122 Conifer P450s, 1 fungi (Pinus root induced)

99 Pinus taeda

17 Pinus pinaster

1 Pinus radiata

3 Taxus cuspidata

1 Taxus chinensis

1 Picea abies

2 Cryptomeria japonica (Japanese cedar)

 

$CYP51 bin

 

>CYP51       Pinus taeda (pine)

BF517195.1 AW984874.1 AW626637.1 BX676845 CD021313 CF394090

AW290673 BF610290.1 BX250011.1 BX250891 CD027336

N-term 71% to 51A2 arab. C-term 82% to 51A2 arab.

MDFIQNIYVQAGLLILATLVLAKIVSSILGFGSSKNLPPMVPAWPIVGGLMKFLKGPIVMLR

EEYPKLGNVFTIKLLIKNVTFLIGPEVSQHFFKAPESDLSQQEVYQFNVPTFGPGVVYDV

DYSVRQEQFRFFTESLR 536

CYP51 C-term

LXHDVLAXXDVLYRCIKEALRLHPPLIVLLRSNHRDFTVTAKDGKDYVIPKGHVVATSPAFANRLPHIFKNPDT

YDPDRFVPGREEDKVGGAFSYISFGGGRHGCLGEPFAYLQIKAIWTHLLRNFELELISP

FPEIDWNAMVVGVKDKVMVRYRRRPLSVD*

 

$CYP73 bin

 

>CYP73A20 AF096998.1 Pinus taeda trans-cinnamate 4-hydroxylase (TC4H) mRNA,

CF387404 CF390012 CF393821 CF397305 CF399964 CF402320 CF470644

CF477753 CF478231 CF478379 CF666477 AI812674 AI920132

CYP73A20 79% to 73A5

MEIMTVASLEKGLLAIFAVIVGAIFISKLKSKKLKLPPGPLAVP

IFGNWLQVGDDLNHRNLGDLAKKYGEIFLLKMGQRNLVVVSSPDLAKEVLHTQGVEFG

SRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRFAWEDELGRA

VDDIKKRPEASTTGIVIRRRLQLVMYNIMYRMMFDRRFESEDDPLFLRLKALNGERSR

LAQSFEYNYGDFIPVLRPFLRGYLKICKEVKESRLLLFKDYFIDERKKLASTTGSKVT

GDKCAIDHIFEAEEKGEINEDNVLYIVENINVAAIETTLWSMEWGLAEIVNHPEIQQK

IRAELDAVIGRGVPLTEPDTTKLPYLQAVVKETLRLHMAIPLLVPHMNLHQAKLGGYD

IPAESKILVNAWFLANNPEWWEKPEEFIPERFLGEEKIEASGNDFRFLPFGVGRRSCP

GIILALPILALALGRLVQNFELLPPPGQSKVDVTEKGGQFSLHILNHSVVVAKPIA

 

>CF474252 Well-watered loblolly pine roots WW2 Pinus taeda cDNA clone

93% to 73A20 78% TO CYP73A23 80% TO BX251949 68% TO AL751089

KCGIDHIFEAEEKGEINEDNVLYIVENINVAAIETTLWSMEWGIAEIVNSPDIQQKIRAE

LDAVIGRGVPLTEPDTTKLPYLQAVVKETMRLHMAIPLLVPHMNLDHAKLCGYDIPAESK

ILVNAWFLANNPEWWDKPEEFIPERFLGDQEKIEASGNDFRFLPFGVGRRSCPGIILALP

IVALALGRLVQNFELLPPPGQSRVDVTEKRGQFSLQILNHSVVVAKPID*

 

>AL751089   AL751089 RS Pinus pinaster cDNA clone RS05A03 similar to

           TRANS-CINNAMATE 4-HYDROXYLASE.

71% to 73A20 68% to CF474252 65% to BX251949 64% to 73A23

2   KIRDELDAVVGPGIPMTESDIVKLPYLQAVMKESLRLHITLPFVPRLNVPQTKLGGYDIP 181

182 AGTKVLVNIWWLANNPELWDNPQDFIPERFLQEGEKIEFHGNDFRFLPFGAGRRSCPGIH 361

362 MALANVALTVGRLLQNFELLPPPGKSKVDVSDKGGQFSLPILNHTLLVAKPRLPASS*

 

>CYP73A23    Pinus taeda

AI812813, AA556941, AI812771, AI812842, AI919827

CF670152 BX254757 AW042602 AW495794 BE187484.1 BE643861.1 BF609655.1

BF610527.1 BG275633.1

            sequence made from ESTs only

            missing 160 amino acids at N-terminal

            81% to 73A20 79% to 73A5

MASEVLAQGSALLEKSLIALLV

VVVGAVLVNKLRGRKLKLPPGPFALPIFGNWLQVGDDLNHRNLTDLAKKYGKIFLLKMGQ RNLVVVSAPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGDHWRKMRRIMAV

PFFTNKVVRHYRFAWEDEISRV

VADVKSRAESSTSGIVIRKRLQLMMYNIMYRMMFDRRFESEDDPLFLKLKALNGERSRLA

QSFEYNYGDFIPILRPFLRGYLRICNEIKEKRLSLFKDYFVEERKKLNSTKTSTNTGELK

CAMDHILDAQNKGEI

NEDNVLYIVENINVAAIETTLWSMEWGIAELVNHQDIQSKVRAELDAVLGPGVQITEPDT

TRLPYLQAVVKETLRLRMAIPLLVPHXNLHDAKLGGYDIPAESKILVNAWWLANNPANWK

NPEEFRPERFFEEEKHTEANGNDFKFLPFGVGRKTCPGIILALPLLALSIGR

LVQNFHLLPPPGQSKVDVTEKGGQFSLHILNHSLIVAKPIASA*

 

>BX251949 Pinus pinaster differenciating xylem adult Pinus pinaster

5 diffs to CYP73A23 in Pinus taeda (ortholog of 73A23 from Pinus taeda)

QSKGEINEDNVLYIVENINVAAIETTLWSMEWGIAELVNHQEIQSKVRAELDAVLGPGVQ

ITEPDTTRLPYLQAVVKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLAN

NPANWKNPEEFRPERFFEEEKNTEANGNDFKFLPFGVGRRSCPGIILALPLLALSIGRLV

QNFHLLPPPGQSXVDVTEKGGQFSLHILNHSLIVAKPIASAYP

 

$CYP78 bin

 

>Pinus radiata cytochrome P450 (PRE74) mRNA, complete cds.

AF049067 AA220888 AA220889 AA220898 AA220911 BM158467.1

CYP78A4 59% to 78A7

MENRRSSGGSGWWVCVLPLFTKDGPAYFLHSSSDDVSAWRQWPL

YIALLIVAVCAVLVSWLSPGGCAWAGRHKRGRVAIPGPKGWPIIGSLMDMSVGLPHRK

LESLARLHGAKQLMSFSLGCTPAVITSDPEVARELLTSPHFANRPLKQSAQQLLFGRA

IGFAPNGGYWRLLRRIASAHLFAPRRIAAHEAGRQADVVAMLDDIQKEYHSKGVVRVR

RHLQGAALNNIMGSVFGRRFDMSHENEEVKKLREMVDEGFQLLGAFNWADHLPWLRPL

DPLRIHARCARLVPRVTTFVSNIIEQHRREEQRRESGDQCDFVDVLLSLQGEDKLDEE

DMIAVLWEMIFRGTDTTALLTEWTMAELVLHPEAQKKAQAELDAVVGHDRSVKDSDIP

KLPYIQAVVKEALRMHPPGPLLSWARLSTEDVNMGDGMCVPAGTTAMVNMWSITHDPN

IWESPYEFRPERFVVFEGGEEVDVRGNDLRLAPFGAGRRVCPGKALGLATVNLWVAKL

LHHFEWLPHAEHPVDLSEVLKLSCEMARPLHCVPVTRVPFAKFSD

 

$CYP98 bin

 

>AY064170.1  UniGene info Pinus taeda p-coumarate 3-hydroxylase mRNA, complete cds

BX251037 CF668250 BX248886 CF672102 CF663747 CF668330 AA556173 BG039994.1

BG040095.1 BG039083.1 BE187393.1 AW888136.1 BG625848.1 BQ697614

CYP98A19 74% to 98A3

MSVPEMGPFGVVVTGIVAIAIVYKLVQRWRFKLPPGPRPWPVVG

NLLQIEPVRFRCFWDWSKKYGPIMSVWFGSTLNVVVSNTELAKEVLKEHDQQLADRPR

SRSAEKFSRNGQDLIWADYGPHYVKVRKVCTLELFSPKRLEALRPIREDEVAAMVESI

FNDCGKQEGIGKPLVVKRYLSGVAFNNITRPAFGKRFVNEEGKMDPQGVEFKEIVATG

LKLGASLTMAEHIPYLRWMFPLEEGAFAKHGARRDNVTKAIMEEHTLARQTSGAKQHF

VDALLTLQEKYDLSEDTIIGLLWDMITAGMDTTAITVEWAMAELVRNPRIQQKAQEEI

DRVVGRDRVMNETDFPHLPYLQCITKEALRLHPPTPLMLPHKATQNVKIGGYDIPKGS

NVHVNVWAIARDPAVWKDPVTFRPERFLEEDVDIKGHDYRLLPFGAGRRICPGAQLGI

NLVQSMLGHLLHHFVWAPPEGMQAEDIDLTENPGLVTFMAKPVQAIAIPRLPDHLYKR

QPLN

 

>Picea abies partial mRNA for cytochrome P450-like protein, (CYP81

            gene).

