTLDSMLQCAISCETECQQEG*IINLYDIL YTYGKHVSET**GGERWDTFLFYFLI PFGSKQITFNEFKPYIVTTPTDRC*LFKTRLGYLDNMC*QCPILPHSTILYTYMVNTLVK YNSTTGTATLIQTRYSP*PQLL*NEFSIHFVTLTGFLP*QKVGGSSKRRPNLFTNLMKRY MIIDGIST*QNSNLSCLIANGIYSMSDTHS*LLV*PAMYFAMSTLG*PCV*CP*L >LQW223280.y1_3 AGPHFDI*TVSISQHY*LHAMRSIVNNVYTGTLKFSMHAAKQC*KSGRGNVTVLR*KCLG QLV**PWTVCCSVQYRVKQNANKKGK*LTFTIYYTRTVNT*VKHSRVGKDGTHFYSIFSF HLVVNK*HSTNLSRISSQLPRTVVNCLKQD*DIWIICANSVPFYPIALFCTHIW*TP**N IILQQEQQRLYRRGIHPNHNCYETNFQSILSR*LDFCHDKKWAAVQSGGQTYSRI**KGI *LLTV*VLDRIQIYLA*SRMVYTA*VIHTRNCWYNLLCILQ*APLANLVCNVRN Other seq b accessions LQW46299.y1 LQW223280.y1 matches intron seq also 92% to other intron seq DEV54197.y1 matches intron seq also LQW33146.y1 LQW165994.y1 DEV22920.x01 matches intron seq also Seq b intron and flanking exon region PVSLMTLDSMLQCAISCETECQQEG*IINLYDIL HVR*TRK*NIVGWGKMGHIFILFSH SIW**TNNIQRI*AVYRHNSHGPLLIV*NKIRIFG*YVLTVSHFTP*HYSVHIYGKHLSK I*FYNRNSNAYTDAVFTLTTTAM >LQW232957.y1_1 *IESVPLNRWLCCHVPLN*NIRCIKPHRPFILFAAVLAVAIQEFFL*VYIFFSIFSLSAH FKITFFNRRI*PKPV*NCTKKLKIYPNLRIR*TTPLLT*TGNKLGMSVCHYNCFLPSIGI FQLISLVLFCRAESVDFEWSC*NIHALCYIVLLGK*ECKHSIMR*LLFGWTDKMFLHFLS Q*KKRKLILDGVSGLPLKSNLALHIYLGHHC*SV**LSTGGSCYYKNTL*MDAYFQVKKS MLNHSVFFCETFDYLTAQLKIE >LQW232957.y1_2 RSSRYL*IDGYAVMSH*IRTLGV*NLIDHLSYLQLCLLWQSKNFFFKCTFFSLYFH*VHI LK*PSLIAGFNQSPFKIARRNSKSIRT*GYVKQHHY*PKRVTNLVCQYVTIIVFYPQ*VF FNLFL*FYSAELNQWISSGVAEISMLCVTLYCLGNRNVNTL*CGNCCSVGLTKCFCIFFL SEKNAS*FWMAFQGYH*SPI*LYIFI*DIIVDLYDDSLLAVVAIIKTHYKWMLTFKLRNR C*IIQYFFAKHLIT*QHSLK* >LQW232957.y1_3 same exon seq but surrounding gene seq is different is this a very similar gene with differeences in the introns? DRVGTFESMAMLSCPTELEH*VYKTSSTIYLICSCACCGNPRIFSLSVHFFLYIFIKCTF *NNLL*SQDLTKARLKLHEETQNLSELEDTLNNTIINLNG*QTWYVSMSL*LFFTLNRYF STYFFSFILQS*ISGFRVELLKYPCFVLHCTAWEIGM*TLYNAVTAVRLD*QNVSAFSFS VKKTQVDFGWRFRVTIKVQFSSTYLSRTSLLICMMTLYWR*LLL*KHIINGCLLSS*EID VESFSIFLRNI*LLNSTA*NR >GCiWno480_g04.b1_1 KLGMSVCHYNCFLPSIGIFQLISSVLFCRAQSVDFEWSC*NIHALCYIVLLGK*ECKHSI MR*LLFGWTDRMFLHFLSQ*KKRKSILDGISGLPLKSYLALHIYLGHHC*SV**LSTGGS CYYKNTL*MDAYFQVKKLMLKHSVFFCETFDYLTAQHKIEKKCFFFDFWCKNFRSSLT*C GFH*VI*GQSSATFSDQDIGCPRTIYTSTTCVLVQSSARPWRNFVQYSSCIKLL*VGFSR EKYF*KYLGPAETVXMRTEIAWRSFRSKICTG*KP*NTKYSIYGEGKMXTXFILFLCTIX >GCiWno480_g04.b1_2 NLVCQYVTIIVFYPQ*VFFNLFLQFYSAELNQWISSGVAEISMLCVTLYCLGNRNVNTL* CGNCCSVGLTECFCIFFLSEKNASRFWMAFRGYH*SPI*LYIFIWDIIVDLYDDSLLAVV AIIKTHYKWMLTFKLRN*C*NIQYFFAKHLIT*QHSIK*RKNVFSLTFGVKTSDLL*LDV DSIK*FKDNHRRHFRIRTLVVHVQFIPQQRAY*YSLQLGHGEILSNTVPV*NFYKWAFRV KNIFRNTSGLQRRXVCVRRSLGAVFGRKSVRVKNPEIQSIVYMVRERWXLXSFYFYVQL >GCiWno480_g04.b1_3 TWYVSMSL*LFFTLNRYFSTYFFSFILQSSISGFRVELLKYPCFVLHCTAWEIGM*TLYN AVTAVRLD*QNVSAFSFSVKKTQVDFGWHFGVTIKVLFSSTYLSGTSLLICMMTLYWR*L LL*KHIINGCLLSS*EIDVETFSIFLRNI*LLNSTA*NREKMFFL*LLV*KLQIFFNLMW IPLSDLRTIIGDIFGSGHWLSTYNLYLNNVRTSTVFSSAMAKFCPIQFLYKTFISGLFA* KIFLEIPRACRDGXYAYGDRLAQFSVENLYGLKTLKYKV*YIW*GKDGXXFHSIFMYN >GCiWno480_g04.g1_4 DIGCPRTIYTQTTCVXVQSQLRPWRILSNTVPVXNFIKWLFA*KNIFRNTSGLQRTVGMR TEIAWRSFRSKICTG*KPXNTKV*YIW*GKMGLVFILFLCTIW**TKIFTEIYIQLGCGK MGHLLTPFSRSI*C*TKNIQRIIKLYPHDSYRTLVIV*NTIRIFRYYVLKVSHIPPVPYY ITVIPRHQSALFKQSLRNTRLRNMGFSCQRIPILLHSTVIIHLYCHWES*HPL*TQPEVS LKILGLVHTFASSQTCALR*SVMIGMPMFKGASTTLLQSDLGSCKCLFRNISANIDGVKY GGVRWNTFSTSY >GCiWno480_g04.g1_5 GHWLSTYYLYSNNVRXSTVSAAAMANFVQYSSCIXLYKVAFRVKKYF*KYLGPAENGRYA YGDRLAQFSVENLYGLKT*XYKSIVYMVRKDGTCFHSIFMYNLVVNKNIYRNIYTVRVWK DGTPFNSIFSFHLVLNKEHSKNY*TISSRLL*NVGNCLKHDQDI*ILCA*SVPYPPSTLL YNRNSTTPKCVV*AKFKKYTFKKYGI*LPTDSHLTPQYCNHPFILSLGKLTSAINTARSK SKDLRSSTYLRVFPNLCVTMKRHDRNADV*RCVHHSAAVGFRKL*MFV*KHIC*Y*WCKV RWGKMEHL*HIIX >GCiWno480_g04.g1_6 TLVVHVLFILKQRAX*YSLSCGHGEFCPIQFLYXTL*SGFSREKIFLEIPRACRER*VCV RRSLGAVFGRKSVRVKNLXIQKYSIYGEERWDLFSFYFYVQFGSKQKYLQKYIYS*GVER WDTF*LHFLVPFSVKQRTFKELLNYILTTPIERW*LFKTRSGYLDIMCLKCPISPQYPTI *P*FHDTKVRCLSKV*EIHV*EIWDLVANGFPSYSTVL*SSIYIVIGKADIRYKHSQK*V *RS*V*YIPSRLPKLVRYDEAS*SECRCLKVRPPLCCSRI*EAVNVCLETYLLILMV*ST VG*DGTPLAHHX >GCiWno38_h04.b1_4 PSP**YTVFHDTKVVV*AKFKKYTLRNMDLVPTGIPSYSTVLQSSXYIVIGKADXPL*TQ PEVSLKILGLVHTFASSQTCSLR*SVMIGMPMFKGASTTLLQSDLGSCKCLFRNISANID GVKYGGVRWNTFSTSYPNIPIVF*TINNGL*GVLRIRLYIFLNVLCLLPNGAEKWNEKEF HLPPPYYTLSITCSSPTLN*SPPNPRGNLTGCSVLLATANTGG*SRSTSFINIVTNGSFD RSCLHTNFT*FISDFQ*RTVNTDLTIPRHLLIPQLVQFLPYIFLIFLISCKTIYEGICSV *PAGKLRSD >GCiWno38_h04.b1_5 PQSLIIYRIPRHQSGCLSKV*EIHVKKYGFSAHXYPILLHSTAIIHXYCHWES*HXAINT ARSKSKDLRSSTYLRVFPNLFVTMKRHDRNADV*RCVHHSAAVGFRKL*MFV*KHIC*Y* WCKVRWGKMEHL*HIISKYPDRVLNNQQRPIRSLEDTTLYIFKCALFTTKWGGKME*KGV PSPPTLLYIVHYLFIADVELITTKSSRKFNRLFSSSRNCKHRWIKSKYFFYKHRNERQL* *ILPTYKFYMIYFRLSITNCQY*SHHSKASFDPTTCSISSLHFLDIPH*LQDHI*GDLQC LTGRQAKIRX >GCiWno38_h04.b1_6 PVPNNIPYSTTPKWLFKQSLRNTR*EIWI*CPXVSHLTPQYCNHPXILSLGKLTXRYKHS QK*V*RS*V*YIPSRLPKLVRYDEAS*SECRCLKVRPPLCCSRI*EAVNVCLETYLLILM V*STVG*DGTPLAHHIQISRSCFKQSTTAYKES*GYDFIYF*MCFVYYQMGRKNGMKRSS ISPHPIIHCPLPVHRRR*IDHHQILAEI*PVVQFFSQLQTPVDKVEVLLL*TS*RTAALI DLAYIQILHDLFPTFNNELSILISPFQGIF*SHNLFNFFPTFS*YSSLAARPYMRGSAVF NRQAS*DPX >rciad066m08_1 QHKIEQNVFSLTFGVKLQIFFNLMWIPLSDLRTNXRRHFRIRTLVVHVQFVPQQRAYQYS L*LSHGEILSDTVPRACRER*VSVRRSLGAVFGRKSVRVKNLRVFPNLFVTMKRHDRNSD V*RCVHHSAAVGFRKLFIADVELITTKSSRKFNRLFSSSRNCKHRWIKSKYFFYKHRNER QPLIDLAIPRHLLIPQLVQFLPYIFFLIFLISCKTI**PX >rciad066m08_2 SIK*SKMFFL*LSV*NFRSSLT*CGFH*VI*GQXIGDIFGSGHWLSTYNLYLNSVRTSTV FSSAMAKFCPIQFLGPAEKGR*AYGDRLAQFSVENLYGSKTFASSQTCSLR*SVMIGIPM FKGAXTTLLQSDLGSCSSPTLS*SRPNPRGNLTGCSVLLATANTGG*SRSTSFINIVTNG SL**ILPFQGIF*SHNLFNFFPTFFS*YSSLAARQYNDQ >rciad066m08_3 A*NRAKCFFFDFRCKTSDLL*LDVDSIK*FKDKXSATFSDQDIGCPRTICTSTACVPVQS LAQPWRNFVRYSSSGLQRKVGKRTEIAWRSFRSKICTGQKPSRLPKLVRYDEAS*SEFRC LKVRXPLCCSRI*EAVHRRR*VDHDQILAEI*PVVQFFSQLQTPVDKVEVLLL*TS*RTA AFDRSCHSKASFDPTTCSISSLHFFLDIPH*LQDNIMT >rciad066m08_4 = seq 130 seq 158 WSLYCLAANEEYQEKNVGKKLNKLWDQKMPWNGKIYQRLPFVTMFIKEVLRLYPPVFAVA RRTEQPVKFPRGFGRDQLNVGDEQLPKSDCSRVVXAPLNIGIPIMTLHRNEQVWEDAKVF DPYRFSTENCAKRSPYAYLPFSAGPRNCIGQNFAMAELKTVLVRTLLRYKLYVDNQCPDP KMSPXICP*IT*WNPHQVKEDLKFYTESQRKNILLYFML >rciad066m08_5 LVIILSCS**GISRKKCREEIEQVVGSKDALEWQDLSKAAVRYDVYKRSTSTLSTGVCSC EKN*TTG*ISARIWS*STQRRR*TAS*IRLQQSGXRTFKHRNSDHDASS*RTSLGRREGF *PVQIFDRKLRQAISVRLPTFLCRPEELYRTKFRHG*AKDCTGTHAVEVQIVRGQPMS*S ENVADXLSLNHLMESTSS*RRSEVLHRKSKKKHFALFYAX >rciad066m08_6 GHYIVLQLMRNIKKKM*GRN*TSCGIKRCLGMARSIKGCRSLRCL*KKYFDFIHRCLQLR EELNNRLNFREDLVVINSTSAMNSFLNPTAAEWXTHL*TSEFRS*RFIVTNKFGKTRRFL TRTDFRPKTAPSDLRTLTYLSLQARGTVSDKISPWLS*RLYWYARC*GTNCTWTTNVLIR KCRRXFVLKSLNGIHIKLKKI*SFTPKVKEKTFCSILCX >ciad066m08_1 = seq 146 RRCRYAA MLLPDYLEFSLSLYSIGAVCVVVFLYKSRKLIGRFLKERRIRKELTKEIDGPQ PHWLFGHLNLLQPNEETILKTCEQTQKYPKLGMVWFGPALAYLMVFHPHVVRPVLNVEHP KDNLAYRFIKPWIGDGLLVSHGSKWRRNRHLLTKAFHFDILKQYTKVFDACCKTMLEKWS RKCDGSMVEVFRPVSLMTLDSMLQCAISCETECX >ciad066m08_2 AVVDTLLCCYRII*NSA*VCTVLERFVW*CFCTSLES*LVDF*KKGAYAKSSRRKLMARS HIGCLVT*ICFNQMKKLSSKHANRHKNTRNLEWCGLVQH*RT*WYFIRM*CDLY*TLNTR RTTWRTDSSNHGLATDCWLATAVSGEETAIYLLKLFISTY*NSTLKFSMHAAKQC*KSGR GNVTVPW*KCLGQLV**PWTVCCSVQYRVKRNA >ciad066m08_3 PL*IRCYAVTGLFRIQLKFVQYWSGLCGSVFVQVSKVNW*IFERKAHTQRAHEGN*WPAA TLVVWSPKSASTK*RNYPQNMRTDTKIPETWNGVVWSSISVLDGISSACSATCTER*TPE GQLGVQIHQTMDWRRIAG*PRQ*VAKKPPSTY*SFSFRHIKTVH*SFRCMLQNNVRKVVA EM*RFHGRSV*AS*SDDPGQYAAVCNIV*NGM >ciad066m08_4 AFRFTRYCTLQHTVQGHQTNWPKHFYHGTVTFPRPLF*HCFAACIENFSVLF*YVEMKSF SK*MAVSSPLTAVANQQSVANPWFDESVRQVVLRVFNVQYRSHYMRMKYHQVR*CWTKPH HSKFRVFLCLFACFEDSFFIWLKQI*VTKQPMWLRAINFLRELFAYAPFFQKSTN*LSRL VQKHYHTNRSNTVQT*AEF*IIR*QHSSVSTTA >ciad066m08_5 GIPFHTILHTAAYCPGSSD*LA*TLLPWNRHISATTFLTLFCSMHRKL*CTVLICRNEKL **VDGGFFATYCRG*PAIRRQSMV**ICTPSCPSGVQRSVQVALHADEIPSSTLMLDQTT PFQVSGIFVSVRMF*G*FLHLVEADLGDQTTNVAAGHQFPS*ALCVCAFLSKIYQLTFET CTKTLPHKPLQYCTNLS*ILNNPVTA*QRIYNGX >ciad066m08_6 HSVSHDIAHCSILSRVIRLTGLNTSTMEPSHFRDHFSNIVLQHASKTLVYCFNMSK*KAL VSRWRFLRHLLPWLTSNPSPIHGLMNLYAKLSFGCSTFSTGRTTCG*NTIKYANAGPNHT IPSFGYFCVCSHVLRIVSSFG*SRFR*PNNQCGCGPSISFVSSLRMRLSFKNLPINFRDL YKNTTTQTAPILYKLKLNSK*SGNSIAAYLQRR LQW251090.y1 LQW251090.y1.phd.1 LQW251090.x1 11:10:30 2001 TEMPLATE: LQW251090 DIRECTION: rev Length = 732 Score = 48.4 bits (113), Expect(3) = 1e-19 Identities = 19/22 (86%), Positives = 22/22 (99%) Frame = +3 Query: 14 EKNVGKKLNKLWDQKMPWNGKI 35 +KNVGKKL+KLWDQKMPWNG+I Sbjct: 390 KKNVGKKLSKLWDQKMPWNGEI 455 Score = 48.4 bits (113), Expect(3) = 1e-19 Identities = 22/23 (95%), Positives = 23/23 (99%) Frame = +1 Query: 38 RLPFVTMFIKEVLRLYPPVFAVA 60 +LPFVTMFIKEVLRLYPPVFAVA Sbjct: 526 KLPFVTMFIKEVLRLYPPVFAVA 594 Score = 37.5 bits (85), Expect(3) = 1e-19 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 1 WSLYCLAANEEYQEK 15 WSLYCLAANEEYQEK Sbjct: 353 WSLYCLAANEEYQEK 397 >LQW251090.y1_1 ADYIISWSCFKNYNGHESREDTVL*LFKCFSFTTKWDEKIGKKVSHLTPTYYIHFCRIAI FSCGW*L*LRKQELT*HLT*SFVFVG**WERFN*ARNTGRSGHFSV*RSRHYG*RHCLVI ILSCS**GISRKM*GRN*ASCGIKRCLGMVRSVLTVRY*NSEIKHVKFVCRQDLSKLPFV TMFIKEVLRLYPPVFAVARRTEQPVKFPRGFGGDQFNVDDEQVMDHVS*GGGRWDPFSFH FSGP >LQW251090.y1_2 PTI*YPGRVLRITTVTKVVRIRFYNYSNVFRLPPNGTRK*EKRCPILPQPITYTFAE*PS LAVGGNFNCESRNLLNI*LKALCL*DDDGKGLTEREIRDEVDTFLFEGHDTTASGIAWSL YCLAANEEYQEKCREEIEQVVGSKDALEW*DQY*QFVIEIRK*SM*NLYVGKIYQSCRSL PCL*KKYFDFIHRCLQLREELNNRLNFREDLVVINSMSTMNR*WTMSHKVGGDGTPFHSI FPA >LQW251090.y1_3 RLYNILVVF*ELQRSRKS*GYGFIIIQMFFVYHQMGRENRKKGVPSYPNLLHTLLQNSHL *LWVVTLTAKAGTYLTFNLKLCVCRMMMGKV*LSAKYGTKWTLFCLKVTTLRLAALLGHY IVLQLMRNIKKNVGKKLSKLWDQKMPWNGEISIDSSLLKFGNKACKICM*ARSIKAAVRY HVYKRSTSTLSTGVCSCEKN*TTG*ISARIWW*SIQCRR*TGNGPCLIRWGEMGPLFIPF FRP ciad066m08_1 = seq 146 rciad066m08_4 = seq 130 seq 158 MLLPDYLEFSLSLYSIGAVCVVVFLYKSRKLIGRFLKERRIRKELTKEIDGPQ PHWLFGHLNLLQPNEETILKTCEQTQKYPKLGMVWFGPALAYLMVFHPHVVRPVLNVEHP KDNLAYRFIKPWIGDGLLVSHGSKWRRNRHLLTKAFHFDILKQYTKVFDACCKTMLEKWS RKCDGSTVEVFRPVSLMTLDSMLQCAISCETECQQEG NRNSNTYTDAVFTLTTIAMKRIFNPFCHVDWIFAMTKSGRQFKAAAKLIHEI VIRERRQENKKILGRSDDEDLTQEDLEKITSWRKSDGRYLDFLDMLILTR DDDGKGLTEREIRDEVDTFLFEGHDTTASGIA WSLYCLAANEEYQEKCREEIEQVVGSKDALEW QDLSKLPFVTMFIKEVLRL YPPVFAVA RRTEQPVKFPRGFGRDQLNVGDEQ LPKSDCSRVVXAPLNIGIPIMTLHRNEQVWEDAKVF DPYRFSTENCAKRSPYAYLPFSAGPRNCIGQNFAMAELKTVLVRTLLRYKLYVDNQCPDP KMSPMIVLKSLNGIHIKLKKI* >GCiWno307_h20.g1_4 PGSSNPVNGAGLLVSPGQ*VGKKPPMYLIKLFIWHY*NSSVFPNTISCMQCAV*LITYTQ VH*SFRCMLQNNVRKVVAEM*RFHGRSV*AS*SDDPGQYAAVCNIV*NGMPTRRVNN*PL RYTIHVR*TRK*NIVGWGKMGHIFILFSHSIW**TNNIQRI*AVYRHNSHRPLLIV*NKV RIFG*YVLTVSHFTP*HYSVHIYGKHLSKI*F*NRNSNTYTDAVFTLTTIAMKRIFNPFC HVDWIFAMTKSGRQFKAAAKLIHEI*XKGLR*DKVHSKMSV*FMVHRCFPVKRRPCQXPF YQ >GCiWno307_h20.g1_5 XRFIQPSEWRRIAG*PRPVSGEEAAHVLNKAFHLALLKQFSISQHY*LHAMRSIVNNVYT GTLKFSMHAAKQC*KSGRGNVTVPW*KCLGQLV**PWTVCCSVQYRVKRNANKKGK*LTF TIYYTRTVNT*VKHSRVGKDGTHFYSIFSFHLVVNK*HSTNLSRISSQLPQTVVNCLKQG *DIWIICANSVPFYPIALFCTHIW*TP**NIILKQEQQHLYRRGIHPNHNCYETNFQSIL SR*LDFCDDKKWAAV*SGGQTYSRDLXKRIKVR*GSQ*NVGLVHGS*MFSSKTTAMPXAI LPX >GCiWno307_h20.g1_6 QVHPTQ*MAPDCWLAPASKWGRSRPCT**SFSFGIIKTVQYFPTLLAACNAQYS**RIHR YTKVFDACCKTMLEKWSRKCDGSMVEVFRPVSLMTLDSMLQCAISCETECQQEG*IINLY DILYTYGKHVSET**GGERWDTFLFYFLIPFGSKQITFNEFKPYIVTTPTDRC*LFKTRL GYLDNMC*QCPILPHSTILYTYMVNTLVKYNSKTGTATLIQTRYSP*PQLL*NEFSIHFV TLTGFLR*QKVGGSLKRRPNLFTRFDXKD*GKIRFTVKCRSSSWFIDVFQ*NDGHAKXHF TX LQW152517.x1 LQW152517.x1.phd.1 LQW152517.y1 14:27:00 2001 TEMPLATE: LQW152517 DIRECTION: fwd Length = 960 Score = 69.5 bits (167), Expect = 3e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 50 DDDGKGLTEREIRDEVDTFLFEGHDTTASGIA 81 DDDGKGLTEREIRDEVDTFLFEGHDTTASGIA Sbjct: 256 DDDGKGLTEREIRDEVDTFLFEGHDTTASGIA 161 >LQW152517.x1_4 FLRMLVFSCFCSGGLLSVQCGFSVLLVWFVSRSPCSFCSLFVSRIWGWVPVVLVLVLGSC FLRCFVSLFVLYSFVVPWLRDFDLIWLGYFVVFFSTWCLWASVYFFIFLT*DACVCHLSP LFYGTLFLSGGGYIFFY*FVKACLSFPSLPPPYYIIGWGKMGHL*HLIYKYPDRVLKN*L R*TKVVRIRFYNYLNVLRLPPNGTRK*NEKVSHLPPTYYIHFCRIAFNLKLCVCRMMMGK V*LSAKYGTK*TLFCLKVTTLRLAALLGHYIVLQLMRNIKKNVGKKLNKLWDQKMPLEW* DQY*QFVIEIRK*XTA*QLT >LQW152517.x1_5 SSYACLLVLLFWGPPFCAVWFLCSTRLVRVSFPVFFLFSFRLPYLGLGTRGSGFGTWLLF LALFC*FICAVFLCCSLAS*F*FDLVGIFRCVF*YLVLVG*CLFFYIFDIGCLCLPSFST FLWDSVFVGGGVHIFLLICQSVLKFSIPSPALLYNRLGEDGTPLALNIQIS*SCFKELTT VNESRKDTVL*LFKCSSFTTKWDEKIE*KGVPSSPNLLYTFLQNSI*LKALCL*DDDGKG LTEREIRDEVDTFLFEGHDTTASGIAWSLYCLAANEEYQEKCREEIEQVVGSKDALGMVR SVLTVRY*NSEIXNSMTADX >LQW152517.x1_6 FFVCLSSRAFVLGASFLCSVVSLFYSSGSCLVPRVLSVLFSSPVSGVGYPWFWFWYLALV SCVVLLVYLCCIPLLFLGFVILI*SGWDISLCFLVPGACGLVFIFLYF*HRMLVFAIFLH FSMGLCFCRGGGTYFFINLSKRA*VFHPFPRPII**VGGRWDTFST*YTNILIVF*RINY GKRKS*GYGFIII*MFFVYHQMGRENRMKRCPIFPQPIIYIFAE*HLT*SFVFVG**WER FN*ARNTGRSRHFSV*RSRHYG*RHCLVIILSCS**GISRKM*GRN*TSCGIKRCPWNGE ISIDSSLLKFGNKXQHDS*L >GCiWno307_h20.g1 CHROMAT_FILE: GCiWno307_h20.g1 PHD_FILE: GCiWno307_h20.g1.phd.1 CHEM: term DYE: big TIME: Fri Oct 5 11:27:34 2001 TEMPLATE: GCiWno307_h20 DIRECTION: rev Length = 907 Score = 78.4 bits (190), Expect = 3e-14 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 1 RKCDGSTVEVFRPVSLMTLDSMLQCAISCETECQQEG 37 RKCDGS VEVFRPVSLMTLDSMLQCAISCETECQQEG Sbjct: 674 RKCDGSMVEVFRPVSLMTLDSMLQCAISCETECQQEG 564 Score = 46.5 bits (108), Expect = 1e-04 Identities = 17/45 (37%), Positives = 29/45 (63%) Frame = -2 Query: 44 YINAVHELTLLVMERVYNPLHMIDWIYHFSSNGRRFRKLVDFVHE 88 Y +AV LT + M+R++NP +DWI+ + +GR+F+ +HE Sbjct: 249 YTDAVFTLTTIAMKRIFNPFCHVDWIFAMTKSGRQFKAAAKLIHE 115 >GCiWno356_e08.b1 CHROMAT_FILE: GCiWno356_e08.b1 PHD_FILE: GCiWno356_e08.b1.phd.1 CHEM: term DYE: big TIME: Fri Oct 5 12:29:12 2001 TEMPLATE: GCiWno356_e08 DIRECTION: fwd Length = 907 Score = 99.8 bits (245), Expect = 9e-21 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -3 Query: 1 NRNSNTYTDAVFTLTTIAMKRIFNPFCHVDWIFAMTKSGRQFKAAA 46 NRNSNTYTDAVFTLTTIAMKRIFNPFCHVDWIFAMTKSGRQFKAAA Sbjct: 758 NRNSNTYTDAVFTLTTIAMKRIFNPFCHVDWIFAMTKSGRQFKAAA 621 >GCiWno356_e08.b1_4 SSQLPXDRX*LFKTRFRIYG*YVLTVSHFTP*HYSVHIYGKHX**NIILKQEQQHLYRRG IHPNHNCYETNFQPILSR*LDFCDDKKWAAV*SGGQTYSRI**KGICDCKVHLTILVSYV I*M*LT*PLLILYSMSDTQLVTCW**TCYVNLANEQSLG*TFVRKCHVNLLALYTCLKIP HVATLAVPCR*HLLYAFFKYTYSKG*GGMGHVFILLVGRGEFSLSK*GGVEWDMFTFSFL VQFVSKQRIFTADPIKERC*LLKTQSGIVGCICANCILYPIPQYVLLHRICSRFLASKLR SX >GCiWno356_e08.b1_5 IVTTXTRPXLIV*NKI*DIWIICANSVPFYPIALFCTHIW*TPLVKYNSKTGTATLIQTR YSP*PQLL*NEFSTHFVTLTGFLR*QKVGGSLKRRPNLFTNLMKRYM*L*GTFDDLSFLR NLNVAYMTPADTIQHE*YTTRNLLVINLLCKPCK*AIIGLNICA*MSRKSTCPLYVLKNT TRCHISCPMQIAPSLCFF*IYLQ*RVGWNGTCFHSVSRAG*VFII*VGWGGMGHVYILFS RSIC**TENLYC*PYKRTLLIVKNTIGNSGVYMC*LYPISYTAVCIAAQDLQSFSGKQAK IRX >GCiWno356_e08.b1_6 RHNXHXTVXNCLKQDLGYMDNMC*QCPILPHSTILYTYMVNTXSKI*F*NRNSNTYTDAV FTLTTIAMKRIFNPFCHVDWIFAMTKSGRQFKAAAKLIHEFDEKVYVIVRYI*RS*FLT* FECSLHDPC*YYTA*VIHNS*LVGNKPAM*TLQMSNHWVKHLCVNVT*IYLPFIRA*KYH TLPH*LSHADSTFFMLFLNIPTVKGRVEWDMFSFC**GGVSFHYLSRVGWNGTCLHSLFS FNLLVNRESLLLTL*KNVVNC*KHNRE*WGVYVLIVSYILYRSMYCCTGSAVVFWQAS*D PX >GCiWno425_l18.g1 CHROMAT_FILE: GCiWno425_l18.g1 PHD_FILE: GCiWno425_l18.g1.phd.1 CHEM: term DYE: big TIME: Thu Oct 11 11:35:12 2001 TEMPLATE: GCiWno425_l18 DIRECTION: rev Length = 888 Score = 89.7 bits (219), Expect = 1e-17 Identities = 43/44 (97%), Positives = 43/44 (97%), Gaps = 1/44 (2%) Frame = -3 Query: 1 VQFVSKQRIFTADPIKERC-LLKTQSGIVGCICANCILYPIPQY 43 VQFVSKQRIFTADPIKERC LLKTQSGIVGCICANCILYPIPQY Sbjct: 610 VQFVSKQRIFTADPIKERC*LLKTQSGIVGCICANCILYPIPQY 479 >GCiWno425_l18.g1_4 NLLLXPANEPSWVNICA*MSRKSTCPYTC*KYHTLPH*LSHADSTFFMLFLNIPTVKGRV EWDMFSFC**GGVSFHYLSRVGWNGTCLHSLFSFNLLVNRESLLLTL*KNVVNC*KHNRE *WGVYVLIVSYILYRSIVLHQVQPLYLLNPQSILQ VIRERRQENKKILGRSDDEDLTQED LEKITSWRKSDGRYLDFLDMLILTR VGIVGWGKLGHGARWDSVYFF*IFDKGCLSLPSFP ILLWDTVFGGGGTHFFIN**SVLKFSIPPPALLYNRVGEDGTPLALNIQIS*SVLK >GCiWno425_l18.g1_5 LAIKXCK*AIMG*HLCVNVT*IYLPLYVLKIPHVATLAVPCR*HLLYAFFKYTYSKG*GG MGHVFILLVGRGEFSLSK*GGVEWDMFTFSFLVQFVSKQRIFTADPIKERC*LLKTQSGI VGCICANCILYPIPQYCFASGTAIISTQPTIDTTGNSGTPSGKQKDFR*K*RRRSHARRF GKDYFLAKIRWKILGLSGYVDFDKGGYSRLG*VRTRGKMG*CLFFLDI*QRVLEFTIFPH LTMGHRFWRGGDTFFY*LIKRA*VFHPSPRPII**GGGRWDTFST*YTNILIGFKX >GCiWno425_l18.g1_6 TCY*XLQMSHHGLTFVRKCHVNLLALIRAKNTTRCHISCPMQIAPSLCFF*IYLQ*RVGW NGTCFHSVSRAG*VFII*VGWGGMGHVYILFSRSIC**TENLYC*PYKRTLLIVKNTIGN SGVYMC*LYPISYTAVLFCIRYSHYIYSTHNRYYR*FGNAVRKTKRF*VEVTTKISRKKI WKRLLLGENQMEDTWTFWIC*F*QGWV**VGVS*DTGQDGIVFIFFRYLTKGA*VYHLSP SYYGTPFLAGGGHIFLLIDKACLSFPSLPPPYYIIGWGKMGHL*HLIYKYPDRF*X >cilv031p09_3 NOT SAME SEQ = SEQ 147 ETTFWPSYDVYGDVSNLTLDTMMQCAMSTDTDSGG EDGGYGYINAVHELTLLVMERVYNPLHMIDWIYHFSSNGRRFRKLVDFVHETSET IIKERKKELETLVQEDNDNASTATNNELSSFKKRGTKHLDFLDILLQTK DENGNGLTLKEIRDEVDTFLFEGHDTTASGIAWCLYNLAKH PEYQQRCREEVLEEVGEKEKIEWEDLSKLT >GCiWno1035_e06.g1_1 YDSSSVPYQME*ENRIKMCPIFPHPTMFHLRVYRTCIVYRKG*LFTLLVGIPFHTILHTA AYCPGSSD*LA*TLLPWNRHISATTFLTLFCSMHRKL*CTCVYVINYTAHCMQLIVLGNT ELF*YVEMKSFSK*MAVSSPLTAVANQQSVANPWFDESVRQVVLRV*NG**LSH*MMNVT YFIPARRENNSR*SIRIVMILK*LL*KKVGT*GDALFSFIRTLVFFQFIFHCLLPYSI*X TLSIDYAYLHDFHSTXFVMGLLYYTXE*CXGYSYVQTYVSTFSTGRTTCG*NTISTLMLD QPHI >GCiWno1035_e06.g1_2 TIRARYPTKWNEKIE*KCVPSFPTLLCFTYVFTVRV*YIVKVNYLPFLLAFRFTRYCTLQ HTVQGHQTNWPKHFYHGTVTFPRPLF*HCFAACIENFSVPVYTLLTILRIACS**CWEIL NCFNMSK*KALVSRWRFLRHLLPWLTSNPSPIHGLMNLYAKLSFGSKMDNNCLIK**M*L TLSPRGGKTTVVKALELL*F*NDYFRKR*AHRAMLCSPLLGH*FSSNSYSIAYCPTQYXI H*V*TMRIYTTSILLXLLWAYYIILXNSVXVTVTCKHTFQLSVQVALHADEIPSVR*CWT NHT >GCiWno1035_e06.g1_3 RFELGTLPNGMRK*NKNVSHLSPPYYVSLTCLPYVYSIS*RLIIYPSCWHSVSHDIAHCS ILSRVIRLTGLNTSTMEPSHFRDHFSNIVLQHASKTLVYLCIRY*LYCALHAANSVGKY* TVLICRNEKL**VDGGFFATYCRG*PAIRRQSMV**ICTPSCPSGLKWIIIVSLNDECNL LYPRAAGKQQSLKH*NCYDFKMITLEKGRHIGRCFVLLY*DTSFLPIHIPLLTALLNIXY IEYRLCVFTRLPFYLXCYGPIILYXGIVLXLQLRANIRFNFQYRSHYMRMKYHQYANAGP TTH >GCiWno1035_e06.g1_4 NVWLVQH*RTDGISSACSATCTES*NVCLHVTVTXTLFXSII**AHNKXSRMEVV*IRIV YTQCXLY*VGQ*AMEYELEEN*CPNKGEQSIALCAYLFLK*SF*NHNNSNALTTVVFPPR GDKVSYIHHLMRQLLSILDPKDNLAYRFIKPWIGDGLLVSHGSKWRRNRHLLTKAFHFDI LKQFSISQHY*LHAMRSIVNNVYTGTLKFSMHAAKQC*KSGRGNVTVPW*KCLGQLV**P WTVCCSVQYRVKRNANKKGK*LTFTIYYTRTVNT*VKHSRVGKDGTHFYSIFSFHLVGYR ARIV >GCiWno1035_e06.g1_5 CVVGPALAY*WYFIRM*CDLY*KLKRMFARNCNXNTIP*YNIIGP*QXK*NGSRVNTHSL YSMYXILSRAVSNGI*IGRKLVS**RRTKHRPMCLPFSKVIILKS*QF*CFNDCCFPAAR G*SKLHSSFNETIIIHFRPEGQLGVQIHQTMDWRRIAG*PRQ*VAKKPPSTY*SFSFRHI KTVQYFPTLLAACNAQYS**RIHRYTKVFDACCKTMLEKWSRKCDGSMVEVFRPVSLMTL DSMLQCAISCETECQQEG*IINLYDILYTYGKHVSET**GGERWDTFLFYFLIPFGRVPS SNRX >GCiWno1035_e06.g1_6 MCGWSSISVLMVFHPHVVRPVLKVETYVCT*L*P*HYSXV*YNRPITXQVEWKSCKYA*S ILNVXYIE*GSKQWNMNWKKTSVLIKENKASPYVPTFF*SNHFKIITILML*RLLFSRRA GIK*VTFII**DNYYPF*TRRTTWRTDSSNHGLATDCWLATAVSGEETAIYLLKLFISTY *NSSVFPNTISCMQCAV*LITYTQVH*SFRCMLQNNVRKVVAEM*RFHGRSV*AS*SDDP GQYAAVCNIV*NGMPTRRVNN*PLRYTIHVR*TRK*NIVGWGKMGHIFILFSHSIW*GTE LESX >GCiWno307_h20.g1 CHROMAT_FILE: GCiWno307_h20.g1 PHD_FILE: GCiWno307_h20.g1.phd.1 CHEM: term DYE: big TIME: Fri Oct 5 11:27:34 2001 TEMPLATE: GCiWno307_h20 DIRECTION: rev Length = 907 Score = 50.8 bits (119), Expect = 3e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 1 VKHSRVGKDGTHFYSIFSFHLV 22 VKHSRVGKDGTHFYSIFSFHLV Sbjct: 514 VKHSRVGKDGTHFYSIFSFHLV 449 >GCiWno307_h20.g1_4 PGSSNPVNGAGLLVSPGQ*VGKKPPMYLIKLFIWHY*NSSVFPNTISCMQCAV*LITYTQ VH*SFRCMLQNNVRKVVAEM*RFHGRSV*AS*SDDPGQYAAVCNIV*NGMPTRRVNN*PL RYTIHVR*TRK*NIVGWGKMGHIFILFSHSIW**TNNIQRI*AVYRHNSHRPLLIV*NKV