ACCESSION   AJ438350 59% to 98A11

REAFGSGNAEEGDLANLPYLQAVMKETMRLHPPAPLLLPHEVSETGVTLGGFSVPKGARVLI

 

$CYP725 bin

 

>AY056019.1   Taxus cuspidata taxane 13-alpha-hydroxylase mRNA,

CYP725A2 48% to 718

MDALKQLEVSPSILFVTLAVMAGIILFFRSKRHSSVKLPPGNLG

FPLVGETLQFVRSLGSSTPQQFIEERMSKFGDVFKTSIIGHPTVVLCGPAGNRLVLSN

ENKLVQMSWPSSMMKLIGEDCLGGKTGEQHRIVRAALTRFLGPQALQNHFAKMSSGIQ

RHINEKWKGKDEATVLPLVKDLVFSVASRLFFGITEEHLQEQLHNLLEVILVGSFSVP

LNIPGFSYHKAIQARATLADIMTHLIEKRRNELRAGTASENQDLLSVLLTFTDERGNS

LADKEILDNFSMLLHGSYDSTNSPLTMLIKVLASHPESYEKVAQEQFGILSTKMEGEE

IAWKDLKEMKYSWQVVQETLRMYPPIFGTFRKAITDIHYNGYTIPKGWKLLWTTYSTQ

TKEEYFKDADQFKPSRFEEEGKHVTPYTYLPFGGGMRVCPGWEFAKMETLLFLHHFVK

AFSGLKAIDPNEKLSGKPLPPLPVNGLPIKLYSRS

 

>AY188177.1   Taxus cuspidata taxane 14b-hydroxylase mRNA, complete cds

CYP725A3 49% to 718

MDVFYPLKSTVAKFNECFPAILFIVLSAVAGIVLPLLLFLRSKR

RSSVGLPPGKLGYPFIGESLLFLKALRSNTVEQFLDERVKNFGNVFKTSLIGHPTVVL

CGPAGNRLILANEEKLVQMSWPKSSMKLMGEKSITAKRGEGHMIIRSALQGFFSPGAL

QKYIGQMSKTIENHINEKWKGNDQVSVVALVGDLVFDISACLFFNINEKHERERLFEL

LEIIAVGVLAVPVDLPGFAYHRALQARSKLNAILSGLIEKRKMDLSSGLATSNQDLLS

VFLTFKDDRGNPCSDEEILDNFSGLLHGSYDTTVSAMACVFKLLSSNPECYEKVVQEQ

LGILSNKLEGDEITWKDVKSMKYTWQVVQETLRLYPSIFGSFRQAITDIHYNGYIIPK

GWKLLWTPYTTHPKEMYFSEPEKFLPSRFDQEGKLVAPYTFLPFGGGQRSCPGWEFSK

MEILLSVHHFVKTFSTFTPVDPAEIIARDSLCPLPSNGFSVKLFPRSYSLHTGNQVKKI

 

>AF545833.1   Taxus chinensis 5-alpha-taxadienol-10-beta-hydroxylase mRNA, complete

5-alpha-taxadienol-10-beta-hydroxylase"

MDSFIFLRSIGTKFGQLESSPAIISLTLAPILAIILLLLFRYNH

RSSVKLPPGKLGFPLIGETIQLLRTLRSETPQKFFDDRLKKFGPVYMTSLIGHSTVVL

CGPAGNKLALSNEDKLVEMEGPKSFMKLIGEDSIVAKRGEDHRILRTALARFLGAQAL

QNYLGRMSSEIGHHFNKKWKGKDEVKVLPLVRGLIFSIASTLFFDANDGHQQKQLHHL

LETILVGSLSVPLDFPGTRYRKGLQARLKLDEILSSLIKRRRSDLRSGIASDDQDLLS

VLLTFRDEKGNSLTDQGILDNFSAMFHASYDTTVAPMALIFKLLYSNPEYHEKVFQEQ

LEIIGNKKEGEEISWKDLKSMKYTWQAVQESLRMYPPVFGIFRKAITDIHYDGYTIPK

GWRVLCSPYTTHLREEYFPEPEKFRPSRFEDEGRHVTPYTYVPFGGGLRTCPGWEFSK

IEILLFVHHFVKNFSSYIPVDPNEKVLSDPLPPLPANGFSIKLFPRS

 

>AF318211   Taxus cuspidata 5-alpha-taxadienol-10-beta-hydroxylase mRNA, complete

CYP725A1 45% to 718

MDSFIFLRSIGTKFGQLESSPAILSLTLAPILAIILLLLFRYNH

RSSVKLPPGKLGFPLIGETIQLLRTLRSETPQKFFDDRLKKFGPVYMTSLIGHPTVVL

CGPAGNKLVLSNEDKLVEMEGPKSFMKLIGEDSIVAKRGEDHRILRTALARFLGAQAL

QNYLGRMSSEIGHHFNEKWKGKDEVKVLPLVRGLIFSIASTLFFDVNDGHQQKQLHHL

LETILVGSLSVPLDFPGTRYRKGLQARLKLDEILSSLIKRRRRDLRSGIASDDQDLLS

VLLTFRDEKGNSLTDQGILDNFSAMFHASYDTTVAPMALIFKLLYSNPEYHEKVFQEQ

LEIIGNKKEGEEISWKDLKSMKYTWQAVQESLRMYPPVFGIFRKAITDIHYDGYTIPK

GWRVLCSPYTTHLREEYFPEPEEFRPSRFEDEGRHVTPYTYVPFGGGLRTCPGWEFSK

IEILLFVHHFVKNFSSYIPVDPNEKVLSDPLPPLPANGFSIKLFPRS

 

$CYP71 bin

 

>CF397580 Drought-stressed loblolly pine roots DS3 Pinus taeda cDNA clone

CF393834 CF397258 CF398277 CF399002 CF399517 CF472070 CF475340 CF666506 CF668475

CF663405 CF390647 CF664544 CF472140 CF399053 CF399084 CF388981 CF395197 CF395240

94% to CF396181 94% TO CF398971 70% CF670928 62% TO CF672363

45% to 71A1, low 40% range with other CYP71 subfams 43% to 75B1 42% to 92A1

MAFHHLCESLALPATFTVADGGPPAATVLCLLWSFFMIWFLRKRRTSATL

PPGPYAWPIIGNLHQLVLPAHRSLRGLADKYGPILFLRLGSVPTVVVSSSETAKEFLKTH

DLIFASRPPTAAGRLMFSNSKDVVFAPYGDHWRQMRKICVLELLTAKRIESFKSVREEEV

SAMISSIWEESEKGKMGVNVSKAVSTLTSNIVWRILAGRKFSDDDLGGDFQGFKG

LMTELTATVGEFNIGDFIPYLDWLDLQGIKRRMKKIHKTFDEFAEKIIDDH

VNVNHLQKEAVDAEPHVQDFVDVLLHMAKANTKITRETIKAVVLDLFGAGLDRISISLE

WAMSELLRHPRAMKKIKEEIESVVGQHWKVKESDLANMKYLHCVVKETLRLYPAAPLAIP

HESAETVTVGGYSIPKKTMLMVNVWAIGRDPKVWGADASEFKPERFMEDEHVNVTYPSNF

NMIPFGAGRRGCPGASMAIPTVQLALAQLLHTFDWRVDGDPSQLDMKEACGLTIPRKVPL

SAFPKLSSSFPI*

 

>CF477451  UniGene info RTWW3_7_C08.g1_A022 Well-watered loblolly pine roots WW3 Pinus

           taeda cDNA clone RTWW3_7_C08_A022 5'.

          Length = 683

96% to CF397580

30  QGFKGLMTELTATVGEFNIGDFIPYLDCLDLQGIKRRMKKIHKTFDEFAEKIIDDHVNVN 209

210 HLQKEAVDADPHVQDFVDVLLHMAKADTKITRETIKAVVLDLFGAGLDRISISLEWAM 383

384 SELLRHPRAMKKLKEEIGSVVGQHWKVKESDLANMKYLHCVVKETLRLYPAAPLAIPHES 563

564 AETVTVGGYFIPKKTMLMVNVWAIGRDPKVWGSDASEFKP 683

 

>CF669910  UniGene info RTCNT1_46_G07.g1_A029 Root control Pinus taeda cDNA clone

           RTCNT1_46_G07_A029 5'.

          Length = 784

97% to CF397580 96% to CF396958

3   RQMRKICVLELLTAKRIESFKSVREEEVSAMISSIWEESEKGKMGVNVSKAVSTLTSNIV 182

183 WRILAGRKFSDDDLGGDFQGFKGLMTELTATVGEFNIGDFIPYLDCLDLQGIKRRMK 353

354 KIHKTFDEFAEKIINDHVNVNHLQKEAVDADPHVQDFVDVLLHMAKADTKITRETIKA 527

528 VVLDLFGAGLDRISISLEWAMSELLRHPRAMKKLKEEIGSVVGQHWKVKESDLANMKYLH 707

708 CVVKETLRLYPAAPLAIPHES 770

 

>BX680860   BX680860 RS Pinus pinaster cDNA clone RS49H02.

          Length = 598

94% to CF397580 95% to CF396181 94% to CF396958

71  GRVNIGDFIPYLDWLDLQGIKRRMKKIHKTFDEFAEKIIDDHVNVNHLQKEAVDAEPHVQ 250

251 DFVDVLLHMAKADTKMTRETIKAVVLDLFGAGLDRISISLEWAMSELLRHPRAMKKLK 424

425 EEIESVVGQHWKVRESDLASMKYLHCVVKETLRLYPAAPLAIPHESAETVTVGGYFIP 598

 

>CF396958 Drought-stressed loblolly pine roots DS2 Pinus taeda cDNA clone

CF470773

96% TO CF397580

MAFHSLCASLALPATFTVADGGPPAATVLCLLWSFFMICFLRKRRTSASL

PPGPYAWPIIGNLHQLILPAHRSLRRLADKYGPILFLRLGSVPTLVVSSSETAKEFLKTH

DLIFASRPPTAAGRLMFSNSKDVVFAPYGDHWRQMRKICVLELLTAKRIESFKSVREEEV

SAMISSIWEESEKGKMGVNVSKAVATLTSNIVWRILAGRKFSDDDLGG

DFQGFKGLMTELTATVGEFNIGDFIPYLDWLDLQGIKRR

MKKIHKTFDEFAEKIIDDHVNVNHLQKDAVDAEPHVQDFVDVLLHMAKADIKITRETIKA

VVLDLFGAGLD

 

>AL750435   AL750435 RN Pinus pinaster cDNA clone

          Length = 581

CF669880

95% to CF397580

QGFKGLMTELTATVGEFNIGDFIPYLDCLDLQGIKRRMKKIHKTFDEFAEKIIDDHVNVN

HLQKEAVDADPHVQDFVDVLLHMAKADTKITRETIKAVVLDLFGAGLDRISISLEWAM

SELLRHPRAMKKLKEEIESVVGQHWKVKESDLANMKYLHCVVKETLRLYPAAPLAIPHESAETVTVGG

YFIPKKTMLMVNVWAIGRDPKVWGADASEFKPERFMEDEHVNVTDPSNFNMIPFGAGRRG

CPGASMAIPTVHLALAQLLHTFDWRVDGDPFHLDMKEACGLTIPRKVPLSAFPKLSSSXP

M*

 

>BX677571   BX677571 RN Pinus pinaster cDNA clone RN41D01.

          Length = 515

97% to CF396181 97% to AL750435

3   DVLLHMAKADTKITRETIKAVVLDLFGAGLDRISISLEWAMSELLRHPRAMKKLKEEI 176

177 ESVVGQHCKVMESDLANMKYLHCVVKETLRLYPAAPLAIPHESAQTVTVGGYFIPKKTML 356

357 MVNVWAIGRDPKVWGADASEFKPERFMEDEHVNVTDPSNFNMIPFGAGRRGCP 515

 

>CF397603 Drought-stressed loblolly pine roots DS3 Pinus taeda cDNA clone

CF391212 (4 Diffs) CF396553

96% TO CF397580 47% to 92A9 MAY BE N-TERM OF CF396181

GFPNLRQSLAFPATLTVADGGPPAATVLCLLWSFFMIWFLRKRRTSARLPPGPYAWPVIGNLPQLIL

PAHRSLRGLADKYGPILFLRLGSVPTVVVSSSETAKEFLKTHDLIFASRPRTAAGRLMFS

NSKDVVFAPYGDHWRQMRKICVLELLTAKRIESFKSVREEEVSAMISSIWDESEKGKMGV

NVSKAVSTLTSNIVWRILAGRKFSDDDLGGDFKGFKGLMTELTATVGEFNIGDFIPYLDW

LDLQGIKRRMKKIIK

 

>CF396181 Drought-stressed loblolly pine roots DS2 Pinus taeda cDNA clone

CF396137 CF398971 CF398326 CF397839

94% TO CF397580 62% to CF672363 74% TO CF670928

    IGDFIPYLDWLDLQGIKRRMKKIHKTFDEFAEKIIDDHVNVNHLQKDAVDAEPHVQDFVDVLLHMAKADIK

89  ITRETIKAVVLDLFGAGLDRISISLEWAMSELLRHPRAMKKLKEEIELVVGQHCKVMESD 268

269 LANMKYLHCVVKETLRLYPAAPLAIPHESAETVTVGGYFIPKKTMLMVNVWAIGRDPKVW 448

449 GADASEFKPERFMEDEHVSLTDPSNFNMIPFGAGRRGCPGASMAIPTVQLALAQLLHTF 625

626 DWRVDGDPSQLDMEEACGLTIPRKVPLSAFPKLSSSFR

 

>CF399241  UniGene info RTDS3_27_C09.g1_A022 Drought-stressed loblolly pine roots DS3 Pinus

           taeda cDNA clone RTDS3_27_C09_A022 5'.

          Length = 759

same as CF396181

28  VGEFNIGDFIPYLDWLDLQGIKRRMKKIHKTFDEFAEKIIDDHVNVNHLQKDAVDAEPHV 207

208 QDFVDVLLHMAKADIKITRETIKAVVLDLFGAGLDRISISLEWAMSELLRHPRAMKKL 381

382 KEEIELVVGQHCKVMESDLANMKYLHCVVKETLRLYPAAPLAIPHESAETVTVGGYFIPK 561

562 KTMLMVNVWAIGRDPKVWGADASEF

636 QPERFMEDEHVSLTDPSNFNMIPFGAGRRGCPGASMAIPTV 758

 

>CF672363  UniGene info RTCNT1_63_B12.b1_A029 Root control Pinus taeda cDNA clone

CF663367

64% TO CF670928 63% TO CF397580 62% TO CF398971 62% TO CF396181 51% to CF397949

QETVKSIMFDILIAGMETSASTLEWTMSELLRHPHVLKKLQEEIESTVGKRGKVNGSDVR

RMKFLQCVVKETLRLHPPVPLALPHESVETASVCGYNIPKRTTVMVNVWAIGRDPNVWGV

DALDFKPERFMHELGEHDNIMDLVTGQSDFRMLPFSAGRRGCPGATMAIPMIELALAQLL

HSFDWRVDGDPSELDMTEEAGASISRQVPLFAFPKVRREGL*

 

>CF663285  UniGene info RTCNT1_2_A02.b1_A029 Root control Pinus taeda cDNA clone

           RTCNT1_2_A02_A029 3'.

          Length = 686

2 diffs to CF672363

3   EWTMSELLRHPHVLKKLQEEIESTVRKRGKVNGSDVRRMKFLQCVVKETLRLHPPVPLAL 182

183 PHESVETATVCGYNIPKRTTVMVNVWAIGRDPNVWGVDALDFKPERFMHELGEHDNIMDL 362

363 VTGQSDFRMLPFSAGRRGCPGATMAIPMIELALAQLLHSFDWRVDGDPSELDMTEEAGAS 542

543 ISRQVPLFAFPKVR 584

 

>CF399874  UniGene info RTWW1_1_B05.g1_A015 Well-watered loblolly pine roots WW1 Pinus

           taeda cDNA clone RTWW1_1_B05_A015 5'.

          Length = 709

93% to CF672363

705 ETSASTLEWTMSELLRHPHVLKKLQQEIESTVGKRGKVNGSDVGRMKFLQCVVKETLRLH 526

525 PPVPLELPHESVETASVCGYNIPKKPPVMVNVWAIGRDPNVWGVDALDFKPERFMHELGE 346

345 HDNIMDLVTGQSDFRMLPFSAGRRGCPGTTMAIPMIELALA*LLHSFDWRVDGDPSELDM 166

165 TEEVGLSVSRHFPLFAFPRVR 103

 

>CF670928  UniGene info RTCNT1_53_B09.g1_A029 Root control Pinus taeda cDNA clone

CF663543 CF671055

74% to CF396181 70% TO CF397580 72% TO CF398971 64% TO CF672363

    WLDLQGLKGRMNKIHKAFDEFAEKIIDDHVGHRMAASHQKDEEPHVKDFVDVLLEKAEADSK

31  ITRETMKALVLDMFVAAVDTVSTTLEWAMSELLRHPHAMKSLQEEIECIVGKHRQVIESD 210

211 VVRMKYLHCLVKETLRLHPAGPLGIPHESVEAVTAGGYHIPKKTMVMVNVWAIGRDPSVW 390

391 GADASEFKPERFMEEEHVNLADQSDFRMIPFGAGRRGCPGVPMAIPTIELALAQLMHV 564

565 FDWTVEGDPSLLDMTELGGLIMPRQVPLCAYPGLRAGLPL*

 

>CF479211  UniGene info RTWW3_24_D10.g1_A022 Well-watered loblolly pine roots WW3 Pinus

           taeda cDNA clone RTWW3_24_D10_A022 5'.

          Length = 681

4 diffs to CF670928

2   MGAFNMGVFIPYLDWLDLQGLKGRMNKIHKAFDEFAEKIIDDHVGHRMAASHQKDEEPHV 181

182 KDFVDVLLEKAEADSKITRETMKALVLDMLVAAVDTLSTTLEWAMSELLRHPHAMKSL 355

356 QEEIECIVGKHRQVIESDVVRMKYLHCVVKETLRLYPAGPLGIPHESVEAVTAGGYHIPK 535

536 KTMVMVNVWAIGRDPSVWGADASEFKPERFMEXEHVNLADQSDFRMIP 679

 

>CF475194  UniGene info RTWW2_14_D08.g1_A021 Well-watered loblolly pine roots WW2 Pinus

           taeda cDNA clone RTWW2_14_D08_A021 5'.

          Length = 776

74% to CF670928

2   PHVMNSLQEEIECVVGKDRKVNESDVASMKYLHCVVKETLRLYPPVAIAIPHESVEAVTV 181

182 GGYYIPKKTTLIANLWAIGRDPNVWGLDASEYKPERFMKDEHVNSTDQSDFSMIPFS 352

353 AGRRGCPGAPMAIPTIELTLTQLLHIFNWRVEGDPSQLDMTEVSGASIPRQVPLFAYPTL 532

533 RVS 541

 

>CF389966  UniGene info RTDR2_11_E07.g1_A021 Loblolly pine roots recovering from drought

           DR2 Pinus taeda cDNA clone RTDR2_11_E07_A021 5'.

          Length = 718

71% to CF670928

3   ETTAITLVWAMSELLRHPHAMKRLQEEIECRVGKHRKVKESDVVSMKYLHSVVRETLRLY 182

183 PAGPLGFPHESAEAVTVGEYHIPKKAMLIVNVWAIGRDPNVWGKDASEFKPERFMEELVG 362

363 HNDYMDVTNTQDFRMLPFGAGRRGCPGAPMAIPTIFLTLAQLVHIFNWRVEGDPSQLDMK 542

543 EAHSMSMPREIPLFAFPSLRL 605

 

$CYP76 like seqs. part of 71 clan

 

>CF667935  UniGene info RTCNT1_33_A02.g1_A029 Root control Pinus taeda cDNA clone

CF672051

64% to CF667376 59% to 76H6 60% to 76C4

5   DFLDMLLEYKSESGETF

56  TKKDIIPFLYDMFVAGSETSSATIEWAMAEAIRNPRIMKKAQAELDEVIGTGRRVEETDI 235

236 DRLPYLHAVVKETFRLHPPAPLLIPHRAESSCEVAGYMIPKDTQLLVNAWAIGRDPTIWD 415

416 EPTKFKPERFVESEMEYRGQNFELIPFGAGRRICPGLPLAHRMVHVVTASLLHSFNWS 589

590 LPDGITTDTMDMSERFGITLQRASPLIAIPSLRLPSHLXNDQHH*

 

>BX784158   BX784158 Pinus pinaster differenciating xylem adult Pinus pinaster

           cDNA clone 130A02.

          Length = 679

81% to CF667935

2   LDEVIGKDRKFEESDIDRLPYLHALVREVFRLHPPTPLMIPHRAESSCEVAGYMIPKSTK 181

182 VLVNAWAIGRDPTIWNEPFEFKPERFMECDIEYKGQNFELIPFGAGRRICPGLPL 346

347 AHRMVHLVTASLLHSFNWSLPDGTTPGDMDMTEKFGITLQKALPLIAIPSPRLRSHLFNDRQH*

 

>CF667376  UniGene info RTCNT1_29_G09.g1_A029 Root control Pinus taeda cDNA clone

64% to CF667935

    RSDEFTRTDIRGYLTDIFGAGTDTTTTTIEWAMAELIRNPKIMKRAQKELDDVIGRKRKVEESDTERLP 208

209 YLRAVVKEVFRFHPTVPLLVPHKAESRCEVGGFVIPKNSQLLVNVWAIGRDPTLWDEPTI 388

389 FMPERFMCDDKSDMEYRGQHFELIPFGAGRRMCVGLPLASRMVHLVLASLIHSFDWAPPN 568

569 GVNAEKIDMTDKFGLTLKKAVPLYAIPTPRLLSDMYY*

 

>CF668595  UniGene info RTCNT1_37_B03.g1_A029 Root control Pinus taeda cDNA clone

           RTCNT1_37_B03_A029 5'.