RIFG*YVLTVSHFTP*HYSVHIYGKHLSKI*F*NRNSNTYTDAVFTLTTIAMKRIFNPFC HVDWIFAMTKSGRQFKAAAKLIHEI*XKGLR*DKVHSKMSV*FMVHRCFPVKRRPCQXPF YQ >GCiWno307_h20.g1_5 XRFIQPSEWRRIAG*PRPVSGEEAAHVLNKAFHLALLKQFSISQHY*LHAMRSIVNNVYT GTLKFSMHAAKQC*KSGRGNVTVPW*KCLGQLV**PWTVCCSVQYRVKRNANKKGK*LTF TIYYTRTVNT*VKHSRVGKDGTHFYSIFSFHLVVNK*HSTNLSRISSQLPQTVVNCLKQG *DIWIICANSVPFYPIALFCTHIW*TP**NIILKQEQQHLYRRGIHPNHNCYETNFQSIL SR*LDFCDDKKWAAV*SGGQTYSRDLXKRIKVR*GSQ*NVGLVHGS*MFSSKTTAMPXAI LPX >GCiWno307_h20.g1_6 QVHPTQ*MAPDCWLAPASKWGRSRPCT**SFSFGIIKTVQYFPTLLAACNAQYS**RIHR YTKVFDACCKTMLEKWSRKCDGSMVEVFRPVSLMTLDSMLQCAISCETECQQEG*IINLY DILYTYGKHVSET**GGERWDTFLFYFLIPFGSKQITFNEFKPYIVTTPTDRC*LFKTRL GYLDNMC*QCPILPHSTILYTYMVNTLVKYNSKTGTATLIQTRYSP*PQLL*NEFSIHFV TLTGFLR*QKVGGSLKRRPNLFTRFDXKD*GKIRFTVKCRSSSWFIDVFQ*NDGHAKXHF TX >GCiWno1035_e06.g1 CHROMAT_FILE: GCiWno1035_e06.g1 PHD_FILE: GCiWno1035_e06.g1.phd.1 CHEM: term DYE: big TIME: Thu Dec 27 12:49:06 2001 TEMPLATE: GCiWno1035_e06 DIRECTION: rev Length = 912 Score = 111 bits (276), Expect(2) = 6e-47 Identities = 50/53 (94%), Positives = 52/53 (97%) Frame = -3 Query: 41 LKQYTKVFDACCKTMLEKWSRKCDGSMVEVFRPVSLMTLDSMLQCAISCETEC 93 + +YTKVFDACCKTMLEKWSRKCDGSMVEVFRPVSLMTLDSMLQCAISCETEC Sbjct: 307 IHRYTKVFDACCKTMLEKWSRKCDGSMVEVFRPVSLMTLDSMLQCAISCETEC 149 Score = 98.3 bits (241), Expect(2) = 6e-47 Identities = 43/45 (95%), Positives = 45/45 (99%) Frame = -1 Query: 1 KDNLAYRFIKPWIGDGLLVSHGSKWRRNRHLLTKAFHFDILKQYT 45 KDNLAYRFIKPWIGDGLLVSHGSKWRRNRHLLTKAFHFDILKQ++ Sbjct: 492 KDNLAYRFIKPWIGDGLLVSHGSKWRRNRHLLTKAFHFDILKQFS 358 >rciad066m08 Length = 658 Score = 52.3 bits (123), Expect = 8e-07 Identities = 28/32 (87%), Positives = 29/32 (90%), Gaps = 2/32 (6%) Frame = +3 Query: 22 SHHSKASFDPTTCSISSLH-FLDIPH-LQDHI 51 S HSKASFDPTTCSISSLH FLDIPH LQD+I Sbjct: 555 SCHSKASFDPTTCSISSLHFFLDIPH*LQDNI 650 >rciad066m08_4 WSLYCLAANEEYQEKNVGKKLNKLWDQKMPWNGKIYQRLPFVTMFIKEVLRLYPPVFAVA RRTEQPVKFPRGFGRDQLNVGDEQLPKSDCSRVVXAPLNIGIPIMTLHRNEQVWEDAKVF DPYRFSTENCAKRSPYAYLPFSAGPRNCIGQNFAMAELKTVLVRTLLRYKLYVDNQCPDP >GCiWno480_g04.b1 AAACTTGGTATGTCAGTATGTCACTATAATTGTTTTTTACCCTCAATAGGTATTTTTCAACTTATTTCTTCAGTTTTATT CTGCAGAGCTCAATCAGTGGATTTCGAGTGGAGTTGCTGAAATATCCATGCTTTGTGTTACATTGTACTGCTTGGGAAAT AGGAATGTAAACACTCTATAATGCGGTAACTGCTGTTCGGTTGGACTGACAGAATGTTTCTGCATTTTCTTTCTCAGTGA AAAAAACGCAAGTCGATTTTGGATGGCATTTCGGGGTTACCATTAAAGTCCTATTTAGCTCTACATATTTATCTGGGACA TCATTGTTGATCTGTATGATGACTCTCTACTGGCGGTAGTTGCTATTATAAAAACACATTATAAATGGATGCTTACTTTC AAGTTAAGAAATTGATGTTGAAACATTCAGTATTTTTTTGCGAAACATTTGATTACTTAACAGCACAGCATAAAATAGAG AAAAAATGTTTTTTCTTTGACTTTTGGTGTAAAAACTTCAGATCTTCTTTAACTTGATGTGGATTCCATTAAGTGATTTA AGGACAATCATCGGCGACATTTTCGGATCAGGACATTGGTTGTCCACGTACAATTTATACCTCAACAACGTGCGTACTAG TACAGTCTTCAGCTCGGCCATGGCGAAATTTTGTCCAATACAGTTCCTGTATAAAACTTTTATAAGTGGGCTTTTCGCGT GAAAAATATTTTTAGAAATACCTCGGGCCTGCAGAGACGGTANGTATGCGTACGGAGATCGCTTGGCGCAGTTTTCGGTC GAAAATCTGTACGGGTTAAAAACCCTGAAATACAAAGTATAGTATATATGGTGAGGGAAAGATGGNNACTGNTTTCATTC TATTTTTATGTACAATTG rcieg018p24 C-term Length = 579 LQW232957.y1 LQW232957.y1.phd.1 LQW232957.x1 20:56:15 2001 TEMPLATE: LQW232957 DIRECTION: rev Length = 786 Score = 66.7 bits (160), Expect = 2e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 23 DLTKARLKLHEETQNLSELEDTLNNTIINLNG 54 DLTKARLKLHEETQNLSELEDTLNNTIINLNG Sbjct: 207 DLTKARLKLHEETQNLSELEDTLNNTIINLNG 302 >rcicl007c05_4 K*ILTIT**KRNANC*ARKSAGRFARRDC*N*SFE*YITKGTK*TKRKTKR*NEKCRISC KKNESLSSKKHGIPKNYTEIESGV*VPWFSERNFS*GVGEERRRNQGSARKVKTSPSLSR LLPKSSRREDLLNFKFFH*CL*TKSFLYVFDIFFFCMFLIRKQKKHMSVLCFS*KKSKNK SFLYVF*RKTKQKVTSILV >rcicl007c05_5 *VNSHYHLIKKKCKLLSEKICRKICKKGLLKLKF*IIHYKGN*VN*TKN*TMK*KMQNFL QKERKFIKQKTWNTKKLYRD*VRSLSPLVFGAKFLMRSW*REETKSRICKKS*NLSVFIS TPSKIFPP*GFIKF*IFSLVLIDEKFSVCF*YFLFLYVFDKKTKKTHECSVFFVEKIKKQ EFSVCFLKENKTKSYINFSX >rcicl007c05_6 LSEFSLSLDKKEMQIAERENLQEDLQEGIAEIKVLNNTLQRELSELNEKLNDEMKNAEFL AKRTKVYQAKNMEYQKTIQRLSQEFKSLGFRSEISHEELVKRGDEIKDLQEKLKPLRLYL DSFQNLPAVRIY*ILNFFISAYRRKVFCMFLIFSFSVCF**ENKKNT*VFCVFRRKNQKT RVFCMFFKGKQNKKLHQF*X >rcitb099l21_4 NEKLNDEMKNAEFLAKRTKVYQAKNMEYQKTI QRLSQEFKSLGFRSEISHEELVKRGDEI KDLQEKLKPLRLYLDSFQNLPADLTKARLKLHEETQNLSELEDTLNNTIINLNG*QT*AE SVDFEWSC*NIHALCYIVLLGKPECKHSIMR*LLLG*TDRMFLHFLS**KKPS*FWMAFQ GYH*SPI*LYIFIWDIIVDLYDESLLAVVAIIKTHYKWVLTFKLRN*C*IIQYFFAKHLI T*QHS >rcitb099l21_5 KRKTKR*NEKCRISCKKNESLSSKKHGIPKNYTEIESGV*VPWFSERNFS*GVGEERRRN QGSARKVKTSPSLSRLLPKSSRRFN*SPFKIARGNSKSIRT*GYVKQHHY*PKRITNLS* ISGFRVELLKYPCFVLHCTAWETGM*TLYNAVTAVGLD*QNVSAFSFLVKKTKLILDGVS GLPLKSNLALHIYLGHHC*SV**ISTGGSCYYKNTL*MGAYFQVKKLMLNHSVFFCETFD YLTAQX >rcitb099l21_6 TKN*TMK*KMQNFLQKERKFIKQKTWNTKKLYRD*VRSLSPLVFGAKFLMRSW*REETKS RICKKS*NLSVFISTPSKIFPPI*LKPV*NCTRKLKIYPNLRIR*TTPLLT*TDNKLELN QWISSGVAEISMLCVTLYCLGNRNVNTL*CGNCCWVRLTECFCIFFLSEKNQVDFGWRFR VTIKVQFSSTYLSGTSLLICMMNLYWR*LLL*KHIINGCLLSS*EIDVESFSIFLRNI*L LNSTA >citb099l21_2 and rcitb099l21_4 MKSEISVDKGAVGDGLDSQVNSVYAWLSEVAPDSMTDDF ELNQEAISYLHEWIELEKHEKMTSDKLEQTIAREIVEHRAESQRLGKILSFVGLQPCDLS PKATVSLKILTECATHLDVLVPNEVFLTTALSEFSLSLDKKEMQIAERENLQEDLQEGIA EIKVLNNTLQRELSELNEKLNDEMKNAEFLAKRTKVYQAKNMEYQKTIQRLSQEFKSLGF RSEISHEELVKRGDEIKDLQEKLKPLRLYLDSFQNLPA (?) DLTKARLKLHEETQNLSELEDTLNNTIINLNG walk downstream >cieg087j23_4 PQ*VFFN*FL*FYSAELNQWISSGVAEISMLCVTLYCLGNRNVNTL*CGNCCWVRLTECF CIFFLSEKNQVDFGWRFRVTIKVQFSSTYLSGTSLLICMMNLYWR*LLL*KHIINGCLLS S*EIDVESFSIFLRNI*LLNSTA*NRAKMFFL*LSV*KLQIFFNLMWIPLSDLRTIIGDI FGSGHWLSTYNLYLNSVRTSTVFSSAMAKFCPIQFLLVPN >cieg087j23_5 SIGIFQLISLVLFCRAESVDFEWSC*NIHALCYIVLLGKPECKHSIMR*LLLG*TDRMFL HFLS**KKPS*FWMAFQGYH*SPI*LYIFIWDIIVDLYDESLLAVVAIIKTHYKWVLTFK LRN*C*IIQYFFAKHLIT*QHSIK*SKNVFSLTFGVKTSDLL*LDVDSIK*FKDNHRRHF RIRTLVVHVQFVPQQRAYQYSL*LSHGEILSDTVPPRAEX >cieg087j23_6 LNRYFSTNFFSFILQS*ISGFRVELLKYPCFVLHCTAWETGM*TLYNAVTAVGLD*QNVS AFSFLVKKTKLILDGVSGLPLKSNLALHIYLGHHC*SV**ISTGGSCYYKNTL*MGAYFQ VKKLMLNHSVFFCETFDYLTAQHKIEQKCFFFDFRCKNFRSSLT*CGFH*VI*GQSSATF SDQDIGCPRTICTSTACVPVQSLAQPWRNFVRYSSSSCRX >rciad066m08_1 QHKIEQNVFSLTFGVKLQIFFNLMWIPLSDLRTNXRRHFRIRTLVVHVQFVPQQRAYQYS L*LSHGEILSDTVPRACRER*VSVRRSLGAVFGRKSVRVKNLRVFPNLFVTMKRHDRNSD V*RCVHHSAAVGFRKLFIADVELITTKSSRKFNRLFSSSRNCKHRWIKSKYFFYKHRNER QPLIDLAIPRHLLIPQLVQFLPYIFFLIFLISCKTI**PX >rciad066m08_2 SIK*SKMFFL*LSV*NFRSSLT*CGFH*VI*GQXIGDIFGSGHWLSTYNLYLNSVRTSTV FSSAMAKFCPIQFLGPAEKGR*AYGDRLAQFSVENLYGSKTFASSQTCSLR*SVMIGIPM FKGAXTTLLQSDLGSCSSPTLS*SRPNPRGNLTGCSVLLATANTGG*SRSTSFINIVTNG SL**ILPFQGIF*SHNLFNFFPTFFS*YSSLAARQYNDQ >rciad066m08_3 A*NRAKCFFFDFRCKTSDLL*LDVDSIK*FKDKXSATFSDQDIGCPRTICTSTACVPVQS LAQPWRNFVRYSSSGLQRKVGKRTEIAWRSFRSKICTGQKPSRLPKLVRYDEAS*SEFRC LKVRXPLCCSRI*EAVHRRR*VDHDQILAEI*PVVQFFSQLQTPVDKVEVLLL*TS*RTA AFDRSCHSKASFDPTTCSISSLHFFLDIPH*LQDNIMT >rciad066m08_4 P450 Cterm on opposite strand WSLYCLAANEEYQEKNVGKKLNKLWDQKMPWNGKIYQRLPFVTMFIKEVLRLYPPVFAVA RRTEQPVKFPRGFGRDQLNVGDEQLPKSDCSRVVXAPLNIGIPIMTLHRNEQVWEDAKVF DPYRFSTENCAKRSPYAYLPFSAGPRNCIGQNFAMAELKTVLVRTLLRYKLYVDNQCPDP KMSPXICP*IT*WNPHQVKEDLKFYTESQRKNILLYFML >rciad066m08_5 LVIILSCS**GISRKKCREEIEQVVGSKDALEWQDLSKAAVRYDVYKRSTSTLSTGVCSC EKN*TTG*ISARIWS*STQRRR*TAS*IRLQQSGXRTFKHRNSDHDASS*RTSLGRREGF *PVQIFDRKLRQAISVRLPTFLCRPEELYRTKFRHG*AKDCTGTHAVEVQIVRGQPMS*S ENVADXLSLNHLMESTSS*RRSEVLHRKSKKKHFALFYAX >rciad066m08_6 GHYIVLQLMRNIKKKM*GRN*TSCGIKRCLGMARSIKGCRSLRCL*KKYFDFIHRCLQLR EELNNRLNFREDLVVINSTSAMNSFLNPTAAEWXTHL*TSEFRS*RFIVTNKFGKTRRFL TRTDFRPKTAPSDLRTLTYLSLQARGTVSDKISPWLS*RLYWYARC*GTNCTWTTNVLIR KCRRXFVLKSLNGIHIKLKKI*SFTPKVKEKTFCSILCX attempt to find same problem on JGI data LQW151952.x1 LQW151952.x1.phd.1 LQW151952.y1 14:16:39 2001 TEMPLATE: LQW151952 DIRECTION: fwd Length = 1000 Score = 66.7 bits (160), Expect = 2e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 39 DLTKARLKLHEETQNLSELEDTLNNTIINLNG 70 DLTKARLKLHEETQNLSELEDTLNNTIINLNG Sbjct: 429 DLTKARLKLHEETQNLSELEDTLNNTIINLNG 334 >LQW151952.x1_4 NL*IXRVTLESCARQKRERVLYMVQHWYNLLFALISSGYIYYCKAN*FVECTP*G*NPQH RVTRSLDRNGK*DKSQSFLYVFKKRKKSPEFLVCFGYKRSEGPRKCSICFYCEYQFAFLC IYVSFCFLNSHGYCCTCPTELEH*VYKTLLTINHISSCACRDNPSIFLKCTFFLYIFIKC TFKNNLL*SQDLTKARLKLHEETQNLSELEDTLNNTIINLNG*QTWYVSHYNCFLPSIGI FQLISSVLFCRAESVDFEWSC*NIQALCYIVLLGK*ECKHSIMR*LLLG*TDRMFLHFLS **KKRKLILDGVSGLPLKSNLALHIYLGADLPS >LQW151952.x1_5 QSVDXKSNVRIMRKAKKRESPVYGATLVQSFVRSHFLGLYILL*SQLICGVYPLRIEPTT QSYSKFG*KWKVR*ITKLSLCF*KKKKITRVFSMFWI*KKRRAQEVFYMFLL*ISVCFLV YIC*LLLFEFAWLLLYMSH*IRTLGV*NSIDH*SY*QLCLP*QSKHFS*VYIFSLYFH*V HI*K*PSLIAGFN*SPFKIARRNSKSIRT*GYVKQHHY*PKRITNLVCQSL*LFFTLNRY FSTYFFSFILQS*ISGFRVELLKYPSFVLHCTAWEIGM*TLYNAVTAVGLD*QNVSAFSF LVKKTQVDFGWRFRVTIKVQFSSTYLSRS*PAVX >LQW151952.x1_6 ICRXEE*R*NHAQGKKERESCIWCNIGTIFCSLSFPRVIYITVKPIDLWSVPPEDRTHNT ELLEVWIEMESKINHKAFSMFLKKEKNHQSF*YVLDIKEAKGPGSVLYVFIVNISLLSCV YMLAFAF*IRMAIAVHVPLN*NIRCIKLY*PLIILAAVLAVTIQAFFLSVHFFSIFSLSA HLKITFFNRRI*LKPV*NCTKKLKIYPNLRIR*TTPLLT*TDNKLGMSVTIIVFYPQ*VF FNLFLQFYSAELNQWISSGVAEISKLCVTLYCLGNRNVNTL*CGNCCWVRLTECFCIFFL SEKNAS*FWMAFQGYH*SPI*LYIFI*ELTCRL >rcitb099l21_4 NEKLNDEMKNAEFLAKRTKVYQAKNMEYQKTI QRLSQEFKSLGFRSEISHEELVKRGDEI KDLQEKLKPLRLYLDSFQNLPADLTKARLKLHEETQNLSELEDTLNNTIINLNG*QT*AE SVDFEWSC*NIHALCYIVLLGKPECKHSIMR*LLLG*TDRMFLHFLS**KKPS*FWMAFQ GYH*SPI*LYIFIWDIIVDLYDESLLAVVAIIKTHYKWVLTFKLRN*C*IIQYFFAKHLI T*QHS >LQW232957.y1_1 *IESVPLNRWLCCHVPLN*NIRCIKPHRPFILFAAVLAVAIQEFFL*VYIFFSIFSLSAH FKITFFNRRI*PKPV*NCTKKLKIYPNLRIR*TTPLLT*TGNKLGMSVCHYNCFLPSIGI FQLISLVLFCRAESVDFEWSC*NIHALCYIVLLGK*ECKHSIMR*LLFGWTDKMFLHFLS Q*KKRKLILDGVSGLPLKSNLALHIYLGHHC*SV**LSTGGSCYYKNTL*MDAYFQVKKS MLNHSVFFCETFDYLTAQLKIE >LQW232957.y1_2 RSSRYL*IDGYAVMSH*IRTLGV*NLIDHLSYLQLCLLWQSKNFFFKCTFFSLYFH*VHI LK*PSLIAGFNQSPFKIARRNSKSIRT*GYVKQHHY*PKRVTNLVCQYVTIIVFYPQ*VF FNLFL*FYSAELNQWISSGVAEISMLCVTLYCLGNRNVNTL*CGNCCSVGLTKCFCIFFL SEKNAS*FWMAFQGYH*SPI*LYIFI*DIIVDLYDDSLLAVVAIIKTHYKWMLTFKLRNR C*IIQYFFAKHLIT*QHSLK* >LQW232957.y1_3 DRVGTFESMAMLSCPTELEH*VYKTSSTIYLICSCACCGNPRIFSLSVHFFLYIFIKCTF *NNLL*SQDLTKARLKLHEETQNLSELEDTLNNTIINLNG*QTWYVSMSL*LFFTLNRYF STYFFSFILQS*ISGFRVELLKYPCFVLHCTAWEIGM*TLYNAVTAVRLD*QNVSAFSFS VKKTQVDFGWRFRVTIKVQFSSTYLSRTSLLICMMTLYWR*LLL*KHIINGCLLSS*EID VESFSIFLRNI*LLNSTA*NR LQW165994.x1 LQW165994.x1.phd.1 LQW165994.y1 12:30:28 2001 TEMPLATE: LQW165994 DIRECTION: fwd Length = 939 Score = 83.5 bits (203), Expect = 5e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +1 Query: 38 LLAVVAIIKTHYKWMLTFKLRNRC*IIQYFFAKHLIT*QHSLK 80 +LAVVAIIKTHYKWMLTFKLRN C*IIQYFFAKHLIT*QHS+K Sbjct: 1 VLAVVAIIKTHYKWMLTFKLRN*C*IIQYFFAKHLIT*QHSIK 129 >LQW165994.x1_1 VLAVVAIIKTHYKWMLTFKLRN*C*IIQYFFAKHLIT*QHSIK*SKNVFSLTFGVKTSDL L*LDVDSIK*FKDNHRRHFRIRTFVVHVQFILQQRAYQYSL*LSHGEILSDTVPVENL** VNLF*VEKYL*KYLGPAEKGR*AYGDRLAQFSVENLYGSKT*KDKSMYRIRSGRWNTFSL YFYVQFGSKQELFSLLRKSVVKC*QFV*EKRFRCQRDPNLIHSTISL*CLTKADICYKH* LGLV*RFRSGHTSGLPTVLT*R*IGFDLRSHIWGGWNEFVDLRKTVTGEELVSFT*TGDG KLWPGGKVLIVRV >LQW165994.x1_2 YWR*LLL*KHIINGCLLSS*EIDVESFSIFLRNI*LLNSTA*NRAKMFFL*LSV*KLQIF FNLMWIPLSDLRTIIGDIFGSGHSLSTYSLYFNSVRTSTVFSSAMAKFCPIQFL*KTYNE *TFFKWKNIFRNTSGLQRKVGKRTVIAWRSFRSKICTGQKPEKTKVCIEYDREDGTRFHS IFMYNLVVNKSYFHYSEKALLNVNNSFRKSDLGANGIPTLSTVLSLYNV*QKLISAINIS *D*SEDLDLDILRVSQLFLHEGRSDSI*GLTFGAVGTNLLTFGRR*RGKNLFHSLKREME NYGQGGKSL**E >LQW165994.x1_3 TGGSCYYKNTL*MDAYFQVKKLMLNHSVFFCETFDYLTAQHKIEQKCFFFDFRCKNFRSS LT*CGFH*VI*GQSSATFSDQDIRCPRTVYTSTACVPVQSLAQPWRNFVRYSSCRKLIMS EPFLSGKISLEIPRACRER*VSVR*SLGAVFGRKSVRVKNLKRQKYV*NTIGKMEHVFTL FLCTIW**TRVIFTTPKKRC*MLTIRLGKAI*VPTGSQPYPQYYLFIMSNKS*YLL*TLA RTSLKI*IWTYFGSPNCSYMKVDRIRFKVSHLGRLERIC*PSEDGNGGRTCFIHLNGRWK IMARGESPYSKS >LQW165994.x1_4 = seq 158 with intron DSYYKDFPPWP*FSISRLSE*NKFFPRYRLPKVNKFVPTAPNVRP*IESDLPSCKNSWET RSMSRSKSSD*S*LMFIADISFC*TL*RDSTVDKVGIPLAPKSLFLNELLTFNNAFSE** K*LLFTTKLYIKIE*KRVPSSRSYSIHTFVFSGF*PVQIFDRKLRQAITVRLPTFLCRPE VFLKIFFHLKKVHSL*VFYRNCIGQNFAMAELKTVLVRTLLKYKLYVDNECPDPKMSPMI VLKSLNGIHIKLKKI*SFYTESQRKNIFALFYAVLLSNQMFRKKILNDSTSIS*LESKHP FIMCFYNSNYRQY >LQW165994.x1_5 LLL*GLSPLAIIFHLPFK*MKQVLPPLPSSEGQQIRSNRPKCETLNRIRSTFM*EQLGDP KYVQI*IFRLVLANVYSRYQLLLDIIKR*YCG*GWDPVGT*IAFPKRIVNI*QRFFGVVK ITLVYYQIVHKNRVKTCSIFPIVFYTYFCLFRFLTRTDFRPKTAPSDHRTLTYLSLQARG ISKDIFPLKKGSLIISFLQELYRTKFRHG*AKDCTGTHAVEV*TVRGQRMS*SENVADDC P*IT*WNPHQVKEDLKFLHRKSKKKHFCSILCCAVK*SNVSQKNTE*FNINFLT*K*ASI YNVFL**QLPPVX >LQW165994.x1_6 TLTIRTFPPGHNFPSPV*VNETSSSPVTVFRRSTNSFQPPQM*DLKSNPIYLHVRTVGRP EVCPDLNLQTSPS*CL*QISAFVRHYKEIVLWIRLGSRWHLNRFS*TNC*HLTTLFRSSE NNSCLLPNCT*K*SENVFHLPDRILYILLSFQVFDPYRFSTENCAKRSPYAYLPFSAGPR YF*RYFST*KRFTHYKFSTGTVSDKISPWLS*RLYWYARC*SINCTWTTNVLIRKCRR*L SLNHLMESTSS*RRSEVFTPKVKEKTFLLYFMLCC*VIKCFAKKY*MIQHQFLNLKVSIH L*CVFIIATTAST >LQW165994.y1_1 opp end of clone matches region between N and C-term LYRRGITLTTTAMKRIFNPFCHVDWIFAMRKSGRQFKAAAKLIHEFDEKVYDY*RYKYLT EFKFILPDRDWYYTA*VIHNS*LVGNKPAM*ILQMSNHWVKHLCVNVT*IYLPFIRA*KH HTLPH*LSHADSTFFMLFLNTYSKG*GGMGHVFILLVGRGEFSLSK*DGVE*DMFSFC** GGVSFHYLSRMGWNGTCFHSLFSFNLLVNRNLYS*FIKDVVIVKTNGIGVYSAIVLYLFK MFDQ*AYIITDDI*VWERRTKFRMNNSQMKSLEQK*ST*RDAHDADSIGNS*RGIQSSAS CLGLQKARTKTQTKX >LQW165994.y1_2 YTDAVSL*PQLL*NEFSIHFVTLTGFLP*EKVGGSSRRRPNLFTNLMKRYMIIDGIST*Q NSNLSCLIATGIIQHE*YTTRNLLVINLLCKFCK*AIIGLNICV*MSRKSTCHLYVLKNT TRCHISCPMQIAPSLCFF*IPTVKGRVEWDMFSFC**GGVSFHYLSRMGWNRTCFHSVSR AG*VFII*VGWGGMGHVFILFSRSIC**TEIFTADS*KTLLLLKQTE*GCIVLLFYIYSR CLISKHIL*QMIYRYGSVEQSLE*TIRK*NLWNRNDRLDGTRMTQIR*GTPRGEYSPPLP ASVSKRQEQRHKQK >LQW165994.y1_3 IQTRYHSNHNCYETNFQSILSR*LDFCHEKKWAAVQGGGQTYSRI**KGI*LLTV*VLDR IQIYLA*SRLVLYSMSDTQLVTCW**TCYVNFANEQSLG*TFVCKCHVNLLAIYTCLKTP HVATLAVPCR*HLLYAFFKYLQ*RVGWNGTCFHSVSRAG*VFII*VGWGGIGHVFILLVG RGEFSLSK*DGVEWDMFSFSFLVQFVSKQKSLQLIHKRRCYC*NKRNRGV*CYCSISIQD V*SVSIYYNR*YIGMGA*NKV*NEQFANEISGTEMIDLTGRA*RRFDRELLEGNTVLRFL PRSPKGKNKDTNK Score = 114 bits (283), Expect = 5e-26 Identities = 54/56 (96%), Positives = 56/56 (99%) Frame = +2 Query: 1 RNCIGQNFAMAELKTVLVRTLLKYKLYVDNECPDPKMSPMIVLKSLNGIHIKLKKI 56 RNCIGQNFAMAELKTVLVRTLL+YKLYVDN+CPDPKMSPMIVLKSLNGIHIKLKKI Sbjct: 158 RNCIGQNFAMAELKTVLVRTLLRYKLYVDNQCPDPKMSPMIVLKSLNGIHIKLKKI 325 >rcieg018p24 CTTTTGTCTTTTCAGGTTTTTGACCCGTNACAGNATTTTCGACCGAAAACTGCGCCAAGCGATCTCCGTACGCTTACCTA CCTTTCTCTGCAGGCCCGNGGTATTTCTAAAGATATTTTTCCACTTAAAAAAGGTTCACTCATTATAAGTTTTCTACAGG AACTGTATCGGACAAAATTTCGCCATGGCTGAGCTAAAGACTGTACTGGTACGCACGCTGTTGAGGTACAAATTGTACGT GGACAACCAATGTCCTGATCCGAAAATGTCGCCGATGATTGTCCTTAAATCACTTAATGGAATCCACATCAAGTTAAAGA AGATCTGAAGTTTTTACACCGAAAGTCAAAGAAAAAACATTTTTGCTCTATTTTATGCTGTGCTGTTAAGTAATCAAATG TTTCGCAAAAAAATACTGAATGATTCAACATCAATTTCTTAACTTGAAAGTAAGCACCCATTTATAATGTGTTTTTATAA TAGCAACTACCGCCAGTAGAGATTCATCATACAGATCAACAATGATGTCCCAGATAAATATGTAGAGCTAAATTGGACTT TAATGGTAACCCTGAAACG >rcieg018p24_1 LLSFQVFDPXQXFRPKTAPSDLRTLTYLSLQARGISKDIFPLKKGSLIISFLQELYRTKF RHG*AKDCTGTHAVEVQIVRGQPMS*SENVADDCP*IT*WNPHQVKEDLKFLHRKSKKKH FCSILCCAVK*SNVSQKNTE*FNINFLT*K*APIYNVFL**QLPPVEIHHTDQQ*CPR*I CRAKLDFNGNPET >rcieg018p24_2 FCLFRFLTRXXIFDRKLRQAISVRLPTFLCRPXVFLKIFFHLKKVHSL*VFYRNCIGQNF AMAELKTVLVRTLLRYKLYVDNQCPDPKMSPMIVLKSLNGIHIKLKKI*SFYTESQRKNI FALFYAVLLSNQMFRKKILNDSTSIS*LESKHPFIMCFYNSNYRQ*RFIIQINNDVPDKY VELNWTLMVTLK >rcieg018p24_3 FVFSGF*PVTXFSTENCAKRSPYAYLPFSAGPXYF*RYFST*KRFTHYKFSTGTVSDKIS PWLS*RLYWYARC*GTNCTWTTNVLIRKCRR*LSLNHLMESTSS*RRSEVFTPKVKEKTF LLYFMLCC*VIKCFAKKY*MIQHQFLNLKVSTHL*CVFIIATTASRDSSYRSTMMSQINM *S*IGL*W*P*N >cieg018p24 TCATTTTTTTGTATGAGTGGATTTCTAAAAAAACATTAAATTACACAACTGCCTAAATTATGAAGTCGGAAATATCAGTT GATAAAGGAGCAGTTGGGGATGGTTTGGACAGTCAAGTAAATTCGGTGTATGCATGGCTGAGTGAAGTGGCCCCTGATAG CATGACTGATGATTTTGAGCTCAATCAAGAAGCAATATCATATCTGCATGAATGGATTGAATTGGAAAAGCATGAAAAAA TGACTTCTGACAAGTTGGAGCAAACAATAGCAAGGGAAATTGTTGAACACCGTGCAGAAAGTCAAAGACTAGGAAAAATT TTAAGTTTTGTTGGTTTACAACCTTGTGATTTGTCACCAAAAGCTACAGTTTCCTTAAAAATACTAACAGAATGTGCCAC GCATCTTGATGTGTTGGTACCAAATGAAGTGTTCTTAACAACAGCTCTAAGTGAATTCTCACTATCACTTGATAAAAAAG AAATGCAAATTGCTGAGCGAGAAAATCTGCAGGAAGATTTGCAAGAAGGGATTGCTGAAATTAAAGTTTTGAATAATACA TTACAAAGGGAACTAAGTGAACTAAACG >cieg018p24_3 IFLYEWISKKTLNYTTA*IMKSEISVDKGAVGDGLDSQVNSVYAWLSEVAPDSMTDDFEL NQEAISYLHEWIELEKHEKMTSDKLEQTIAREIVEHRAESQRLGKILSFVGLQPCDLSPK ATVSLKILTECATHLDVLVPNEVFLTTALSEFSLSLDKKEMQIAERENLQEDLQEGIAEI KVLNNTLQRELSELN >rcicl077k01 Length = 631 Score = 161 bits (402), Expect = 6e-39 Identities = 82/136 (60%), Positives = 94/136 (68%), Gaps = 13/136 (9%) Frame = -3 Query: 1 EDLSKLSYLTLCIKESLRLCPPVPFIGRELNEPLKFRSKL-------------KEPNETT 47 +DLSKL ++T+ IKE LRL PPV + R +P+KF K Sbjct: 503 QDLSKLPFVTMFIKEVLRLYPPVFAVARRTKQPVKFPRGFGGDQFNVGDEQLPKSDCSRV 324 Query: 48 IDAHSNIALHIFTLHRNVHVWDSPEVFDPYRFSTENCAKRSPYAYLPFSAGPRNCIGQNF 107 +DA NI + I TLHRN VW+ +VFDPYRFSTENCAKRSPYAYLPFSAGPRNCIGQNF Sbjct: 323 VDAPLNIGIPIMTLHRNEQVWEDAKVFDPYRFSTENCAKRSPYAYLPFSAGPRNCIGQNF 144 Query: 108 AMAELKTVLVRTLLRY 123 AMAELKTVLVRTLL+Y Sbjct: 143 AMAELKTVLVRTLLKY 96 >sequence 159 417 TAPKNDLGYRFIRTWIGDGLLTSKGKKWFRNRRLLTPAFHYKVLKP 280 LQW144281.y1 c-helix >sequence 154 484 GIAWAMFHLAKYPQFQTKCREELKEVLGNKDEIEW 588 LQW51193.x1 J-helix >sequence 160, 154 YNLSAAGKRNKEVTKILHEHTEKIINERKAVLAKTANIDPEPSDVEGFRKTEGKTLDFLD ILLF CKDENGEGLSDIEIRDEVDTFLFAGHDTTSSGIAWAMFHLAKYPEFQTKCREELKE VLGNKDEIEWSDLPQLVYLTMFLKESMRLRPPVYAVGRYLEHPITIKDKNTKRDTVIPAG TNVSMHIFTLHRHPDFWDEPSKFDPERFTKENIAKRPAFAYV PFSAGSRNCIGQNFAMNEMKISLAHVIRNLRLYIDDETPXPKMQPRLILQSSTGIFVK IEKLERQ* LQW140283.x1 k-helix rcitb004e06 citb004e06 >citb004e06 Length = 667 Score = 77.3 bits (187), Expect = 3e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 1 LPQLVYLTMFLKESMRLRPPVYAVGRYLEHPITIKD 36 LPQLVYLTMFLKESMRLRPPVYAVGRYLEHPITIKD Sbjct: 398 LPQLVYLTMFLKESMRLRPPVYAVGRYLEHPITIKD 505 >citb004e06 TACAATTTATCAGCTGCTGGGAAGAGAAATAAAGAAGTCACGAAAATTCTGCATGAACATACGGAAAAAATAATCAATGA AAGAAAAGCAGTTCTGGCTAAAACTGCAAACATTGACCCTGAACCTTCTGATGTAGAAGGGTTCAGAAAAACGGAAGGAA AAACACTGGATTTTTTGGACATTTTGCTNTTTNTGCAAGGATGAAAATGGTGAAGGATTAAGCGACATTGAAATTCGTGA TGAAGTCGACACTTTCTTGTTTGCGGGACATGATACAACATCTAGCGGCATAGCATGGGCCATGTTTCATCTAGCAAAAT ATCCCGAATTTCAAACAAAATGTAGAGAAGAACTGAAAGAAGTGCTTGGAAACAAGGATGAAATAGAATGGAGCGACCTA CCTCAGCTTGTCTACTTAACCATGTTCCTAAAAGAGAGTATGAGGTTACGACCCCCTGTGTACGCAGTTGGAAGATATTT AGAACACCCAATAACCATCAAAGATAAAAACACAAAACGCGATACTGTGATTCCTGCCGGCACCAATGTATCAATGCATA TCTTTACTTTGCATAGACACCCAGACTTTTGGGACGAGCCATCGAAATTTGACCCTGAAAGGTTTACAAAGGAAAACATA GCCAAACGCCCTGCATTTGCATACGTT >citb004e06_1 YNLSAAGKRNKEVTKILHEHTEKIINERKAVLAKTANIDPEPSDVEGFRKTEGKTLDFLD ILLF XQG*KW*RIKRH*NS**SRHFLVCGT*YNI*RHSMGHVSSSKISRISNKM*RRTER SAWKQG*NRMERPTSACLLNHVPKREYEVTTPCVRSWKIFRTPNNHQR*KHKTRYCDSCR HQCINAYLYFA*TPRLLGRAIEI*P*KVYKGKHSQTPCICIRX >citb004e06_2 TIYQLLGREIKKSRKFCMNIRKK*SMKEKQFWLKLQTLTLNLLM*KGSEKRKEKHWIFWT FCXX CKDENGEGLSDIEIRDEVDTFLFAGHDTTSSGIAWAMFHLAKYPEFQTKCREELKE VLGNKDEIEWSDLPQLVYLTMFLKESMRLRPPVYAVGRYLEHPITIKDKNTKRDTVIPAG TNVSMHIFTLHRHPDFWDEPSKFDPERFTKENIAKRPAFAYV >citb004e06_3 QFISCWEEK*RSHENSA*TYGKNNQ*KKSSSG*NCKH*P*TF*CRRVQKNGRKNTGFFGH FAXXARMKMVKD*ATLKFVMKSTLSCLRDMIQHLAA*HGPCFI*QNIPNFKQNVEKN*KK CLETRMK*NGATYLSLST*PCS*KRV*GYDPLCTQLEDI*NTQ*PSKIKTQNAIL*FLPA PMYQCISLLCIDTQTFGTSHRNLTLKGLQRKT*PNALHLHT >rcitb004e06 Length = 681 Score = 