          Length = 767

91% to CF667376 47% to 76C2

25  GKCVDIGHILFQSAVNLLCNMAFGKGGFDLHSQAVEELKDTGTKLMELCGIPNIAD 192

193 FFPFLQFLDPQGISRDAKFYMGKKYAIIDKFINERLAIRGKGSDRSDDSEKDLMDVLLDM 372

373 RSDEFTLTDIRGYLTDIFAAGTDTTTTTIEWAMAELIRNPEIMKRAQNELDDVVGC 540

541 NRKVEESDTERLPYLHAVVKEVFRFHPTVPLLLPHKADSRCEVGGFVIPKNSQILVNVWA 720

721 IGRDPTLWDE 750

 

 

 

$CYP72 like bin

 

>CF672377  UniGene info RTCNT1_63_D07.b1_A029 Root control Pinus taeda cDNA clone

           RTCNT1_63_D07_A029 3'.

          Length = 782

 

57% to 72A32

311 VGMILHEALRLYPPVSGLQRQACKPMKLGRLSIPAGTHLFLPILAIHHDQSLWGNDANEF 490

491 NPARFSEGIAKAVKHPLAFMPFGFGPRVCVGQNFALLEAKVVLAMILQQFSFVTSPSYAH 670

671 APGIFLTTRPQHGAQVILHMN*

 

>BX252588   BX252588 Pinus pinaster differenciating xylem adult Pinus pinaster

           cDNA clone PP066H04.

          Length = 407

53% to 72A13

AAASNHQLAFLPFSSGPRVCLGQNFAVLEAKLAISIILKNFKFTFSPSYRHAPVAFVTIN

PQHGMPIIIERVHSC*

 

 

$CYP74 like bin

 

>BX249417   BX249417 Pinus pinaster cDNA clone PP023G09.

BF049706

          Length = 675

62% to 74A1 arab.

MALAVMVGPPPPTAMPDRSRFPVQIFPTSRAPRR

QKGAMFAIRASISEKRATQPASPPIDQDAREIPGTYGLPFIGHIRDRQDFFRNRDEFFKS

RMEKYGSTVYRVNMPPGPPLFPDPRVIMLLDAKSFPVLFDTNRVEKKDLFAGTFMPSTDF

TGGYRTLSYLDPSEEKHAQLKNFCFEVLRMNRDRWIPEFSKAAS

 

>BX248874 Pinus pinaster cDNA clone PP002B03.

          Length = 661

54% to 74A1 arab.

2   EITIHSVPLPYGLIKKDFERIQGFFFTHGTRALNSAQKFGLTRDEANHNLIFNICFNTW 178

179 GGMTILFPAIVRLIARAGPQLHKDLAEEVRAAVRDADAGGQITMRALENMPLVQSTVY 352

353 EVMRLEPPVPYQYGRAKENFVLESHDGCFKVRKGELLGGYQPFATRDPKVFVDDPEEFKP 532

533 RRFMGEKGQDLLRYVVWSNGPXNRSPTVXHKQCAXXDFVLMIA 661

 

>CF479695 loblolly pine roots WW3 Pinus taeda cDNA clone

          Length = 684

56% to 74A1 arab. 54% to 74A4 rice 57% to BX248874

3   GLNREEACNNLVFYISFNAFGGLRVFFTNMVKYVARAGVELHRDLAEEVRAAVEAHGG 176

177 LTGRALESMALVRSTAYEVLRIDPPVPLQYGRAKKDFFIESHDGRYAVKKGEMLCGYQ 350

351 PFATRDPEVFTRAEEFVPRRFMGEDGQKMLKHLLWSNGRETDETSADNKQCAGQRDVVVS 530

531 MAHLFLAHFFLRYDSFAIAQSSSSSSSVTFTMLTKGSS*

 

>AL750722   AL750722 RN Pinus pinaster cDNA clone RN06F01 similar to ALLENE

           OXIDE SYNTHASE.

          Length = 660

61% to 74A1 arab 74% to CF479695 57% to BX248874 at least 3 seqs.

2   MLAGYQPFATKDPKVFDKAEEFVPRRFIGEKGEKMLKYVLWSNGYETDETSTDNKQCAGK 181

182 DIVVLVARLFVAHLFLRYNSFSIDQSSSSVTITTLKKA 295

 

 

 

CYP710 like bin

 

BX667594   BX667594 RN Pinus pinaster cDNA clone RN09H09.

          Length = 603

42% to 710A1

5   PGFAFYKARHAVSRLAKTLAGCAHESKKMMENGEEPACLVDFWMAETVNEIKEAERTDAR 184

185 RPPHSDDIEIGGYIFDFLFGGPKFALNSPWWGAIP*WDSTPEILENVQRRNGEDSGPILL 364

365 RPISSQNKFERLEYTEMVSK 424

 

 

 

 

 

 

$CF473014 bin CYP92 like part of CYP71 clan

 

>CF473014 Drought-stressed loblolly pine roots DS1 Pinus taeda cDNA clone

CF471340 CF471821 CF477457(5 diffs) CF394615 AW010433 (4 diffs)

77% to CF470703 77% TO CF398607 62% TO CF397949 61% TO BX677300

46% to 92A8 42% to 84A4

    TTELGFLQRSVSESGEVYAKFATALLFVVLAAVWSFFSCGRKGRLPPGPFPLPIIGNLHM

    LGKLPHRALAALSKKYGPLMSLRFGSALILVVSSPEMAREFLKTHDELFAYKCWSATSKQ

    LSFNFTDIIYSPYKVYWMQMR

    KLCAMEMLNSRRLDNSRFIREDEVSAMIRSIVNSDAHKDSRPVNIKQLASSLVTAIVLRM

    TFGKKYSDRDSGAFSSMIKESLLLLGSFNIGEY

    IPYLNWMDLQGLNRRLKKLRTTQDQLLEKVIEEHAAQNRSNMTHDLVDALLAASADKDRELQ

655 ISRDGVKGILFDILLGGLETAPTMIEWAMAEALRNPPVMKTLQDELERVVGLGRMVCESD 476

475 LPQLVYLQAMVKETLRLHPGGPFLWRCLSAESCNILGYEIPKNTGVIVNLWAIRRDPKSW 296

295 EDAETFKPERFMERVGSEVDANGNQNLGWLAFGTGRRRCPGEQLGMLALELXVAQLLHCF 116

115 NWRLPFDDMNGKNQEMEMTEKHNGFTLPKADELCAIPT

 

>CF389799  UniGene info RTDR2_5_D03.g1_A021 Loblolly pine roots recovering from drought DR2

           Pinus taeda cDNA clone RTDR2_5_D03_A021 5'.

          Length = 725

3 diffs to CF473014

16  SDRDSGAFSSMIKESLLLLGSFNIGEYIPYLNWMDLQGLNRRLKKLRTTQDQLLEKVIEE 195

196 HAAQNRSNMTHDLVDALLAASADKDRELQISRDGVKGILFDILLGGLETAPTMIEW 363

364 AMAEALRNPPVMKKLQDELERVVGLGRMVCESDLPQLVYLQAMVKETLRLHPGGPFLWRC 543

544 LSAESCNILGYEIPQNTGVIVNLWAIGRDPKSWEDAETFKPERFMERVGS 693

 

>CF397949 Drought-stressed loblolly pine roots DS3 Pinus taeda cDNA clone

73% to BX677300 66% to CF470703 62% to CF473014 47% to 71A11

    SIQDEFLEKVIEEHVAQNDPNAERDLVDVLLAASADKDMQPQ

127 ITRDNIKAILYDMLAGGTDTSSTTMEWAMSELLRNPPVLKKVQDELERVVGKGRMVRESD 306

307 LPSLPYLQAVVKETLRLHAASPLSLPHVSVEDCTVLGYEIPKNTIVLVNIWAIGRYPTSW 486

487 EDAERFMPERFMNGFSLDQKIRNFEWIPFGGGRRGCPGEELGILLIEFSLAQLLHCFDW 663

664 TLPDKMNGQELDMSE

 

>CF664461  UniGene info RTCNT1_9_H07.g1_A029 Root control Pinus taeda cDNA clone

           RTCNT1_9_H07_A029 5'.

          Length = 702

82% to CF397949

7   DELLEKVIEEHVAQSDPNVTRDLVDVLLAASADKDMEPQITRDNIKAILYDMLGAG 174

175 TDTSSTTIQWAMSELLRNPPLLKKVQDELERVVGMERMVLESDLPSLPYLQAVVRETLRL 354

355 YPSAPXX 369

377 LPHLSVEACNVLGYEIPKNTQVLVNLWAIGRNPTSWEDAERFVPERFMNGCSLDEKVR 550

551 NCEWIPFGAGRRVCPGEQLAMLLVQFPLAQLLHCFYWTLPDNMNGQEL 694

 

>CF470703 Drought-stressed loblolly pine roots DS1 Pinus taeda cDNA

CF470768 CF471612 CF667212 CF471554

low 40% range to 71 subfams

78% to CF398607 77% to CF473014 66% to CF397949 64% to BX677300

GSQQPCVSYSVVNLYVKLATAFVFVVLATVWSVFSRVTKGKLPAGPFPLPIIGNLHMLGK

LPHRALAALSMKHGPLMSLRLGSSLTLVVSSPEIAREFLKTHDQVFANKGPSAAAKHLSF

NFADIIFSPYRPYWAQMRKLCTLELLSSKRLDGFRFIREDEVFAMIRSIINSDAYKGCRP

LNINKTVASLATAVICRMAFSKRYSDQDSRAFNSMVKESLLLLGTFNVGDY

IPYMAWMDLQGLNRRMKKLHTTQDQLLEKVIEEHVAQNGTNTTHDLVDVLLAASTDRDREFQ

ISRDSIKGILFDMLLGGSDTAPTIIEWAMSEALINPPVMKKLQDELERVVGLDRMACESD

LPQLVYLQAMVKETLRLHPAGPLLNRRLSAESCNVLGYEFPKNTRVLVNAWAIGRNPKLW

EDAETFKPERFMGRVGSEVDANGDQNFAWLAFGAGRRTCPGRQLGTLLVQFALAQLFHCF

NWSLPLDDMNGKKQELDMSERFNGITLPKAHELLAIATPRLECIGHLK*

 

>CF398607 Drought-stressed loblolly pine roots DS3 Pinus taeda cDNA clone

CF398769

78% to CF470703 77% TO CF473014 47% TO 76H3

2   MIEWAMSEALRNPAVMKKLQDELERVVGLERMVRESDLPQLVYLQAMVKETLRLHPAGPF 181

182 LNRRLTAKSCNVMGYDIPHNTCVIFNLWAIGRNPNTWEDAECFKPERFTERVGSEIDANG 361

362 DQNFGWLPFGAGRRRCPGQQLATLLVELGVAQLLHCFNWRIPLDDMNGANQELDMTERFN

    GLTLPKVHELRAIPTPRLNALPTSNRTSFQ*

 

>BX677300   BX677300 RN Pinus pinaster cDNA clone RN20B10.

AL750799

73% to CF397949 64% to CF470703 61% to CF473014  52% to 75A11 52% to 71A11

 3  ELQITRDNIKAVLYDMLAAGTDTSSAGIEWAMSELLRNPLVLNKLQDELQRVVGLERMVRESD 191

192 LPRLPYLQAVVRETLRLHPPGPLAIPHNSIDACKVLGYEIPRNTHVFVNIWAIGRNPKSW 371

372 EDPERFVPERFMHGDCLDDRIKNFEWMPFGAGRRRCPGELLGTLLVEFAVAQLVHCFNW 548

549 RLPDDMTGE

 

 

$CF386061 bin CYP75 like part of 71 clan

 

>CF386061  UniGene info RTDR1_8_D11.b1_A015 Loblolly pine Pinus taeda cDNA clone

          Length = 725

CF386988 CF388779 CF387112 CF386770 (5 diffs) CF400183 CF402294 CF472528

CF665533 CF665452 CF663159 CF472625 CF400297 CF402134 CF387701 CF386892

46% to 75B1 47% to 75B3 63% to CF664732

MVSLNLNEFMLWFLSWLALFIGFRYVLRSNLKLKKRRFPPGPSGWPVVGSLPLLGKMPHVTLYNMYKKYGPI

VYLKLGTSDMVVASTPAAAKAFLKTLDINFSNRPGNAGATYIAYDSQDMVWAAYGGRWKM

ERKVCNMHMLGGKALEDWQPVRDAEMGFMLRNILSHSQRGETVNVPDLLNICAANMIGQI

ILSKRVFETEGDEANEFKDMVVELMTCAGYFNIGDFIPSLAWM

DLQGIQRGMKKLHKKW DALIQRMIDEHQSTAKQRASKPDFLDIVMSQRDNCDGQGGRLSD

VHIKALLLNLFTAGTDTSSSVIEWTLAEVMNNPKLLKRVHEEMDAVIGRERRLKESDLANLPYF

VAVCKEGFRKHPSTPLSLPRVST

EACEVNGHYIPKNTRLMVNIWGIGRDPEVWEKPDEFNPNRFVGSKIDPRGNDFELIPFGA

GRRICAGTRMGITMVEYNLGSLIHAFDW

AVPPNQEGLNMDEAFGLALQKAVPLVAKATPRLPLHLY*

 

>CF388987  UniGene info RTDR2_16_B02.g1_A021 Loblolly pine roots recovering from drought

           DR2 Pinus taeda cDNA clone RTDR2_16_B02_A021 5'.

          Length = 654

97% to CF386061 97% to CF389444 97% to CF665533

30  EANEFKDMVVELMTCAGYFNIGDFIPSVAWMDLQGIQRGMKKLHKKWDALIQRMIDEHQS 209

210 TVKQRASKPDFLDIVMSQRDNCDGQGGRLSNVHIKALLLNLFTAGTDTSSSVIEW 374

375 TLAEVMNNPKLLKRVHEEMDAVIGRERRLKESDLANLPYFVAVCKEGFRKHPSTPLSLPR 554

555 VSTEACEVDGYYIPKNTRLMVNIWGIGRDPEVW 653

 

>CF389444 Pinus taeda cDNA clone

CF400152 CF401062 CF474754 CF475076 CF475411 CF387731

96% to CF386061 6 diffs

51  DALIQRMIDEHQSTAKQRASKPDFLDVVMSQRDNC

25  DGQGGRLSDVHIKALLLNLFTAGTDTSSSVVEWTLAEVMNNPKLLKRVHEEMDAVIGRER 204

205 RLKESDLANLPYFVAVCKEGFRKHPSTPLSLPRVSTEACEVDGYYIPKNTRLMVNIW 375

376 GIGRDPEVWEKPEEFNPDRFVGSKIDPRGNDFELIPFGAGRRICAGTRMGITMVEYNLGS 555

556 LIHAFDWDVPPNQEGLNMDEAFGLALQKAVPLVAKVSPRLPLHLY* 579

 

>CF385271 Loblolly pine roots recovering from drought DR1 Pinus taeda cDNA clone

96% to CF387112 8 diffs in N-term 50 aa 94% to CF386061

WFLSCLALYIGFRYVLRSRLKLKKRQLPPGPPGWPLVGSLPLLGAMPHVTLYNMYKKYGP

IVYLKLGTSDMVVASTPAAAKAFLKTLDINFSNRPGNAGATYIAYDSQDMVWAAYGGRWK

MERKVCNMHMLGGKALEDWQPVRDAEMGFMLRNILSHSQRGETVNVPDLLNICAANMIGQ

IILSKRVFETEGDEANEFKDMVVELMTCAGYFNIGDFIPSLAWMDLQGIQ

 

>CF390685 Loblolly pine roots recovering from drought DR2 Pinus taeda cDNA

CF394958 CF388973 CF477876 CF386135 CF387703 CF672937 CF479071

71% to CF671978 76% TO CF391927 74% TO CF400021 55% TO CF667935

60% to CF386061 57% to 75B3 58% to 75B1

GSRWRMLCKVCNVHLFAGKALDDVQPVREAEVGLMLKSILEHEKQGKAVNLGELLNVCTA 184

185 NVLGQIMLSKRVFESQGAKASEF

    REMVVELMVLAGVFNIGDFVPSLAWMDLQGVQKKMKNLHNRFDQFFSRILEEHKAEA

10  RNGRGKNDFLSVLLSLRNDADGEGGKLTDTDMKAL

LLDLFTAGTDTSASTVEWAIAELIRHPKMMKRLQEEIDSVVGRDRRRLKETDIPKLPYLQAVVKETFRLHPSTP

LLLPRLAAEACEVEGYYIPKNARLLVNAWGIQRDPDVWERPLEFDPERFAGSAVDVRGTD

FEVIPFGAGRRVCAGVSMGIRMVQLMLASLLHSCDWSLPEGQLPENLDMAEAYGLTLQKA

VPLLAAPVARLPHHLYN*

 

>BX681107   BX681107 RS Pinus pinaster cDNA clone RS53F02.

          Length = 554

96% to CF390685 (6 diffs)

34  VNIGDFVPSLAWMDLQGVQKKMKNLHSRFDKFFSRILEEHKAEARNGGGKNDFLSVL 204

205 LSLRNDADGEGGKLTDTDMKALLLDLFTAGTDTSASTVEWAIAELIRHPKMLKRLQEE 378

379 MDSVVGRDRRRIKETDIPKLPYLQAVVKETFRLHPSTPLLLPRLAAEACEVEGYYIP 549

 

>CF391927 Loblolly pine roots recovering from drought DR3 Pinus taeda cDNA clone

93% to CF671978 80% TO CF400021 76% TO CF390685 72% TO AJ309081.1

811 NAGTDTTSITVEWAIAELIRHPNIMKRCQEEIESAVKGEKRKVKESDLRNLPYLQAVVKET 629

628 LRLHPSVPLLVPRMAVEACEIEGYYIPKNARLVVNAWGMHRDPGVWERPLEFDPDRFI 455

454 GSSVDVRGSDFQLIPFGAGRRICAGMSMGIRMVQLMLATLLHSFDLSLPNGQTP 293

292 ETLDMAESSGLTLRKAAPLLVVPAARIPFHLY*

 

>CF671978  UniGene info RTCNT1_60_B07.g1_A029 Root control Pinus taeda cDNA clone

CF475485 CF475538

93% TO CF391927 71% TO CF390685 79% TO CF400021  59% to 75B3

    WMDPQGVRTKMKKLHIRVDAFISKMI

  3 NEHQTSSCNGVKADFLSILLPLRNDADSEEGKLTFDDIKGL

126 LLTMFNAGTDTSSITVEWAIAELIRHPNIMKRCQEEIESAVKGEQRKLEESDLRNLPYLQ 305

306 AVVKETLRLHPSVPLLLPRMTVEACEIEGYYVPKNARLMVNAWGMQRDPGVWERPLEFDP 485

486 DRFIGSSVDVRGSDFQIIPFGAGRRICAGMSMGIRMVQLMLATLLHSFDLSLPNGQPP 659

    EALDMAESFGLTLRKAAPLLVVPAARIPIHLYK*

 

>CF400021 Well-watered loblolly pine roots WW1 Pinus taeda cDNA clone

89% to CF391927 79% TO CF671978 74% TO CF390685 71% TO AJ309081

1   EWTVAELIRHPKMMRRCQEELDSAMKGEERRIKESDLQNLPYLQAVVKETLRLHPPFPLLA 183

184 PRMAAEACEIEGYYIPKNARLIVNAWGMQRDPDVWERPLDFDPDRFIGSSVDVRG 348

349 SDFQLIPFGAGRRICAGMSMGLRIIQLMLATLLQSFDL 462

    CLPDGQSPEKLDMAEAFGLTIHKEVPLLAVPTARRPFHLYD*

 

>CF664732 Pinus taeda cDNA clone

CF387606 CF388012

53% to 75B1 62% to CF386061

LGFGQVLGLLFLALGFFYVVKQSLRKRLPPGPSGWPVIGSLPLLGNVPHHSLFQLSKQYG

PIMYLKLGTTDTVVVTSPKVAEACLKVNDLNFSNRPGNAGAKYMAYDSNDLVWAPYGSRW

RMLRKVCNVHLFAGKALDDVQPVREAEVGLMLKSILEHEKQGKAVNLGELLNVCTANVLG

QIMLSKRVFESQGAKASEFREMVVELMVLAGVFNIGDFVPSLAWMDL

 

>CF391258 Loblolly pine roots recovering from drought DR3 Pinus taeda cDNA clone

78% to CF664732

MDPLFDFLQSSVARLSQVLTVILLLIGLICVVKRNRRKRFPPGPSGW

PVIGSLPLLGNMPHHSLYQLSKQYGPIMYLKLGTTDTVVVSSPKIAEACLKTNDLNFSNR

PGNSSAKYIGYDSHGLVWIPYGPRWRMMRKICNIHLFGGKALDDLQPVREEEVGMLVKSI

LEHERQGKAVNLGEVLNICTANVLGQTMLSKRM

 

>AJ309081.1 Pinus pinaster mRNA for putative flavonoid 3'-hydroxylase

3 aa diffs and a short fs from CF390685

72% to CF671978 72% to CF391927  71% to CF400021 58% to 75B4 51% to 76A5

AVVKETFRLHPSTPLLLPRLAAEACEVEGYYIPKNARLLVNAWG

IQRDPDVWERPLEFDPERFAGSAVDVRGTDFEVIPFGAGRRVCAGVTWESAWFSMLAS

LLHSFDWSLPEGQLPENMDMAEAYGLTLQKAVPLLAAPAARLPHHLYN*

 