77.3 bits (187), Expect = 3e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 1 LPQLVYLTMFLKESMRLRPPVYAVGRYLEHPITIKD 36 LPQLVYLTMFLKESMRLRPPVYAVGRYLEHPITIKD Sbjct: 584 LPQLVYLTMFLKESMRLRPPVYAVGRYLEHPITIKD 477 >rcitb004e06 AATGAAAATTTATACAGATATAGCAGGTACTAGGTAGCACTATTTTACAAATAATAAGCCATTCCAAGCAGTACTAAAAT AGCGCATACATACAGCGAAACAAAGCTGAAAAAATTCTACTGCCGTTCCAGTTTCTCAATCTTGACGAAAATTCCGGTAG AACTTTGCAAAATAAGACGCGGCTGCATTTTTGGNNCTGGCGTTTCATCGTCAATATAAAGACGCAGGTTACGTATCACG TGGGCCAAGCTGATCTTCATTTCGTTCATAGCAAAGTTTTGCCCGATACAGTTTCTGGATCCAGCGCTGAATGGAACGTA TGCAAATGCAGGGCGTTTGGCTATGTTTTCCTTTGTAAACCTTTCAGGGTCAAATTTCGATGGCTCGTCCCAAAAGTCTG GGTGTCTATGCAAAGTAAAGATATGCATTGATACATTGGTGCCGGCAGGAATCACAGTATCGCGTTTTGTGTTTTTATCT TTGATGGTTATTGGGTGTTCTAAATATCTTCCAACTGCGTACACAGGGGGTCGTAACCTCATACTCTCTTTTAGGAACAT GGTTAAGTAGACAAGCTGAGGTAGGTCGCTCCATTCTATTTCATCCTTGTTTCCAAGCACTTCTTTCAGTTCTTCTCTAC ATTTTGTTTGAAATTCGGGATATTTTGCTAGATGAAACATG >rcitb004e06_6 MFHLAKYPEFQTKCREELKEVLGNKDEIEWSDLPQLVYLTMFLKESMRLRPPVYAVGRYL EHPITIKDKNTKRDTVIPAGTNVSMHIFTLHRHPDFWDEPSKFDPERFTKENIAKRPAFA YVPFSAGSRNCIGQNFAMNEMKISLAHVIRNLRLYIDDETPXPKMQPRLILQSSTGIFVK IEKLERQ* >SEQUENCE 190, 162 36% to 26A1 fugu MVESSFLYPDGGGIRKAITNISSLEVPSNRTLINYLESEDFFYFLFFLIKYI GVPCFLMHVICCLWEIRCVRMKDHSCPLPLPRGNMGFPLVGEMFHLFVV (0) GANYQRQRRSKYGKIYRTHMFGSPSVAVIGEEHVKKIVLGE (1?) GTLVQTRWPSTTRRILGTDGIVNGDLATHCRIKRLALKAFSPKYIGTYAPVIQAGVAAHV (?) GCiWno735_j03.b1 QEWVDQGTVHILEKCKQAVSKTMMTV LLGIKSNDPDIQLYIQAADDIINSILSLPLDLPGFGFHK (?) GCiWno735_j03.g1 GLKARELIFNKLESQLKSKFNATDDELFGDSGGEFESVL LNILKFARREGETEIKLRNLQNLSLEFIFAGTQSLQCSCSLVTFHLSQNPQV = seq 162 NFECREEIKAAGLWDTPLTEINVERIQSLRFIELVAKETLRV TPTIPGAVRVALKTFELGGYQIPKGWQIIYSIRLTHEEAAGKVLQN GSKCEFEPGKHFTSTCKNTDPFAFLPFGKGPRMCAGKNYGMLFLKVLIFELVRTA DISLEGKCKIIEVPMTRTDKSVKIKFTSIKKLKPENSVNDASSSTAV* GCiWno634_n23.b1 GCiWno774_o04.g1 GCiWno260_c03.b1 GCiWno617_i16.b1 GCiWno74_a02.b1 GCiWno310_i03.g1 GCiWno561_n19.g1 GCiWno384_f01.g1 cicl022k09 GCiWno987_g07.b1 + GCiWno364_f19.b1 + GCiWno772_k16.b1 - ciad076b17 GCiWno299_i01.b1 - GCiWno164_f14.g1 exon 2 GCiWno985_e11.g1 exon 2 GCiWno985_e11.b1 exon 2 GCiWno149_a11.g1 exon 2 GCiWno386_f08.b1 exon 2 GCiWno373_m11.g1 exon 2 GCiWno261_e18.b1 exon 2 GCiWno309_a14.b1 GCiWno645_i24.g1 GCiWno615_i22.g1 GCiWno8_e05.g1 GCiWno1001_l10.g1 GCiWno735_j03.g1 GCiWno191_f09.b1 opp end = I-helix GCiWno728_p18.g1 >scf/ciona01/G126/seq_dir/hrs/G126P67867R.T0/G126P67867RF5.T0.seq 746 0 746 ABI Length = 746 Minus Strand HSPs: ciona hit to GCiWno149_a11.b1 opp end of exon 2 Score = 89 (31.3 bits), Expect = 0.0018, P = 0.0018 Identities = 19/46 (41%), Positives = 26/46 (56%), Frame = -3 Query: 1 LIESKAKNMLEGKPQKPRWCPYERNPPSALTSMVSFYLFYGFSYIV 46 L + KN+LEGKPQK RW PY R P + ++ + Y YI+ Sbjct: 360 LSSRRHKNVLEGKPQKARWYPYGRILPESNATVSNLYFRLLSFYII 223 >CYP27A fragment b exon 4 fugu blast hit to GCiWno149_a11.b1 opp end of exon 2 Length = 66 Plus Strand HSPs: Score = 41 (14.4 bits), Expect = 2.7, P = 0.94 Identities = 11/51 (21%), Positives = 24/51 (47%), Frame = +2 Query: 20 LIESKAKNMLEGKPQKPRWCPYERNPPSALTSMVSFYLFYGFSYIVGWGKM 172 L ES+ + + P++ R Y L+++V + G+ Y+ W ++ Sbjct: 6 LFESRLGCLNDEVPEETRRVIYSVGEMCRLSAVVVLFPQSGWPYLPVWARL 56 >GCiWno164_f14.g1_1 HL*YNAKTRCKTPEFRKCQHWYEQQK*EIDLAILLTAFPCLKYLC*GSFP*QGNMASYVN *NNFASMHC*ILKSLQYTVVLSPDPERFDQPFDISAAGSKLPTTTKEQVWKDL*NPHVWQ PISCCDRRGAC*KNCPRRR*KVMRGV*HRS*HFKIPRTVVLWTRKYIKVFEKTKIVPFKS R*RRKANIKRLLYAQPCNEIHVECCVLANIRVCFKLLVIGVF*SAFCQXTKLNWRSFILP IVPLVRPDGQAQKDPFLGTDGIVNGDTPPPCRIKRLALKTVFPKYIRALRPGNSGRSGPP LKVTPILIRNLLX >GCiWno164_f14.g1_2 IYDTTQKLDVKHPSLENVSTGMNNKNKKSI*LFY*QLSPV*NICVEVHFHSRVIWQVMLT KITSLPCIVRY*SHFSILWYYRQIRKDLINLLIFLPQGANYQRQRRSKYGKIYRTHMFGS PSVAVIGEEHVKKIVLGEGRRLCGVYSIVVNILKYRVPLCYGHENTLRFSRKPKLYLSNL DRDEKLT*NAFYMLSHAMKYMWNVVFWQT*GYALSSW**EYFRVPFAX*QSLTGVLLSCP *YPWSDQMAKPKKTHFLALTAS*TVILPPLAVSNDLPLKPFSPNIFAPYAPGIQAEVAPP *R*HPSSSETY*X >GCiWno164_f14.g1_3 FMIQRKNSM*NTRV*KMSALV*TTKIRNRFSYFTNSFPLFKIFVLRFISIAG*YGKLC*L K*LRFHALLDTEVTSVYCGIIARSGKI*STF*YFCRREQTTNDNEGASMERSIEPTCLAA HQLL*SERSMLKKLSSEKVEGYAGCIAS*LTF*NTAYRCVMDTKIH*GFRENQNCTFQI* IETKS*HKTPSICSAMQ*NTCGMLCFGKHKGML*ALGNRSILECLLPXDKA*LAFFYLAH STLGQTRWPSPKRPISWH*RHRKR*YSPPLPYQTTCP*NRFPQIYSRLTPREFRQKWPPP KGNTHPHQKLIN >GCiWno634_n23.b1_1 SI*RCPVKPW*NLLFFIRMVEELEKQLRTSHLWRFHPTELSSTTSNPKISSTFSSSLLST SESPVS*CMSFAASGRSGVSG*KITVVLFRFHGAIWGFP*SEKCFISLWW*VYVLFYQ*V *CPRQYNILLLSMDFT*VINYNLKLPVVIYL*H*LRKHFAAKSINSGKGGMVTQFD*NLG RCLVSLTQIANMTNVIPRSKFRRLPAVLCDDFSLKRIRRICC*RLFIAVTCLRLANLLFM GTLPPLRFGRHPKTLL*SYKNPGFW*NWRFTISRATVEGLGVNPGTAC*NDLHGGX >GCiWno634_n23.b1_2 QFNAVQSNHGRIFFSLSGWWRN*KSNYEHLIFGGSIQQNSHQLPRIRRFLLLSLLPY*VH RSPLFLDACHLLPLGDPVCPDERSQLSSSASTGQYGVSPSRRNVSSLCGGKFMFYFINKC NVPDSIIFYCCPWILLESLTTI*SYL**FTCDINYANISRLKALTREREAW*PSSIKIWV VVSFR*RKSQI*RM*FQEVNFGVCLRCYVMTFP*NGYAGYVVDAYSSQLPASGWQIYYLW EPYHHCVLAGTRKPFYNPIKTQAFGKIGDSRSPAQPLRVWELTQGPPVETTCTGV >GCiWno634_n23.b1_3 NLTLSSQT MVESSFLYPDGGGIRKAITNISSLEVPSNRTLINYLESEDFFYFLFFLIKYI GVPCFLMHVICCLWEIRCVRMKDHSCPLPLPRGNMGFPLVGEMFHLFVVVSLCFILSISV MSPTV*YFIVVHGFYLSH*LQFKVTCSDLLVTLTTQTFRG*KH*LGKGRHGNPVRLKFGS LSRFADANRKYDECNSKK*ISASACGAM**LFPKTDTPDMLLTLIHRSYLPPVGKFTIYG NLTTIAFWPAPENPFIIL*KPRLLVKLEIHDLPRNR*GFGS*PRDRLLKRLARG >scf/ciona01/G126/seq_dir/hrs/G126P66139R.T0/G126P66139RC11.T0.seq file 5 0 703 ABI Length = 703 Plus Strand HSPs: Score = 355 (125.0 bits), Expect = 3.2e-32, P = 3.2e-32 Identities = 62/89 (69%), Positives = 78/89 (87%), Frame = +1 Query: 18 ITNISSLEVPSNRTLINYLESEDFFYFLFFLIKYIGVPCFLMHVICCLWEIRCVRMKDHS 77 +TN+SS + +N+TL++Y+ S DF++ +FFLIKYIG+P FL+++ C LWEIRCVRMKDHS Sbjct: 283 MTNMSSWDNATNKTLVSYIGSNDFYFTIFFLIKYIGIPGFLLYLTCWLWEIRCVRMKDHS 462 Query: 78 CPLPLPRGNMGFPLVGEMFHLFVVVSLCF 106 CPLPLP GNMGFPLVGEMFHLFVVVSL + Sbjct: 463 CPLPLPGGNMGFPLVGEMFHLFVVVSLVY 549 >scf/ciona01/G126/seq_dir/hrs/G126P66139R.T0/G126P66139RC11.T0.seq 703 0 703 ABI GAGCTCCATGTGGTGGAATTCTGTGTCAAGGTTCTCACGTCTGGTAGCTC GTCGCTAGCTGAAACCTGTGTTTCCCTGACGAGTAGTTGGCTTGCCGATT CTCTGGTGGCCATTCCCAGCAGTTCGATCCAGGAACTGAAGCTGACAGAC TTGGAAGCAAACAGTTCAGGCAGTGAGCATAGCGAAAATCTGCTGACAGT CAATCTAACTCTACCAACCATCGAGGAAACCATGGAAGGGAACTCAGTAG AGTATATAGACCCTGTGGTGTACGGAGGAACCATGACGAACATGTCATCC TGGGATAATGCAACCAACAAAACGCTCGTCAGCTATATCGGATCGAATGA TTTCTACTTTACAATCTTCTTTCTGATAAAGTATATCGGTATTCCCGGCT TTCTCCTCTATCTAACCTGCTGGCTGTGGGAAATCCGATGTGTCCGGATG AAAGATCACTCCTGTCCTCTTCCGCTGCCTGGAGGAAACATGGGGTTTCC CCTAGTTGGAGAAATGTTCCATCTTTTTGTAGTGGTGAGTCTTGTTTACT GTTGTGATGAGAATGACTGCGTGAATTACAGACAGAACTTCAATATTTAT CTACGATACCCGCTTTGTGGATCGCCTTTCACTTAAGTCACATTACTGCG CAAACATGTCTCTATTGGCCTGTCGCGTTGCGATACCCCATTTCGGTTCT ATG Savignyi ortholog MEGNSVEYIDPVVYGGTMTNMSSWDNATNKTLVSYIGSNDFYF TIFFLIKYIGIPGFLLYLTCWLWEIRCVRMKDHSCPLPLPGGNMGFPLVGEMFHLFVV (0?) GANYQRQRRRKYGKIYRTHMFGSPSVAVIGDEYVKKIVLGE (1?) LVQTRWPSTTRRILGTDGIVNGDLATHCRIKRLALKAFSPKYVGTFAPVIQ QEWLRRSTVPILEMCKQAVSKTMMTVLLGIKSDDPNIQLYIQAADDIINSILSLPLDIPGFGFRK >scf/ciona01/G126/seq_dir/hrs/G126P67040F.T0/G126P67040FC5.T0.seq 778 0 778 ABI Length = 778 Plus Strand HSPs: Score = 280 (98.6 bits), Expect = 2.5e-24, P = 2.5e-24 Identities = 55/65 (84%), Positives = 60/65 (92%), Frame = +2 Query: 11 NKRPVALQEWVDQGTVHILEKCKQAVSKTMMTVLLGIKSNDPDIQLYIQAADDIINSILSLPLDLPG 70 QEW+ + TV ILE CKQAVSKTMMTVLLGIKS+DP+IQLYIQAADDIINSILSLPLD+PG Sbjct: 146 HVSKYVFQEWLRRSTVPILEMCKQAVSKTMMTVLLGIKSDDPNIQLYIQAADDIINSILSLPLDIPG 325 Query: 71 FGFHK 75 FGF K Sbjct: 326 FGFRK 340 >scf/ciona01/G126/seq_dir/hrs/G126P67040F.T0/G126P67040FC5.T0.seq 778 0 778 ABI ACATTGCGCTACTGTATCTACGCTCTGTGGTGGAATTCCACATCCTAAAT AATACCAAACTACAACCGCAGACTTATCGCCCTAAACGCATATAAAAGAA CTAGACCTTGAACAAACGAGTAAACATGTGAGCAAATACGTTTTCCAGGA ATGGCTAAGGCGAAGCACGGTGCCTATCCTTGAAATGTGCAAGCAAGCAG TTTCTAAAACAATGATGACTGTACTTCTGGGCATCAAATCGGACGACCCT AACATTCAACTCTACATCCAAGCGGCCGACGACATTATAAACAGCATTTT GAGCCTCCCGTTGGACATACCGGGGTTTGGATTTAGAAAGGTAAGTTTTG ACACGTTTTTAAGCCGAAAGATTTTAAATTATGCATTCTCCACGGACATT AAATGAAACACTAATGGTGGGTATTTTTTTTTGGGGGGGGGAGGGGGGGG NNNNNNNNNNNNNNCCAAAAAACAAAANNGNGCNNNNAACACNAAGNAGG GGGNNCNANANCANAANCCCACCAGCCAAGAGGAAAANAAANCCACCNNC GAAAGNACCCCCAAAAGCCAAACANNNAAAAACCAACCAANANAAAAAAA AAAAAAAAAAANNNNNCCAACGAGNNAAAAANCCCCANNAGGGGCACCCC CCNAACAACGGNNNGNNNACCACNNGGANAAGGGACCGGGGGGGGNACCC CANNGGGCCCACCAACCGACCCGAAACCANAANCCAAACAGNACCAANAA AAGGCCACNCGGCGACCACCCCCGCACG >GCiWno164_f14.g1 CHROMAT_FILE: GCiWno164_f14.g1 PHD_FILE: GCiWno164_f14.g1.phd.1 CHEM: term DYE: big TIME: Fri Sep 28 15:22:32 2001 TEMPLATE: GCiWno164_f14 DIRECTION: rev Length = 938 Score = 81.9 bits (199), Expect = 1e-15 Identities = 38/41 (92%), Positives = 40/41 (96%) Frame = +2 Query: 1 GANYQRQRRRKYGKIYRTHMFGSPSVAVIGDEYVKKIVLGE 41 GANYQRQRR KYGKIYRTHMFGSPSVAVIG+E+VKKIVLGE Sbjct: 293 GANYQRQRRSKYGKIYRTHMFGSPSVAVIGEEHVKKIVLGE 415 >scf/ciona01/G126/seq_dir/hrs/G126P601968F.T0/G126P601968FC10.T0.seq 710 0 710 ABI Length = 710 Minus Strand HSPs: Score = 81 (28.5 bits), Expect = 0.013, P = 0.013 Identities = 16/16 (100%), Positives = 16/16 (100%), Frame = -1 Query: 89 FPLVGEMFHLFVVVSL 104 FPLVGEMFHLFVVVSL Sbjct: 707 FPLVGEMFHLFVVVSL 660 >scf/ciona01/G126/seq_dir/hrs/G126P601968F.T0/G126P601968FC10.T0.seq file 11 710 ABI TGGATCATCNCCCTGTGGTGGAATTCTAGCGATNNNACGTATGNNNNNNN NNACTNNNNNNNNNNNNCTAGCGACCGACGATAAAGCGGTAAATAAAGGC GGTATGAAGGCGGGGTCTTATTACCACAAAGACGCCGTATAGGGCTCGAC GTTGCAGGTTTCTTTCTACGGCAAACACGAAATCAGGTTTATGGGTGCTG GTTAAAGGAATTGGACCACGTAGCAGGAACGGATATGATCTTGCATCAGG TCTGTTTCCGTGACGCGAATCAGTCAGGGTTTTACGGTACCAGCCCGTCA TAACTTCTGCGGTTTCCATAAATAGACAGTTTGCGCGCAAATAATGACTA ACCCAATGTGGTCAGGCGACTTTACATCGTTAAGGGGGAAGTCTTATCAC GACACCGTATTATACATAGATTTCGCATTTCCCGTGTTAGGATTGGTCAT AGCGGCGTTCGCGCTTCACCATACAGAATCGTACGTTCGTCGACCTAAAT CATAGAACCGAAATGGGTTATCGCAACGCGACAGGCCAATAGAGACATGT TTGCGCAGTAATGTGACTTAAGTGAAAGGCGATCCCAAAGCGGGTATCGT AGATAATATTTGAAGTTCTGTCTGTAATTCACGCAGTCATTCTCATCACA ACAGTAAACAAGACTCACCACTACAAAAAGATGGAACATTTCTCCAACTA GGGGAAACCN >scf/ciona01/G126/seq_dir/hrs/G126P601968F.T0/G126P601968FC10.T0.seq_4 file 11 710 ABI VSPSWRNVPSFCSGESCLLL**E*LRELQTELQILSTIPALGSPFT*VTLLRKHVSIGLS RCDNPFRFYDLGRRTYDSVW*SANAAMTNPNTGNAKSMYNTVS**DFPLNDVKSPDHIGL VIICAQTVYLWKPQKL*RAGTVKP*LIRVTETDLMQDHIRSCYVVQFL*PAPINLISCLP *KETCNVEPYTASLW**DPAFIPPLFTALSSVAXXXXXVXXXIRXIARIPPQGDDP >scf/ciona01/G126/seq_dir/hrs/G126P601968F.T0/G126P601968FC10.T0.seq_5 file 11 710 ABI GFP*LEKCSIFL*W*VLFTVVMRMTA*ITDRTSNIIYDTRFGIAFHLSHITAQTCLYWPV ALR*PISVL*FRSTNVRFCMVKRERRYDQS*HGKCEIYV*YGVVIRLPP*RCKVA*PHWV SHYLRANCLFMETAEVMTGWYRKTLTDSRHGNRPDARSYPFLLRGPIPLTSTHKPDFVFA VERNLQRRALYGVFVVIRPRLHTAFIYRFIVGR*XXXXSXXXHTXXR*NSTTGX*SX >scf/ciona01/G126/seq_dir/hrs/G126P601968F.T0/G126P601968FC10.T0.seq_6 file 11 710 ABI XFPLVGEMFHLFVVVSLVYCCDENDCVNYRQNFKYYLRYPLWDRLSLKSHYCANMSLLAC RVAITHFGSMI*VDERTILYGEARTPL*PILTREMRNLCIIRCRDKTSPLTM*SRLTTLG *SLFARKLSIYGNRRSYDGLVP*NPD*FASRKQT*CKIISVPATWSNSFNQHP*T*FRVC RRKKPATSSPIRRLCGNKTPPSYRLYLPLYRRSLXXXXXXXXXYVXSLEFHHRXMIX >scf/ciona01/G126/seq_dir/hrs/G126P65142R.T0/G126P65142RB3.T0.seq 737 0 737 ABI NTCTTTGACGCTGAAGCTCCATGTGGTGGGATTCAAATTATTCGACTCGA AGCCTTGATGTTTAAAATGTCAGAACGAAAGATTTGAGATAGATTTAAAC CAAACCGCGCCGATAAGAACTATTTGTATAAGCTTTTCGTACAGGTAATT CAAGGGTTTGTGACTTACCGGATGCCGCAACAGTCTGGCCGCATGCGATA AGTGCTTTTTGCGGTGATATTTGCAACGTTAATCACGTCGAATAGGGGCG GCAGATGTAGCGAATTGCCGCTTCAATCACACCGACTTAATATTAGCGTC GAGCGACCGACGATAAAGCGGTAAATAAAGGCGGTATGAAGGGCGGGGTC TTATTACCACAAAGCCGCTGTATAGGGNTCGACGTTGCAGGTTTCTTTCT ACGGCAAACACGAAATCAGGTTTATGGGTGCTGGTTAAGGGAATTGGACC ACGTAGCAGGAACGGATGTGATCTTGCACCAGGTCTGTTTCCGTGACGCG AATCAGTCAGGGTTTTACGGTACCAGCCCGTCATAACTTCTGCGGTTTCC ATAAATAGACAGTTTGCGCGCAAATAATGACTAACCCAATGTGGTCAGGC GTCTTTACATCGTTAAGGGGAAGTCTTATCACGACACCGTATTAAACATA GATTTCGCATTTCCCGTGTTAGGATTGGTCATAAGCGCGTACGCGCGTCA CCATACAGAATCGTACGTTCGTCGACCTTAATCATAA >scf/ciona01/G126/seq_dir/hrs/G126P65142R.T0/G126P65142RB3.T0.seq_4 737 0 737 ABI MIKVDERTILYGDARTRL*PILTREMRNLCLIRCRDKTSP*RCKDA*PHWVSHYLRANCL FMETAEVMTGWYRKTLTDSRHGNRPGARSHPFLLRGPIPLTSTHKPDFVFAVERNLQRRX LYSGFVVIRPRPSYRLYLPLYRRSLDANIKSV*LKRQFATSAAPIRRD*RCKYHRKKHLS HAARLLRHPVSHKPLNYLYEKLIQIVLIGAVWFKSISNLSF*HFKHQGFESNNLNPTTWS FSVKX >scf/ciona01/G126/seq_dir/hrs/G126P65142R.T0/G126P65142RB3.T0.seq_5 737 0 737 ABI YD*GRRTYDSVW*RAYALMTNPNTGNAKSMFNTVS**DFPLTM*RRLTTLG*SLFARKLS IYGNRRSYDGLVP*NPD*FASRKQTWCKITSVPATWSNSLNQHP*T*FRVCRRKKPATSX PIQRLCGNKTPPFIPPLFTALSSVARR*Y*VGVIEAAIRYICRPYST*LTLQISPQKALI ACGQTVAASGKSQTLELPVRKAYTNSSYRRGLV*IYLKSFVLTF*TSRLRVE*FESHHME LQRQRX >scf/ciona01/G126/seq_dir/hrs/G126P65142R.T0/G126P65142RB3.T0.seq_6 737 0 737 ABI L*LRSTNVRFCMVTRVRAYDQS*HGKCEIYV*YGVVIRLPLNDVKTPDHIGLVIICAQTV YLWKPQKL*RAGTVKP*LIRVTETDLVQDHIRSCYVVQFP*PAPINLISCLP*KETCNVX PYTAALW**DPALHTAFIYRFIVGRSTLILSRCD*SGNSLHLPPLFDVINVANITAKSTY RMRPDCCGIR*VTNP*ITCTKSLYK*FLSARFGLNLSQIFRSDILNIKASSRII*IPPHG ASASKX >scf/ciona01/G126/seq_dir/hrs/G126P601470R.T0/G126P601470RA2.T0.seq 741 0 741 ABI GGACTTTGTNGAAAACCCCCACTTTGGNNTTTTTAAATCCCCCCCGCANA GTTATGACGGGTTTTTACCGTAAAACCCTGACTGATTCGCGTCACGGAAA CAGACCTGATGCAAGATCATATCCGTTCCTGCTACGTGGTCCAATTCCTT TAACCAGCACCCATAAACCTGATTTCGTGTTTGCCGTAAAAAGAAACCTG CAACGTCGAGCCCTATACGGCGTCTTTGTGGTAATAAGACCCCGCCTTCA TACCGCCTTTATTTACCGCTTTATCGTCGGTCGCTAGACGCTAATATTAA GTCGGTGTGATTGAAGCGGCAATTCGCTACATCTGCCGCCCCTATTCGAC GTGATTAACGTTGCAAATTTCACCGCAAAAAGCACTTATCGCATGCGGCC AGACTGTTGCGGCATCCGGTAAGTCACAAACCCTCGAATTACCTGTACGA AAACCTTATACAAATAGTTCTTATCGGCGCGGTTTTGTTTGAATCTATCT CAAAATCTTTCATTTTGACATTTTAAACATCAAGGCGTCGAGTAGAATAT ATTTCGTGGTGTATTGATTGTAATCACAGATAATAAGATAGAGCTTTAAC ACAAGTAAGAAACAACTGGCAAAATCCCGTAAACGAGACGCGTATGCTGA AATTCCAGCAAAATTTCAAACTCTTAGTACGTATAAACACGCAGTAAATT TGATTGACCATAATTTATAGTTTTTGATGTTTTATTCGATT >scf/ciona01/G126/seq_dir/hrs/G126P601470R.T0/G126P601470RA2.T0.seq_1 741 0 741 ABI GLCXKPPLWXF*IPPAXL*RVFTVKP*LIRVTETDLMQDHIRSCYVVQFL*PAPINLISC LP*KETCNVEPYTASLW**DPAFIPPLFTALSSVARR*Y*VGVIEAAIRYICRPYST*LT LQISPQKALIACGQTVAASGKSQTLELPVRKPYTNSSYRRGFV*IYLKIFHFDILNIKAS SRIYFVVY*L*SQIIR*SFNTSKKQLAKSRKRDAYAEIPAKFQTLSTYKHAVNLIDHNL* FLMFYSI >scf/ciona01/G126/seq_dir/hrs/G126P601470R.T0/G126P601470RA2.T0.seq_2 741 0 741 ABI DFVENPHFGXFKSPPXSYDGFLP*NPD*FASRKQT*CKIISVPATWSNSFNQHP*T*FRV CRKKKPATSSPIRRLCGNKTPPSYRLYLPLYRRSLDANIKSV*LKRQFATSAAPIRRD*R CKFHRKKHLSHAARLLRHPVSHKPSNYLYENLIQIVLIGAVLFESISKSFILTF*TSRRR VEYISWCIDCNHR**DRALTQVRNNWQNPVNETRMLKFQQNFKLLVRINTQ*I*LTIIYS F*CFIR >scf/ciona01/G126/seq_dir/hrs/G126P601470R.T0/G126P601470RA2.T0.seq_3 741 0 741 ABI TLXKTPTLXFLNPPRXVMTGFYRKTLTDSRHGNRPDARSYPFLLRGPIPLTSTHKPDFVF AVKRNLQRRALYGVFVVIRPRLHTAFIYRFIVGR*TLILSRCD*SGNSLHLPPLFDVINV ANFTAKSTYRMRPDCCGIR*VTNPRITCTKTLYK*FLSARFCLNLSQNLSF*HFKHQGVE *NIFRGVLIVITDNKIEL*HK*ETTGKIP*TRRVC*NSSKISNS*YV*TRSKFD*P*FIV FDVLFD >scf/ciona01/G126/seq_dir/hrs/G126P604177F.T0/G126P604177FA6.T0.seq file 14 0 702 ABI Length = 702 Plus Strand HSPs: Score = 195 (68.6 bits), Expect = 2.9e-15, P = 2.9e-15 Identities = 39/39 (100%), Positives = 39/39 (100%), Frame = +1 Query: 1 SFNTSKKQLAKSRKRDAYAEIPAKFQTLSTYKHAVNLID 39 SFNTSKKQLAKSRKRDAYAEIPAKFQTLSTYKHAVNLID Sbjct: 277 SFNTSKKQLAKSRKRDAYAEIPAKFQTLSTYKHAVNLID 393 >scf/ciona01/G126/seq_dir/hrs/G126P604177F.T0/G126P604177FA6.T0.seq 702 0 702 ABI AGCTATGCGNTACTGAATCCATCGTCCTGTGGTGGNAATTCTAACGTTGC AAATTTCACCGCAAAAGCACTTATCGCATGCGGCCAGACTGTTGCGGCAT CCGGTAAGTCACAAACCCTCGAATTACCTGTACGAAAACCTTATACAAAT AGTTCTTATCGGCGCGGTTTTGTTTGAATCTATCTCAAAATCTTTCATTT TGACATTTTAAACATCAAGGCGTCGAGTAGAATATATTTCGTGGTGTATT GATTGTAATCACAGATAATAAGATAGAGCTTTAACACAAGTAAGAAACAA CTGGCAAAATCCCGTAAACGAGACGCGTATGCTGAAATTCCAGCAAAATT TCAAACTCTTAGTACGTATAAACACGCAGTAAATTTGATTGACACATAAT TTATAGTTTTTGATGTTTTATTCGATTAATTTACCTATAATGTGCGTTGC TGGGTTCTTTTAAACGCCCGAAACTGGAATTTTAATAAAAAAATAAAGGC AATACCAGCGTTTCAATGGTTGCCAAACCAATTAAATTTTATTAGGGCCC GTGCCTCTGGTGACTTTAATTTTTTGACCGCTATTTTGGTATCGGCTTAT TTTTAAACAGTACTCAAGATAAGGTAATTAGATAAAAAAAAGTTTGTTTT TTTAATAATAATTTGTAATGCATGGTTTAAATGTCGAGTTAAATCAAACT TA >scf/ciona01/G126/seq_dir/hrs/G126P604177F.T0/G126P604177FA6.T0.seq_1 702 0 702 ABI SYAXLNPSSCGGNSNVANFTAKALIACGQTVAASGKSQTLELPVRKPYTNSSYRRGFV*I YLKIFHFDILNIKASSRIYFVVY*L*SQIIR*SFNTSKKQLAKSRKRDAYAEIPAKFQTL STYKHAVNLIDT*FIVFDVLFD*FTYNVRCWVLLNARNWNFNKKIKAIPAFQWLPNQLNF IRARASGDFNFLTAILVSAYF*TVLKIR*LDKKKFVFLIIICNAWFKCRVKSNL >scf/ciona01/G126/seq_dir/hrs/G126P604177F.T0/G126P604177FA6.T0.seq_2 702 0 702 ABI AMRY*IHRPVVXILTLQISPQKHLSHAARLLRHPVSHKPSNYLYENLIQIVLIGAVLFES ISKSFILTF*TSRRRVEYISWCIDCNHR**DRALTQVRNNWQNPVNETRMLKFQQNFKLL VRINTQ*I*LTHNL*FLMFYSINLPIMCVAGFF*TPETGILIKK*RQYQRFNGCQTN*IL LGPVPLVTLIF*PLFWYRLIFKQYSR*GN*IKKSLFF***FVMHGLNVELNQT >scf/ciona01/G126/seq_dir/hrs/G126P604177F.T0/G126P604177FA6.T0.seq_3 702 0 702 ABI LCXTESIVLWWXF*RCKFHRKSTYRMRPDCCGIR*VTNPRITCTKTLYK*FLSARFCLNL SQNLSF*HFKHQGVE*NIFRGVLIVITDNKIEL*HK*ETTGKIP*TRRVC*NSSKISNS* YV*TRSKFD*HIIYSF*CFIRLIYL*CALLGSFKRPKLEF**KNKGNTSVSMVAKPIKFY *GPCLW*L*FFDRYFGIGLFLNSTQDKVIR*KKVCFFNNNL*CMV*MSS*IKL >scf/ciona01/G126/seq_dir/hrs/G126P66016R.T0/G126P66016RA1.T0.seq file 5 708 ABI Length = 708 Minus Strand HSPs: Score = 168 (59.1 bits), Expect = 2.1e-12, P = 2.1e-12 Identities = 32/32 (100%), Positives = 32/32 (100%), Frame = -2 Query: 1 FFDRYFGIGLFLNSTQDKVIR*KKVCFFNNNL 32 FFDRYFGIGLFLNSTQDKVIR*KKVCFFNNNL Sbjct: 227 FFDRYFGIGLFLNSTQDKVIR*KKVCFFNNNL 132 >scf/ciona01/G126/seq_dir/hrs/G126P66016R.T0/G126P66016RA1.T0.seq 708 0 708 ABI GAGCTCCATGTGGTGGAATTCCTTATTTAAAATTGTTAAATCGAGTTTTT AATGGTAAAAATGGTTAAATTTCTGTATTAAGGTAGGTATATTGTAAGTT TGATTTAACTCGACATTTAAACCATGCATTACAAATTATTATTAAAAAAA CAAACTTTTTTTTATCTAATTACCTTATCTTGAGTACTGTTTAAAAATAA GCCGATACCAAAATAGCGGTCAAAAAATTAAAGTCACCAGAGGCACGGGC CCTAATAAAATTTAATTGGTTTGGCAACCATTGAAACGCTGGTATTGCCT TTATTTTTTTATTAAAATTCCAGTTTCGGGCGTTTAAAAGAACCCAGCAA CGCACATTATAGGTAAATTAATCGAATAAAACATCAAAAACTATAAATTA TGTGTCAATCAAATTTACTGCGTGTTTATACGTACTAAGAGTTTGAAATT TTGCTGGAATTTCAGCATACGCGTCTCGTTTACGGGATTTTGCCAGTTGT TTCTTACTTGTGTTAAAGCTCTATCTTATTATCTGTGATTACAATCAATA CACCACGAAATATATTCTACTCGACGCCTTGATGTTTAAAATGTCAAAAT GAAAGATTTTGAGATAGATTCAAACAAAACCGCGCCGATAAGAANCTATT TGTATAAGGTTTTCGTACAGGTAATTTCGAGGGTTTGTGACTTACCGGAT GCCGCAAC >scf/ciona01/G126/seq_dir/hrs/G126P66016R.T0/G126P66016RA1.T0.seq_4 708 0 708 ABI VAASGKSQTLEITCTKTLYK*XLIGAVLFESISKSFILTF*TSRRRVEYISWCIDCNHR* *DRALTQVRNNWQNPVNETRMLKFQQNFKLLVRINTQ*I*LTHNL*FLMFYSINLPIMCV AGFF*TPETGILIKK*RQYQRFNGCQTN*ILLGPVPLVTLIF*PLFWYRLIFKQYSR*GN *IKKSLFF***FVMHGLNVELNQTYNIPTLIQKFNHFYH*KLDLTILNKEFHHMEL >scf/ciona01/G126/seq_dir/hrs/G126P66016R.T0/G126P66016RA1.T0.seq_5 708 0 708 ABI CGIR*VTNPRNYLYENLIQIXSYRRGFV*IYLKIFHFDILNIKASSRIYFVVY*L*SQII R*SFNTSKKQLAKSRKRDAYAEIPAKFQTLSTYKHAVNLIDT*FIVFDVLFD*FTYNVRC WVLLNARNWNFNKKIKAIPAFQWLPNQLNFIRARASGDFNFLTAILVSAYF*TVLKIR*L DKKKFVFLIIICNAWFKCRVKSNLQYTYLNTEI*PFLPLKTRFNNFK*GIPPHGAX >scf/ciona01/G126/seq_dir/hrs/G126P66016R.T0/G126P66016RA1.T0.seq_6 708 0 708 ABI LRHPVSHKPSKLPVRKPYTNXFLSARFCLNLSQNLSF*HFKHQGVE*NIFRGVLIVITDN KIEL*HK*ETTGKIP*TRRVC*NSSKISNS*YV*TRSKFD*HIIYSF*CFIRLIYL*CAL LGSFKRPKLEF**KNKGNTSVSMVAKPIKFY*GPCLW*L*FFDRYFGIGLFLNSTQDKVI R*KKVCFFNNNL*CMV*MSS*IKLTIYLP*YRNLTIFTIKNSI*QF*IRNSTTWSS >scf/ciona01/G126/seq_dir/hrs/G126P68612R.T0/G126P68612RH6.T0.seq file 13 699 ABI Length = 699 Minus Strand HSPs: Score = 200 (70.4 bits), Expect = 8.6e-16, P = 8.6e-16 Identities = 38/38 (100%), Positives = 38/38 (100%), Frame = -2 Query: 1 FVMHGLNVELNQTYNIPTLIQKFNHFYH*KLDLTILNK 38 FVMHGLNVELNQTYNIPTLIQKFNHFYH*KLDLTILNK Sbjct: 683 FVMHGLNVELNQTYNIPTLIQKFNHFYH*KLDLTILNK 570 >scf/ciona01/G126/seq_dir/hrs/G126P68612R.T0/G126P68612RH6.T0.seq 699 0 699 ABI CTACACGTAGGTGGAATTTCGGTAACTCGCGTGATGTAATCTGACCCGCT GGTTGTGAGAACTATCCCTAGCATATTCGCGACGCAATTTGACGATTACT GTATGATAACGCGCCTTGCGTTTTCCCATTTAATAGGACAAAGATATATA TCTTATCCTTTAAGTTTTAAAGCCGTAAAGGGTTAGCTCATCGCTAAGAC ACTACTAACAGTTATATCGTCTGCGTTGAGCATTCAATAACACGTCCGTA CAAAACAAGCAAGTTTATCAAGAACCTTCTTCCATTCGATAACGCGGATG CGAATAAATTAGTTTAACCACGTGCGCCACAACTGATTTTGTTACTAAAT GTCCGGGATTTTGCAAGGAAAATTTTCTTAGAATAAATCACAAGTGATTA AACCATTTTTTTCAGAGTTAACTAGTTCGGCGAATGTTGATTACTTTTTC GACTACTATTGTGGTACCAGTAAAAGTACAAATTGCATTACATATTTACA CCGCTATACTTTAAACGATTTACTAATCTGCTAACAAAAACAAGAAAAAC AGCAGTTTAACTTTATTAGCTTATTTAAAATTGTTAAATCGAGTTTTTAA TGGTAAAAATGGTTAAATTTCTGTATTAAGGTAGGTATATTGTAAGTTTG ATTTAACTCGACATTTAAACCATGCATTACAAATTATTATTAAAAAAAC >scf/ciona01/G126/seq_dir/hrs/G126P68612R.T0/G126P68612RH6.T0.seq_4 699 0 699 ABI VFLIIICNAWFKCRVKSNLQYTYLNTEI*PFLPLKTRFNNFK*ANKVKLLFFLFLLAD** IV*SIAV*ICNAICTFTGTTIVVEKVINIRRTS*L*KKWFNHL*FILRKFSLQNPGHLVT KSVVAHVVKLIYSHPRYRMEEGS**TCLFCTDVLLNAQRRRYNC**CLSDELTLYGFKT* RIRYISLSY*MGKRKARYHTVIVKLRREYARDSSHNQRVRLHHASYRNSTYV* >scf/ciona01/G126/seq_dir/hrs/G126P68612R.T0/G126P68612RH6.T0.seq_5 699 0 699 ABI FFNNNL*CMV*MSS*IKLTIYLP*YRNLTIFTIKNSI*QF*IS**S*TAVFLVFVSRLVN RLKYSGVNM*CNLYFYWYHNSSRKSNQHSPN*LTLKKMV*SLVIYSKKIFLAKSRTFSNK ISCGARG*TNLFASALSNGRRFLINLLVLYGRVIECSTQTI*LLVVS*R*ANPLRL*NLK DKIYIFVLLNGKTQGALSYSNRQIASRIC*G*FSQPAGQITSRELPKFHLRVX >scf/ciona01/G126/seq_dir/hrs/G126P68612R.T0/G126P68612RH6.T0.seq_6 699 0 699 ABI FF***FVMHGLNVELNQTYNIPTLIQKFNHFYH*KLDLTILNKLIKLNCCFSCFC*QISK SFKV*RCKYVMQFVLLLVPQ**SKK*STFAELVNSEKNGLITCDLF*ENFPCKIPDI**Q NQLWRTWLN*FIRIRVIEWKKVLDKLACFVRTCY*MLNADDITVSSVLAMS*PFTALKLK G*DIYLCPIKWENARRVIIQ*SSNCVANMLGIVLTTSGSDYITRVTEIPPTCX >scf/ciona01/G126/seq_dir/hrs/G126P68253R.T0/G126P68253RD1.T0.seq file 9 742 ABI Length = 742 Minus Strand HSPs: Score = 124 (43.7 bits), Expect = 6.7e-11, Sum P(2) = 6.7e-11 Identities = 24/25 (96%), Positives = 24/25 (96%), Frame = -2 Query: 1 MGKRKARYHTVIVKLRREYARDSSH 25 MGKRKARYHTVIVKLRREYARD SH Sbjct: 435 MGKRKARYHTVIVKLRREYARDRSH 361 Score = 49 (17.2 bits), Expect = 6.7e-11, Sum P(2) = 6.7e-11 Identities = 9/10 (90%), Positives = 9/10 (90%), Frame = -3 Query: 29 VRLHHASYRN 38 VRLHHA YRN Sbjct: 350 VRLHHAIYRN 321 >scf/ciona01/G126/seq_dir/hrs/G126P68253R.T0/G126P68253RD1.T0.seq 742 0 742 ABI CACTCTGACACTGAAACTCCATGTGGTGNGATTCGAACTGTGCGTCCTGT AGATCTTCCCGTATTTTCGCCTTCTTTGTCGTTGGTAATTCGCCCCCTAC AACGAACATAAAATTCTCAATATTTTAAGTTCGGTCGATTGGCCGGACTT AATAGGTTAGTGCGACGCCTTTTAACCGAGAGGTTGCAGGTTCAAAACTG GTAATTAGCTAGTCGGTTGTGTCTTTGCGCAAGGCACTTAACAGACATTG ACTAAACCCATTGAAATGATCGGTTCTACCAAATTAAAGGAACATCTCAA TCATACATCACACTTCAATAGTTCCGGTAAATCGCGTGATGTAATCTGAC CATTACTTTTGTGAGAACGATCCCTTGCATATTCGCGACGCAATTTGACG ATTACTGTATGATAACGCGCCTTGCGTTTTCCCATTTAATAGGACAAAGA TATATATCTTATCCTTTAAGTTTTAAAGCCGTAAAGGGTTAGCTCATCGC TAAGACACTACTAACAGTTATATCGTCTGCGTTGAGCATTCAATAACACG TCCGTACAAAACAAGCAAGTTTATCAAGAACCTTCTTCCATTCGATAACG CGGATGCGAATAAATTAGTTTAACCACGTGCGCCACAACTGATTTTGTTA CTAAATGTCCGGGATTTTGCAAGGAAAATTTTCTTAGAATAAATCACAAG TGATTAAACCATTTTTTTCAGAGTTAACTAGTTCGGCGAATG >scf/ciona01/G126/seq_dir/hrs/G126P68253R.T0/G126P68253RD1.T0.seq_4 742 0 742 ABI IRRTS*L*KKWFNHL*FILRKFSLQNPGHLVTKSVVAHVVKLIYSHPRYRMEEGS**TCL FCTDVLLNAQRRRYNC**CLSDELTLYGFKT*RIRYISLSY*MGKRKARYHTVIVKLRRE YARDRSHKSNGQITSRDLPELLKCDV*LRCSFNLVEPIISMGLVNVC*VPCAKTQPTS*L PVLNLQPLG*KASH*PIKSGQSTELKILRILCSL*GANYQRQRRRKYGKIYRTHSSNXTT WSFSVRV >scf/ciona01/G126/seq_dir/hrs/G126P68253R.T0/G126P68253RD1.T0.seq_5 742 0 742 ABI HSPN*LTLKKMV*SLVIYSKKIFLAKSRTFSNKISCGARG*TNLFASALSNGRRFLINLL VLYGRVIECSTQTI*LLVVS*R*ANPLRL*NLKDKIYIFVLLNGKTQGALSYSNRQIASR ICKGSFSQK*WSDYITRFTGTIEV*CMIEMFL*FGRTDHFNGFSQCLLSALRKDTTD*LI TSFEPATSRLKGVALTY*VRPIDRT*NIENFMFVVGGELPTTKKAKIREDLQDAQFESHH MEFQCQSX >scf/ciona01/G126/seq_dir/hrs/G126P68253R.T0/G126P68253RD1.T0.seq_6 742 0 742 ABI FAELVNSEKNGLITCDLF*ENFPCKIPDI**QNQLWRTWLN*FIRIRVIEWKKVLDKLAC FVRTCY*MLNADDITVSSVLAMS*PFTALKLKG*DIYLCPIKWENARRVIIQ*SSNCVAN MQGIVLTKVMVRLHHAIYRNY*SVMYD*DVPLIW*NRSFQWV*SMSVKCLAQRHNRLANY QF*TCNLSVKRRRTNLLSPANRPNLKY*EFYVRCRGRITNDKEGENTGRSTGRTVRIXPH GVSVSEX >scf/ciona01/G126/seq_dir/hrs/G126P64610F.T0/G126P64610FC7.T0.seq file 0 754 ABI Length = 754 Plus Strand HSPs: Score = 213 (75.0 bits), Expect = 3.3e-17, P = 3.3e-17 Identities = 43/44 (97%), Positives = 43/44 (97%), Frame = +1 Query: 1 KASH*PIKSGQSTELKILRILCSL*GANYQRQRRRKYGKIYRTH 44 KASH*PIKS QSTELKILRILCSL*GANYQRQRRRKYGKIYRTH Sbjct: 118 KASH*PIKSDQSTELKILRILCSL*GANYQRQRRRKYGKIYRTH 249 >scf/ciona01/G126/seq_dir/hrs/G126P64610F.T0/G126P64610FC7.T0.seq 754 0 754 ABI AACCTTTTGCGNTACTGATAATCCTNCGCTTCTCTGTGGTGGNAATTCAG TCACCTTGGCCCAAGGACACAACCTACTAGCTAACGACCAGTTTCGCACC TGCAACCTCTCGGTTAAAAGGCGTCGCACTAACCTATTAAGTCCGACCAA TCGACCGAACTTAAAATATTGAGAATTTTATGTTCGTTGTAGGGGGCGAA TTACCAACGACAACGAAGGCGCAAATATGGGAAGATCTACAGGACGCACA TGTTCGGGAGTCCGTCGGTGGCGGTAATTGGCGACGAATACGTGAAAAAG ATTGTATTGGGGGAAGGTGGGTGTCAAAATGGAATATTTAAACACATTTG AAAACATTTCAACATATTTAAACAAATTTTTATTACATTTAAACATTTTT TTACAAAATTTTAATACATTTTAACACATGTTTTAACAATTTTTATCAAA TTTTTAAATCAGTTCAACACATTTAAACACATTTTGCCAATTTTTTATCA AATTTTACCAGATGTTTAACACATTTTAACACATTTTTGACACAGTTAAG TACCAAAATATCTGTGCGCAAGTTTGGTAAAGAAGTTTTGTTCAGAAGAA AATTTTGAAATTCTATTAAAATTCTAGTTCAGATTATTTCGATTCACAGT TTTTTTATTGGCAATAAAAATACGCTNTCCTGGCATACCGGTAGAACTAA AGGATTCATTGCTCTAAATAACTNCATATCGAATGGTTAATAACGCGACC GATT >scf/ciona01/G126/seq_dir/hrs/G126P64610F.T0/G126P64610FC7.T0.seq_1 754 0 754 ABI NLLRY**SXASLWWXFSHLGPRTQPTS*RPVSHLQPLG*KASH*PIKSDQSTELKILRIL CSL*GANYQRQRRRKYGKIYRTHMFGSPSVAVIGDEYVKKIVLGEGGCQNGIFKHI*KHF NIFKQIFITFKHFFTKF*YILTHVLTIFIKFLNQFNTFKHILPIFYQILPDV*HILTHF* HS*VPKYLCASLVKKFCSEENFEILLKF*FRLFRFTVFLLAIKIRXPGIPVELKDSLL*I TXYRMVNNATDX >scf/ciona01/G126/seq_dir/hrs/G126P64610F.T0/G126P64610FC7.T0.seq_2 754 0 754 ABI TFCXTDNPXLLCGGNSVTLAQGHNLLANDQFRTCNLSVKRRRTNLLSPTNRPNLKY*EFY VRCRGRITNDNEGANMGRSTGRTCSGVRRWR*LATNT*KRLYWGKVGVKMEYLNTFENIS TYLNKFLLHLNIFLQNFNTF*HMF*QFLSNF*ISSTHLNTFCQFFIKFYQMFNTF*HIFD TVKYQNICAQVW*RSFVQKKILKFY*NSSSDYFDSQFFYWQ*KYAXLAYR*N*RIHCSK* LHIEWLITRPI >scf/ciona01/G126/seq_dir/hrs/G126P64610F.T0/G126P64610FC7.T0.seq_3 754 0 754 ABI PFAXLIILRFSVVXIQSPWPKDTTY*LTTSFAPATSRLKGVALTY*VRPIDRT*NIENFM FVVGGELPTTTKAQIWEDLQDAHVRESVGGGNWRRIREKDCIGGRWVSKWNI*THLKTFQ HI*TNFYYI*TFFYKILIHFNTCFNNFYQIFKSVQHI*THFANFLSNFTRCLTHFNTFLT QLSTKISVRKFGKEVLFRRKF*NSIKILVQIISIHSFFIGNKNTLSWHTGRTKGFIALNN XISNG**RDR >scf/ciona01/G126/seq_dir/hrs/G126P64297F.T0/G126P64297FD4.T0.seq 739 0 739 ABI Length = 739 Minus Strand HSPs: Score = 108 (38.0 bits), Expect = 1.3e-05, P = 1.3e-05 Identities = 22/22 (100%), Positives = 22/22 (100%), Frame = -3 Query: 1 NSIKILVQIISIHSFFIGNKNT 22 NSIKILVQIISIHSFFIGNKNT Sbjct: 500 NSIKILVQIISIHSFFIGNKNT 435 Score = 75 (26.4 bits), Expect = 0.061, P = 0.059 Identities = 15/24 (62%), Positives = 16/24 (66%), Frame = -2 Query: 15 FFIGNKNTLSWHTGRTKGFIALNN 38 FF SWHTGRTK FIA+NN Sbjct: 459 FFYWQ*KHASWHTGRTKVFIAVNN 388 >scf/ciona01/G126/seq_dir/hrs/G126P64297F.T0/G126P64297FD4.T0.seq 739 0 739 ABI AGCTCTGCGCTACTGTATCTCGCCCTGTGGTGNGATTCGCTGGTATTCAT GTAAGCAGTATAAAATACAACTGACCTTAAAACATACTGCAACGGTAATA TAAAATGAAATAGGCGGTAAAGTCTAACGGTTTTTGGCGGTTAGAATAAC GATAAATGCGACAGGTAATTATTGTCAAAGAGTTGATTACTAGGGCATCA TCAAGTAATCAGCGCACGCATCAAAATAACGTACCAAGATATAACATGTA ACATATTAAGTTTATTTTTTACCGGGCCCAGTTTGATCCCATTTAGTAAC TAAATCAGTTTTCATTATATACGGCGTGGTATACGAATCGGTCGCGGTAT TAACCATTCGGCCACACGACCGTTCATGAAGTATGGAGTTATTGACAGCA ATGAATACTTTAGTTCTACCGGTATGCCAGGACGCGTGTTTTTATTGCCA ATAAAAAAACTGTGAATCGAAATAATCTGAACTAGAATTTTAATAGAATT TCAAAATTTTCTTCTGAACAAAACTTCTTTACCAAACTTGCGCACAGATA TTTTGGTACTTAACTGTGTCAAATATGTGTTAAAATGTGTTAAAAATCTG GTAAAATTTGATAAAAAAATGGCAAAATGTGTTTAAATGTGTTGAACTGA TTTAAAAATTTGTTAAAAATTGTTAAAACATGTGTTAAAATGTATTAAAA TTTTGTAAAAAAATGTTTAAATGTAATAAAAAATTTGTT >scf/ciona01/G126/seq_dir/hrs/G126P64297F.T0/G126P64297FD4.T0.seq_4 739 0 739 ABI TNFLLHLNIFLQNFNTF*HMF*QFLTNF*ISSTHLNTFCHFFIKFYQIFNTF*HIFDTVK YQNICAQVW*RSFVQKKILKFY*NSSSDYFDSQFFYWQ*KHASWHTGRTKVFIAVNNSIL HERSCGRMVNTATDSYTTPYIMKTDLVTKWDQTGPGKK*T*YVTCYILVRYFDACADYLM MP**STL*Q*LPVAFIVILTAKNR*TLPPISFYITVAVCFKVSCILYCLHEYQRIXPQGE IQ*RRA >scf/ciona01/G126/seq_dir/hrs/G126P64297F.T0/G126P64297FD4.T0.seq_5 739 0 739 ABI NKFFITFKHFFTKF*YILTHVLTIFNKFLNQFNTFKHILPFFYQILPDF*HILTHI*HS* VPKYLCASLVKKFCSEENFEILLKF*FRLFRFTVFLLAIKTRVLAYR*N*SIHCCQ*LHT S*TVVWPNG*YRDRFVYHAVYNEN*FSY*MGSNWAR*KINLICYMLYLGTLF*CVR*LLD DALVINSLTIITCRIYRYSNRQKPLDFTAYFILYYRCSMF*GQLYFILLT*IPANXTTGR DTVAQSX >scf/ciona01/G126/seq_dir/hrs/G126P64297F.T0/G126P64297FD4.T0.seq_6 739 0 739 ABI QIFYYI*TFFYKILIHFNTCFNNF*QIFKSVQHI*THFAIFLSNFTRFLTHFNTYLTQLS TKISVRKFGKEVLFRRKF*NSIKILVQIISIHSFFIGNKNTRPGIPVELKYSLLSITPYF MNGRVAEWLIPRPIRIPRRI**KLI*LLNGIKLGPVKNKLNMLHVISWYVILMRALIT** CPSNQLFDNNYLSHLSLF*PPKTVRLYRLFHFILPLQYVLRSVVFYTAYMNTSESHHRAR YSSAEL >scf/ciona01/G126/seq_dir/hrs/G126P602136R.T0/G126P602136RB3.T0.seq 732 0 732 ABI Length = 732 Plus Strand HSPs: Score = 275 (96.8 bits), Expect = 9.2e-24, P = 9.2e-24 Identities = 50/50 (100%), Positives = 50/50 (100%), Frame = +1 Query: 1 TFFYKILIHFNTCFNNFYQIFKSVQHI*THFANFLSNFTRCLTHFNTFLT 50 TFFYKILIHFNTCFNNFYQIFKSVQHI*THFANFLSNFTRCLTHFNTFLT Sbjct: 223 TFFYKILIHFNTCFNNFYQIFKSVQHI*THFANFLSNFTRCLTHFNTFLT 372 >scf/ciona01/G126/seq_dir/hrs/G126P602136R.T0/G126P602136RB3.T0.seq 732 0 732 ABI TACTTGGACACTGAAACTCCATGTGGTGGAAATTCGACAACGCAAGGCGC AAATATGGGAAAGATCTACAGGACGCACATGTTCGGGAGTCCGTCGGTGG CGGTAATTGGCGACGAATACGTNGAAAAAGATTGTATTGGGGGAAGGTGG GTGTCAAAATGGAATATTTAAACACATTTGAAAACATTTCAACATATTTA AACAAATTTTTATTACATTTAAACATTTTTTTACAAAATTTTAATACATT TTAACACATGTTTTAACAATTTTTATCAAATTTTTAAATCAGTTCAACAC ATTTAAACACATTTTGCCAATTTTTTATCAAATTTTACCAGATGTTTAAC ACATTTTAACACATTTTTGACACAGTTAAGTACCAAAATATCTGTGCGCA AGTTTGGTAAAGAAGTTTTGTTCAGAAGAAAATTTTGAAATTCTATTAAA ATTCTAGTTCAGATTATTTCGATTCACAGTTTTTTTATTGGCAATAAAAA TACGCTTTCCTGGCATACCGGTAGAACTAAAGGATTCATTGCTCTAAATA ACTCCATATCGAATGGTTAATAACGCGACCGATTCGTATAATACCACGCC GTATATAATGAAAACGGACTTAGTTACTTAATGGAATCGAAACTGAGAGT GGCAAAAAACACAAAAACAACAACTTTATATTCCAATCACTGCAGGGACC TTTAGTGCAAACGAGATGGCCAAGCACACNAG >scf/ciona01/G126/seq_dir/hrs/G126P602136R.T0/G126P602136RB3.T0.seq_1 732 0 732 ABI YLDTETPCGGNSTTQGANMGKIYRTHMFGSPSVAVIGDEYVEKDCIGGRWVSKWNI*THL KTFQHI*TNFYYI*TFFYKILIHFNTCFNNFYQIFKSVQHI*THFANFLSNFTRCLTHFN TFLTQLSTKISVRKFGKEVLFRRKF*NSIKILVQIISIHSFFIGNKNTLSWHTGRTKGFI ALNNSISNG**RDRFV*YHAVYNENGLSYLMESKLRVAKNTKTTTLYSNHCRDL*CKRDG QAHX >scf/ciona01/G126/seq_dir/hrs/G126P602136R.T0/G126P602136RB3.T0.seq_2 732 0 732 ABI TWTLKLHVVEIRQRKAQIWERSTGRTCSGVRRWR*LATNTXKKIVLGEGGCQNGIFKHI* KHFNIFKQIFITFKHFFTKF*YILTHVLTIFIKFLNQFNTFKHILPIFYQILPDV*HILT HF*HS*VPKYLCASLVKKFCSEENFEILLKF*FRLFRFTVFLLAIKIRFPGIPVELKDSL L*ITPYRMVNNATDSYNTTPYIMKTDLVT*WNRN*EWQKTQKQQLYIPITAGTFSANEMA KHT >scf/ciona01/G126/seq_dir/hrs/G126P602136R.T0/G126P602136RB3.T0.seq_3 732 0 732 ABI LGH*NSMWWKFDNARRKYGKDLQDAHVRESVGGGNWRRIRXKRLYWGKVGVKMEYLNTFE NISTYLNKFLLHLNIFLQNFNTF*HMF*QFLSNF*ISSTHLNTFCQFFIKFYQMFNTF*H IFDTVKYQNICAQVW*RSFVQKKILKFY*NSSSDYFDSQFFYWQ*KYAFLAYR*N*RIHC SK*LHIEWLITRPIRIIPRRI**KRT*LLNGIETESGKKHKNNNFIFQSLQGPLVQTRWP STX >scf/ciona01/G126/seq_dir/hrs/G126P603542F.T0/G126P603542FC12.T0.seq 694 0 694 ABI Length = 694 Minus Strand HSPs: Score = 130 (45.8 bits), Expect = 1.7e-11, Sum P(2) = 1.7e-11 Identities = 25/25 (100%), Positives = 25/25 (100%), Frame = -2 Query: 1 LLNGIETESGKKHKNNNFIFQSLQG 25 LLNGIETESGKKHKNNNFIFQSLQG Sbjct: 501 LLNGIETESGKKHKNNNFIFQSLQG 427 Score = 46 (16.2 bits), Expect = 1.7e-11, Sum P(2) = 1.7e-11 Identities = 8/9 (88%), Positives = 8/9 (88%), Frame = -1 Query: 25 GPLVQTRWP 33 G LVQTRWP Sbjct: 430 GTLVQTRWP 404 >scf/ciona01/G126/seq_dir/hrs/G126P603542F.T0/G126P603542FC12.T0.seq 694 0 694 ABI CATTGGCGANTACTGAAACTCATCGCCCTGTGGTGGGATTCAACGGGCCG TTTCGAAGCTACAATCTTTCGGTTAAAAGACGTCGCACCAACCCATCCAA CCCATCCGATGACTAATTATCTTTATATGAACGGTCGTGTGGCCGAATGG TTAACGCGACCGATACATATGCCGACTCCTATGCAAAAACGGTGACATCC CCATCATGGGCTCGAAACTTGGCTCGTTAATAAAAAATAATAATTACCTT TATATGAGCGGCGATGCCCGCCTGAATAACCGGGGCAAAAGTGCCGACAT ATTTTGGCGAAAACGCTTTCAGAGCGAGCCGTTTGATCCGGCAATGTGTG GCAAGGTCGCCGTTCACAATCCCATCCGTGCCCAGAATACGTCTTGTTGT GCTTGGCCATCTCGTTTGCACTAAAGTCCCTGCAGTGATTGGAATATAAA GTTGTTGTTTTTGTGTTTTTTGCCACTCTCAGTTTCGATTCCATTAAGTA ACTAAGTCCGTTTTCATTATATACGGCGTGGTATTATACGAATCGGTCGC GTTATTAACCATTCGATATGGAGTTATTTAGAGCAATGAATCCTTTAGTT CTACCGGTATGCCAGGAAAGCGTATTTTTATTGCCAATAAAAAAACTGTG AATCGAAATAATCTGAACTAGAATTTTAATAGAATTTCAAAATA >CYP26A1 Scaffold_12575 Length = 5934 Length = 432 Minus Strand HSPs: Score = 88 (31.0 bits), Expect = 0.00041, P = 0.00041 Identities = 19/59 (32%), Positives = 34/59 (57%), Frame = -1 Query: 424 LVQTRWPSTTRRILGTDGIVNGDLATHCRIKRLALKAFSPKYVGTFAPVIQAGIAAHIK 248 LV +WP++ R ILG+D + N A H K+ ++AFS + + + P +Q + A ++ Sbjct: 107 LVAVQWPASVRTILGSDTLSNVHGAQHKTKKKAIMQAFSREALEFYIPAMQHEVQAAVQ 165 >scf/ciona01/G126/seq_dir/hrs/G126P603542F.T0/G126P603542FC12.T0.seq_4 694 0 694 ABI ILKFY*NSSSDYFDSQFFYWQ*KYAFLAYR*N*RIHCSK*LHIEWLITRPIRIIPRRI** KRT*LLNGIETESGKKHKNNNFIFQSLQGL*CKRDGQAQQDVFWARMGL*TATLPHIAGS NGSL*KRFRQNMSALLPRLFRRASPLI*R*LLFFINEPSFEPMMGMSPFLHRSRHMYRSR *PFGHTTVHIKIISHRMGWMGWCDVF*PKDCSFETAR*IPPQGDEFQXSPM >scf/ciona01/G126/seq_dir/hrs/G126P603542F.T0/G126P603542FC12.T0.seq_5 694 0 694 ABI YFEILLKF*FRLFRFTVFLLAIKIRFPGIPVELKDSLL*ITPYRMVNNATDSYNTTPYIM KTDLVT*WNRN*EWQKTQKQQLYIPITAGTLVQTRWPSTTRRILGTDGIVNGDLATHCRI KRLALKAFSPKYVGTFAPVIQAGIAAHIKVIIIFY*RAKFRAHDGDVTVFA*ESAYVSVA LTIRPHDRSYKDN*SSDGLDGLVRRLLTERL*LRNGPLNPTTGR*VSVXANX >scf/ciona01/G126/seq_dir/hrs/G126P603542F.T0/G126P603542FC12.T0.seq_6 694 0 694 ABI F*NSIKILVQIISIHSFFIGNKNTLSWHTGRTKGFIALNNSISNG**RDRFV*YHAVYNE NGLSYLMESKLRVAKNTKTTTLYSNHCRDFSANEMAKHNKTYSGHGWDCERRPCHTLPDQ TARSESVFAKICRHFCPGYSGGHRRSYKGNYYFLLTSQVSSP*WGCHRFCIGVGICIGRV NHSATRPFI*R*LVIGWVGWVGATSFNRKIVASKRPVESHHRAMSFSXRQX >GCiWno735_j03.b1 CHROMAT_FILE: GCiWno735_j03.b1 PHD_FILE: GCiWno735_j03.b1.phd.1 CHEM: term DYE: big TIME: Wed Nov 28 13:26:02 2001 TEMPLATE: GCiWno735_j03 DIRECTION: fwd Length = 902 Score = 111 bits (276), Expect = 9e-25 Identities = 54/60 (90%), Positives = 57/60 (95%) Frame = +3 Query: 10 LYIPITAGTLVQTRWPSTTRRILGTDGIVNGDLATHCRIKRLALKAFSPKYVGTFAPVIQ 69 savignyi L +PI GTLVQTRWPSTTRRILGTDGIVNGDLATHCRIKRLALKAFSPKY+GT+APVIQ Sbjct: 291 LILPI--GTLVQTRWPSTTRRILGTDGIVNGDLATHCRIKRLALKAFSPKYIGTYAPVIQAGVAAHVK 464 >CYP26A1 Scaffold_12575 Length = 5934 Length = 432 Plus Strand HSPs: Score = 115 (40.5 bits), Expect = 4.2e-07, P = 4.2e-07 Identities = 21/38 (55%), Positives = 29/38 (76%), Frame = +1 Query: 202 YQRQRRRKYGKIYRTHMFGSPSVAVIGDEYVKKIVLGE 315 + R +R+KYG IYRTH+FG+P+V V G V+ I+LGE Sbjct: 67 FLRMKRQKYGYIYRTHLFGNPTVRVTGANNVRHILLGE 104 >CYP26C1 Scaffold_11741 complete gene 7 exons Length = 7795 probable ortholog of CYP26C1 Length = 510 Plus Strand HSPs: Score = 112 (39.4 bits), Expect = 1.2e-06, P = 1.2e-06 Identities = 18/41 (43%), Positives = 30/41 (73%), Frame = +1 Query: 193 GANYQRQRRRKYGKIYRTHMFGSPSVAVIGDEYVKKIVLGE 315 G+N+ RR+++G +++TH+ G P V V G E ++KI+LGE Sbjct: 65 GSNFHISRRKRHGNVFKTHLLGKPLVRVTGAENIRKILLGE 105 >GCiWno299_i01.b1_4 INXGSLSRFADANRKYDECNSRSNFGVCXRCYVMTFP*NGYAGYVVEA*SSQLRATGWQI YYLWKLYHNWYCQAP*TLFIIL*RPMFLVNL*IYDLTPDV*GIVCLPRDRF*QQL*LRFQ DNN*TYRRAFSFYSRLYQHP*HIRALVGLINLKSG*KADTVWGSTGLASFSWRSINKRMQ FNARCY*FPDYFR*CNDHCIRVREDGTSFHSI***TKNIQRII*PCACNPLIMLIV*NTI RIFGFIYIQLHNGNTTFLLQMKVKVRRYVQ*VIFKHNVLSGSC**F*PASNL*SE >GCiWno299_i01.b1_5 XKXWVVVSFR*RKSQI*RM*FKK*FRRLLAVLCDDFSLKRIRRICC*GLVIAVTCYRLAN LLFMEAIPQLVLPGTVNPFYNSIKTDVSGKFVDLRSHARRLGYCMFTKGPLLAAALTAVS G**LNVPESIQLLFPALSASLTH*GTCGFD*FEKRLKS*HCLGVDRFSVIFMAFNQQTNA V*RALLLVSRLFSLM*RPLY*GEGRWDEFSFYIVVNKKHSKNYLTVCLQPPNHVNCLKHD QDIWIYLHTVAQRKYNIFIANES*GTEIRSIGNL*TQCIIRIVLVVLTGKQSMIRX >GCiWno299_i01.b1_6 *XXGRCLVSLTQIANMTNVIQEVISASAXGAM**LFPKTDTPDMLLRLSHRSYVLQVGKF TIYGSYTTIGIARHRKPFL*FYKDRCFW*ICRFTISRQTFRVLYVYQGTAFSSSFDCGFR IIIKRTGEHSAFIPGFISILDTLGHLWV*LI*KAVKKLTLSGGRQV*RHFHGVQSTNECS LTRVVISFPTIFVDVTTIVLG*GKMGRVFILYSSKQKTFKELFNRVLATP*SC*LFKTRS GYLDLSTYSCTTEIQHFYCK*KLRYGDTFNR*SLNTMYYQDRASSFNRQAIYDPX >sequence 162 differs from 191, though they share opposite ends of 2 clones YLQGLKARELIFNKLESQLKSKFNATDDELFGDSGGE FESVLLNILKFARREGETEIKLRNLQNLSLEFIFAGTQSLQCSCSLVTFHLSQNPQVNFE CREEIKAAGLWDTPLTEINVERIQSLRFIELVAKETLRVTPTIPGAVRVALKTFELG (0?) GYQIPKGWQIIYSIRLTHEEAAGKVLQNGSKCEFEPGKHFTSTCKNTD (VKKSGEDKSHECLKQQS) not in alignment PFAFLPFGKGPRMCAGKNYGMLFLKVLIFELVR TADISLEGKCKIIEVPMTRTDKSVKIKFTSIKKLKPENSVNDASSSTAV* LGI398.y1 heme DEV4168.x1 PKG TO HEME opposite end = seq 191 DEV36513.x1 PKG TO HEME opposite end = seq 191 DEV36513.x01 366-383 opposite end = seq 191 rcicl022k09 rciad056p18 rcieg032g08 cieg032g08 >scf/ciona01/G126/seq_dir/hrs/G126P600572R.T0/G126P600572RE10.T0.seq 718 0 718 ABI Length = 718 Plus Strand HSPs: Score = 372 (131.0 bits), Expect = 4.9e-34, P = 4.9e-34 Identities = 72/102 (70%), Positives = 83/102 (81%), Frame = +2 Query: 2 KCEFEPGKHFTSTCKNTDVK--KSGEDKSHECLKQQSPFAFLPFGKGPRMCAGKNYGMLF 59 +CEF PG++F +C + D K K+ K H C KQ SP++FLPFGKG RMCAGKNYGML+ Sbjct: 197 ECEFNPGQYFDCSCDSDDSKSTKTAPPK-HTCSKQNSPYSFLPFGKGARMCAGKNYGMLY 373 Query: 60 LKVLIFELVRTADISLEGKCKIIEVPMTRTDKSVKIKFTSIKK 102 LKVLIFELVR ADISL GKCKI+EVPMTRTDKSVKIK T I+K Sbjct: 374 LKVLIFELVRNADISLVGKCKIVEVPMTRTDKSVKIKLTPIRK 502 >scf/ciona01/G126/seq_dir/hrs/G126P601582F.T0/G126P601582FC8.T0.seq 701 file 10 0 701 ABI Length = 701 Plus Strand HSPs: Score = 236 (83.1 bits), Expect = 1.3e-19, P = 1.3e-19 Identities = 45/69 (65%), Positives = 54/69 (78%), Frame = +1 Query: 2 KCEFEPGKHFTSTCKNTDVK--KSGEDKSHECLKQQSPFAFLPFGKGPRMCAGKNYGMLF 59 +CEF PG++F +C + D K K+ K H C KQ SP++FLPFGKG RMCAGKNYGML+ Sbjct: 493 ECEFNPGQYFDCSCDSDDSKSTKTAPPK-HTCSKQNSPYSFLPFGKGARMCAGKNYGMLY 669 Query: 60 LKVLIFELVR 69 LKVLIFELVR Sbjct: 670 LKVLIFELVR 699 runs off end >scf/ciona01/G126/seq_dir/hrs/G126P64264F.T0/G126P64264FC2.T0.seq 743 0 743 ABI Length = 743 Plus Strand HSPs: Score = 156 (54.9 bits), Expect = 3.8e-11, P = 3.8e-11 Identities = 29/36 (80%), Positives = 32/36 (88%), Frame = +1 Query: 1 GYQIPKGWQIIYSIRLTHEEAAGKVLQNGSKCEFEP 36 GYQIP+GWQIIYSIRLTHEEAAGKVLQNG + +P Sbjct: 