>AW056850 ST57B04 Pine TriplEx shoot tip library Pinus taeda cDNA clone

65% to CYP75A3 nearly identical to AJ309081.1 Pinus pinaster except lower case

79% to CF671978

GYYIPKNARLLVNAWGIQRDPDVWERPLEFDPERFAGSAVDVRGTDFEVIPFGAGRRVCA

GVsmgirmvqlMLASLLHSFDWSLPEGQLPENLDMAEAYGLTLQKAVPLLAAP

 

>AW043335 ST32B07 Pine TriplEx shoot tip library Pinus taeda cDNA clone

55% identical to CYP75A3 53% identical to CYP98A1 75% to CF671978

DTSSITVEWAMAELTRHPKLLRRCQEELDSAVGGEQRTLKESDLQNLPYLKSVVKETLRL

HPPVPLLIPRXAPXXXXIXXYYIPKNARLXVNAWGMQRDPSVWGNSLEFNPDRFMVSSVD

VRGSDFQVIPFGAXRRTCAGMSMGIRMVELML

 

>CF387990 Loblolly pine roots recovering from drought DR1 Pinus taeda cDNA clone

CF672431

62% to CF397580 63% to AL751033 46% to 92A9

LPQTLPPHLPATWRATAGYGALIFFLLYRILQLKGGRNGGRLPPGPYPWPIIGNLNQLKK

PVHHALKDLADKHGPIMFLRLGSVPTVVVSSSETAKHFLKTQDSIFASRPATAAGKYLSY

NFKGMVLSPYGDYWRQVRKLCVLELFTSKRIESFKHVRDEEVSAITRSIWEQSQNGTIAV

NVSKAILTLSSNVISRILFGRKVSDDDLGA DGKGFKHMLLEVSATVGDVNIGDFIPYLDW

MDLQGTKRRMVEISKTYDAFAEKIIDEHLHVQAVAPSS

 

>CF474775  UniGene info RTWW2_7_B10.g1_A021 Well-watered loblolly pine roots WW2 Pinus

           taeda cDNA clone RTWW2_7_B10_A021 5'.

          Length = 725

3 diffs to CF387990

23  DGKGFKHMLLELSATVGDVNIGDFIPYLDWMDLQGIKRRMVEISKTYDAFAEKIIDEHLH 202

203 VQAAAPSS DGQAEAEAKAEAEHVKDFVDVLLQMTANNNHIKGDTKARRETVKSIMFDI 376

377 LIAGMETSASTLEWAMSELLRHPHVLKKLQEEIDSCVRKRGKVNGSDVGRMKFLQCVVKE 556

557 TLRLHPPVPLAIPHESVETATVCGYNIPKKTTVMVNVWAIGRDPNVWGVDALDFKP 724

 

 

 

 

 

 

$CYP97 bin

 

>CF395695 Drought-stressed loblolly pine roots DS2 Pinus taeda cDNA

77% to 97B3 77% to 97B4 46% to 97As

    VINECLDNLIAGAKETRQEDDVEALQGRDYSKVKDASLLRFLVDMKGED

148 VDNRQLRDDLMTMLIAGHETTAAVLTWAVFMLAQNPDKLVKAQAEVDMVLAQRNPTYECI 327

328 KKLQYIRLIIAEALRLYPQPPLLIRRALRPDTLPGGYRGDKDGYPIPQGTDIFISVYNLH 507

508 RSPYFWDQPDNFEPERFLLPKDSKGIEGWAGFDPYKGQGALYPNEIISDFAFLPFGGGPR 687

688 KCVGDQFALMESTVGLAMLL 747

 

 

 

 

 

$CYP85 clan

 

 

>CF667047  UniGene info RTCNT1_27_H01.g1_A029 Root control Pinus taeda cDNA clone

CF666968

51% to 716A1 67% TO GLYCIME MAX EST BG156590 47% to 728Cs in 85 clan

50% to 725A2

2   NLPGTRYNKATHAANAIRQQLNRILNERRVALEVGKASPEQDLLSFLISNVDEHGESLTDS 184

185 EILDNILDLLYAGHDTSSSTLTVLLKYLAENPQCYDEVQREQLDIAGSKEAGQLLEWEDL 364

365 QRMKYSWRVAQETLRLCPAVQGSFRKAIKDFKYEGFTIPKGWKLYWTVNATHKKS 529

530 QYFSDPEKFDPSRFEGDGPPPYTFVPFGGGPRMCPGNEFARMEILVFIHNIVKTF 694

695 KWSLVNPGEKVIVDPMPNPVNGLPIKLVPHQ*

 

>CYP724B5   Pinus pinaster (cluster pine, maritime pine)

           GenEMBL EST AL750251 AS Pinus pinaster cDNA clone AS07D08

           59% TO 724B1 RICE 44% TO 90B1 41% TO 724A1 

1   LLGETLPFLKPHPSTSTGPFLHQRVQRFGRVFKSHLFGEPAIVSCDPDLNAYVLQNEDRL 180

181 FQCSYPTAIHGILGEMSMLVVVGDAHKRLRTLALSLVNAAKTNPNFLSDIEANALLITGK 360

361 WKQKQTVLFCEEARKFTFTVIVKQILSLKPDSPETSTILKDFLTFMKGLASLPLYIPGTS 540

541 YAKAVKSKSQILSTLKTLVDRRRNEGIQRGDXLDMLLXSTSLGDDE 678

 

>CF388492 Loblolly pine roots recovering from drought DR2 Pinus taeda cDNA clone

CF474400 CF667437

71% to 707A1

3   FPRAMKARKHLSEILNQIIATRRANNVVNNDLLGSLMQSTDGSSQTLTDDQIADNIIGVIFA 188

189 AQDTTASVLTWIIKYLKDNPSFLEAVTAEQEAIRQSKGKENYLLTWEDTRKMPLTCRVIQ 368

369 ETLRVASILSFTFREAVADVEYKGYLIPKGWKVMPLFRNLHHSPEFFPDPQKF 527

528 DPSRFEVPQKPNTFMPFGGGAHSCPGNELAKLEMLIIIHHM 650

    TTKYRWDFVGTETGIQYGPFPVPMQGLPIKVSRRFPGSQ*

 

>CF386955  Loblolly pine roots recovering from drought DR1 Pinus taeda cDNA clone

56% to 88A4

YNWILFIRYDPNAIGALEREYGVLNLGVRAMAINLPGTAFNKAFKARRNVEAILQSVIDK

RRSGQEKNDDKNGDMLDSLLQVKDENGRFLTDEEIIDLLVMYLNAGHESSAHITMWTIIF

LLKHPEIYAKAKAEQENIVKRRIDRQTHMRFSELREMHYLRKVLDESLRLVNISPMVFRE

AVDDVEFNGFTIPKGWKTQVWLRNVHLDPHVYHDPLKFNPERWNSFVPKAGMFIPF

 

>BX681703   BX681703 RS Pinus pinaster cDNA clone RS63B12.

BX252216 BX255396

65% to CYP85 C-term

DNFLYPDFSAFNPWRWQEKNGDSVMYFTAFGGGSRLCPGKELGLVQISMFLHHFVTRYRWEEV 201

202 GGDEILKFPRVVAPKGLRIKVSEY

 

>BM903010  UniGene info NXLV_077_H10_F NXLV (Nsf Xylem Late wood Vertical) Pinus taeda cDNA 58% to 87B

32  DDYTSMKFTQCVINETLRISNLAAGFFREALEDTKVKGYVIPKGWVIFAFTTANHLDKK 208

209 FDAPLKFDPWRWQQNQDSSYDPFYIPFGAGARLCPG 316

 

>BX000562   BX000562 Pinus pinaster xylem Pinus pinaster cDNA clone PPEM1.

      Length = 197 68% to 90B1 77% to 724B1

63  FGGGPRLCPGSELAKVETAFFIHHLVLNFRWRAAELDHSVAYPYV 197

 

>BX680099   BX680099 RS Pinus pinaster cDNA clone RS39B12.

          Length = 590

46% to 87A2

7   REKKSRGEVYLTWEDYKSMTFTTNVITETLRVSSIGTYLYRECIEETKINGYRVPKGWRV 186

187 IACTSPVNLDPSMHFEPLSFNPWRWEKRTCNKSDFQVFGGGLRYCVGSELARVQIAVFL 363

364 HHLVTKFRWEKALGWKEAIIRRPRIIFKNGY 456

 

>CF385695  UniGene info RTDR1_5_F02.g1_A015 Loblolly pine roots recovering from drought DR1

           Pinus taeda cDNA clone RTDR1_5_F02_A015 5'.

          Length = 749

44% to 716A1

MIWKEAATVLHKAQHLEKPPFIFTVFIASFIGFA

AFSYLITNRRTRELRGIPPGTFGWPLIGETLEFLGCQRRGRPQDFCDRRKQKYGNVFTSS

LVGHPTVVLCSPQGNRFLFANENKLVVNSWPASVGNLFRSSLITAVGDDAKRLRRILMTF

LRPEALQKFVGRVDSMTKDHLAEYWIGKNEVRALPLLKRYTFSLACDLFATINNREEQAR

FWRHFMVFV

 

>CF390581 Pinus taeda cDNA clone RTDR2_20_B07_A021 3'.

          Length = 623

CF390669 CF666518 CF666508 CF666450

75% to BF609170.1 46% to 90C1 45% to 90B2

LQARDFLIKRIYASIKYRREHPEVVHNDFLGELLKEDLHSEEIIADFVLFLLFAGH 191

ETSASTMAFAIKFLTDCPQALRELKAE

HNALIKRKGSPRNQNITWDDYQSLKFTQCVINETHRLANVAPAVFREAIEDIKIEGGFVI

PKGWSVLVLMNGIHLDDKYHSSPLKFDPWRWQQILENNELYKNPSFMPFGGGLRLCPGMH

LAKLELGLFLHHFITKFRWEPLDDDKISYFPVSHLTKGFPIRLHPQEQMDD*

 

>BI416628.1 Pinus sylvestris

CYP85 clan ortholog of BE049731.1

    IQEREKRYGEIFRSNLFGRSRIVVSVDPEFNKHVLQHEGRQFQANYPKPLRNL 180

181 IGKFGLLFLYGDLQKKLHGAAVNLLRFERLSVDFMEDI 294

 

>AW011172.1 ST17E09 Pine TriplEx shoot tip library Pinus taeda cDNA clone

56% to 87A2

85  LVCFALGMLLLELYKLVWRVDSRGYKLPPGSTGLPLIGETISFFRGINS 231

232 TDQPRRYIQEREKRYGEIFKSNLFGKISDCCVRGFKVQQTCPAARRQEFQANYPKPPPN 408

409 PNRKFWLLA

435 VHGDFQKKLHGTXVNXFKVQKL 500

 

>AA740068 833 PtIFG2 Pinus taeda cDNA clone 9312M 3'