592 GYQIPRGWQIIYSIRLTHEEAAGKVLQNGGEW*IQP 699 >scf/ciona01/G126/seq_dir/hrs/G126P65955R.T0/G126P65955RB1.T0.seq 712 0 712 ABI Length = 712 Minus Strand HSPs: Score = 225 (79.2 bits), Expect = 8.6e-33, Sum P(2) = 8.6e-33 Identities = 44/50 (88%), Positives = 49/50 (98%), Frame = -1 Query: 19 LESQLKSKFNATDDELFGDSGGEFESVLLNILKFARREGETEIKLRNLQN 68 LE+QLKSKFNA+D+ELFGD+GGE+ESVLLNILK ARREGETEIKLRNLQN Sbjct: 712 LETQLKSKFNASDEELFGDNGGEYESVLLNILKLARREGETEIKLRNLQN 563 Score = 151 (53.2 bits), Expect = 8.6e-33, Sum P(2) = 8.6e-33 Identities = 29/32 (90%), Positives = 31/32 (96%), Frame = -2 Query: 67 QNLSLEFIFAGTQSLQCSCSLVTFHLSQNPQV 98 + LSLEFIFAGTQSLQCSCSLVTFHLSQNP+V Sbjct: 567 KTLSLEFIFAGTQSLQCSCSLVTFHLSQNPKV 472 >scf/ciona01/G126/seq_dir/hrs/G126P66139F.T0/G126P66139FC11.T0.seq 702 file 5 0 702 ABI Length = 702 Minus Strand HSPs: Score = 440 (154.9 bits), Expect = 3.1e-41, P = 3.1e-41 Identities = 86/98 (87%), Positives = 94/98 (95%), Frame = -2 Query: 1 IRTLYLQGLKARELIFNKLESQLKSKFNATDDELFGDSGGEFESVLLNILKFARREGETE 60 I Y+QGLKARELIF+KLE+QLKSKFNA+D+ELFGD+GGE+ESVLLNILK ARREGETE Sbjct: 428 INQYYIQGLKARELIFDKLETQLKSKFNASDEELFGDNGGEYESVLLNILKLARREGETE 249 Query: 61 IKLRNLQNLSLEFIFAGTQSLQCSCSLVTFHLSQNPQV 98 IKLRNLQNLSLEFIFAGTQSLQCSCSLVTFHLSQNP+V Sbjct: 248 IKLRNLQNLSLEFIFAGTQSLQCSCSLVTFHLSQNPKV 135 >rciad056p18 CGGTTGTTCGTTTGTCTTTATATTAGTACTGTATAACTATTAGTAGTAAGTCGTTAGTGGTGCCAGCAGGCAGAATTATG AAAAGCGCAGTATAGGAAATTAAATAAGGCAAGTACATTGCGAACAACGAATCACAAGATGGCAAAGTAAACATTATAGA TTCGATATGAATCAATATCGCAACTTCTTGTCATTCATTAAACGGCAGTACTAGATGAGGCATCATTAACAGAGTTCTCC GGTTTCAACTTTTTGATGGAAGTGAATTTAATTTTCACGGATTTGTCAGTACGTGTCATCGGAACTTCGATTATTTTGCA TTTTCCTTCTAGACTGATGTCAGCTGTACGAACTAGCTCGAATATAAGAACTTTCAGGAACAGCATACCATAGTTTTTAC CAGCGCACATCCGTGGACCTTTTCCGAACGGCAAGAAAGCGAAAGGGCTCTGCTGTTTCAAGCATTCGTGTGACTTGTCC TCACCAGACTTTTTAACGTCCGTGTTCTTGCAGGTGGAAGTAAAATGCTTCCCGGGTTCGAACTCGCACTTGGAGCCATT TTGCAAAACCTTTCCTGCGGCTTCTTCGTGCGTTAACCGAATGCTGTATATGATCTGCCAACCTTTGGGGATCTGGTAGC CACCAAGCTCAAAAGTTTTTAAAGCCACACGCACAGCTCCCGGTATAGTAGGTGTGACGCGTAACGTCTNCTTGGCAACC AACTCAATAAAACGTAGAGACTGAATTCGCTCG >GCiWno962_k02.b1_1 ISVYE*IVEKLHKHIGYALLQREYK*ITRHIVSVNINLIKMCSLNTHLLDYKK*KYALF* *QAI*GQSM*L*NVRFCDLFFT*QYTGNSFR*IFLTVTMW*TRTWGK*DISRIYRIIFKQ ICFRSVHLGR*AMQRGNKSGRLMGHPLN*D*RRANSVSSFY*VGCQGDVTRHTYYTGSCA CGFKNF*AWGK*WWRNAFNY*LMEP*INVILRVVKSNVICAPAXVTTFPV*LH*IPXDTL L*LXSWTFXEYTLVCHTWGLGQIIASLLXNV*X >GCiWno962_k02.b1_2 YRCMSELLKSFINT*VTPYYNVNINKSRDISYRLILI*SKCVLLIHICWIIKSENMHYSN NKQYKDKACNCKM*GSVTCFLLSNIQVILFVKFS*L*LCGKPVHGANRIYLESTELFSNK YVFDPCI*VVKQCREEIKAAGLWDTPLTEINVERIQSLRFIELVAKETLRVTPTIPGAVR VALKTFELGVSDGGGMHLIIN*WNLESMLSCVW*SPT*YALPLX*PLSQFNYIRYPEIRC CD*XLGRFXNTRWSATPGASGKLSPVY*XMFDX >GCiWno962_k02.b1_3 IGV*VNC*KAS*THRLRLTTT*I*INHETYRIG*Y*FNQNVFS*YTSAGL*KVKICIILI TSNIRTKHVTVKCKVL*LVFYLAIYR*FFSLNFLNCNYVVNPYMGQIGYI*NLQNYFQTN MFSIRAFRSLSNAERK*KRPAYGTPP*LRLTSSEFSLFVLLSWLPRRRYASHLLYRELCV WL*KLLSLG*VMVEECI*LLIDGTLNQCYLACGKVQRDMRSRLXDHFPSLTTLDTXRYVV VIKXLDVLXIHVGLPHLGPRANYRQFIX*CLX >GCiWno1047_f09.b1_4 ST*VKPHR*ILRYRCMSDC*KAS*THRLRLTTT*I*INHETYRIG*YYFNQNVFS*YTSA GL*KVKICIILITSNIRTNHVTVKCKVL*LVFYLAIYR*FLSLNFLNCNYVVNPYMGQIG YV*NLQNYFQTNMFSIRAFRSLSNAERK*KRPAYGTPP*LRLTSSEFSLYVLLSWLPRRR YASHLLYRELCVWL*KLLSLG*VMMEECI*LLIDGTLNQCYLACGKVQRDMRSRLGDHFP SLTTLDTRDTLL*LNLGRFRNTRWSATPGASGKLSPV >GCiWno1047_f09.b1_5 HLSQTPQVNFEISVYE*LLKSFINT*VTPYYNVNINKSRDISYRLILF*SKCLLLIHICW IIKSENMHYSNNKQYKDKSCNCKM*GSVTCFLLSNIQVIPFVKFS*L*LCGKPVHGANRI CLESTELFSNKYVFDPCI*VVKQCREEIKAAGLWDTPLTEINVERIQSLRFIELVAKETL RVTPTIPGAVRVALKTFELGVSNDGGMHLIIN*WNLESMLSCVW*SPT*YALPLR*PLSQ FNYIRYPRYVVVIKSWTF*EYTLVCHTWGLGQIIASX >GCiWno1047_f09.b1_6 PLESNPTGKF*DIGV*VIVEKLHKHIGYALLQREYK*ITRHIVSVDIILIKMSSLNTHLL DYKK*KYALF**QAI*GQIM*L*NVRFCDLFFT*QYTGNSFR*IFLTVTMW*TRTWGK*D MSRIYRIIFKQICFRSVHLGR*AMQRGNKSGRLMGHPLN*D*RRANSVSTFY*VGCQGDV TRHTYYTGSCACGFKNF*AWGK**WRNAFNY*LMEP*INVILRVVKSNVICAPA*VTTFP V*LH*IPEIRCCD*ILDVLGIHVGLPHLGPRANYRQX >GCiWno784_i13.b1_1 REISA*ISHLTPFHFIIIIKFEHFTYRG*KLGS*FLTNSNRSSSLNSTQQTTSSLVTAVA SLRACYLTF*NLLAARGRQRSSFVISKTCRLSSSSQEHRVSNAHALW*LST*VKTHR*IL RYRCMSELLKSFINT*VTPYYNVNINKSRDISYRLILI*SKCVLLIHICWIIKSENMHYS NNKQYKDKACNCKM*GSVTCFLLSNIQVILFVKFS*L*LCGXPVHGANRIYLESTELFSN KYVFDPCI*VVKQCREENKAAGLWDTP*LRLRRANQSLRLMX >GCiWno784_i13.b1_2 GK*VHKYPISPHSTLL*LLNSNTLLTGVESSGVNF*QTRIAAQV*IQRNRRRALW*QRWR V*ERAT*HSKICSPRGGDRDQAS*SPKLVA*VHLRRNTESPMLMLSGNFPLESKPTGKF* DIGV*VNC*KAS*THRLRLTTT*I*INHETYRIG*Y*FNQNVFS*YTSAGL*KVKICIIL ITSNIRTKHVTVKCKVL*LVFYLAIYR*FFSLNFLNCNYVVXPYMGQIGYI*NLQNYFQT NMFSIRAFRSLSNAERKIKRPAYGTPPN*DYVERISLFV**X >GCiWno784_i13.b1_3 GNKCINIPSHPIPLYYNY*IRTLYLQGLKARELIFNKLESQLKSKFNATDDELFGDSGGE FESVLLNILKFARREGETEIKLRNLQNLSLEFIFAGTQSLQCSCSLVTFHLSQNPQVNFE ISVYE*IVEKLHKHIGYALLQREYK*ITRHIVSVNINLIKMCSLNTHLLDYKK*KYALF* *QAI*GQSM*L*NVRFCDLFFT*QYTGNSFR*IFLTVTMWXTRTWGK*DISRIYRIIFKQ ICFRSVHLGR*AMQRGK*SGRLMGHPLTEITSSESVSSFNE >rcicl022k09 Length = 641 Score = 107 bits (264), Expect = 9e-24 Identities = 53/66 (80%), Positives = 53/66 (80%), Gaps = 13/66 (19%) Frame = -2 Query: 1 EFEPGKHFTSTCKNTDVKKS-------------PFAFLPFGKGPRMCAGKNYGMLFLKVL 47 EFEPGKHFTSTCKNTDVKKS PFAFLPFGKGPRMCAGKNYGMLFLKVL Sbjct: 544 EFEPGKHFTSTCKNTDVKKSGEDKSHECLKQQSPFAFLPFGKGPRMCAGKNYGMLFLKVL 365 Query: 48 IFELVR 53 IFELVR Sbjct: 364 IFELVR 347 >SEQUENCE 164, 171, 165 530 RRQGEPPLVNHTLPFIGAALDFGKDPLNYLRNLQSKFGDVFTIKLAG 670 LKLHEFSKKLIFDITFNLLFGSLPDYERASEETERTYDVFKTYFKGSAL LVDRIPIHLLPETKKARGIFLKMMEELDWSKRENVSKLIDDIVK RMFNFNIYNTEFLKQRA RHLMVVLWAAQANTTPALFWTLFYLIANPDAKRAVLEEYEQLRR QKMKHSSVRSEEK WPTMKDILQIERKDLDKLVILDGC LRETMRLTGASMSIRKATRDESIKTSDGKQYSVRRGDYTAFFAPVTHMDEDIFEKPA SFNPDRFTKNGQRVAVSRAIMTFGYGVTRCPGRHIALIEIKLAVLAMLGHF NVQFVDSNTKPPSFDLTHLGFGVMPPDTDIEVLIAPKCC* LQW207007.x1 26-73 N-TERM LQW146342.x1 N-TERM DEV27368.y1 N-TERM GCiWno297_p09.b1 GCiWno745_j19.g1 GCiWno423_g12.b1 GCiWno264_m05.g1 GCiWno437_g11.g1 GCiWno579_n01.g1 GCiWno850_h17.b1 opp end = seq 165 FLKQRARHLMVVLWAAQANTTPALFWTLFYLIANPDAKRAVLEEYEQLRR GCiWno301_m22.b1 GCiWno735_p22.g1 GCiWno1016_h19.g1 >GCiWno845_i05.b1 CHROMAT_FILE: GCiWno845_i05.b1 PHD_FILE: GCiWno845_i05.b1.phd.1 CHEM: term DYE: big TIME: Thu Dec 6 16:00:32 2001 TEMPLATE: GCiWno845_i05 DIRECTION: fwd Length = 864 Score = 73.0 bits (176), Expect = 6e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +3 Query: 1 MWLLLVASVEQYLSKHTSCRVRNTSVAVTPTCVK 34 MWLLLVASVEQYLSKHTSCRVRNTSVAVTPTCVK Sbjct: 63 MWLLLVASVEQYLSKHTSCRVRNTSVAVTPTCVK 164 >GCiWno845_i05.b1 TGCTTTATTGCATTCATTTTACTGTTTATTCCAGTTCAAATTACAGGTCAAAATCTTGGTTAATGTGGTTACTCTTGGTT GCCAGTGTTGAGCAATATCTTTCAAAACATACATCCTGTCGAGTAAGAAATACTTCCGTTGCCGTAACCCCCACTTGCGT CAAAGCGTGAGTTAATCTATCTTTGTAACTTGCCTTCATGTTTTGCTCTTCCGTCATTTATAGTATTGCGTAAGATCATT CGTCACGTTTAGTCCTCTATTTAAGCAGACACCGGTATTCGAATTTCAACTATTTACTTTGATCTGATTCGACACACGAG CTGAAAGATGTTCTGGACCCTGGCACTCGTTATTTTAAATGTGGTCTGTTACTCAATTTACAGAAACCGCCGTCGGAGGT TAGTTGTTTAAACAAATTTTATAGTTCTTACTCTTTAAACTATTTTATCCATACGCAAGTTTTAGTAGAACCCTCGATTT TGGCGAATTTGTTGATAGATTTTTTACTTTATGAATGAACGTAACTCATTTATCCTCGCGTGGCGGGGTAACGGGAATCG TTATAACCTGAGTGTTTTGGTTCATAAACACCTCGTGCTCCCTTACGAGGTACCGCGTTTGTAAATTTTTTATTTAGTTT TTTAATCTAATTTCGACCTTGTAAAATACAGACGTGCAGGAGAACCTCCTTTGGTTTCACATTGGATTCCATTTATTGGA TCTGCTCTTGATTTTGGAAAAGCACCTTTGGAATACCTGCAATCGTTACAGAAGCGTTTGGGAGATGTATTTACCATAAA GCTGGCTGGATGGTAAGTAATAAAGATTGCTGTGTAGTTCAAATGGTGTTAGAGTTNAGTTGCN probable exon 1 of seq 164 confirm >GCiWno551_j06.g1 CHROMAT_FILE: GCiWno551_j06.g1 PHD_FILE: GCiWno551_j06.g1.phd.1 CHEM: term DYE: big TIME: Mon Oct 22 11:13:24 2001 TEMPLATE: GCiWno551_j06 DIRECTION: rev Length = 927 Score = 60.5 bits (144), Expect = 3e-09 Identities = 28/34 (82%), Positives = 30/34 (87%) Frame = +3 Query: 1 MWLLLVASVEQYLSKHTSCRVRNTSVAVTPTCVK 34 MW ++VASVEQYLSK SCRVRNTSVAV PTCVK Sbjct: 246 MWFVMVASVEQYLSKLISCRVRNTSVAVIPTCVK 347 >GCiWno551_j06.g1_1 YM*SYCNLTGLYSMLG*GVC*LLKT*NMG*YVLTVSILYPTLLL*YVIN*NIAQKRARIL SCFIAFILLFIPVQITGQNLG*CGSSWLPVLSNIFQNLYPVE*EILPLP*SPLASKRELI YLCNLPACFAFPSFIVLRKIIRHV*SSI*ADTGIRISTIYFDLIRHTS*KMFWTLALVIL NVVCYSIYRNRRRRLVV*TNFSVLTL*TILSIRKFS*NPRFWRIC**VFYFMNERNSFIL AWRXNGNRYTRVFWFITPRAPLRLPRL*FLHFLIIFQSNFDLVNTDVQENLLWXTLXSIX WVCS*FGKA >GCiWno551_j06.g1_2 ICKVIAT*PVCIVCWGKVCVNC*KHEIWDNMC*RYPSYTPHYYCNM**IEI*RKNELVF* AASLHSFYCLFQFKLQVKILVNVVRHGCQC*AISFKTYILSSKKYFRCRNPHLRQNVS*S IFVTCLHVLLFRHL*YCVRSFVTFSPLFKQTPVFEFQLFTLI*FDTRAERCSGPWHSLF* MWSVTQFTETAVGG*LFKQILVFLLFKLFYPYASFRRTLDFGEFVDRFFTL*MNVTHLSS RGGVTGIVIHECFGS*HLVLPYDYRVCNFCIF*LFFNLISTL*IQTCRRTSFGSHWXPXI GSALDLEK >GCiWno551_j06.g1_3 YVKLLQLNRFV*YVGVRCVLIVKNMKYGIICANGIHLIPHIIIVICDKLKYSAKTSSYFK LLHCIHFTVYSSSNYRSKSWLMWFVMVASVEQYLSKLISCRVRNTSVAVIPTCVKT*VNL SL*LACMFCFSVIYSIA*DHSSRLVLYLSRHRYSNFNYLL*SDSTHELKDVLDPGTRYFK CGLLLNLQKPPSEVSCLNKF*CSYSLNYFIHTQVFVEPSILANLLIGFLLYE*T*LIYPR VAX*RESLYTSVLVHNTSCSLTITAFVIFAFFNYFSI*FRPCKYRRAGEPPLXHIGIHXL GLLLIWKS opposite end GCiWno551_j06.b1 contains this seq from seq 169 RRAGEPPLVSHWIPFIGSALDFGKAPLEYLQSLQKRLGDVFTIKLAG >GCiWno551_j06.g1 TATATGTAAAGTTATTGCAACTTAACCGGTTTGTATAGTATGTTGGGGTAAGGTGTGTGTTAATTGTTAAAAACATGAAA TATGGGATAATATGTGCTAACGGTATCCATCTTATACCCCACATTATTATTGTAATATGTGATAAATTGAAATATAGCGC AAAAACGAGCTCGTATTTTAAGCTGCTTCATTGCATTCATTTTACTGTTTATTCCAGTTCAAATTACAGGTCAAAATCTT GGTTAATGTGGTTCGTCATGGTTGCCAGTGTTGAGCAATATCTTTCAAAACTTATATCCTGTCGAGTAAGAAATACTTCC GTTGCCGTAATCCCCACTTGCGTCAAAACGTGAGTTAATCTATCTTTGTAACTTGCCTGCATGTTTTGCTTTTCCGTCAT TTATAGTATTGCGTAAGATCATTCGTCACGTTTAGTCCTCTATTTAAGCAGACACCGGTATTCGAATTTCAACTATTTAC TTTGATCTGATTCGACACACGAGCTGAAAGATGTTCTGGACCCTGGCACTCGTTATTTTAAATGTGGTCTGTTACTCAAT TTACAGAAACCGCCGTCGGAGGTTAGTTGTTTAAACAAATTTTAGTGTTCTTACTCTTTAAACTATTTTATCCATACGCA AGTTTTCGTAGAACCCTCGATTTTGGCGAATTTGTTGATAGGTTTTTTACTTTATGAATGAACGTAACTCATTTATCCTC GCGTGGCGGNGTAACGGGAATCGTTATACACGAGTGTTTTGGTTCATAACACCTCGTGCTCCCTTACGATTACCGCGTTT GTAATTTTTGCATTTTTTAATTATTTTTCAATCTAATTTCGACCTTGTAAATACAGACGTGCAGGAGAACCTCCTTTGGN TCACATTGGNATCCATTNATTGGGTCTGCTCTTGATTTGGAAAAGCC >GCiWno551_k19.g1 CHROMAT_FILE: GCiWno551_k19.g1 PHD_FILE: GCiWno551_k19.g1.phd.1 CHEM: term DYE: big TIME: Mon Oct 22 11:13:56 2001 TEMPLATE: GCiWno551_k19 DIRECTION: rev Length = 923 Score = 84.7 bits (206), Expect = 2e-16 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 1 RDTHVFMNPLDVRSLERAKFLGHQEIIGDFVTRMVGSPH 39 RDTHVFMNPLDVRSLERAKFLGHQEIIGDFVTRMVGSPH Sbjct: 15 RDTHVFMNPLDVRSLERAKFLGHQEIIGDFVTRMVGSPH 131 >GCiWno551_k19.g1 TTATATTTACTTACAGGGACACACACGTGTTCATGAACCCCTTAGACGTTCGTAGCCTTGAAAGAGCTAAGTTTTTGGGC CACCAAGAAATTATTGGCGATTTCGTGACCAGAATGGTTGGGAGTCCGCACAGTATTCATAACCACGAACACCTGGCGGA AATCTTTCCAAAAAACGGGAAACCAAAAAATCCGGATCAAGTTCTATCTCCCGCTGCTGACGTGCAGAAAAAACTGACGC ATTCAATTGAGAAAAATCTACGCGGGTCTATGCAGCTCAATCTTCTGTGCTCGTCATGTAAACCCGTGGTGGTCAACGCT TTGCACCGAACGCTCGGACATACGATGAATCATCATAAACCGGTTAGTTAGACCTGAAGTCCGAAAAATGCGCTTGACAA ATTCCTATAATCTCGAGTGTTATGTTATATCCGTTGCCTTACCAGGCGCGTGCTAATAGTTTGGCATTGCGGCAGATAAT TATGGGCTTAAAAATTGTGCAACCACTAATTTAGATAAGCCTTGCGATTAACCAATATTAATTCTCCTTAAGATATATAC ATGGCATATCATACGCATTATATGAAGCAATTTTGATTCATAATTTTTACCTTTAGAATTTTGCAGGTGTGGGTTGACCA CTATAATTGAAATAGAATGCTAACGCGACCACACCTGCTATTTTAGTTACATTNNTTGCGGTTAAAGGGAATTTATATTG CGGAAATGAATCATTCTAATATCGCGTTTAAACTTTTAGTGGTAAATGTATCCTTTCCAGTACATAGTTCATATAATTTA TCAATCGTCCAAATATTCCTAATTTTTTTTACAGTTAAGACTTTCACGAATTCCAGCAGAAACTGGATCTTCGATATCAC TTTCAATCTTCCTTTTCGGATCACTCCCGGAATACGACAAAAN Note there are 3 different savignyi N-term ends >scf/ciona01/G126/seq_dir/hrs/G126P67436R.T0/G126P67436RE7.T0.seq 733 0 733 ABI Length = 733 Plus Strand HSPs: Score = 216 (76.0 bits), Expect = 1.6e-17, P = 1.6e-17 Identities = 40/46 (86%), Positives = 44/46 (95%), Frame = +2 Query: 1 RRQGEPPLVNHTLPFIGAALDFGKDPLNYLRNLQSKFGDVFTIKLA 46 RR+GEPPLV+H LPFIGAA+DFGKDPLNYL+NLQSK GDVFTIKLA Sbjct: 518 RRKGEPPLVSHALPFIGAAIDFGKDPLNYLKNLQSKHGDVFTIKLA 655 >scf/ciona01/G126/seq_dir/hrs/G126P67436R.T0/G126P67436RE7.T0.seq_1 733 0 733 ABI ISDAETPCGXIQGTWDRNQSLASRLCPFAKHLMDISCTQWINCCTKTEETSKMWILGLN* ISKRFQTYINIYMQ*PH*PDTALEVAIAHLLFPS*KYAQIQYLILN*TKTKGTF*NWVIG LNQSSTTS*STTCNYFNQQRARNGYNTLAFRIIKIKTKKYPIFHFKYPVLFRQAQRGTPV SEPRPPFYRGGHRLRQRSTQLPQEPPVKTRRCFHNQAGXGW*VAIFSGLLIXVVYFGRPK QRRLX >scf/ciona01/G126/seq_dir/hrs/G126P67436R.T0/G126P67436RE7.T0.seq_2 733 0 733 ABI SRTLKLHVVXFKGPGIETSR*LVGCVLLQST*WIFPVPSGLIVVPKLKKRLKCGFLV*TK SAKGFKHI*IYICNSPINPIPH*RWQ*HTCCSHHKNTHKSNI*F*TEPKLKARFKTGLLV *TKAAQRLNQQPAIISINSGQGMVTTPLLSAS*K*RQKSIQYFILNILSFSGRRKGEPPL VSHALPFIGAAIDFGKDPLNYLKNLQSKHGDVFTIKLAXVGESPFFLAY*X**FILAGXN RGGC >scf/ciona01/G126/seq_dir/hrs/G126P67436R.T0/G126P67436RE7.T0.seq_3 733 0 733 ABI LGR*NSMWXDSRDLGSKPVAS*SVVSFCKALNGYFLYPVD*LLYQN*RNV*NVDSWFKLN QQKVSNIYKYIYAIAPLTRYRTRGGNSTPAVPIIKIRTNPIFNFKLNQN*RHVLKLGYWF KPKQHNVLINNLQLFQSTAGKEWLQHPCFPHHKNKDKKVSNISF*ISCPFPAGAKGNPR* *ATPSLLSGRP*TSAKIHSTTSRTSSQNTAMFSQSSWXRLVSRHFFWLIDXSSLFWQAXT EAA >scf/ciona01/G126/seq_dir/hrs/G126P65030F.T0/G126P65030FA8.T0.seq 761 0 761 ABI Length = 761 Plus Strand HSPs: Score = 210 (73.9 bits), Expect = 6.8e-17, P = 6.8e-17 Identities = 38/47 (80%), Positives = 44/47 (93%), Frame = +3 Query: 1 RRQGEPPLVNHTLPFIGAALDFGKDPLNYLRNLQSKFGDVFTIKLAG 47 RR+GEPPLV+H LPFIG+A+ FGKDPLNYL+NLQSK GDVFTIK+AG Sbjct: 174 RRKGEPPLVSHALPFIGSAIHFGKDPLNYLKNLQSKHGDVFTIKMAG 314 >scf/ciona01/G126/seq_dir/hrs/G126P66874F.T0/G126P66874FD3.T0.seq 738 0 738 ABI Length = 738 Plus Strand HSPs: Score = 174 (61.3 bits), Expect = 4.6e-13, P = 4.6e-13 Identities = 32/46 (69%), Positives = 39/46 (84%), Frame = +2 Query: 1 RRQGEPPLVNHTLPFIGAALDFGKDPLNYLRNLQSKFGDVFTIKLA 46 R GEPPLV+H +PF+GAALD GK PL+Y+R+LQ + GDVFTIKLA Sbjct: 404 RLPGEPPLVSHWIPFVGAALDIGKAPLDYMRSLQRRLGDVFTIKLA 541 >scf/ciona01/G126/seq_dir/hrs/G126P64608F.T0/G126P64608FE12.T0.seq 692 0 692 ABI Length = 692 Minus Strand HSPs: Ortholog to exon 2 of seq 164 Score = 369 (129.9 bits), Expect = 1.1e-33, P = 1.1e-33 Identities = 71/92 (77%), Positives = 80/92 (86%), Frame = -2 Query: 1 IKLHEFSKKLIFDITFNLLFGSLPDYERASEETERTYDVFKTYFKGSALLVDRIPIHLLP 60 IKLH+F K++IFDITFNLLFGSLPDY + +ET R YDVFK YFK SALLVDRIPIHLLP Sbjct: 601 IKLHDFCKRVIFDITFNLLFGSLPDYNESCKETSRMYDVFKLYFKRSALLVDRIPIHLLP 422 Query: 61 ETKKARGIFLKMMEELDWSKRENVSKLIDDIV 92 ETKKAR FLK+ME ++WSKRENVS+LI DIV Sbjct: 421 ETKKARTEFLKLMEGIEWSKRENVSRLIQDIV 326 >scf/ciona01/G126/seq_dir/hrs/G126P64608F.T0/G126P64608FE12.T0.seq_4 692 0 692 ABI HW*LNL***NTQLKRYSVFFNLLNLIIFLRSNCMISANE*FLTSHSTFYLVLYPTITNPA KKLRECMTYSNSTSKDRHCWSTEYRFTFYPRPRKLEPSS*SLWKGLNGQKGRMYQDLFKT LLMSILN*VGNINNSL*GQH*KEGRSETAH*NYRN*F*HCPKQ*SQPQK*R*LEPIPNTT YIAIAFVLVSTFPLSFFRSTQKKERLLYKIILVELINSRSSENSTTGREQ >scf/ciona01/G126/seq_dir/hrs/G126P64608F.T0/G126P64608FE12.T0.seq_5 692 0 692 ABI TLVTQFVIVKHAIKKVQCVF*FAEFDYFPQIKLHDFCKRVIFDITFNLLFGSLPDYNESC KETSRMYDVFKLYFKRSALLVDRIPIHLLPETKKARTEFLKLMEGIEWSKRENVSRLIQD IVDVNPKLGW*HK*QFIGATLKGGKK*NCPLKL*KLILTLPQTVISTPEITLT*THS*HY LYRHSIRFSEHFSS*FFPFNAKEGKIAV*NYFSGIN*FAEFREFHHRARTX >scf/ciona01/G126/seq_dir/hrs/G126P64608F.T0/G126P64608FE12.T0.seq_6 692 0 692 ABI XTGNSICDSKTRN*KGTVCFLIC*I*LFSSDQTA*FLQTSDF*HHIQPSIWFSTRL*RIL QRNFENV*RIQTLLQKIGTAGRQNTDSPFTRDQES*NRVLKAYGRD*MVKKGECIKTYSR HC*CQS*TRLVT*ITVYRGNTKRREEVKLPTETIETNSNIAPNSNLNPRNNANLNPFLTL PISP*HSF**ALFLLVFSVQRKRRKDCCIKLF*WN*LIRGVQRIPPQGENX Walk 1 >scf/ciona01/G126/seq_dir/hrs/G126P65467F.T0/G126P65467FG1.T0.seq_4 756 0 756 ABI *ALSLLVFXVQRKRRKDCFIXYFSXIINSLGSEDVR*VTVPQGTIDQLKIMQFLVCKHAD SYNYI*SDNKLWSPFKLCSTTFHKLNSYSFRSIEYRAKHFTHLKSNYRNSKIFTNPNRIA CQVLNMPTYVNSKIHGLLNHGPTSSIVKCCIQ*RRCFDQFTGLKYHVFNTNI*NGKASIM RMKL*FYLKGPASCFHRGNKKIK*SKNYRYKIQAKIGMFKNSFYLNKDR**K*LMYCVMN XHHKGEFSYRKA >scf/ciona01/G126/seq_dir/hrs/G126P65467F.T0/G126P65467FG1.T0.seq_5 756 0 756 ABI STFPLSFXRSTQKKERLLYXIF*XNY*FAGFRGCPLSDCPPRDNRPTKDHAIFSLQAC*L I*LYIVRQ*TLVTV*ALFNYIPQIKFIFF*KH*I*GKTLYPLKV*LPQLENIYQP*PHCV PSFKYAYLC*FQNSWVT*PWSYQLYCKMLYSMKTLL*PVYWFKVSCFQYQYLKWKG*YNA YEALILLERSCFVFSSWKQKNKVI*KL*V*NTGQNWYV*K*FLFE*GPIMKIVNVLCNEX PPQRGVFIPKGX >scf/ciona01/G126/seq_dir/hrs/G126P65467F.T0/G126P65467FG1.T0.seq_6 756 0 756 ABI EHFPS*FXPFNAKEGKIALXXILVXLLIRWVQRMSAE*LSPKGQSTN*RSCNF*SASMLT HIIIYSQTINFGHRLSFVQLHSTN*IHILLEALNIGQNTLPT*SLITATRKYLPTLTALR AKF*ICLLMLIPKFMGYLTMVLPALL*NAVFNEDVALTSLLV*SIMFSIPISEMERLV*C V*SFNFT*KVLLRVFIVETKK*SNLKIIGIKYRPKLVCLKIVSI*IRTDNENS*CIV**I XTTKGSFHTERL Walk 2 >scf/ciona01/G126/seq_dir/hrs/G126P65846R.T0/G126P65846RD11.T0.seq_1 723 0 723 ABI SLDTENPCWNRFQSLLMLIPKFXXVT*PWYLPALL*NAVFNEDVALTSLLV*SIMFSIPI SEMERLV*CV*SFNFT*KVLLRVFIVETKK*SNLKIIGIKYRPKLVCLKIVSI*IRTDNE NS*CIS*LKLI*ITTIIVLVTILGYRCKFCLSFWVLVELV*IYIFTLCVFVSNKYMENMN *LVILLFFAELPAGSTQFLHKQVIFHAKML*TYSKIADNTKIP*YFFKLKIFVKTNATFG Y >scf/ciona01/G126/seq_dir/hrs/G126P65846R.T0/G126P65846RD11.T0.seq_2 723 0 723 ABI A*TLKTHVGIDSNPYLC*FQNSXGLLNHGTYQLYCKMLYSMKTLL*PVYWFKVSCFQYQY LKWKG*YNAYEALILLERSCFVFSSWKQKNKVI*KL*V*NTGQNWYV*K*FLFE*GPIMK IVNVYLN*N*FELQL**FLSQY*AIDANFVYHFGCWSN*YKSIYLPCVFLCQISIWRI*I NW*FCYFLRNCLQAAHNFCINRLFSMQKCFKHTARLLITQKFLDTFLN*RYL*KQMRPLD >scf/ciona01/G126/seq_dir/hrs/G126P65846R.T0/G126P65846RD11.T0.seq_3 723 0 723 ABI PRH*KPMLESIPIPTYVNSKIHXGYLTMVPTSSIVKCCIQ*RRCFDQFTGLKYHVFNTNI *NGKASIMRMKL*FYLKGPASCFHRGNKKIK*SKNYRYKIQAKIGMFKNSFYLNKDR**K *LMYILIKTNLNYNYNSSCHNIRL*MQILFIILGVGRISINLYIYLVCFCVK*VYGEYEL TGDSAIFCGIACRQHTIFA*TGYFPCKNALNIQQDC**HKNSLILF*IEDICKNKCDLWI Walk 3 >scf/ciona01/G126/seq_dir/hrs/G126P68549F.T0/G126P68549FC2.T0.seq_4 732 0 732 ABI SMKTLL*PVYWXKVSCFQYQYLKWKG*YNAYEALILLERSCFVFSSWKQKNKVI*KL*V* NTGQNWYV*K*FLFE*GPIMKIVNVYLN*N*FELQL**FLSQY*AIDANFVYHFGCWSN* YKSIYLPCVFLCQISIWRI*INW*FCYFLRNCLQAAHNFCINRLFSMQKCFKHTARLLIT QNFLDTFLN*RYL*KQMRPLDILKNGQLKYIPSEYFIDDIIKV*TFRQCTIAFFSGIPPQ GENQ >scf/ciona01/G126/seq_dir/hrs/G126P68549F.T0/G126P68549FC2.T0.seq_5 732 0 732 ABI NEDVALTSLLV*SIMFSIPISEMERLV*CV*SFNFT*KVLLRVFIVETKK*SNLKIIGIK YRPKLVCLKIVSI*IRTDNENS*CIS*LKLI*ITTIIVLVTILGYRCKFCLSFWVLVELV *IYIFTLCVFVSNKYMENMN*LVILLFFAELPAGSTQFLHKQVIFHAKML*TYSKIADNT KFP*YFFKLKIFVKTNATFGYIKKWPVKIHTIGIFYR*YHQSVNFPXMYNRILLRNSTTG RESX >scf/ciona01/G126/seq_dir/hrs/G126P68549F.T0/G126P68549FC2.T0.seq_6 732 0 732 ABI Q*RRCFDQFTGXKYHVFNTNI*NGKASIMRMKL*FYLKGPASCFHRGNKKIK*SKNYRYK IQAKIGMFKNSFYLNKDR**K*LMYILIKTNLNYNYNSSCHNIRL*MQILFIILGVGRIS INLYIYLVCFCVK*VYGEYELTGDSAIFCGIACRQHTIFA*TGYFPCKNALNIQQDC**H KISLILF*IEDICKNKCDLWIY*KMAS*NTYHRNILSMISSKCKLSXNVQSHSSQEFHHR ARIX Walk 4 >scf/ciona01/G126/seq_dir/hrs/G126P602424R.T0/G126P602424RH7.T0.seq_4 742 0 742 ABI NLCINRLFSMQKCFKHTARLLITQKFP*YFFKLKIFVKTNATFG*IKNGELKYIPSEYFI DDIIKV*TFRNVQSHSSQRGVT*ILKNLFILANY*CGW*W*NTAGAQRSL*VPTANFCAK SYVKERQ*GRRKTVHCKFGNQF*SCP*RVLGREGNSLFTIETFHNFNPLSNKLTLTLFLT LYGSVSDQLVRPF*HKNGICNRSLYKQSYLPISYLTKT*PSP*HYTYNAKSLIYEXPPTL EVSAVQE >scf/ciona01/G126/seq_dir/hrs/G126P602424R.T0/G126P602424RH7.T0.seq_5 742 0 742 ABI QSLHKQVIFHAKML*TYSKIADNTKISLILF*IEDICKNKCDLWID*KWRVKIHTLGIFY R*YHQSVNFPQCTIAFFSARGNLDPKEFVYFGKLLMRLVMVEHCRSPKVTLSAYGEFLR* VIC*RKAIGTKENCSL*VWKPILIMSLKGIREGGKLFIYN*NFS*L*PSF*QTNFNPVSN TIRLSFGPIGTTVLA*KWYM*SVALQAIVLTNIILNQDLTLALTLHL*R*IFNL*IXTNI GGFSCPRX >scf/ciona01/G126/seq_dir/hrs/G126P602424R.T0/G126P602424RH7.T0.seq_6 742 0 742 ABI IFA*TGYFPCKNALNIQQDC**HKNFLDTFLN*RYL*KQMRPLDRLKMAS*NTYPRNILS MISSKCKLSAMYNRILLSAG*PRS*RICLFWQITDAVGNGRTLPEPKGHFKCLRRISALS HMLKKGNRDEGKLFTVSLETNFNHVPKGY*GGRETLYLQLKLFITLTLFLTN*L*PCF*H YTAQFRTNWYDRFSIKMVYVIGRSTSNRTYQYHT*PRLNPRPDTTPITLNL*FMNXHQHW RFQLSKX Walk 5 >scf/ciona01/G126/seq_dir/hrs/G126P64804F.T0/G126P64804FG2.T0.seq_4 729 0 729 ABI RETLYLQLKLFITLTLFLTN*L*PCF*HYTAQFRTNWYDRFSIKMVYVIGRSTSNRTYQY HT*PRLNPRPDTTPITL*SLIYYRVSQLTFFLFFFTLRRQTERINKPHLCLLLFD*VPCK *VVFVTVVRLHHQ*LGNIMPV*PERCNRFEIIDYLGFFQKNNEMAYTNKNNHNLFKAHLA VKICLKHIWDFCIS*PLK*S*L*QLLAHRALSNKKIAKV*HTPSGFPQTNXHXQEXGYQX RKS >scf/ciona01/G126/seq_dir/hrs/G126P64804F.T0/G126P64804FG2.T0.seq_5 729 0 729 ABI GNSLFTIETFHNFNPLSNKLTLTLFLTLYGSVSDQLVRPF*HKNGICNRSLYKQSYLPIS YLTKT*PSP*HYTYNAIIFNLL*SFSINLFFIFFYPPTTDRKD**AAFMFVTFRLGTLQM SSFCHGCSLTSPIIRKYHAGLTRKM*QIRNHRLFGFFSEK**NGLHE*E*SQFV*STSGC QNLFKAYLGFLYLVTSKMIMIMTTFSPPCTIQ*KNRESLTYPVRFSPDEXPXTGGRISVX KIX >scf/ciona01/G126/seq_dir/hrs/G126P64804F.T0/G126P64804FG2.T0.seq_6 729 0 729 ABI GKLFIYN*NFS*L*PSF*QTNFNPVSNTIRLSFGPIGTTVLA*KWYM*SVALQAIVLTNI ILNQDLTLALTLHL*RYNL*FIIEFLN*PFFYFFLPSDDRQKGLISRIYVCYFSTRYPAN E*FLSRLFAYITNN*EISCRFDQKDVTDSKS*IIWVFFRKIMKWPTRIRIITICLKHIWL SKFV*SISGIFVSRNL*NDHDYDNF*PTVHYPIKKSRKFDIPRQVFPRRIXTHRRXDISX ENP Walk 6 >scf/ciona01/G126/seq_dir/hrs/G126P619097F.T0/G126P619097FD9.T0.seq_1 697 0 697 ABI CGGIPFFFLPPDDRQKGLISRIYFCYFSTRYPANE*FLSRLFAYITNN*EISCRFD*NM* QIRNHRFFVGFSGK**NGLHE*E*SQFV*STSGCQNLFKAYLRFLDLVTSKINHDYVNF* PTVHYTFKKTKKKFDRTRPGFPYRRILSYQNCAPCRGFCLLCSLLFLRSKRGAMQR*IVV QITRLFASIISRIPVLSIPLR*IHKQ*MSQRRITILKCFTFIALYT*FHDNIX >scf/ciona01/G126/seq_dir/hrs/G126P619097F.T0/G126P619097FD9.T0.seq_2 697 0 697 ABI VVEFLSFFYPPTIDRKD**AAFIFVTFRLGTLQMNSFCPGCSLTSPIIRKYHVGLIRICN RFEIIDFLWGFRENNEMAYTNKNNHNLFKAHLAVKICLKHI*DFWIW*PLKLIMIMSTFS PPCTIHLKKQKKSLTEPAQVFHTDEY*VTRIVLRAGVSAFFVHYYFSVQRGAQCNAKLLF R*PDCLLQLSHEFPCYQFHCVKSTSNK*VSVVSQF*NVLLL*HYTHNSMITY >scf/ciona01/G126/seq_dir/hrs/G126P619097F.T0/G126P619097FD9.T0.seq_3 697 0 697 ABI WWNSFLFFTPRR*TERINKPHLFLLLFD*VPCK*IVFVPVVRLHHQ*LGNIMSV*LEYVT DSKS*IFCGVFGKIMKWPTRIRIITICLKHIWLSKFV*SISEIFGSGNL*N*S*LCQLLA HRALYI*KNKKKV*QNPPRFSIQTNIKLPELCSVQGFLPSLFIIISPFKEGRNATLNCCS DNPTVCFNYLTNSRAINSIALNPQAINESASYHNSKMFYFYSIIHIIP**H Seq 167 for comp MLSVILAFFVLILATYFLWNSRKRQQRDGEPNIVPYSIPWL (?) GSSLPFYKDPVKFLKECEKKYGSVFTLFM (?) GGQYFTFVTDPFVQHIIVKEKKVLRFRNCLPPVLKHAFDYYPTAVDDEMMKLTHHYFQ (?) GKPLGLLVKQMNTNIQKWILDGNQGDAGDKWET VGLLSLVQRVMGSASFVSL (?) FGENPKASDTLDVQRQLLNFLTVFPSLLRGLPLSLIK (?) RSREYRQDLWNSLTKSKVTKRKEIFPIIDEIVTLHEQNGENKLLPKRLLPVLVASQ (?) VNTNPSSFWILYYLLKNSEALAAVKDEMEKVLQERSKNPGNNFVCFTKEEMETMMTL (?) ESAINESLRLSISGGMLRKAATEYRLEIPDYGQTYTIRENDMVLVWTQVNQMDPE IFEEPEVFKYDRFLNEDGSLKTNFYKDGKLVKYAFQPFGDGS (?) SKCPGRYWAVLELKQLVVNMLLYYDIQLIDSQEIKMDKGRVGLGALNPTKDALMSIRRKPLC* SEQUENCE 169 for comp ATKKSRGRLFELLSRFDFENRDNVSELIKKVAAVGTNEEKVRHLLIILWSAQANTL PALFWTLFYILNDKTARIDVLEEFEKHLRKTVPACDVIGTVTDDLK WPNLSDIQRMRKGDVDKLVLLDSCTKETMRM TGSSLAARRAHADTTVTLASGQEYKIRKGDYTSYFAPVTHQDADIYDKPE LKSRTQFSKNGKRISPSTSIMTFGYGAVRCPGRHIALMEIKFLTLVLLRHF DIKLVKNYSRQSEDYPQFDLTHLGFGVMPPSRDVDVTLSI* Walk from DDIVK exon >GCiWno301_m22.b1_1 VGS*PGLPVKLLHDPAGNLYSRK*IILISRLNFKCKMYPFQYSSYNLSTVKIILIF*QIK LHEFSKKLIFDITFNLLFGSLPDYERASEETERTYDVFKTYFKGSALLVDRIPIHLLPET KKARGIFLKMMEELDWSKRENVSKLIDDIVKVNPKLGKKTRIYNVI*LDGKMGRL*HIMS TYSDRVLNHYLTTVYDHCLLQNGTRKYILKMSHLPPPYHNVAICFTFFLNTFKFRIKHLS *TSVVKYSLSKSQHEYE*IPDVPIGEKHQFWYLPIYTCTAFFISYRYCFFPHLFIFISFR PRVLPVNG*X >GCiWno301_m22.b1_2 SDHSLACR*NYCTIPRVIYIRGNESF*YRV*TLSVKCTLSSTVHIIYQPSK*FSFFNR*N FTNSARN*SSISLSIFFSDHSRTTREHPKKRKELTTSSRPTSRDQHFWSIAYRFICFRRP KKQEASS*K*WRN*IGRNERMFQS*SMIL*KLIQNLVRKLAYIM*YSWMGRWDAFST*CP HILIVF*TII*QRSMIIVYFKMERENIF*RCPISPHPTIMLPFVLLFFLIHLSSA*NILV KRRWSSTV*VKANMNMNKYRMYQLVKSTNFGIYQFIHALHSL*VTGTVFFHIYLFS*VLG QGSCQLMGKX >GCiWno301_m22.b1_3 RIIAWPAGKTTARSRG*FIFAEMNHFNIAFEL*V*NVPFPVQFI*FINRQNNSHFLTDKT SRIQQETDLRYHFQSSFRITPGLRESIRRNGKNLRRLQDLLQGISTSGRSHTDSFASGDQ KSKRHLLKNDGGIRLVETRECFKVNR*YCKS*SKTW*ENSHI*CNIVGWEDGTPLAHNVH IF*SCFKPLFNNGL*SLFTSKWNEKIYFKDVPSPPTLP*CCHLFYFFS*YI*VPHKTS*L NVGGQVQFK*KPT*I*INTGCTNW*KAPILVFTNLYMHCILYKLPVLFFSTFIYFHKF*A KGPAS*WVX >GCiWno301_m22.b1 GTCGGATCATAGCCTGGCCTGCCGGTAAAACTACTGCACGATCCCGCGGGTAATTTATATTCGCGGAAATGAATCATTTT AATATCGCGTTTGAACTTTAAGTGTAAAATGTACCCTTTCCAGTACAGTTCATATAATTTATCAACCGTCAAAATAATTC TCATTTTTTAACAGATAAAACTTCACGAATTCAGCAAGAAACTGATCTTCGATATCACTTTCAATCTTCTTTTCGGATCA CTCCCGGACTACGAGAGAGCATCCGAAGAAACGGAAAGAACTTACGACGTCTTCAAGACCTACTTCAAGGGATCAGCACT TCTGGTCGATCGCATACCGATTCATTTGCTTCCGGAGACCAAAAAAGCAAGAGGCATCTTCTTAAAAATGATGGAGGAAT TAGATTGGTCGAAACGAGAGAATGTTTCAAAGTTAATCGATGATATTGTAAAAGTTAATCCAAAACTTGGTAAGAAAACT CGCATATATAATGTAATATAGTTGGATGGGAAGATGGGACGCCTTTAGCACATAATGTCCACATATTCTGATCGTGTTTT AAACCATTATTTAACAACGGTCTATGATCATTGTTTACTTCAAAATGGAACGAGAAAATATATTTTAAAGATGTCCCATC TCCCCCCACCCTACCATAATGTTGCCATTTGTTTTACTTTTTTTCTTAATACATTTAAGTTCCGCATAAAACATCTTAGT TAAACGTCGGTGGTCAAGTACAGTTTAAGTAAAAGCCAACATGAATATGAATAAATACCGGATGTACCAATTGGTGAAAA GCACCAATTTTGGTATTTACCAATTTATACATGCACTGCATTCTTTATAAGTTACCGGTACTGTTTTTTTCCACATTTAT TTATTTTCATAAGTTTTAGGCCAAGGGTCCTGCCAGTTAATGGGTAAAN These two overlap >GCiWno850_h17.g1_4 = seq 171, 165 FXIHXSSA*NISLKRGG*STV*VKANMNMNKYRMYQLGKARIFGIYQL*HAPHSL*VTVL FFQQFIYFHKF*AKDSAS*WLR*NIVSKVALSARGKYLNSLLSF*HISSLARNTSLHFKI PLSSPASPVLQFSV*MV**R*WRPHPWSLYFMNK*IWLVLTWENNSRYYTGVLFLKPRAR LRVTTYVTL*VKKLCVFYFFNTGNLNNP*PLCHMA RMFNFNIYNTEFLKQRARHLMVVLW AAQANTTPALFWTLFYLIANPDAKRAVLEEYEQLRRQKMKHSSVRSEEKGWPTMVPS* >GCiWno850_h17.g1_5 XNTXKFRIKHLIKTWWVKYSXSKSKHEYE*IPDVPIGKSTNFWYLPIITCTAFFISYRTV FPTIYLFS*ILGQGFCQLMVKIKHSFKGRLERPGEILKLFA*FLTHFQLST*YFTTFQNS FKFTSKSGFTILRVNGLVTLVAATSMVPLLYE*INLACTYVGKQQSLLHRCSVS*TSCPL TSHHICNFMSKKIVCFLFF*YRQLKQPVTALPHGADV*F*YLQHRVS*ATGSAPHGRSMG GTGKYNTCAFLDIVLSHCESRCKTCSS*RIRTTTSTENEAFLCSLRRKGLANDGTELX >GCiWno850_h17.g1_6 S*YIXVPHKTSH*NVVGEVQXK*KQT*I*INTGCTNWEKHEFLVFTNYNMHRILYKLPYC FSNNLFIFINFRPRILPVNG*DKT*FQRSP*APGGNT*TLCLVFDTFPA*HVILHYISKF L*VHQQVRFYNSPCKWFSNVSGGHIHGPFTL*INKFGLYLRGKTTVVTTQVFCFLNLVPA YESPHM*LYE*KNCVFFIFLIPAT*TTRNRFATWRGCLILIFTTQSFLSNGLGTSWSFYG RHRQIQHLRFFGHCFISLRIPMQNVQFLKNTNNYVDRK*SIPLFAQKKRAGQRWYRAX Seq for seq 169 match cannot move upstream of this seq >GCiWno358_p05.g1_1 seq 169 upstream of GCiWno359_j16.b1 MDVVLLEKL*PDWPYFYWKEL*PK*TELY*ESLIVYVKRRYV*DRRFVYIFIYLCL*VYI YNGSFYTW*LV*SGYEVYMYKTEHPYYNNYTCNHGLLNSDAMY*V*VMIQLMSAFEYISK CNKQKTTYLTEQHKL*IL*NNSKIASVTFQNIIFLKNIGQYDICLPSIFLILSNY*FELY T*IFSLCRSDFTNCARNWCLT*HLTFSLDPSLRTRNATKKPNKFAKNSSFTLNRQHF*LI RYPSTYCQPLKSQGVACLSYFSPFRF*EPR*LVGTHKXSRRCXVRIPLINSXIDYK*PGK LTFLGNLVX >GCiWno358_p05.g1_2 WTSFYWKSYDLTGRIFTGKSYDLNERSFTERV*LYT*NEGMYRTDVLYIYLYIYVYKYIF IMVVFIRGNSYKAGTRCICIKQNTRIITIIHAIMGYLIPMPCIEYRS*YNSCPPSSTFQN ATNKKLLT*QNNINCRSYKIILK*LR*LFKTLSF*KTLGNMIFAYRRFF*F*VIINLSYI PKFSRYADRTLRIVQEIGV*HDT*PFLWIPRFGREMQRRNPTNLRRILRLL*IVSTSS*S DTHPLIASH*KVKGSPV*VTFHRFDFENRDNLSGLIXKVAAVRYXYL*LIHXSIINNPES *HSWETWSX >GCiWno358_p05.g1_3 GRRFTGKAMT*LAVFLLERAMT*MNGALLREFNCIRETKVCIGQTFCIYIYIFMFISIYL *W*FLYVVTRIKRVRGVYV*NRTPVL*QLYMQSWAT*FRCHVLSIGHDTTHVRLRVHFKM QQTKNYLLNRTT*IVDLIK*F*NSFGNFSKHYLFEKHWAI*YLPTVDFFDFE*LLI*VIY LNFLVMQIGLYELCKKLVSDMTLNLFFGSLASDEKCNEETQQICEEFFVYFKSSALLVDP IPIHLLPATKKSRGRLFELLFTVSILRTEITCRDS*XKSPLXGTXTFN*FIXRL*ITRKV NIPGKPGQ Seq for seq 169 match >GCiWno358_p05.g1 CHROMAT_FILE: GCiWno358_p05.g1 PHD_FILE: GCiWno358_p05.g1.phd.1 CHEM: term DYE: big TIME: Fri Oct 5 12:43:33 2001 TEMPLATE: GCiWno358_p05 DIRECTION: rev Length = 926 Score = 94.4 bits (231), Expect(2) = 2e-23 Identities = 47/71 (66%), Positives = 55/71 (77%) Frame = +3 Query: 3 LHEFSKKLIFDITFNLLFGSLPDYERASEETERTYDVFKTYFKGSALLVDRIPIHLLPAT 62 L+E KKL+ D+T NL FGSL E+ +EET++ + F YFK SALLVD IPIHLLPAT Sbjct: 570 LYELCKKLVSDMTLNLFFGSLASDEKCNEETQQICEEFFVYFKSSALLVDPIPIHLLPAT 749 Query: 63 KKSRGRLFELL 73 KKSRGRLFELL Sbjct: 750 KKSRGRLFELL 782 Score = 34.8 bits (78), Expect(2) = 2e-23 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +2 Query: 75 RFDFENRDNVSELIKKVAA 93 RFDFENRDN+S LI KVAA Sbjct: 788 RFDFENRDNLSGLIXKVAA 844 >GCiWno359_j16.b1_4 seq 169 upstream of GCiWno877_b10.g1 VETCTRRGQKVYV*NRTTCVITFDLLYPLPEYILRISMRNLELPRI**GGGDGTPFYSIY LSHYKTVSSRLP*TIVNCLKHDQVI*ILCGKDVPPSHHNIQLCGYLFLYMFFCVWLTNHT NLYNGHGMQYTKQRNCRVVSWK*QATLKCNLRY*LL*RAHVIPNVHANNC*HVLSPCFKP PTLSRIKALSKLLTEKIINFQ*YLRIHNARVRRTQRFLIFDIFCDLYYMRRFFKFYYIFL LS*SLVLFASAVCLQ*GLCFSKM*AADSFGFDNICMCRQSPDLQ*FSAGS*IH >GCiWno359_j16.b1_5 RGNLYKAGTKGLCMKQNXVCYNV*PAVSTSRVHFTN*YA*FGVTTYIVGWGRWDTFLFYL LVTL*NRILTTPIDHC*LFKTRSGYLNFMW*RCSTFPS*YTTLWVFIFIYVFLCMVDESH KPI*WTRYAIYQAKELSSSFLEIAGNVKM*LTLLITVTCTRDTQCPC*QLLTRFITMFQT ADSFTN*SLV*TFNRKDN*FSVILKDTQRSRATYTTFFNF*HFLRPILYAAIF*ILLHFF TELKFGLICFRGLLTIRPMFF*NVSRRLFWI**HLHVQAVTGSAVVFRRQLDPX >GCiWno359_j16.b1_6 WKLVQGGDKRFMYETEXRVL*RLTCCIHFPSTFYELVCVIWSYHVYSRVGEMGHLFILFT CHIIKPYPHDSHRPLLIV*NTIRLFKFYVVKMFHLPIIIYNFVGIYFYICFFVYG*RITQ TYIMDTVCNIPSKGIVE*FPGNSRQR*NVTYVINYCNVHT*YPMSMLTTVNTFYHHVSNR RLFHELKPCLNF*QKR*LIFSNT*GYTTLACDVHNVF*FLTFFATYIICGDFLNFITFFY *VKVWSYLLPRFAYNKAYVFLKCKPQTLLDLITFACAGSHRICSSFPQAARST Seq 169 upstream of I-helix >GCiWno877_b10.g1_1 *YLRIHNARVRRTQRFLIFDIFCDLYYMRRFFKFYYIYFTELKFGLICFRGLLTIRPMFF *NVSRRLFWI*KHLHVQAVIRHLLRAQNKLISCTW*YYI*WGEVRWNTFSFFIPVPFGSK QRTFKEL*NRTSQLPYKIAVKCIKHDQDIGYNVLKMSHLPPQCYIRK*FTIRIDVVFFTL QAQVKKKFAIF*SFYGLHKQTPSPLYSGLYFTSLTIKRRGLTFWKNSKNI*EKQFPLVTS *ER*LTT*SGRT*ATSSG*EKATLINWSC*VRYCNIVNRLKFYNVVSNEYLLPHIT >GCiWno877_b10.g1_2 NT*GYTTLACDVHNVF*FLTFFATYIICGDFLNFITFILLS*SLVLFASAVCLQ*GLCFS KM*AADSFGFENICMCRQSFGIYYVHKIN*FRAPGNITYNGVR*DGTPFHSLFPSHLVVS KEHSKNYETVPRNSHIRSLLNV*NTIRILDITCSRCPIFPHSAILGSSLQLELTLYFLRC RLK*RKSSPSFNHSMVCTSKHPPRSILDFILHP*R*NGED*RFGRIRKTFKKNSSRL*RH RNGD*RPEVAELERHPADEKKRR**IGLVR*DIVI**IDLSFTTLLAMNIFYRIS >GCiWno877_b10.g1_3 ILKDTQRSRATYTTFFNF*HFLRPILYAAIF*ILLHLFY*VKVWSYLLPRFAYNKAYVFL KCKPQTLLDLKTFACAGSHSAFTTCTK*TNFVHLVILHIMG*GKMEHLFILYSRPIW**A KNIQRIMKPYLATPI*DRC*MYKTRSGYWI*RAQDVPSSPTVLY*EVVYN*N*RCIFYVA GSSEEKVRHLLIILWSAQANTLPALFWTLFYILNDKTARIDVLEEFEKHLRKTVPACDVI GTVTDDLKWPNLSDIQRMRKSDVDKLVLLGEIL*YSK*T*VLQRC*Q*ISSTAYH >GCiWno877_b10.g1 TAATACTTAAGGATACACAACGCTCGCGTGCGACGTACACAACGTTTTTTAATTTTTGACATTTTTTGCGACCTATATTA TATGCGGCGATTTTTTAAATTTTATTACATTTATTTTACTGAGTTAAAGTTTGGTCTTATTTGCTTCCGCGGTTTGCTTA CAATAAGGCCTATGTTTTTCTAAAATGTAAGCCGCAGACTCTTTTGGATTTGAAAACATTTGCATGTGCAGGCAGTCATT CGGCATTTACTACGTGCACAAAATAAACTAATTTCGTGCACCTGGTAATATTACATATAATGGGGTGAGGTAAGATGGAA CACCTTTTCATTCTTTATTCCCGTCCCATTTGGTAGTAAGCAAAGAACATTCAAAGAATTATGAAACCGTACCTCGCAAC TCCCATATAAGATCGCTGTTAAATGTATAAAACACGATCAGGATATTGGATATAACGTGCTCAAGATGTCCCATCTTCCC CCACAGTGCTATATTAGGAAGTAGTTTACAATTAGAATTGACGTTGTATTTTTTACGTTGCAGGCTCAAGTGAAGAAAAA GTTCGCCATCTTTTAATCATTCTATGGTCTGCACAAGCAAACACCCTCCCCGCTCTATTCTGGACTTTATTTTACATCCT TAACGATAAAACGGCGAGGATTGACGTTTTGGAAGAATTCGAAAAACATTTAAGAAAAACAGTTCCCGCTTGTGACGTCA TAGGAACGGTGACTGACGACCTGAAGTGGCCGAACTTGAGCGACATCCAGCGGATGAGAAAAAGCGACGTTGATAAATTG GTCTTGTTAGGTGAGATATTGTAATATAGTAAATAGACTTAAGTTTTACAACGTTGTTAGCAATGAATATCTTCTACCGC ATATCACC >GCiWno719_m20.b1 CHROMAT_FILE: GCiWno719_m20.b1 PHD_FILE: GCiWno719_m20.b1.phd.1 CHEM: term DYE: big TIME: Mon Nov 12 10:17:53 2001 TEMPLATE: GCiWno719_m20 DIRECTION: fwd Length = 899 Score = 121 bits (300), Expect = 8e-27 Identities = 60/65 (92%), Positives = 61/65 (93%), Gaps = 1/65 (1%) Frame = +1 Query: 23 DGCLRETMRLTGASMSIRKATRDESIKTSDGKQYSVRRGDYTAFFAPVTHMDEDIFEKP- 81 DGCLRETMRLTGASMSIRKATRDESIKTSDGKQYSVRRGDYTAFFAPVTHMDEDI+E P Sbjct: 61 DGCLRETMRLTGASMSIRKATRDESIKTSDGKQYSVRRGDYTAFFAPVTHMDEDIYENPQ 240 Query: 82 ASFNP 86 SF P Sbjct: 241 VSF*P 255 >GCiWno719_m20.b1 AGTCTACATAATGGGTGTATTGCGTGCCACGGATGGTATATAAGATTTATTTCGCTTTCAGACGGATGTTTGCGTGAGAC CATGCGTTTAACTGGAGCCAGTATGAGCATAAGAAAAGCCACAAGAGATGAAAGTATTAAAACCTCAGACGGTAAACAGT ATTCTGTGAGAAGGGGGGACTATACGGCTTTCTTTGCCCCTGTAACACACATGGACGAGGACATATACGAAAACCCGCAG GTAAGCTTTTAACCCTTTAACCGCCACGCTCGAACAAACTTAACACGGACAAAATGCTCATAATTGTTTACGTGCTAAAC TTGAATCAATATAAGTTATAGTCGTGAGCTTTTGGTATTCATGTTGCTGTTTTAACATATAATTGTATTTAATGCGCTCA TTGATATTCTCGCGTCTGTTTTTATCAATAATGTCCAAACGCTTCAGGCCGTGTCGTGTTATTTCATACTAAGATATATG CCTTTTGAATACCCCTTCATTTGACCGAACCATTTTTAAGAATTCCCGCGCACGATCGTTTCCTCGTATCAGTTGACGAT ACGAGCTCAAGCTGCAGTTCGACCGACAGTGACGCTTTCTCGGCCTTACCTAACCACAGACGGTCGCAAATTTTTCGGGC AGCTCAAACCAAGGTCACGGTTCACGAAGAACGGACAGAGGGTAGCCGTGTCAAGAGCAATTATGACATTTGGTTATGGC GTGACTCGTTGCCCAGGACGTCATATTGCATTAATTGAAATAAACTTGCAGTACTAGCGATGTTAGGTCATTTTAACGTA CAGTTTGTTGATTCTATACAAAACCTCCCTCGNTTGATCTTCACATTTTAGATTCNGCGTGATGCCGCCCGACACTGATT TGAGGTGGTTAATCGCACC >GCiWno170_o10.g1 CHROMAT_FILE: GCiWno170_o10.g1 PHD_FILE: GCiWno170_o10.g1.phd.1 CHEM: term DYE: big TIME: Fri Sep 28 15:53:56 2001 TEMPLATE: GCiWno170_o10 DIRECTION: rev Length = 876 Score = 177 bits (445), Expect = 5e-44 Identities = 84/85 (98%), Positives = 84/85 (98%) Frame = +1 Query: 29 RFTKNGQRVAVSRAIMTFGYGVTRCPGRHIALIEIKLAVLAMLGHFNVQFVDSNTKPPSF 88 RFTKNGQRVAVSRAIMTFGYGVTRCPGRHIALIEIKLAVLAMLGHFNVQFVD NTKPPSF Sbjct: 199 RFTKNGQRVAVSRAIMTFGYGVTRCPGRHIALIEIKLAVLAMLGHFNVQFVDPNTKPPSF 378 Query: 89 DLTHLGFGVMPPDTDIEVLIAPKCC 113 DLTHLGFGVMPPDTDIEVLIAPKCC Sbjct: 379 DLTHLGFGVMPPDTDIEVLIAPKCC 453 >GCiWno170_o10.g1 CTGGCCGTCGTTTTACTGGAAACAGCTATGACCTTGACTGGCCGTGGCTGTACTGTAAACAACGATTATGTGCACTATCG GTTTCTCGTATGAATTGACGATACGAGCTCAAGCTGCAGTTCGACCGACAGTGACGCTTCCTCGCCCTACCTCAACACAG ACGGTCGCAAATTTTTCGGGCAGCTCAAACCAAGGTCACGGTTCACGAAGAACGGACAGAGGGTAGCCGTGTCAAGAGCA ATTATGACATTTGGTTATGGCGTGACTCGTTGCCCAGGACGTCATATTGCATTAATTGAAATTAAACTTGCAGTACTAGC GATGTTAGGTCATTTTAACGTACAGTTTGTTGATCCCAATACTAAACCTCCTTCGTTTGACCTTACACATTTAGGATTCG GCGTGATGCCGCCCGACACTGATATTGAGGTGTTAATCGCACCAAAATGTTGTTAAAATGTCGATTTTCATAGATATTAT TGTCTTACACATAAAGCACAATCATATTATATTATTAACCTCAATTCCATTATATAGCACTGTAGGGTAAGGTAGGAAAC CGCAAGCATCTGTATCCCATATTTCCTATTCGTGTTTTTAACAATTCACAACGCCATTTTAGATTCTCTTATTGGCTACT GTTTTATAATTCTGTAAATATTACTTGTTTACTACTAAATGAGACGAGAAAGGAGGATGAAAACGTGTCATATTTTATCA CACCCTACTTACAGAATTTGTTTTACCGAATTTAAAATTTATGGTCCGTTATTTGTTGGATTCCTAGGGCGTACTTCGAT CGGTAAAGCTTTTTTACTCCCCATTTTCTATGCAAACGATCAGCTAAAGTGCAGCTTGGAGAACAAATCCGTGAAG >GCiWno182_k21.g1 CHROMAT_FILE: GCiWno182_k21.g1 PHD_FILE: GCiWno182_k21.g1.phd.1 CHEM: term DYE: big TIME: Sun Sep 30 16:37:49 2001 TEMPLATE: GCiWno182_k21 DIRECTION: rev Length = 768 Score = 48.8 bits (114), Expect = 1e-05 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = +1 Query: 2 WPTMKDILQIERKDLDKLVILG 23 WPTMKDILQIERKDLDKLVILG Sbjct: 307 WPTMKDILQIERKDLDKLVILG 372 >GCiWno182_k21.g1 CTTGTCGAGTTTACTGGGAGCGCTTTTTATTTTTTTAATACCGGCAACTTAAACAACCCGTAACCGCTTTGCCACATGGC GCGGATGTTTAATTTTAATATTTACAACACAGAGTTTCTTAAGCAACGGGCTCGGCACCTCATGGTCGTTCTATGGGCGG CACAGGCAAATACAACACCTGCGCTTTTTTGGACATTGTTTTATCTCATTGCGAATCCCGATGCAAAACGTGCAGTTCTT GAAGAATACGAACAACTACGTCGACAGAAAATGAAGCATTCCTCTGTTCGCTCAGAAGAAAAGGGCTGGCCAACGATGAA AGATATTCTTCAAATTGAACGGAAGGATTTAGACAAACTGGTCATACTTGGTAAATATAAAACTTCCAATTCTCGTGCCA AGTCATACATAATGGGTGTATTGCGTGCCACGGATGGTATATAAGATTTATTTCGCTTTCAGACGGATGTTTGCGTGAGA CCATGCGTTTAACTGGAGCCAGTATGAGCATAAGAAAAGCCACAAGAGATGAAAGTATTAAAACCTCAGACGGTAAACAG TATTCTGTAAGAAGGGGGGACTATACGGCTTTCTTTGCCCCTGGAACACACATGGACGAGGACATATACGAAAACCCGCA GGTAAGCTTTTTACCCTTTAACCGCCACGCTCGAACAACTTAACACGGACAAAATGCTCCAAATTGGTTACGTGCTAAAC TTGGATCATTATAAGGGTATATCCGGAAGCTTTTTGGAATTCATGGTG >scf/ciona01/G126/seq_dir/hrs/G126P64352F.T0/G126P64352FC4.T0.seq 721 0 721 ABI Length = 721 Minus Strand HSPs: Score = 153 (53.9 bits), Expect = 7.8e-11, P = 7.8e-11 Identities = 28/46 (60%), Positives = 35/46 (76%), Frame = -2 Query: 41 LFWTLFYLIANPDAKRAVLEEYEQLRRQKMKHSSVRSE-EKGWPTM 85 LFW LFYL++NPDAKRAV+EEYEQL+R K ++ V+ GW TM Sbjct: 672 LFWILFYLLSNPDAKRAVMEEYEQLKRHKNRNKQVKERGNDGWSTM 535 Score = 83 (29.2 bits), Expect = 0.0078, P = 0.0078 Identities = 17/26 (65%), Positives = 21/26 (80%), Frame = -3 Query: 25 HLMVVLWAAQANTTPAL--FWTLFYL 48 HL+VVLWAAQANTTPA + + F+L Sbjct: 719 HLLVVLWAAQANTTPAFSGYSSTFFL 642 >scf/ciona01/G126/seq_dir/hrs/G126P65376F.T0/G126P65376FE6.T0.seq 712 0 712 ABI Length = 712 Plus Strand HSPs: Score = 260 (91.5 bits), Expect = 3.7e-22, P = 3.7e-22 Identities = 47/68 (69%), Positives = 58/68 (85%), Frame = +1 Query: 13 IYNTEFLKQRARHLMVVLWAAQANTTPALFWTLFYLIANPDAKRAVLEEYEQLRRQKMKH 72 ++ TEFL+QRARHL+VVLWAAQANTTPA FW LFYL++NPDAKRAV+EEYEQL+R K ++ Sbjct: 490 VFFTEFLQQRARHLLVVLWAAQANTTPAFFWILFYLLSNPDAKRAVMEEYEQLKRHKHRN 669 >GCiWno423_g12.b1_4 like seq 136 KDHSRNYXTAFSRLP*TVXYGLKHD*DI*TLCLKVSXXFPHPLLXHEY**VGTRCVK*NT HVITTVVDPPLENKASYT*IA*ITCLFEQATR*TTFG*PHTSIHRGGS*LR*RSVELLKK SSVEIWRRFYNQTCRMVRNVYACIFSAFFCIM**RALHRDRAA*MQALFTVRDSVTSRCR QIVDKHFLQNFWSQRNEKNSVLRRKCVDALCIAKQIRPEVILYGLQTR*FLQTLYSN*LF VQY*KIM*I*T*T*EKNI*KIFK*RLCQIYKKHLCKNRLFLYKCTALGHVLGPVQK >GCiWno423_g12.b1_5 KGPFKELXNCILAAPIDRVLWFKTRLGYLDIMSKGVXXLSPPPTXX*VLVSGYEVCEIEH PCYNDCC*PATRE*SKLHINSLNNLLI*TGDKVNHLWLTTHFHSSGRLLTSVKIR*IT*E IFSRNLATFLQSNLQDGKKCICLYFQRIFLHYVITRSAP*PCCMNAGIVHREG*RYKQVQ ANSR*AFSTKFLVAKK*KKFSLAPKMC*RPMYSEANKA*GHIIRFTNAIIFANSLFKLII CSILKNNVNLNINVGKKYLKNI*ITVMPNI*KTLV*KSVIFVQMYSFGSCFRPCTKX >GCiWno423_g12.b1_6 RTIQGIIXLHSRGSHRPCXMV*NTIRIFRHYV*RCPXXFPTPYYXMSISKWVRGV*NRTP ML*RLLLTRHSRIKQVTHK*LK*LAYLNRRQGEPPLVNHTLPFIGAALDFGKDPLNYLRN LQSKFGDVFTIKLAGW*EMYMLVFSAHFSALCNNALCTVTVLHECRHCSP*GIALQAGAG K**ISIFYKIFGRKEMKKIQSCAENVLTPYV*RSK*GLRSYYTVYKRDNFCKLFIQINYL FNIKK*CEFKHKRRKKIFKKYLNNGYAKYIKNTCVKIGYFCTNVQLWVMF*ALYKX Walk 1 >GCiWno412_a11.b1_1 XGS*PALPGKTTGKIMVHRLLIIKTTIKNNVNLNINVGEKIFKKYLNNGYAKYIKNTLV* KSVIFVQMYSFG*CFRPVQKIHFDRVFRNALKPCIAYTVQDCLLQLPFMLKQRN*SLSQ* CLRTQLPVAFKALSYVLSLNLCIFYNCGINFALLLFYIVKNYVVIL*TFLLDSLNLYSYL HMVTTI*NSMNK*NLFILALWVNDSRCIKQVFHYTDFVPALELP*MQLFG*LFRGVFVCF GSSNNL*CTEGLEQLLSEICAITTISQCIFKYNIKKKHFQYNV*YNFNSKTLIFTSQXHT RVHEPLXRRSLEELSFLAHRKY >GCiWno412_a11.b1_2 SDHSLLCQVKRLARSWFIDC*SLKPLLKIM*I*T*M*EKKYLKNI*ITVMPNI*KTLLCK NRLFLYKCTALGNVLGLYKKYTLTVCFVMH*NRV*PIPFKTVCYNCRSCLSSGINRCLND V*GRSFP*LLRP*VTSYH*ICASSIIVVLILHYFYFIL*KTMW*FCKRFY*IL*IYTHTY TWLLQFKTV*INETYLSSRCGSTTAVV*NRCFITRTSSPLSSYHECNFLGDYFGEFLFVS EVQTTYNVLKGWSNCCQKYARLPLFHNVFLNTILKKNIFNTMSNTILIQKHLYLLHRXTH VFMNPLXVVALKS*VFWPTGN >GCiWno412_a11.b1_3 RIIACFAR*NDWQDHGS*TVNH*NHY*K*CEFKHKCRRKNI*KIFK*RLCQIYKKHSCVK IGYFCTNVQLWVMF*ACTKNTL*PCVS*CIKTVYSLYRSRLFATIAVHA*AAELIAVSMM FKDAASRSF*GLELRLIIEFVHLL*LWY*FCITFILYCKKLCGNFVNVFIRFFKFILILT HGYYNLKQYE*MKPIYPRVVGQRQPLYKTGVSLHGLRPRSRVTMNATFWVIISGSFCLFR KFKQPIMY*RVGAIAVRNMRDYHYFTMYF*IQY*KKTFSIQCLIQF*FKNTYIYFTGTHT CS*TPXTS*P*RAKFFGPQEI Walk 2 >GCiWno735_p22.b1_1 XLNLYSYLHMVTTI*NSMNK*NLFILALWVNDSRCIKQVFHYTDFVPALELP*MQLFG*L FRGVFVCFGSSNNL*CTEGLEQLLSEICAITTISQCIFKYNIKKKHFQYNV*YNFNSKTL