AI725255 AI725351 AA739879 BQ107601 BQ696511 CF664817

90 like C-term 50% to 90A1 85 clan

24  DLLTKLLEEDSISDEIICDFILFLLFAGHETSSRAMTFAIKFLTTCPKALTQMKEE 191

    HDAILKAKGGHKKLEWDDYKSMKFTQCVINETLRLGNFGPGVFRETKEDTKVKDCLI 200

201 PKGWVVFAFLTATHLDEKFHNEALTFNPWRWELDQDVSNNHLFSPFGGGARLCP 362

    GSHLARLELALFLHIFITRFRWEALADEHPSYFPLPYLAKGFPMRLYNRE* 236

 

>AW011225.1 ST18B12 Pine TriplEx shoot tip library Pinus taeda cDNA clone

CYP90 like different from AA740068

3   GGGARLCPGSHLARLELALFLHIFITRFRWEALADEHPSYFPLPYLAKGFPMCLYNRE 176

 

>BG318205.1 NXPV_011_G08_F NXPV (Nsf Xylem Planings wood Vertical) Pinus taeda

BI202885.1 BG318334.1 BI644007.1 BI077317.1 AI725351 BQ698310 CF664899

CYP90 like sequence

15  MADQISLLLVVFTAAVALLHLIYRWWNAQRGQKRTNNEKNPEGHLPPGSTGWPLIGETYS 194

195 YYRSMTSNRPRQFIDDREKRYDSDIFVSHLFGSQAVISSDPQFNKHVLQNEGRFFQAHYP 374

375 KALKALIGDYGLLSVHGDLQRKLHGIAVNLLRFERLKFDFMEEIQNLVHST

    LDRWVDKKEIALQNECHQMVLNLMAKQLLDLSPSKETNEICELFVDYTNAVI

 

>BI398025.1 NXPV_113_E11_F NXPV (Nsf Xylem Planings wood Vertical) Pinus taeda

BQ695774 CF474262 CF476257 CF663173 CF665569 CF665493

CYP90 like

12  ESIEDRRQHPEAVHSDLLTKLLKEDSFSEEIIADFILFLLFAGHETSSRSMSFAIK 179

180 FLTDCPRALEELKAEHDALLKRKGNLENQK

14  LNWDDYQSLKFTQCVIHETLRVGNFGPGVFRETKEDIKTKGGFVIPRGWTVYVFLTGTHL 193

194 DEKYHSSALKFDPWRWQPHLQDQELLKNPSFMPFGGGARLCPGMHLAKMELALFLHNFVT 373

374 KFRWEALQDDKISYFPFPRLIKGLXIRLRLRE*

 

>BE049731.1 NXNV_143_A08_F Nsf Xylem Normal wood Vertical Pinus taeda cDNA

BG040616.1 BE582456.1 BF778196.1 BG040616.1 BG318000.1 BQ701705

CYP720 like cyp85 clan 87A2 like

MTETLTDSWLVGLLCLVLGFLLLQLYKLVWGASSRAYK

LPPGSTGWPLIGETISFFRGINSTAQPRQFIQERERRYGEIFRSNLFGRSRIVVSVDPE

FNKHVLQHEGRQFQANYPKPLRNLIGKYGLLSVHGDLQKKLHGAAVNLLX

FERLSVDFMEDIQNLLHITLXKWEAKRDIHLQEE 551

 

>AW056514  65% to BE049731.1 85 clan

81  MAETSVTYSWLVGFVCFVLATILLQLYRIVDSRGYNLPPGSRGWPLIGESLGFMREI 251

252 NSGSQPRRFIXDRELRYGEIFXSNLFGRSRLIVSVXXEFNKHVLQXXXRLFXANXPRPFR 431

432 N 434

 

>AI725152.1 1051 PtIFG2 Pinus taeda cDNA clone 9047r.

Like CYP720

84  LLTKLLXQDSISDEITCDFILFLLFAGHXTSSKXXTXATKFLTTCPRLIDSHERI 248

 

 

 

 

 

 

>CF667480  UniGene info RTCNT1_30_C05.g1_A029 Root control Pinus taeda cDNA clone

53% to 81D2

MATLLQRSDVLKRAQQELDVIVGRERILEESDLPKLKYLEAIVKETLRLYPAAPLLLPHV

AAAPCRVGGYYVPEGTEVLFNAWGIHRDPAVWESPLKFEPERFISSSIDVNGHDFTYIPF

GYGRRACPGIWLAMRMLLLTVGRLLQGFDWSIPEGTEGVDMNEGRALTLHRAVPLEAAIR

PRLPHYLY*

 

>CYP?       Cryptomeria japonica (Japanese cedar)

           GenEMBL AU036755

           Tsumura,Y., Suyama,Y., Yoshimura,K., Shirato,N. and Mukai,Y.

           Sequence-tagged-sites (STSs) of cDNA clones in Cryptomeria japonica

           and their evaluation as molecular markers in conifers

           Theor. Appl. Genet. 94, 764-772 (1997)

           This fragment is 54% identical to 76C1, 52% identical to 98A2 and

           others

           The sequence is too short to name.

53% to CF667480

RLQLRHSPSLCSLMKPSEACKCWRIPCPEGTQLLVNIWEIHRDXAVWDRP

MEFIPERFVKSDTEIDVKGQDFELIPFGSGRRKCPGMPLAXTVISHTLGR

LLQSFEWFCPEGSEIDMTEGLGLSTPKSVPLEAIIKPRLPLHLY*

 

>CYP?       Cryptomeria japonica (Japanese cedar)

           GenEMBL BP176293.1

           76% to AU036755

           57% to 92A11 60% to CF667480

    LGKAQQEIDXHVGRSRLMEESDIHKLKYLQAIVKETFRLFPAAPLLLPHVSIGA

441 ACTVGGYCVPAGTQLLVNVWAIHRDAAVWERPMEFDPERFLKSGKEIDVKGQDFELIPFG 262

261 SGRRICPGMSLGLIVVSHTLGCLLQSFECFSPEGTEIDMTEGLGLTMPKSIPLEVIIKPR 82

81  LPLHLY 64

 

>CF393317 Loblolly pine roots recovering from drought DR3 Pinus taeda cDNA clone

63% to CF397949

12  LKAILLDMLHAGSDAPSTALEWAMSELLRRPSAMKKAQEELEKVVGLNRKVRETDLPNLF 191

192 YLQAVVKETLRLYPSAPLLAPHESMEPCTVCGYEIPAGTRVIVNAWAIGRDPKSWEDAEE 371

372 FKPERFTESPNSCVDVRGQDFQLIPFGSGRRGCPGMQL

GMVIVEFLLAQLLHCFDW

RLPDGMEGRDLDMNEIFGLAIPRAVPLLAIPTPRLPAQVFGSRY*

 

>CF673059 Root control Pinus taeda cDNA clone

67% to 92A9

DDPQLNLFRVKVKAFTQDIIAGGTESSATLVEWAMAELLKKPETLEKAAEELDRVVGRER

WVEEKDIGGLEYLQAIVKEMMRLHPVAPMLVPRLSTEACKVGGYDIPANTRLHVNVWTIA

RDSGFWENPDEFRPERFQGSALDVKGRDYQLLPFGTGRRMCPGYNLGLKVVHLGLANLIH

GFHWCLPDGQSPKDLDMGETFGLSTPKTQPLVALARPRLPSHLYASEQQT*

 

>CF402148  UniGene info RTWW1_20_B09.g1_A015 Well-watered loblolly pine roots WW1 Pinus

           taeda cDNA clone RTWW1_20_B09_A015 5'.

          Length = 795

78% to CF673059

15  EDLDRVVGRERWVEEKDIPGLKYIQWIGKETMRLHPVAPMLVPHLSTQPCRIAGYDIPAN 194

195 TRLFVNVWTIGRDGKLWENPDEFQPERFKGSTLDVKGRDYELLPFGSGRRMCPGY 359

360 SHGLKVVYMALSNLIHGFQWKLPDGQNPEELDMCETFGLSTPRTIPLVAMARPRLPSHLY 539

 

>BM493207 Root-induced cDNA library from Laccaria bicolor (Fungi) cDNA.

67% to White rot CYP51

MPLSDHWSGYLAHAQANLPPLNSRFALIAVLNFPLFVIILNALAQL

IPRRASEPPVVFHWLPIIGSAISYGNDPLNFFFKCQKKYGDVFTFILFGRRVTVALGPRG

NNFILGGKSTVLNAEDAYTHLTTPIFGKDVVYDVPNEVFMEQKKFVKVGLSTDNLRAYVG

MIEEEVEEFMRNDAAFKVFQPNDINEWGTFDVVNVMQEITILTASRTLQGKEVRESLDKE

FAHLYNDLDGGFTPLNFL

 

 

@@@@@@@@@@@@

N-terminals

 

>CF475447 Well-watered loblolly pine roots WW2 Pinus taeda cDNA clone

CF474434 CF672718 AW064998 CF479001

47% to 71A25

    MVNELGSEKPFLVCL

560 EFYMKLAIALVALVVAWSFFVKGRNRKLPPGPFPLPIIGNLHLLGQLPHQALAALSLK 387

386 FGPLMSLRLGSALTLVVSSPDMAKEFLKTHDLLFASRPPSAATNYFWYNCTDIGFAPYGA 207

206 YWRQMRKVCVLQLLSSRRLDYFRFIREEEVSAMIHSIAHSDHPVNISKIVSTLMT 42

41  DIICRMTLGRKYSDEDSIGGKGINSVVRESYVVAGAFNVGDYIPYXGLDGSTRSQ

    QTLQGNTWHPRRVARESN

 

>CF388753 Loblolly pine roots recovering from drought DR2 Pinus taeda cDNA

48% to 71A25

1 SAWPVHECPYFYFKLATVILLAVATAWGFLFRGRKQKLPPGPFQWPIVGNLHMMGELPHQAIT 189

190 ALSMKYGPLMSLRLGSYLTLVVSSADVAEEFLKIHDLAFSSRPPTIGTKYLWYNSSDVTF 369

370 SPYGPYWRQMRKICVLQLLSSRRIDSFRHIREEEVSAMIRYIANSDLRPANISRAV 537

538 SALGIDIICRMAFGKKYCDQDLIGGIGINSMIKETFVLAGSLNMG 672

 

>BX249800   BX249800 Pinus pinaster differenciating xylem adult cDNA clone PP027H05.