IFTSQGHTRVHEPLRRS*P*KS*VFGPPRNYWRFRDQNGWESAQYS*PRTPSGNLSKKRK TKKSGSSSISRR*RAEKTDAFN*EKSTRIYAAQSSVLVM*TRGGQRFAPNARTYDESS*T G*LDLKSEKCA*QFL*SRVICDIGCLTKRVLMIWHCGR*YGLKIVHH*F*IPMR >GCiWno735_p22.b1_2 L*IYTHTYTWLLQFKTV*INETYLSSRCGSTTAVV*NRCFITRTSSPLSSYHKCNFLGDY FGEFSFVSEVQTTYNVLKGWSNCCQKYARLPLFHNVFLNTILKKNIFNTMSNTILIQKHL YLLHR DTHVFMNPLDVRSLERAKFLGHQEIIGDFVTRMVGSPHSIHNHEHLAEIFPKNGK PKNPDQVLSPAADVQKKLTHSIEKNLRGSMQLNLLCSSCKPVVVNALHRTLGHTMNHHKP VS*T*SPKNALDNSYNLE*YVISVALPSAC**FGIAADNMD*KLCTTNFEYLCX >GCiWno735_p22.b1_3 FKFILILTHGYYNLKQYE*MKPIYPRVVGQRQPLYKTGVSLHGLRPRSRVTINATFWVII SGSFRLFRKFKQPIMY*RVGAIAVRNMRDYHYFTMYF*IQY*KKTFSIQCLIQF*FKNTY IYFTGTHTCS*TP*TFVALKELSFWATKKLLAIS*PEWLGVRTVFITTNT*RKSFQKTEN QKIRIKFYLPPLTCRKN*RIQLRKIYADLCSSIFCARHVNPWWSTLCTERSDIR*IIINR LVRPEVRKMRLTIPIISSDM*YRLPYQARANDLALRQIIWTKNCAPLILNTYA >GCiWno735_p22.b1 NCTTTAAATTTATACTCATACTTACACATGGTTACTACAATTTAAAACAGTATGAATAAATGAAACCTATTTATCCTCGC GTTGTGGGTCAACGACAGCCGTTGTATAAAACAGGTGTTTCATTACACGGACTTCGTCCCCGCTCTCGAGTTACCATAAA TGCAACTTTTTGGGTGATTATTTCGGGGAGTTTTCGTTTGTTTCGGAAGTTCAAACAACCTATAATGTACTGAAGGGTTG GAGCAATTGCTGTCAGAAATATGCGCGATTACCACTATTTCACAATGTATTTTTAAATACAATATTAAAAAAAAACATTT TCAATACAATGTCTAATACAATTTTAATTCAAAAACACTTATATTTACTTCACAGGGACACACACGTGTTCATGAACCCC TTAGACGTTCGTAGCCTTGAAAGAGCTAAGTTTTTGGGCCACCAAGAAATTATTGGCGATTTCGTGACCAGAATGGTTGG GAGTCCGCACAGTATTCATAACCACGAACACCTAGCGGAAATCTTTCCAAAAAACGGAAAACCAAAAAATCCGGATCAAG TTCTATCTCCCGCCGCTGACGTGCAGAAAAAACTGACGCATTCAATTGAGAAAAATCTACGCGGATCTATGCAGCTCAAT CTTCTGTGCTCGTCATGTAAACCCGTGGTGGTCAACGCTTTGCACCGAACGCTCGGACATACGATGAATCATCATAAACC GGTTAGTTAGACCTGAAGTCCGAAAAATGCGCTTGACAATTCCTATAATCTCGAGTGATATGTGATATCGGTTGCCTTAC CAAGCGCGTGCTAATGATTTGGCATTGCGGCAGATAATATGGACTAAAAATTGTGCACCACTAATTTTGAATACCTATGC G >GCiWno877_b10.g1 CHROMAT_FILE: GCiWno877_b10.g1 PHD_FILE: GCiWno877_b10.g1.phd.1 CHEM: term DYE: big TIME: Thu Dec 20 11:51:55 2001 TEMPLATE: GCiWno877_b10 DIRECTION: rev Length = 888 Score = 112 bits (278), Expect = 6e-25 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = +3 Query: 1 YVAGSSEEKVRHLLIILWSAQANTLPALFWTLFYILNDKTARIDVLEEFEKHLR 54 YVAGSSEEKVRHLLIILWSAQANTLPALFWTLFYILNDKTARIDVLEEFEKHLR Sbjct: 534 YVAGSSEEKVRHLLIILWSAQANTLPALFWTLFYILNDKTARIDVLEEFEKHLR 695 >GCiWno877_b10.g1 TAATACTTAAGGATACACAACGCTCGCGTGCGACGTACACAACGTTTTTTAATTTTTGACATTTTTTGCGACCTATATTA TATGCGGCGATTTTTTAAATTTTATTACATTTATTTTACTGAGTTAAAGTTTGGTCTTATTTGCTTCCGCGGTTTGCTTA CAATAAGGCCTATGTTTTTCTAAAATGTAAGCCGCAGACTCTTTTGGATTTGAAAACATTTGCATGTGCAGGCAGTCATT CGGCATTTACTACGTGCACAAAATAAACTAATTTCGTGCACCTGGTAATATTACATATAATGGGGTGAGGTAAGATGGAA CACCTTTTCATTCTTTATTCCCGTCCCATTTGGTAGTAAGCAAAGAACATTCAAAGAATTATGAAACCGTACCTCGCAAC TCCCATATAAGATCGCTGTTAAATGTATAAAACACGATCAGGATATTGGATATAACGTGCTCAAGATGTCCCATCTTCCC CCACAGTGCTATATTAGGAAGTAGTTTACAATTAGAATTGACGTTGTATTTTTTACGTTGCAGGCTCAAGTGAAGAAAAA GTTCGCCATCTTTTAATCATTCTATGGTCTGCACAAGCAAACACCCTCCCCGCTCTATTCTGGACTTTATTTTACATCCT TAACGATAAAACGGCGAGGATTGACGTTTTGGAAGAATTCGAAAAACATTTAAGAAAAACAGTTCCCGCTTGTGACGTCA TAGGAACGGTGACTGACGACCTGAAGTGGCCGAACTTGAGCGACATCCAGCGGATGAGAAAAAGCGACGTTGATAAATTG GTCTTGTTAGGTGAGATATTGTAATATAGTAAATAGACTTAAGTTTTACAACGTTGTTAGCAATGAATATCTTCTACCGC ATATCACC >GCiWno877_b10.g1_1 *YLRIHNARVRRTQRFLIFDIFCDLYYMRRFFKFYYIYFTELKFGLICFRGLLTIRPMFF *NVSRRLFWI*KHLHVQAVIRHLLRAQNKLISCTW*YYI*WGEVRWNTFSFFIPVPFGSK QRTFKEL*NRTSQLPYKIAVKCIKHDQDIGYNVLKMSHLPPQCYIRK*FTIRIDVVFFTL QAQVKKKFAIF*SFYGLHKQTPSPLYSGLYFTSLTIKRRGLTFWKNSKNI*EKQFPLVTS *ER*LTT*SGRT*ATSSG*EKATLINWSC*VRYCNIVNRLKFYNVVSNEYLLPHIT >GCiWno877_b10.g1_2 NT*GYTTLACDVHNVF*FLTFFATYIICGDFLNFITFILLS*SLVLFASAVCLQ*GLCFS KM*AADSFGFENICMCRQSFGIYYVHKIN*FRAPGNITYNGVR*DGTPFHSLFPSHLVVS KEHSKNYETVPRNSHIRSLLNV*NTIRILDITCSRCPIFPHSAILGSSLQLELTLYFLRC RLK*RKSSPSFNHSMVCTSKHPPRSILDFILHP*R*NGED*RFGRIRKTFKKNSSRL*RH RNGD*RPEVAELERHPADEKKRR**IGLVR*DIVI**IDLSFTTLLAMNIFYRIS >GCiWno877_b10.g1_3 ILKDTQRSRATYTTFFNF*HFLRPILYAAIF*ILLHLFY*VKVWSYLLPRFAYNKAYVFL KCKPQTLLDLKTFACAGSHSAFTTCTK*TNFVHLVILHIMG*GKMEHLFILYSRPIW**A KNIQRIMKPYLATPI*DRC*MYKTRSGYWI*RAQDVPSSPTVLY*EVVYN*N*RCIFYVA GSSEEKVRHLLIILWSAQANTLPALFWTLFYILNDKTARIDVLEEFEKHLRKTVPACDVI GTVTDDLKWPNLSDIQRMRKSDVDKLVLLGEIL*YSK*T*VLQRC*Q*ISSTAYH >scf/ciona01/G126/seq_dir/hrs/G126P607939F.T0/G126P607939FG1.T0.seq 761 0 761 ABI Length = 761 Plus Strand HSPs: Score = 386 (135.9 bits), Expect = 4.7e-40, Sum P(2) = 4.7e-40 Identities = 74/98 (75%), Positives = 82/98 (83%), Frame = +3 Query: 124 HRDTHVFMNPLDVRSLERAKFLGHQEIIGDFVTRMVGSPHSIHNHEHLAEIFPKNGKPKN 183 HRD HVFMNPLDVRSLERAKFLGHQEIIGDFVTRMVG+PH IH+H+ + E+ +GK K Sbjct: 330 HRDYHVFMNPLDVRSLERAKFLGHQEIIGDFVTRMVGNPHKIHSHDFIPELHTADGKSK- 506 Query: 184 PDQVLSPAADVQKKLTHSIEKNLRGSMQLNLLCSSCKP 221 + LSP A+VQKKLTHSIEKNLRGSMQLN LC SC P Sbjct: 507 --KTLSPGAEVQKKLTHSIEKNLRGSMQLNSLCESCNP 614 Score = 59 (20.8 bits), Expect = 4.7e-40, Sum P(2) = 4.7e-40 Identities = 16/30 (53%), Positives = 20/30 (66%), Frame = +2 Query: 220 KPVVVNALHRTLGHTMNHH-KPVS*T*SPK 248 +P VVNAL R L +M+H KPVS* P+ Sbjct: 608 QPGVVNALLRNLKPSMSHQDKPVS*LVRPR 697 Walk 3 >GCiWno1016_h19.g1_1 FSSVPSSSSVLVM*TRGGQRFAPNARTYDESS*TG*LDLKSEKCA*QIPIISSVMLYPLP YQARANSLALRQIIMGLKIVQPLI*ISLAINQY*FSLRYIHGISYALYEAILIHNFYL*N FAGVG*PL*LK*NANATTPAILVTFLRLKGIYIAEMNHSNIAFKL*V*NVSFPVHSSYNL SIVKIILIFLTVKTSRIQQETDLRYHFQSSFRITPGLRESIRRNGKNLRRLQDLLQRIST SGRSHTDTFASRRQKSKRHLLXNDXRN*IGRNERCXQSNR*YCQSYPNLVRNSHIRXKV >GCiWno1016_h19.g1_2 SARYPAHLLCSSCKPVVVNALHRTLGHTMNHHKPVS*T*SPKNALDKFL*SRVLCYIRCL TRRVLIVWHCGR*LWA*KLCNH*FR*ALRLTNINSP*DIYMAYHTHYMKQF*FIIFTFRI LQVWVDHYN*NRMLTRPHLLF*LHFCG*REFILRK*IILISRLNFKCKMYPFQYIVHIIY QSSK*FLFF*QLKLHEFSKKLIFDITFNLLFGSLPDYERASEETERTYDVFKTYFKGSAL LVDRIPIHLLPGDKKARGIFLXMMXGIRLVETRDVXKVIDDIVKVIQTW*ETRI*GXK >GCiWno1016_h19.g1_3 QLGTQLIFCARHVNPWWSTLCTERSDIR*IIINRLVRPEVRKMRLTNSYNLECYVISVAL PGAC**FGIAADNYGLKNCATTNLDKPCD*PILILLKIYTWHIIRII*SNFDS*FLPLEF CRCGLTTIIEIEC*RDHTCYFSYIFAVKGNLYCGNESF*YRV*TLSVKCILSST*FI*FI NRQNNSYFFNS*NFTNSARN*SSISLSIFFSDHSRTTREHPKKRKELTTSSRPTSKDQHF WSIAYRYICFPETKKQEASSXK*XEELDWSKREMFXK*SMILSKLSKLGKKLAYKX*S >GCiWno1016_h19.g1 CHROMAT_FILE: GCiWno1016_h19.g1 PHD_FILE: GCiWno1016_h19.g1.phd.1 CHEM: term DYE: big TIME: Thu Dec 27 11:47:51 2001 TEMPLATE: GCiWno1016_h19 DIRECTION: rev Length = 897 Score = 109 bits (271), Expect = 4e-24 Identities = 57/60 (95%), Positives = 58/60 (96%), Gaps = 2/60 (3%) Frame = +2 Query: 1 QSSK-FLFF-QIKLHEFSKKLIFDITFNLLFGSLPDYERASEETERTYDVFKTYFKGSAL 58 QSSK FLFF Q+KLHEFSKKLIFDITFNLLFGSLPDYERASEETERTYDVFKTYFKGSAL Sbjct: 542 QSSK*FLFF*QLKLHEFSKKLIFDITFNLLFGSLPDYERASEETERTYDVFKTYFKGSAL 721 >GCiWno1016_h19.g1 TTCAGCTCGGTACCCAGCTCATCTTCTGTGCTCGTCATGTAAACCCGTGGTGGTCAACGCTTTGCACCGAACGCTCGGAC ATACGATGAATCATCATAAACCGGTTAGTTAGACCTGAAGTCCGAAAAATGCGCTTGACAAATTCCTATAATCTCGAGTG TTATGTTATATCCGTTGCCTTACCAGGCGCGTGCTAATAGTTTGGCATTGCGGCAGATAATTATGGGCTTAAAAATTGTG CAACCACTAATTTAGATAAGCCTTGCGATTAACCAATATTAATTCTCCTTAAGATATATACATGGCATATCATACGCATT ATATGAAGCAATTTTGATTCATAATTTTTACCTTTAGAATTTTGCAGGTGTGGGTTGACCACTATAATTGAAATAGAATG CTAACGCGACCACACCTGCTATTTTAGTTACATTTTTGCGGTTAAAGGGAATTTATATTGCGGAAATGAATCATTCTAAT ATCGCGTTTAAACTTTAAGTGTAAAATGTATCCTTTCCAGTACATAGTTCATATAATTTATCAATCGTCAAAATAATTCT TATTTTTTTAACAGTTAAAACTTCACGAATTCAGCAAGAAACTGATCTTCGATATCACTTTCAATCTTCTTTTCGGATCA CTCCCGGACTACGAGAGAGCATCCGAAGAAACGGAAAGAACTTACGACGTCTTCAAGACCTACTTCAAAGGATCAGCACT TCTGGTCGATCGCATACCGATACATTTGCTTCCCGGAGACAAAAAAGCAAGAGGCATCTTCTTANAAATGATGNGAGGAA TTAGATTGGTCGAAACGAGAGATGTTTNCAAAGTAATCGATGATATTGTCAAAGTTATCCAAACTTGGTAAGAAACTCGC ATATAAGGANTAAAGTG >scf/ciona01/G126/seq_dir/hrs/G126P64608F.T0/G126P64608FE12.T0.seq 692 0 692 ABI Length = 692 Minus Strand HSPs: Score = 312 (109.8 bits), Expect = 1.2e-27, P = 1.2e-27 Identities = 62/95 (65%), Positives = 73/95 (76%), Frame = -2 Se translation 2 above Query: 1 QLKLHEFSKKLIFDITFNLLFGSLPDYERASEETERTYDVFKTYFKGSALLVDRIPIHLL 60 Q+KLH+F K++IFDITFNLLFGSLPDY + +ET R YDVFK YFK SALLVDRIPIHLL Sbjct: 604 QIKLHDFCKRVIFDITFNLLFGSLPDYNESCKETSRMYDVFKLYFKRSALLVDRIPIHLL 425 Query: 61 PGDKKARGIFLXMMXGIRLVETRDVXKVIDDIVKV 95 P KKAR FL +M GI + +V ++I DIV V Sbjct: 424 PETKKARTEFLKLMEGIEWSKRENVSRLIQDIVDV 320 >GCiWno437_g11.g1_4 GDVLMRGWGGAIYEVGVETIGP*QLDWVGGNNGLEGGGGKVRWRNGD*F*RGGRRRRKRL GRVVTLAFLGRGMWVGGGGEPSAQGLLGSPVVIFQVNTGAGDSVGPRRIVR*MLGGHRAK GTTKYTXXXVPSSPXLPIYNVNMLNMPC*VKREILWLDLLIKYKVTYIRVRKMGHIFILF SLSIW**TKNIQRIIKLHSRGSHRPLLIV*NTIRIFRHYVLKVSQLSPPLLHEYCKWARG V*NRTPML*RLSLTRHSRIKQVTHK*LK*LAYLNRRRGEPPLVNHTLPFIGAALDFGKDP LNYLRNLQSKLET >GCiWno437_g11.g1_5 RGCVNERVGGGDLRGGRRDNWTLAAGLGGG**RS*RRGGKSTVAEWGLILTGGAAPPKAV GARGYVSIFGQRNVGGGRGGAFGARAPGVAGGDFPS*HRCRGFGRTPSNSAVNVRGTPRQ GDXXIHXXXCXXXPXPTYI*C*HA*HAMLGETRNFVVRSTD*I*SNVY*SEKDGTHFYSI FSFHLVVNKEHSKNYKTAFSRLP*TVVNCLKHD*DI*TLCAKGVPTFPTPTT*VL*VGTR CVK*NTHVITTVVDPPLENKASYT*IA*ITCLFEQATR*TTFG*PHTSIHWGGT*LW*RS VELLKESSVEIGDX >GCiWno437_g11.g1_6 GMC**EGGGGRFTRWA*RQLDLSSWIGWGVITVLKEGGEKYGGG MGIDSDGGGGAAESGW GAWLR*HFWAEECGWGEGGSLRRKGSWGRRW*FSKLTPVQGIR*DPVE*CGEC*GDTAPR GXXNTXXXXXXXPPPYLYIMLTCLTCHVR*NAKFCG*IY*LNIK*RILE*ERWDTFLFYF LFPFGSKQRTFKEL*NCILAAPIDRC*LFKTRLGYLDIMC*RCPNFPHPYYMSIVSGHEV CEIEHPCYNDCR*PATRE*SKLHINSLNNLLI*TGDEVNHLWLTTHFHSLGRHLTLVKIR *IT*GIFSRNWRR >SEQUENCE 166, 170, 172, 181 Ciona intestinalis 36% to 7B hum all EST except green seq MILEALTTVLAALVSSYLIWLVAKRKQKDGEPPIVPFWIPWL (1) GSGLQYQKDPITFLRKQEKKYGPIFTVFM GGSYFTFVTDPFTHPIIAKESKVLNFRICTIPTIKKVFDFTRRGVDVPTMGGLMVKYMQ GHWLETLVSKMMGNLQKVLLHGSYNNTEWATTGLLHLVETVMCTAGFKSL FGEYPASSGVDNNKLHHKIVEDFVKFDKAFPLLVQGRPISSLK GVKESRANMWKFFTMDEIHKREMVYEMVEQYAKKLEEDQELEQLKKELYCVNWAAM SNTLLSAFWALYYILKHPEAMEAANVEIQRMLKETSQCVDGKSEINFTRDDMAKMTVL DSIINETLRLDISSSLLRQALQDYNLKVVSADRSYKIRKGDKLMTLFQLTHYDPEIYEQPDQFK FDRFLNSDGSPKTDFYKKGKVVKFFLQPFGSGV SKCPGRYWAVTELKQLVILLLLYFDFKLINPKQEIKMDQIRVAFGSLPPNIDPQVQFKRRVIV* EST ciht021k12 ex1, 2, 3, 4, 5 missing last aa of ex 5 EST rcign005a10 ex 6, 7, 8, 9 missing first 16 aa of ex 6 LQW74922.y1 KYG LQW166405.x1 287-324 LQW255002.y1 287-324 LQW254313.y1 287-324 LQW242255.x1 287-324 LQW81413.x1 LQW92154.x1 K-HELIX LQW268672.x1 PERF TO HEME LQW176100.y1 PERF TO HEME LQW15408.x1 PERF TO HEME LQW254112.y1 YXXP TO HEME >CYP7 like Ciona savignyi sequences only one intron shared with human CYP7A1 ortholog to sequence 166 scf/ciona01/G126/seq_dir/hrs/G126P65047F.T0/G126P65047FH3.T0.seq 725 ex1, 2, 3 file 2 scf/ciona01/G126/seq_dir/hrs/G126P68727R.T0/G126P68727RH12.T0.seq 705 ex3 file 6 scf/ciona01/G126/seq_dir/hrs/G126P67293R.T0/G126P67293RG11.T0.seq 707 ex 4 file 5 scf/ciona01/G126/seq_dir/hrs/G126P65770F.T0/G126P65770FA8.T0.seq 717 ex5 file 7 scf/ciona01/G126/seq_dir/hrs/G126P61097R.T0/G126P61097RA10.T0.seq 687 ex 6 file 12 scf/ciona01/G126/seq_dir/hrs/G126P69926F.T0/G126P69926FG3.T0.seq 711 ex 7 file 13 scf/ciona01/G126/seq_dir/hrs/G126P64408F.T0/G126P64408FF10.T0.seq 741 ex 8, 9 file 1 scf/ciona01/G126/seq_dir/hrs/G126P65047R.T0/G126P65047RH3.T0.seq 730 ex9 file 2 MLVSIIYTVLLLLLSSYAIWFIAKRKQKRGEPPIVPFWIPWL (1) GSGLTYQKDPIAFLKKQTKKYGPIFTVFM (1) one aa diff from 7B same phase GGNYFTFVTDPFTHPLVAKEGKILNFRICTLPMIKHLFDYQRPAVEEPTMGGLFVKYLQ (0) GQRLNVMIEKMMKCLQRIMLAGKYTNTDWSEVGLLHFVESIMCTASFSTL (2) FGDYPKSSNKDIPAFEHQMFEDFRKFDEAFPYLVKGYPLNSFK (0) GLEESRKNFWKHLASDELNKREMVSDLIAEYARICDAEKDRTLPKKLFSTAWAAQ (0) same as 8A1 SNTMVSAFWTIYFVTKHGDAKAAAEVEIQRLLKETSQTLDGKTPINFNRDDMDKMTVL (1) same intron as 7A 7B 8A DSIINESLRLHVSASMLRQALQDYDLKVLSVGKTYRLRKGDRVMSLFELNHKDPEIYS NPEVFKYDRFLNEDGSLKTDFYKNGKVVRFALQPFGSGL (2) SKCPGRYWAVTELKQIVILLLLYFDFELINPNEEIKMNKNRVAFGSLPPTNDPKIRFPSTV* >SEQUENCE 167, 173, 174, 176 Ciona intestinalis EST rcinc018n05 WGS GCiWno945_d04.g1 ex 1, 2 WGS GCiWno938_d08.g1 ex 2, 3 WGS GCiWno279_o24.b1 ex 3 WGS GCiWno305_g15.b1 ex 3 WGS GCiWno945_d04.b1 ex 4 EST cinc018n05 ex 5, 6, 7 EST cinc014o02 ex 5, 6, 7 LQW235022.x1 286-346 ex 7 LQW278670.x1 ex 7 EST rcinc014o02 ex 8, 9 missing first 6aa EST rcinc018n05 ex 8, 9 missing first 19aa WGS GCiWno362_k18.g1 ex 8 WGS GCiWno1038_c20.b1 ex 8 LQW178527.x1 EXXR TO HEME ex 8 LQW230608.x1 HEME ex 8 LQW133887.y1 HEME TO END ex 9 LQW157282.x1 HEME ex 9 MLSVILAFFVLILATYFLWNSRKRQQRDGEPNIVPYSIPWL (?) GSSLPFYKDPVKFLKECEKKYGSVFTLFM (?) GGQYFTFVTDPFVQHIIVKEKKVLRFRNCLPPVLKHAFDYYPTAVDDEMMKLTHHYFQ (?) GKPLGLLVKQMNTNIQKWILDGNQGDAGDKWETVGLLSLVQRVMGSASFVSL (?) FGENPKASDTLDVQRQLLNFLTVFPSLLRGLPLSLIK (?) RSREYRQDLWNSLTKSKVTKRKEIFPIIDEIVTLHEQNGENKLLPKRLLPVLVASQ (?) VNTNPSSFWILYYLLKNSEALAAVKDEMEKVLQERSKNPGNNFVCFTKEEMETMMTL (?) ESAINESLRLSISGGMLRKAATEYRLEIPDYGQTYTIRENDMVLVWTQVNQMDPE IFEEPEVFKYDRFLNEDGSLKTNFYKDGKLVKYAFQPFGDGS (?) SKCPGRYWAVLELKQLVVNMLLYYDIQLIDSQEIKMDKGRVGLGALNPTKDALMSIRRKPLC* >Ciona savignyi ortholog to sequence 167 scf/ciona01/G126/seq_dir/hrs/G126P65835F.T0/G126P65835FF5.T0.seq 733 ex1, 2 file 4 scf/ciona01/G126/seq_dir/hrs/G126P66418R.T0/G126P66418RF4.T0.seq 751 ex1, 2 file 6 chromat_dir/hrs/G126P60029R.T0/G126P60029RH11.T0.scf ex2, 3 file 0 scf/ciona01/G126/seq_dir/hrs/G126P607743F.T0/G126P607743FF2.T0.seq 751 ex4, 5, 6 file 21 scf/ciona01/G126/seq_dir/hrs/G126P602029F.T0/G126P602029FE8.T0.seq 722 ex7 scf/ciona01/G126/seq_dir/hrs/G126P67481R.T0/G126P67481RG4.T0.seq 726 ex8 file 3 scf/ciona01/G126/seq_dir/hrs/G126P67704F.T0/G126P67704FG5.T0.seq 769 ex8 file 5 scf/ciona01/G126/seq_dir/hrs/G126P65037F.T0/G126P65037FD9.T0.seq 726 ex9 Most like 8Bs in fugu 36%, 46% to other CYP7 like savignyi seq 45% to intestinalis cyp7 MLEIILSILVLLAVSFLIWNTRKRTAARGEPPIVPYSIPWL (?) GCALPFYKDPLQFLRDCQRKYGPFFTVFM (?) GGEYLTFVTDLSAQQTIAKEKTVLTFRKSLPPVLKQVFGYDSNSVDDEYVKVFPKHFQ (?) GKALENLVSKMNKCLQNFIINGKYYNEEWMTVDLRTFVESIICPASFVSM (?) FGEYSSSRSDKMTEVERNILKFTDLFPSLIRGYPISILK (?) GATACRQYLWKVLSKQEISGRKNVSGVVEETISLHEQYGESDVLPKRLLSFLTATQ (?) VNSVPSAIWLLYFLHKHPEANKVAREEIERVLKESKESTSKDVKIEVTNEDLKKMTVL (?) DSIINESFRLHLAPSMFRIATEDYFVEVAELGRTYKIRKNDKVLLWVQMNQMDPDIFE QPEVFKFDRFLNKDGSRKRDFYKNGRLVKCAFQPFGTGL (2?) SKCPGRYFAVNELKQLAITTLRFFDIELVNPQAEIKMDKNRIGLGALYPATDIKIRIRRKADC* >SEQUENCE 169, 168 RNVHVFMNPHDVPNLERAKNIDHKNVIGDFVSRMVGDEHMIHN PARHSDAVPKILESTLRSTMHLMTLCDSCTNVLPKTIKRTLKSEFN IGLYELCKKLVSDMTLNLFFGSLASDEKCNEETQQICEEFFVYFKSSALLVDPIPIHLLP ATKKSRGRLFELLSRFDFENRDNVSELIKKVAA YVAGSSEEKVRHLLIILWSAQANTLPALFWTLFYILNDKTARIDVLEEFEKHLR KTVPACDVIGTVTDDLK WPNLSDIQRMRKGDVDKLVLLDSCTKETMRM TGSSLAARRAHADTTVTLASGQEYKIRKGDYT SYFAPVTHQDADIYDKPE LKSRTQFSKNGKRISPSTSIMTFGYGAVRCPGRHIALMEIKFLTLVLLRHF DIKLVKNYSRQSEDYPQFDLTHLGFGVMPPSRDVDVTLSI* LQW51831.y1 274-299 DEV43545.y1 274-299 LQW266261.y1 HEME TO END LQW275335.y1 HEME TO END 1 DIFF LQW25182.y1 HEME ONE DIFF GCiWno340_c21.g1 GCiWno78_m01.b1 >scf/ciona01/G126/seq_dir/hrs/G126P65035F.T0/G126P65035FC11.T0.seq 701 0 701 ABI Length = 701 Minus Strand HSPs: Score = 326 (114.8 bits), Expect = 3.7e-29, P = 3.7e-29 Identities = 61/91 (67%), Positives = 79/91 (86%), Frame = -3 Query: 8 GSSEEKVRHLLIILWSAQANTLPALFWTLFYILNDKTARIDVLEEFEKHLRKTVPACDVI 67 G++EE+VRHLLIILWSAQANTLPALFWTLF+ILNDK A++DVL+EFEKHL K+ DV Sbjct: 345 GTNEERVRHLLIILWSAQANTLPALFWTLFHILNDKQAKVDVLQEFEKHLGKSENFYDVT 166 Query: 68 GTVTDDLKWPNLSDIQRMRKSDVDKLVLLGE 98 TV ++L+WP + DIQR++K D+DK+V+LG+ Sbjct: 165 -TVGENLQWPTMDDIQRIKKGDLDKMVVLGK 76 >GCiWno845_i05.b1 CHROMAT_FILE: GCiWno845_i05.b1 PHD_FILE: GCiWno845_i05.b1.phd.1 CHEM: term DYE: big TIME: Thu Dec 6 16:00:32 2001 TEMPLATE: GCiWno845_i05 DIRECTION: fwd Length = 864 Score = 97.9 bits (240), Expect = 2e-20 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 1 RAGEPPLVSHWIPFIGSALDFGKAPLEYLQSLQKRLGDVFTIKLAG 46 RAGEPPLVSHWIPFIGSALDFGKAPLEYLQSLQKRLGDVFTIKLAG Sbjct: 673 RAGEPPLVSHWIPFIGSALDFGKAPLEYLQSLQKRLGDVFTIKLAG 810 >GCiWno845_i05.b1 TGCTTTATTGCATTCATTTTACTGTTTATTCCAGTTCAAATTACAGGTCAAAATCTTGGTTAATGTGGTTACTCTTGGTT GCCAGTGTTGAGCAATATCTTTCAAAACATACATCCTGTCGAGTAAGAAATACTTCCGTTGCCGTAACCCCCACTTGCGT CAAAGCGTGAGTTAATCTATCTTTGTAACTTGCCTTCATGTTTTGCTCTTCCGTCATTTATAGTATTGCGTAAGATCATT CGTCACGTTTAGTCCTCTATTTAAGCAGACACCGGTATTCGAATTTCAACTATTTACTTTGATCTGATTCGACACACGAG CTGAAAGATGTTCTGGACCCTGGCACTCGTTATTTTAAATGTGGTCTGTTACTCAATTTACAGAAACCGCCGTCGGAGGT TAGTTGTTTAAACAAATTTTATAGTTCTTACTCTTTAAACTATTTTATCCATACGCAAGTTTTAGTAGAACCCTCGATTT TGGCGAATTTGTTGATAGATTTTTTACTTTATGAATGAACGTAACTCATTTATCCTCGCGTGGCGGGGTAACGGGAATCG TTATAACCTGAGTGTTTTGGTTCATAAACACCTCGTGCTCCCTTACGAGGTACCGCGTTTGTAAATTTTTTATTTAGTTT TTTAATCTAATTTCGACCTTGTAAAATACAGACGTGCAGGAGAACCTCCTTTGGTTTCACATTGGATTCCATTTATTGGA TCTGCTCTTGATTTTGGAAAAGCACCTTTGGAATACCTGCAATCGTTACAGAAGCGTTTGGGAGATGTATTTACCATAAA GCTGGCTGGATGGTAAGTAATAAAGATTGCTGTGTAGTTCAAATGGTGTTAGAGTTNAGTTGCN >GCiWno845_i05.b1_1 CFIAFILLFIPVQITGQNLG*CGYSWLPVLSNIFQNIHPVE*EILPLP*PPLASKRELIY LCNLPSCFALPSFIVLRKIIRHV*SSI*ADTGIRISTIYFDLIRHTS*KMFWTLALVILN VVCYSIYRNRRRRLVV*TNFIVLTL*TILSIRKF**NPRFWRIC**IFYFMNERNSFILA WRGNGNRYNLSVLVHKHLVLPYEVPRL*IFYLVF*SNFDLVKYRRAGEPPLVSHWIPFIG SALDFGKAPLEYLQSLQKRLGDVFTIKLAGW*VIKIAV*FKWC*SXVA >GCiWno845_i05.b1_2 ALLHSFYCLFQFKLQVKILVNVVTLGCQC*AISFKTYILSSKKYFRCRNPHLRQSVS*SI FVTCLHVLLFRHL*YCVRSFVTFSPLFKQTPVFEFQLFTLI*FDTRAERCSGPWHSLF*M WSVTQFTETAVGG*LFKQIL*FLLFKLFYPYASFSRTLDFGEFVDRFFTL*MNVTHLSSR GGVTGIVIT*VFWFINTSCSLTRYRVCKFFI*FFNLISTL*NTDVQENLLWFHIGFHLLD LLLILEKHLWNTCNRYRSVWEMYLP*SWLDGK**RLLCSSNGVRVXL >GCiWno845_i05.b1_3 LYCIHFTVYSSSNYRSKSWLMWLLLVASVEQYLSKHTSCRVRNTSVAVTPTCVKA*VNLS L*LAFMFCSSVIYSIA*DHSSRLVLYLSRHRYSNFNYLL*SDSTHELKDVLDPGTRYFKC GLLLNLQKPPSEVSCLNKFYSSYSLNYFIHTQVLVEPSILANLLIDFLLYE*T*LIYPRV AG*RESL*PECFGS*TPRAPLRGTAFVNFLFSFLI*FRPCKIQTCRRTSFGFTLDSIYWI CS*FWKSTFGIPAIVTEAFGRCIYHKAGWMVSNKDCCVVQMVLEXSC >GCiWno845_i05.g1_4 opposite end inside seq 169 LMGKSGKLKIAIIITKXTVNYFSHF*FNHIFPRNVHVFMNPHDVPNLREQKTSTIKT*LV ISCHVW*ETSI*FITLLGILMQFLKYWNRRYVAPCTS*HFVIRAPMFCPRRLKEL*KASL IVNVKRRYV*DRRFVYIFIYLCL*VYIYNGSFYTW*LV*SGYEVYMYKTEHPCYNNYTCN HGLLNSDAVY*V*VMIQLMSAFEYISKCNKQKTTYI*QNNINCRSYKIILK*LR*LFKTL SF*KTLGNMIFAYRRFF*F*VIINLSYIPKFSLVMQIGYRAR >GCiWno845_i05.g1_5 FDG*IWKVKNCYYHYQXHS*LFQPFLI*PYFSQERPRIYEPA*RAQPERAKNIDHKNVIG DFVSRMVGDEHMIHNPARHSDAVPKILESTLRSTMHLMTLCDSCTNVLPKTIKRALKSEF NCKRETKVCIGQTFCIYIYIFMFISIYL*W*FLYVVTRIKRVRGVYV*NRTPVL*QLYMQ SWST*FRCRVLSIGHDTTHVRLRVHFKMQQTKNYLHLTEQHKL*IL*NNSKIASVTFQNI IFLKNIGQYDICLPSIFLILSNY*FELYT*IFSRYADRVPSSX >GCiWno845_i05.g1_6 *WVNLES*KLLLSLPXPQLIISAISNLTIFFPGTSTYL*TRMTCPT*ESKKHRP*KRDW* FRVTYGRRRAYDS*PCSAF*CSS*NIGIDAT*HHAPHDTL*FVHQCFAQDD*KSFKKRV* L*T*NEGMYRTDVLYIYLYIYVYKYIFIMVVFIRGNSYKAGTRCICIKQNTRVITIIHAI MVYLIPMPCIEYRS*YNSCPPSSTFQNATNKKLLTFNRTT*IVDLIK*F*NSFGNFSKHY LFEKHWAI*YLPTVDFFDFE*LLI*VIYLNFLSLCRSGTELX >GCiWno845_i05.g1 TCGAGCTCGGTACCCGATCTGCATAACGAGAGAAAATTTAGGTATATAACTCAAATTAATAATTACTCAAAATCAAAAAA ATCGACGGTAGGCAAATATCATATTGCCCAATGTTTTTCAAAAAGATAATGTTTTGAAAAGTTACCGAAGCTATTTTAGA ATTATTTTATAAGATCTACAATTTATGTTGTTCTGTTAAATGTAAGTAGTTTTTTGTTTGTTGCATTTTGAAATGTACTC GAAGGCGGACATGAGTTGTATCATGACCTATACTCAATACACGGCATCGGAATTAAGTAGACCATGATTGCATGTATAAT TGTTATAACACGGGTGTTCTGTTTTATACATATACACCTCGTACCCGCTTTATACGAGTTACCACGTATAAAAACTACCA TTATAAATATATACTTATAAACATAAATATATAAATATATATACAAAACGTCTGTCCTATACATACCTTCGTTTCACGTT TACAATTAAACTCGCTTTTTAAAGCTCTTTTAATCGTCTTGGGCAAAACATTGGTGCACGAATCACAAAGTGTCATGAGG TGCATGGTGCTACGTAGCGTCGATTCCAATATTTTAGGAACTGCATCAGAATGCCGAGCAGGGTTATGAATCATATGCTC GTCTCCTACCATACGTGACACGAAATCACCAATCACGTTTTTATGGTCGATGTTTTTTGCTCTCTCAGGTTGGGCACGTC ATGCGGGTTCATAAATACGTGGACGTTCCTGGGAAAAATATGGTTAAATTAGAAATGGCTGAAATAATTAACTGTGGNTT TGGTAATGATAATAGCAATTTTTAACTTTCCAGATTTACCCATCAAA probable exon 1 of seq 164 confirm >GCiWno551_j06.g1 CHROMAT_FILE: GCiWno551_j06.g1 PHD_FILE: GCiWno551_j06.g1.phd.1 CHEM: term DYE: big TIME: Mon Oct 22 11:13:24 2001 TEMPLATE: GCiWno551_j06 DIRECTION: rev Length = 927 Score = 60.5 bits (144), Expect = 3e-09 Identities = 28/34 (82%), Positives = 30/34 (87%) Frame = +3 Query: 1 MWLLLVASVEQYLSKHTSCRVRNTSVAVTPTCVK 34 MW ++VASVEQYLSK SCRVRNTSVAV PTCVK Sbjct: 246 MWFVMVASVEQYLSKLISCRVRNTSVAVIPTCVK 347 >GCiWno961_e10.g1 CHROMAT_FILE: GCiWno961_e10.g1 PHD_FILE: GCiWno961_e10.g1.phd.1 CHEM: term DYE: big TIME: Tue Dec 25 10:25:08 2001 TEMPLATE: GCiWno961_e10 DIRECTION: rev Length = 886 Score = 121 bits (300), Expect = 4e-27 Identities = 58/60 (96%), Positives = 59/60 (97%) Frame = +1 Query: 47 IGLYELCKKLVSDMTLNLFFGSLASDEKCNEETQQICEEFFVYFKSSALLVDPIPIHLLP 106 IGLYELCKKLVSDMTLNLFFGSLASDEKCNEET+QICEEFFVYFKSSALLVD IPIHLLP Sbjct: 568 IGLYELCKKLVSDMTLNLFFGSLASDEKCNEETKQICEEFFVYFKSSALLVDRIPIHLLP 747 Score = 66.3 bits (159), Expect = 1e-10 Identities = 31/35 (88%), Positives = 32/35 (90%) Frame = +1 Query: 12 LESTLRSTMHLMTLCDSCTNVLPKTIKRTLKSEFN 46 L + LRSTMHLMTLCDSCTNVLPKTIKR LKSEFN Sbjct: 7 LGTPLRSTMHLMTLCDSCTNVLPKTIKRALKSEFN 111 >GCiWno961_e10.g1 TTCGAGCTCGGTACCCCGCTACGTAGCACCATGCACCTCATGACACTTTGTGATTCGTGCACCAATGTTTTGCCCAAGAC GATTAAAAGAGCTTTAAAAAGCGAGTTTAATTGTAAACGTGAAACGAAGGTATGTATAGGACAGACGTTTTGTATATATA TTTATATATTTATGTTTATAAGTATATATTTATAATGGTAGTTTTTATACGTGGTAACTCGTATAAAGCGGGTACGAGGT TGTATATGTATAAAACAACACCCGTGTTATAACAATTATACATGCAATCATGGTCTACTTAATTCCGATGCCGTGTATTG AGTATAGGTCATGATACAACTCATGTCCGCCTTCGGATACATTTCAAAATGCAACAAACAAAAACTACTTACGAACAACA TAAATTGTAGAACTTATAAAATAATTCTAAAATAGCTTCGGTAACTTTTCAAAACATTATCTTTTTGAAAAACATCGGGC AATATGATATTTGCCTGCCGTCGATTTTTTTGATTTTGAGTAATTATTAATTTGAGTTATATACCTAAATTTTCTCTCGT TATGCAGATCGGACTTTACGAATTGTGCAAGAAATTGGTGTCTGACATGACACTTAACCTTTTCTTTGGATCCCTCGCTT CGGACGAGAAATGCAACGAAGAAACCAAACAAATTTGCGAAGAATTCTTCGTTTACTTTAAATCGTCAGCACTTCTAGTT GATCGAATACCCATCCACTTATTGCCAGCAACTAAAAAGTCAAGGGGTCGCCTGTTTGAGTTACTTTCACGTTTCGATTT TGAGAACCGAGATAACGTGTCGGAACTTATAAGAAAGTCGCCGCTGTCGGTACGTATACTTTTATTTATTCATTTATTGA TTATAA seq 166 for comp GVKESRANMWKFFTMDEIHKREMVYEMVEQYAKKLEEDQELEQLKKELYCVNWAAMSNTL ATKKSRGRLFELLSRFDFENRDNVSELIKKVAAVG------EEKVRHLLIILWSAQANTL LSAFWALYYILKHPEAMEAANVEIQRMLKETSQCVDGKSEINFTRDDMAKMTVL PALFWTLFYILNDKTARIDVLEEF Query: 18 QICEEFFVYFKSSALLVDRIPIHLLPATKKSRGRLFELLSRFDFENRDNVSELIKKVA 75 +I E+F + K+ LLV PI L K+SR +++ + + R+ V E++++ A Sbjct: 198 KIVEDFVKFDKAFPLLVQGRPISSLKGVKESRANMWKFFTMDEIHKREMVYEMVEQYA 255 >scf/ciona01/G126/seq_dir/hrs/G126P67457F.T0/G126P67457FB6.T0.seq 737 0 737 ABI Length = 737 Minus Strand HSPs: Score = 264 (92.9 bits), Expect = 2.3e-42, Sum P(2) = 2.3e-42 Identities = 51/65 (78%), Positives = 60/65 (92%), Frame = -2 Query: 15 DTTQICEEFFVYFKSSALLVDRIPIHLLPATKKSRGRLFELLSRFDFENRDNVSELIKKV 74 +T +ICEEFFVYF SSALLVDRIPIHLLPATK+SR ++FELLS FDFENR+NVS+LI +V Sbjct: 736 ETRKICEEFFVYFDSSALLVDRIPIHLLPATKRSRNKMFELLSDFDFENRENVSKLISQV 557 Query: 75 AAVGE 79 AAVG+ Sbjct: 556 AAVGK 542 Score = 203 (71.5 bits), Expect = 2.3e-42, Sum P(2) = 2.3e-42 Identities = 37/45 (82%), Positives = 44/45 (97%), Frame = -3 Query: 79 EEKVRHLLIILWSAQANTLPALFWTLFYILNDKTARIDVLEEFKE 123 EE+VRHLLIILWSAQANTLPALFWTLF+ILNDK A++DVL+EF++ Sbjct: 246 EERVRHLLIILWSAQANTLPALFWTLFHILNDKQAKVDVLQEFEK 112 >scf/ciona01/G126/seq_dir/hrs/G126P67457F.T0/G126P67457FB6.T0.seq_4 737 0 737 ABI KQGRFAKSFSFTSTPRRCWWTESRFICFQPLRGQGTRCSNFFPISILRIGRMYRS*SAKL PLSVSHITRRIVDRVFFIFNSKKLSTC*SIMVY*DYK*N*RNNKKKRDFR*LGPLHSHTC LFTI*NIKYKSN*CKEINVYRMLNMIIMLNEYFVK*N*N*GTNEERVRHLLIILWSAQAN TLPALFWTLFHILNDKQAKVDVLQEFEKHLGKSENFYDVTTVGENLQWRNXHHSGKDGV* XPPEA >scf/ciona01/G126/seq_dir/hrs/G126P67457F.T0/G126P67457FB6.T0.seq_5 737 0 737 ABI ETRKICEEFFVYFDSSALLVDRIPIHLLPATKRSRNKMFELLSDFDFENRENVSKLISQV AAVGKSHNPENSR*SVLHI*LKKVKHMLKHNGLLRL*IKLKEQQKKKGFPIIGSTPFTYL PIYHLKY*I*K*LM*RNQCL*DA*YDNYVERIFC*IKLKLRYKRREGSSSSYNLVVCASQ HSTSPILDFVPHFERQTSES*CSAGI*EALG*I*KLL*RHNGRRKLAMAEXPPQWKGWGL VXARGX >scf/ciona01/G126/seq_dir/hrs/G126P67457F.T0/G126P67457FB6.T0.seq_6 737 0 737 ABI GNKEDLRRVFRLLRLLGAAGGQNPDSFASSH*EVKEQDVRTSFRFRF*E*GECIEVDQPS CRCR*VT*PGE**IECSSYLTQKS*AHVKA*WFIKTINKIKG TTKKKGISDNWVHSIHIL AYLPFKILNIKVIN VKKSMFIGCLI**LC*TNILLNKTKIKVQTKRGFVIFL*SCGLRKP TLYQPYSGLCSTF*TTNKRKLMFCRNLRSTWVNLKTSMTSQRSEKTCNGGIXTTVERMGF SXRPRL >scf/ciona01/G126/seq_dir/hrs/G126P67457F.T0/G126P67457FB6.T0.seq file 3 ABI AGCCTCGGGCGGNTACTAAACCCCATCCTTTCCACTGTGGTGGNAATTCC GCCATTGCAAGTTTTCTCCGACCGTTGTGACGTCATAGAAGTTTTCAGAT TTACCCAAGTGCTTCTCAAATTCCTGCAGAACATCAACTTTCGCTTGTTT GTCGTTCAAAATGTGGAACAAAGTCCAGAATAGGGCTGGTAGAGTGTTGG CTTGCGCAGACCACAAGATTATAAGAAGATGACGAACCCTCTCTTCGTTT GTACCTTAATTTTAGTTTTATTTAACAAAATATTCGTTCAACATAATTAT CATATTAAGCATCCTATAAACATTGATTTCTTTACATTAATTACTTTTAT ATTTAATATTTTAAATGGTAAATAGGCAAGTATGTGAATGGAGTGGACCC AATTATCGGAAATCCCTTTTTTTTTTGTTGTTCCTTTAATTTTATTTATA GTCTTAATAAACCATTATGCTTTAACATGTGCTTAACTTTTTTGAGTTAA ATATGAAGAACACTCTATCTACTATTCTCCGGGTTATGTGACTTACCGAC AGCGGCAACTTGGCTGATCAACTTCGATACATTCTCCCTATTCTCAAAAT CGAAATCGGAAAGAAGTTCGAACATCTTGTTCCTTGACCTCTTAGTGGCT GGAAGCAAATGAATCGGGATTCTGTCCACCAGCAGCGCCGAGGAGTCGAA GTAAACGAAAAACTCTTCGCAAATCTTCCTTGTTTCC >LQW276372.x1_4 SGTLKLFLVIC*LHHLKLSIIMSAALSVTWNDCPAFDGNLMSITNFSVCDRLTIGRIVSD RH*PFLGSIASDEKCNEDTTQICEEFFVYFKSSALLVDRIPIHLLPATKKSRGRLFELLS RFDFENRDNVSELIKKVAA VG TYTFIYSFIDYN*P*SYIRGNLYKAGTKGLCMKQNTCVI TFDLFHPYRVHFTN*YA*FGVTTYIVGWGRCDTFLFY*IVTL*NHILTSIEQC*LFKTRS GYLNFMW*RCSTFPS*YTTLWVFIFMYVFLCMVDESHKPI*WTRYAIYQAKELSGSFLEI VGNVKDVTYVIAGPAV >LQW276372.x1_5 FWYTKAVPCDLLITPFEVEYYYVGCTVCDLE*LPRV*WEFNEYNQFLCMRSTYDWQNCV* QTLTFLGIHRFGREMQRRYHTNLRRILRLL*IVSTSS*SNTHPLIASN*KVKGSPV*VTF TFRF*EPR*RVGTYKESRRCRYVYFYLFIY*L*LTVKLHTWKLVQGGDKRFMYETEHMCY NF*PVSSIPSTFYELVCVIWSYHVYSRVGEM*HLFILLNCHIMKPYSHFHRTVLIV*NTI RLFKFYVVKMFHLPIIIHNFVGIYFYVCFFVYG*RITQTYIMDTVCNIPSKGIVG*FPGN SRQR*RCNLRYCWTCRX >LQW276372.x1_6 FLVH*SCSL*FADYTI*S*VLLCRLHCL*PGMIAPRLMGI**V*PISLYAIDLRLAELCL TDTNLSWDPSLRTRNATKIPHKFAKNSSFTLNRQHF*LIEYPSTYCQQLKSQGVACLSYF HVSILRTEITCRNL*RKSPLSVRILLFIHLLIIINRKVTYVETCTRRGQKVYV*NRTHVL *LLTCFIHTEYILRTSMRNLELPRI**GGGDVTPFYSIKLSHYETIFSLP*NSVNCLKHD QVI*ILCGKDVPPSHHNTQLCGYLFLCMFFCVWLTNHTNLYNGHGMQYTKQRNCRVVSWK **ATLKM*LTLLLDLPS >scf/ciona01/G126/seq_dir/hrs/G126P66044R.T0/G126P66044RD11.T0.seq 742 0 742 ABI Length = 742 Plus Strand HSPs: Score = 310 (109.1 bits), Expect = 1.8e-27, P = 1.8e-27 Identities = 59/77 (76%), Positives = 70/77 (90%), Frame = +3 Query: 53 FLGSIASDEKCNEDTTQICEEFFVYFKSSALLVDRIPIHLLPATKKSRGRLFELLSRFDF 112 F GS+ASD+ C+E+T +ICEEFFVYF SSALLVDRIPIHLLPATK+SR ++FELLS FDF Sbjct: 108 FFGSLASDKDCSEETRKICEEFFVYFDSSALLVDRIPIHLLPATKRSRNKMFELLSDFDF 287 Query: 113 ENRDNVSELIKKVAAVG 129 ENR+NVS+LI +VAAVG Sbjct: 288 ENRENVSKLISQVAAVG 338 >GCiWno840_d11.g1 CHROMAT_FILE: GCiWno840_d11.g1 PHD_FILE: GCiWno840_d11.g1.phd.1 CHEM: term DYE: big TIME: Mon Dec 10 10:15:13 2001 TEMPLATE: GCiWno840_d11 DIRECTION: rev Length = 872 Score = 96.7 bits (237), Expect = 4e-20 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = +2 Query: 1 ATKKSRGRLFELLSRFDFENRDNVSELIKKVAAVGTYTFIYSFIDYN 47 ATKKSRGRLFELLSRFDFENRDNVSELIKKVAAVGTYTFIYSFIDYN Sbjct: 407 ATKKSRGRLFELLSRFDFENRDNVSELIKKVAAVGTYTFIYSFIDYN 547 >GCiWno840_d11.g1 TCGAGCTCGGTACCCTACATTTCAAAATGCAACAAACAAAAAACTACTTACGAACAACATAAATTGTAGAACTTATAAAA TAATTCTAAAATAGCTTCGGTAACTTTTCAAAACATTATCTTTTTGAAAAACATTGGGCAATATGATATTTGCCTACCGT CGATTTTTTTGATTTTGAGTAATTATTAATTTGAGTTATATACCTAAATTTTCTCTCGTTATGCAGATCGGACTTTACGA ATTGTGCAAGAAATTGGTGTCTGACATGACACTTAACCTTTTCTTTGGATCCCTTGCTTCGGACGAGAAATGCAACGAAG AAACCAAACAAATTTGCGAAGAATTCTTCGTTTACTTTAAATCGTCAGCACTTCTAGTTGATCGAATACCCATCCACTTA TTGCCAGCAACTAAAAAGTCAAGGGGTCGCCTGTTTGAGTTACTTTCACGTTTCGATTTTGAGAACCGAGATAACGTGTC GGAACTTATAAAGAAAGTCGCCGCTGTCGGTACGTATACTTTTATTTATTCATTTATTGATTATAATTAACCGTAAAGTT ACATACGTGGAAACTTGTACAAGGCGGGGACAAAAGGTTTATGTATGAAACAGAACACGTGTGTTATAACGTTTGACCTG CTGTATCCACTTCCGAGTACATTTTACGAATTAGTATGCGTAATTTGGAGTTACCACGTATATAGTAGGGTGGGGGAGAT GGGACACCTTTTTATTCTATTTACTTGTCACATTATAAAACCGTATCCTCACGACTCCCATAGACCATTGTTAATTGTTT AAACACGATCAGGTTATTTAAATTTATGTGGTAAAGATGTTCCACCTTCCATCATATATANCACTTTGTGGG >GCiWno340_c21.g1 CATTTAACGCTCGAGCGGAACATGTAGTTACAGCTGTAACACTTCCAGCATTTCTCCTTACGATCGCCGCTTTTCGGATC TCCTTATATGGACAATGTGACGTCCACGTCACGGCTGGGCGGCATGACACCAAACCCCAAATGAGTGAGATCAAATTGTG GGTAATCTTCACTTTGCCTCGAGTAGTTTTTAACCAGTTTGATGTCGAAATGTCTCAATAGAACCAAGGTCAGAAACTTA ATTTCCATCAAAGCGATATGACGACCTGGGCATCTAACGGCGCCGTAGCCAAACGTCATAATGGACGTCGAGGGACTGAT TCTTTTCCCGTTCTTCGAGAATTGGGTTCGAGATTTTAACATGGACGGGTCTTTATCATCGTGTTGTAAAAATCGTTTAT GTCTGTATTCCTGTGATACGAAATTAAAATTACTTGTCGCGTAATTAAAGAATAAAATCCCTTAAGCGGGCACGAGGTGT GAAATAGAACACCCTTATACATATAGTAGGTTGCGGAAGATGATCAATGTTTTCATTCTCCGTTAACGTCCTATTTGGTA GTAAACAAGGAACATTTACAAAACTATAAAACTGTATCCCGGCGGCATTAAAAGTGCGTTGGTAATTGTTAAAACCACGT CCAGGAAATATGGGATGTTACATGCCAACGGTTTCCCATCTTAACAATAATATACACGTATACTGCATTCCACTATGCCA AGAAATAGAATACACNCCTGCGTGTTCTTACCTCTGGCTTATCGTATATATCAGCATCCTGGTGGGTGACGGNNTGCAAA TATGACGTGTAGTCGCCTTTACGTATNCTGTATTCCTGACCCACTGGCTATGNNTACCGTATGTCNGCGTGTGCCCTGCG ACCN >GCiWno340_c21.g1_4 VAGHTXTYGXHSQWVRNTXYVKATTRHICXPSPTRMLIYTISQR*EHAGVYSISWHSGMQ YTCILLLRWETVGM*HPIFPGRGFNNYQRTFNAAGIQFYSFVNVPCLLPNRTLTENENID HLPQPTICIRVFYFTPRARLRDFIL*LRDK*F*FRITGIQT*TIFTTR**RPVHVKISNP ILEEREKNQSLDVHYDVWLRRR*MPRSSYRFDGN*VSDLGSIETFRHQTG*KLLEAK*RL PTI*SHSFGVWCHAAQP*RGRHIVHIRRSEKRRS*GEMLEVLQL*LHVPLER*M >GCiWno340_c21.g1_5 GRRAHADIRXX*PVGQEYXIRKGDYTSYLXXVTHQDADIYDKPEVRTRRXVFYFLA*WNA VYVYIIVKMGNRWHVTSHISWTWF*QLPTHF*CRRDTVL*FCKCSLFTTK*DVNGE*KH* SSSATYYMYKGVLFHTSCPLKGFYSLITRQVILISYHRNTDINDFYNTMIKTRPC*NLEP NSRRTGKESVPRRPL*RLATAPLDAQVVISL*WKLSF*PWFY*DISTSNWLKTTRGKVKI THNLISLIWGLVSCRPAVTWTSHCPYKEIRKAAIVRRNAGSVTAVTTCSARALNX >GCiWno340_c21.g1_6 XSQGTRXHTVXIASGSGIQXT*RRLHVIFAXRHPPGC*YIR*ARGKNTQXCILFLGIVEC SIRVYYC*DGKPLACNIPYFLDVVLTITNALLMPPGYSFIVL*MFLVYYQIGR*RRMKTL IIFRNLLYV*GCSISHLVPA*GILFFNYATSNFNF VSQEYR HKRFLQHDDKDPSMLKSRT QFSKNGKRISPSTSIMTFGYGAVRCPGRHIALMEIKFLTLVLLRHFDIKLVKNYSRQSED YPQFDLTHLGFGVMPPSRDVDVTLSI*GDPKSGDRKEKCWKCYSCNYMFRSSVKX >GCiWno340_c21.g1 CATTTAACGCTCGAGCGGAACATGTAGTTACAGCTGTAACACTTCCAGCATTTCTCCTTACGATCGCCGCTTTTCGGATC TCCTTATATGGACAATGTGACGTCCACGTCACGGCTGGGCGGCATGACACCAAACCCCAAATGAGTGAGATCAAATTGTG GGTAATCTTCACTTTGCCTCGAGTAGTTTTTAACCAGTTTGATGTCGAAATGTCTCAATAGAACCAAGGTCAGAAACTTA ATTTCCATCAAAGCGATATGACGACCTGGGCATCTAACGGCGCCGTAGCCAAACGTCATAATGGACGTCGAGGGACTGAT TCTTTTCCCGTTCTTCGAGAATTGGGTTCGAGATTTTAACATGGACGGGTCTTTATCATCGTGTTGTAAAAATCGTTTAT GTCTGTATTCCTGTGATACGAAATTAAAATTACTTGTCGCGTAATTAAAGAATAAAATCCCTTAAGCGGGCACGAGGTGT GAAATAGAACACCCTTATACATATAGTAGGTTGCGGAAGATGATCAATGTTTTCATTCTCCGTTAACGTCCTATTTGGTA GTAAACAAGGAACATTTACAAAACTATAAAACTGTATCCCGGCGGCATTAAAAGTGCGTTGGTAATTGTTAAAACCACGT CCAGGAAATATGGGATGTTACATGCCAACGGTTTCCCATCTTAACAATAATATACACGTATACTGCATTCCACTATGCCA AGAAATAGAATACACNCCTGCGTGTTCTTACCTCTGGCTTATCGTATATATCAGCATCCTGGTGGGTGACGGNNTGCAAA TATGACGTGTAGTCGCCTTTACGTATNCTGTATTCCTGACCCACTGGCTATGNNTACCGTATGTCNGCGTGTGCCCTGCG ACCN >GCiWno340_c21.g1_4 VAGHTXTYGXHSQWVRNTXYVKATTRHICXPSPTRMLIYTISQR*EHAGVYSISWHSGMQ YTCILLLRWETVGM*HPIFPGRGFNNYQRTFNAAGIQFYSFVNVPCLLPNRTLTENENID HLPQPTICIRVFYFTPRARLRDFIL*LRDK*F*FRITGIQT*TIFTTR**RPVHVKISNP ILEEREKNQSLDVHYDVWLRRR*MPRSSYRFDGN*VSDLGSIETFRHQTG*KLLEAK*RL PTI*SHSFGVWCHAAQP*RGRHIVHIRRSEKRRS*GEMLEVLQL*LHVPLER*M >GCiWno340_c21.g1_5 GRRAHADIRXX*PVGQEYXIRKGDYTSYLXXVTHQDADIYDKPEVRTRRXVFYFLA*WNA VYVYIIVKMGNRWHVTSHISWTWF*QLPTHF*CRRDTVL*FCKCSLFTTK*DVNGE*KH* SSSATYYMYKGVLFHTSCPLKGFYSLITRQVILISYHRNTDINDFYNTMIKTRPC*NLEP NSRRTGKESVPRRPL*RLATAPLDAQVVISL*WKLSF*PWFY*DISTSNWLKTTRGKVKI THNLISLIWGLVSCRPAVTWTSHCPYKEIRKAAIVRRNAGSVTAVTTCSARALNX >GCiWno340_c21.g1_6 XSQGTRXHTVXIASGSGIQXT*RRLHVIFAXRHPPGC*YIR*ARGKNTQXCILFLGIVEC SIRVYYC*DGKPLACNIPYFLDVVLTITNALLMPPGYSFIVL*MFLVYYQIGR*RRMKTL IIFRNLLYV*GCSISHLVPA*GILFFNYATSNFNFVSQEYRHKRFLQHDDKDPSM LKSRT QFSKNGKRISPSTSIMTFGYGAVRCPGRHIALMEIKFLTLVLLRHFDIKLVKNYSRQSED YPQFDLTHLGFGVMPPSRDVDVTLSI*GDPKSGDRKEKCWKCYSCNYMFRSSVKX >scf/ciona01/G126/seq_dir/hrs/G126P600373R.T0/G126P600373RG4.T0.seq file 10 0 699 ABI Length = 699 Minus Strand HSPs: ortholog to seq 169 Score = 201 (70.8 bits), Expect = 6.8e-16, P = 6.8e-16 Identities = 40/55 (72%), Positives = 45/55 (81%), Frame = -2 Query: 14 FVSQEYRHKRFLQHDDKDPSMLKSRTQFSKNGKRISPSTSIMTFGYGAVRCPGRH 68 ++ QEYRH+RFLQ D+KDP+MLKSRTQFSK GKRISPSTSIMT A CPG H Sbjct: 170 YLFQEYRHERFLQRDEKDPNMLKSRTQFSKEGKRISPSTSIMT-SVMAQTCPGIH 9 >scf/ciona01/G126/seq_dir/hrs/G126P600373R.T0/G126P600373RG4.T0.seq_4 699 0 699 ABI IIYLLK*NIRSQFPSATLSTIINTSCQV*SYYLILIDFIT*F*LQILA*KRLCVCPALAW L*GGLPKTPQLRCIAGRYTTYERATTRHISPLLLTRIHRSMISLR*EKSYYGNLIRRFSK YWWGL*PVGYCILYSP*LIDAQLHFCKRDVPHS*IVKKQAVGYCFQSISAL*F*VFIFVP GI*TRAVSATRRKGSKHVKIKNPVFKGRKANQSFNVHHDFGYGANVPRNPPDG >scf/ciona01/G126/seq_dir/hrs/G126P600373R.T0/G126P600373RG4.T0.seq_5 699 0 699 ABI YLFIKIKYTQSIPKCNSKYNY*Y*LSSLKLLLDFD*FYNLILITDSCLKETLRVSGSSMA VRRATQNTTITLHSGKVYNIRKGDYTSYFAPVTHQDTQIYDKPEVRKIILWEFDQAV**I LVGIMTGRVLYSIFTVIN*CTVTFLQKGCSSFLNRKKTGCRLLFSKYFSFVVLSVYICSR NIDTSGFCNETKRIQTC*NQEPSFQRKESESVLQRPS*LRLWRKRAPESTRWX >scf/ciona01/G126/seq_dir/hrs/G126P600373R.T0/G126P600373RG4.T0.seq_6 699 0 699 ABI LFIY*NKIYAVNSQVQL*VQLLILVVKFKVTT*F*LIL*LDFDYRFLPKRDSACVRL*HG CKAGYPKHHNYAA*REGIQHTKGRLHVIFRPCYSPGYTDL**A*GKKNHIMGI*SGGLVN IGGDYDRSGTVFYIHRD*LMHSYISAKGMFLILKS*KNRL*ATVFKVFQLCSFKCLYLFQ EYRHERFLQRDEKDPNMLKSRTQFSKEGKRISPSTSIMTSVMAQTCPGIHQMG >scf/ciona01/G126/seq_dir/hrs/G126P600373R.T0/G126P600373RG4.T0.seq 699 0 699 ABI CCCATCTGGTGGATTCCGGGGCACGTTTGCGCCATAACCGAAGTCATGAT GGACGTTGAAGGACTGATTCGCTTTCCTTCCTTTGAAAACTGGGTTCTTG ATTTTAACATGTTTGGATCCTTTTCGTCTCGTTGCAGAAACCGCTCGTGT CTATATTCCTGGAACAAATATAAACACTTAAAACTACAAAGCTGAAATAC TTTGAAAACAGTAGCCTACAGCCTGTTTTTTTACGATTTAAGAATGAGGA ACATCCCTTTTGCAGAAATGTAACTGTGCATCAATTAATCACGGTGAATA TAGAATACAGTACCCGACCGGTCATAATCCCCACCAATATTTACTAAACC GCCTGATCAAATTCCCATAATATGATTTTTCTTACCTCAGGCTTATCATA GATCTGTGTATCCTGGTGAGTAACAGGGGCGAAATATGACGTGTAGTCGC CCTTTCGTATGTTGTATACCTTCCCGCTATGCAGCGTAATTGTGGTGTTT TGGGTAGCCCGCCTTACAGCCATGCTAGAGCCGGACACACGCAGAGTCTC TTTTAGGCAAGAATCTGTAATCAAAATCAAGTTATAAAATCAATCAAAAT CAAGTAGTAACTTTAAACTTGACAACTAGTATTAATAATTGTACTTAGAG TTGCACTTGGGAATTGACTGCGTATATTTTATTTTAATAAATAAATAAT >scf/ciona01/G126/seq_dir/hrs/G126P69245R.T0/G126P69245RA1.T0.seq 729 0 729 ABI Length = 729 Plus Strand HSPs: Score = 258 (90.8 bits), Expect = 5.8e-22, P = 5.8e-22 Identities = 53/74 (71%), Positives = 59/74 (79%), Frame = +1 Query: 12 FNFVSQEYRHKRFLQHDDKDPSMLKSRTQFSKNGKRISPSTSIMTFGYGAVRCPGRHIAL 71 F FV YRH RFL H+ K +LKSRTQFSK GKRISPSTSIMTFGYGA+RCPGR IA+ Sbjct: 52 FTFVPL-YRHYRFL-HEAKRSKLLKSRTQFSKEGKRISPSTSIMTFGYGAIRCPGRLIAM 225 Query: 72 MEIKFLTLVLLRHF 85 +EIK L L LL+HF Sbjct: 226 IEIKVLALTLLKHF 267 >scf/ciona01/G126/seq_dir/hrs/G126P66834F.T0/G126P66834FE9.T0.seq 741 0 741 ABI Length = 741 Plus Strand HSPs: Score = 183 (64.4 bits), Expect = 5.1e-14, P = 5.1e-14 Identities = 33/51 (64%), Positives = 43/51 (84%), Frame = +2 Query: 35 LKSRTQFSKNGKRISPSTSIMTFGYGAVRCPGRHIALMEIKFLTLVLLRHF 85 LK R++FSK+G+R++ S +IMTFG+GA RCPGRHIA++EIK L LLRHF Sbjct: 431 LKPRSRFSKHGQRVAVSRAIMTFGFGATRCPGRHIAMIEIKLAVLALLRHF 583 >scf/ciona01/G126/seq_dir/hrs/G126P66834F.T0/G126P66834FE9.T0.seq_1 741 0 741 ABI SLAX*YPSLLWWXFD**KILI**RL*GRMVSATDVNKHFCIKSLFVTFTGIGSKQPSKSE LTFFLGDLSQCKTKLSASSYG*RGRFLVRKLSRS*NSSELPFSLGLRPRSVLGVS*RSKQ RKFFGQ*RQYTVIHG*RRTILRATEASIAFQQARTESGGFAGDHDLRVRRNSLPGSAYRN DRNKTSSFSAASTFRRPICKPKRKDP*IRFISSRXWG*CPPQRTLTFSCP*NNPNIKQNS IFFKQSN >scf/ciona01/G126/seq_dir/hrs/G126P66834F.T0/G126P66834FE9.T0.seq_2 741 0 741 ABI AWRYDIHRSCGGNSTNERF*FDDGCEVEWLARPM*ISIFV*NRSL*HSQELVRNSPVNLN LLFS*ETCPSVKQSCLRVRMVSEVDF*FESYLGHKTHLNFLFP*DFVHDRFLVSADEVSS ASSLDSDVSTPSFTGDGERFFGQLKPRSRFSKHGQRVAVSRAIMTFGFGATRCPGRHIAM IEIKLAVLALLRHFDVRFANPNEKTPEFDLSHLGXGGNAPRNGH*RSRVLKTTPTLNKTP FSSNNP >scf/ciona01/G126/seq_dir/hrs/G126P66834F.T0/G126P66834FE9.T0.seq_3 741 0 741 ABI LGXMISIAPVVXIRLMKDFNLMTVVRSNG*RDRCE*AFLYKIALCNIHRNWFETAQ*I*T YFFLRRLVPV*NKVVCEFVWLARSIFSSKVISVIKLI*TSFFLRTSSTIGSWCQLTK*AA QVLWTVTSVHRHSRVTANDSSGN*SLDRVSASTDREWRFRGRS*PSGSAQLAARVGISQ* SK*N*QF*RCFDISTSDLQTQTKRPLNSIYLISVXGVMPPATDIDVLVSLKQPQH*TKLH FLQTIQ >SEQUENCE 165, 171 blue = intron 41 RMFNIDMLTRQQFLKQRARHLMVVLWAAQANTTPALFWTLFYLIANPDAKRAVLEEYEQLRR 208 (?) DFVHDRFLVSVDDTSSSCSSTDSDASSP 509 LRETMRLTGASMSIRKATRDESIKTSDGKQYSVRRGDYTAFFAPVTHMDEDIFEKPAVSFNP 700 (?) DRFLVSVDDTSSSCSSTDSDASSPYLNTDGRKFFGQLKPRSRFTKNGQRVAVSRAI MTFGYGVTRCPGRHIALIEIKLAVLAMLGHFNVQFVDSNTKPPSFDLTHLGFGVMPPDTDIEVLIAPKCC* LQW272121.y1 HEME TO END DEV18788.x1 HEME TO END LQW203971.x1 HEME DEV47938.x1 HEME DEV16150.x1 HEME GCiWno656_n17.b1 GCiWno510_n05.g1 GCiWno170_o10.g1 LQW273210.y1 260-314 2 DIFFS LQW16148.y1 274-314 LQW256475.x1 274-314 GAP K-HELIX LQW98669.x1 274-314 LQW26375.y1 274-297 >GCiWno510_n05.b1 TGCTAAGCCAGGATTCAACCGGTCAATGAAAGAGATATAGAATAACCATTCCCGATGAACATGACCGAACTTGGTGAAAT GCTTATGACTAATGAGCACGTTTACTTTCTCATTCACATATTAACTGAGCATACTTGCAGCGTACAATTCAAACGTAAAC ATTAGTCGCATTAACAAACAACGGTCATTAATATACATATATAAAATAGGGAGTAACGTTAGTGGCGGCCACATCCATGG ACCCTTTACTTTATGAATAAATAAATTGGGCTTGTACTTACGTGGGAAAACAACAGTCGTTACTACACAGGTGTTCTGTT TCTTAAACCTCGTGCCCGCTTACGAGTCACCACATATGTAACTTTATGAGTAAAAAAATTGTGTGTTTTTTATTTTTTTA ATACCGGCAACTTAAACAACCCGTAACCGCTTTGCCACATGGCGCGGATGTTTAATTTTAATATTTACAACACAGAGTTT CTTAAGCAACGGGCTCGGCACCTCATGGTCGTTCTATGGGCGGCACAGGCAAATACAACACCTGCGCTTTTTTGGACATT GTTTTATCTCATTGCGAATCCCGATGCAAAACGTGCAGTTCTTGAAGAATACGAACAACTACGTCGACAGAAAATGAAGC ATTCCTCTGTTCGCTCATAAGAAAAAGGCTGGCCAACGATGAAAGATATTCTTCAAATTGAACGGAAGGATGTANACAAA CTGGTCATACTTGGTAAATATAAAAACTCCCAATTCTCGTGCCAAGTCATACATAATGGGTGTATTGCGTGCCACGGATG GTATATATAATTTATTTCGCTTTCACACGGATGTTTGCGTGAGACATGCGTTCACTGGAGCCGGTTGAGCATAGGAAAGC CCCAGGAGATGAAGTTTTAAAACCTCGACGGTAACGTATCCTGTAGAGGGGG >GCiWno510_n05.b1_1 = seq 165 C*ARIQPVNERDIE*PFPMNMTELGEMLMTNEHVYFLIHILTEHTCSVQFKRKH*SH*QT TVINIHI*NRE*R*WRPHPWTLYFMNK*IGLVLTWENNSRYYTGVLFLKPRARLRVTTYV TL*VKKLCVFYFFNTGNLNNP*PLCHMARMFNFNIYNTEFLKQRARHLMVVLWAAQANTT PALFWTLFYLIANPDAKRAVLEEYEQLRRQKMKHSSVRS*EKGWPTMKDILQIERKDVXK LVILGKYKNSQFSCQVIHNGCIACHGWYI*FISLSHGCLRETCVHWSRLSIGKPQEMKF* NLDGNVSCRGG >GCiWno510_n05.b1_2 AKPGFNRSMKEI*NNHSR*T*PNLVKCL*LMSTFTFSFTY*LSILAAYNSNVNISRINKQ RSLIYIYKIGSNVSGGHIHGPFTL*INKLGLYLRGKTTVVTTQVFCFLNLVPAYESPHM* LYE*KNCVFFIFLIPAT*TTRNRFATWRGCLILIFTTQSFLSNGLGTSWSFYGRHR