69% to CF475447 70% to CF474434 65% to CF388753 61% to CF470703 59% to CF473014

47% to 71A21 52% to 71Y5

25  YSERLMLECDEFYIKFAAAILVTLVVSWSFLFQVRKRRLPPGPFPLPIVGNLHLLLGHL 201

202 PHQALATLSLKCGPLMSLRLGSSALTLVVSSADMAKEFLKNNDRLFAGRPQSMAAKYLSY 381

382 NFSNVGYAPYGAYWRQMRKICVLQLLSSKRLDSFRFIREEEVCCMIRSIIEDSEGSHGP 558

559 VSI 567

 

>CF388617 Loblolly pine roots recovering from drought DR2 Pinus taeda cDNA clone

71% to CF470703 67% to CF473014 61% to CF474434

LGSALTLVVSSPDMASEFLKTHDQLFANKWQSAAAKHLTYNFSDFAFAPFGPYWRQMRKL

CASELLSSRRVDYFRFIREEEVSAMTRSILNSEDSRPLNIRKAVASLATAITCRMAFGKK

NSDTDLKGFNSMVRESLLLLGSFNIGDYLPYLGWMDLQGVNRRMKKLHKTQDQLLEKVID

EHVTLDEPKITHDFVDVLLAASADKDREFQISRDSVKGVLYDVLLGG

 

>AW043075 Pine TriplEx shoot tip library Pinus taeda cDNA clone

69% to CF474434 66% to CF475447 45% to 71A25 55% to 71D16

24  ELGYEMRPVWESAGFYIEALVALVAAWGFFIFIYRNKRRLPSGPVQLPIIGNLHL 188

189 LGKLPHQALSALSLKYGPFMSLRLGSSTLMLVISSGDMAEEFLKTHDQCFASRAPSTAAK 368

369 CLTYNCSGIVFAPYGPYWRQMRKVCVLQLLSSKRIDSFKXTREXGVSXMILXIINQTQXI 548

549 LKDDPPPLNVRK 584

 

>AL751033   AL751033 RS Pinus pinaster cDNA similar to FLAVONOID 3',5'-HYDROXYLASE.

75% to CF397580 48% to 92A9

LPPGPFPWPIIGNLHQLVQPAHRSLKALADKYGPIFSLRLGSVPAIVVSSSEMAKLFLKT

HDLVFSSRPLTSSGKYIFFNYQDVIFAQYGDHWRQMRKICVLELLTAKRIESFRPVREEE

LSVVIRSIWEESESGIKSVNVSKAIATLNTNIIWRVLAGRKFSDDDLGSDFESFKDFMVE

LISTVGAXNIGDFIPRLDWLDLQGIKG

 

>CF392508 Loblolly pine roots recovering from drought DR3 Pinus taeda cDNA clone

CF392160 (3 DIFFS) BQ697969 BI202826 BQ698279

46% TO 92A8 68% TO CF397580

MSFDKLLQALPLPLPAILIATFIFFFSCWILHQSRRNERLPPGPYPWPISGNFHQVRLPLHRALKNLA

EKYGPILFLRFGSVPTVVVSSSEMAKHFLKTHDLIFASRPLTSVGKYFFYNFKDIAFSPY

GDHWRKMRKICVLELLTGKRIESFKHVRQEELSAMIHSIWEESESGRIAVNVSKAISTSL

ANILWRILARKKFSDNDLGADG

 

>CF670174 Pinus taeda cDNA clone

55%  to 92A9

MDLQRVFTTGDMRILGYLTVAVVSAYFICRRLGPSLKLPPGPRGWPIIGHLHLMGKL

PHRSLDRLCKTYGPLMYMRLGSVPCVVASTAEMAQQFLKTNDVIFASRPRVAAGKYTVYN

YSDITGSPYGENWRLGRKLCLMELFSAKRLESFEYIRVEEVGRMIRSVFETCQRGLPVEI

REETTNVSNNIISRMVLGRRYLD

 

>CF387732 Loblolly pine roots recovering from drought DR1 Pinus taeda cDNA clone

80% to CF670174 58% to 92A9

36  MDLQLSFAIADLRMIGYLVVTIISAYLICRRLRPSVKLPPGPRAWPIIGNLNLMGKL 206

207 PHRSLDRLSKTYGPLMYMRLGSMPCVVGSSAEMAREFLKTHDLTFSSRPRVAAGKYTVYN 386

387 YSDITWSPYGEHWRLARKICLMELFSAKRLESFEYIRVEEVARMLSSVFETSRQGLPV 560

561 EIREETTNVSNNIISRMVLG 620

 

>CF398854 Drought-stressed loblolly pine roots DS3 Pinus taeda cDNA clone

74% to CF473014

12  ENSEFYVKLIAALLLVVLLAAWRFLSRGTNSNLPPGPFPLPIIGNLHMLGKLPHRALAAL 191

192 SVEHGPLMSLRLGSALTLVVSSAEMAREFLK 284

 

>CF472421 loblolly pine roots DS1 Pinus taeda cDNA clone

45% to 75B6

MYPVEAATECYLLVGSLLVFVLLLSIRKKKKNRLPPGPPGWPIIGNLLQLGDRPHE

SLYRLAQKYGDLMSLKLGNKLTLVVSSPSMAKEVLKTNDQTFSSRSVTIAAKTFAYQGKT

LVFVHYGPQWRFLRKICTTELFSPKRLDALQHLRKEEVNRTIESIFEDSKKRQSVNIGAS

AFVTSLSLVARMVCGK

 

GTANLSDVFP

 

>BQ697235 Pinus taeda cDNA clone

BI643955

53% to CF474434 some frameshifts and a deletion of about 25 aa

GWVFFFRATKLRLPPGPLPLPIIGNLHQLGELPHRTLAALSHNYGPLMSLRLGSALTLVV

SSPDVAKEFLTTHDRVFGVRPRSXXXXXXXXXXXXXXXXXXXXXXXXXRRLCVYSCWASRSIESFSCIREEEVSAMVCSIANSD

CPVSVGKTVSAVTNNMICRMAFGRKYCDQHLIDS

 

>CF671256 Pinus taeda cDNA clone

poor match to other plant P450s

WYSVLGITSAIVFLVLDLWRRTYGRLPPGPLGWPIVGNLLQLGNKPNESLFHLATKYGPL

MCVSLGMKTTVVVSSPAMAKEVLTTHDRVLAGRTVIQSVKYASYDKTSVGWAQCGPYWRM

LRRISNTELFSVKRLENLQHLRRDQVLRTIHQILQEGIKGNSINIEDTMVHCVVNLLGNM

AFGKDMFDSHSPAFPEFKDSISEMMANATAPNLADYFPP

 

>CF477547 loblolly pine roots WW3 Pinus taeda cDNA clone

57% to CF671256

STVITFLLFDVWRRKAYYRLPPGPAGWPIVGNLPQVGNKPHESFFHLANKYGPIISLSLG

MKTTVVVSSSAMAKEVLKTHDHILSGRILTQAGKALSHYKTSIVFGQYGSHWRMLRRVSI

NELFSAKRLEALLHLRRDQVNRMIHQIFEDAVKGKCVDIGQTAFQSSFNLLGKMVFGKDV

LDPQLGTQELKYALSKVMVLYATPNVADFFPCLQFLDPQSVYRNTNFYF

 

>BI398019 Pinus taeda cDNA clone

83% to CF392508

FDKLLHALPLPLPAILIATFIFFFSCWTLHHSLRNDRLPPGPYPWPITCNFHQVRLPLHR

ALKNLAEKYGPILFLRFGSXXTVVVSSSEMAKHFPKTHDLXFASRPSNIVY

KYFFYNFK

DIAFSPYGHHWRKMIHXXXLELLTGKRFQSLNHVLQEELSSMIHSIX

 

>BQ702358 Pinus taeda cDNA clone

72% to CF477547

LDMLGRKTYYRLPPGPPGWPIVGNLFQLGKNPSESFFHLAQKYGPLMSLSLGMKIAVVVS

SPAMAKEVLKTHDHILAGRIVNQVARSLSQHKSSFVLCQYGSRWRMLRRISNTELFSVKR

LEALQYLRRDQVNGMIHQIFEEXVKGXQC

 

@@@@@@@@@@@@@

from old searches on Pinus page

 

>AI812861 20H12 Pinus taeda cDNA, mRNA sequence

53% to 77A1 N-term

probable N-terminal of a CYP77 from pine

MAILSFLQAVLLLVISLVFLRLVLWKIWRYRNLPPGP

PAWPILGNLLQMGFASGAFERSVQKFHERYGPIFTMWLGSRPLLMIASQE

LAHEALIQKGSLFSDRPPA

 

>AW043205 ST30E11 Pine TriplEx shoot tip library Pinus taeda cDNA clone

61% to CYP77A1

LFLKSRPPKKHLPPGPRGWPLVGNLFQVVFSGKPFIYVIRDLREKFSPIFTLKMGQKTMI

IITCPKVAHEALIENGALFASRPPDTPTKMFFSENKCSVNSSLYGSVWRXLRRNMVSELL

NPSRMK

 

>AI813004 2F2 Pine Lambda Zap Xylem library Pinus taeda cDNA, mRNA

AI920165 704 like 58% to 704A2 86 clan

GRMSYXWWDDAKEFKPERWIQD

10  GIFHPKSPFKXPAFQAGPRTCLGKDFAYLQMKIVAAVLVRXFKFEAVKTKEVRYRTMLTL 189

190 HMNEDGLNVQVTPR 231

 

>AI813156 23F12 Pine Lambda Zap Xylem library Pinus taeda cDNA, mRNA

complete translation 55% to 78A6 52% to 78A4

AFCNTWFLLVLLIAMAYVLLSWLSPGGPAWGGSLKRKPTIPGPMGLPILG

NLTVMCSLAHQRLAYLAQACNAQKLMAFSMGFTRAVICSQPEVAKAILNS

SAFADRPIKESAYQLMFDTAIGFAPYSEYWKNLMRIAALHLFSVPRISGL

RI

 

>AI919813 1357 Pine Lambda Zap Xylem library Pinus taeda cDNA clone

53% identical to CYP84

540 IGRNPKSWEDXESSKPREVSWKKXGXAELDVNVQNFEWIPFGAGRRGCPGQQLGMLVVEX 361

360 GMAQLLHCFNWRLPEKMNGQEELDMSERFNGLTLPRAHELVAVPTPRLSVH 208

 

>AW010774 ST12C06 Pine TriplEx shoot tip library Pinus taeda cDNA clone

52% to 86C1

IALSWLFWLLIQHPAVEENILSELRQILVSRRGSNPGGFTVEEVRQMQYLHAALSETLRL

YPSLPINYKEVIEDEVLPDGARLKRGTNLIFPIYSMGRTXXIWGEDCREFKPERWLKEGV

FVAEGGYKYPVFSAXPRVCLGKDFAFFVHEMG

 

 

>AA220912 27 Pinus radiata somatic embryogenic library Pinus radiata cDNA

like extreme C-term of 78A4

64  VXXXXVLKLSXEXVXLFHXVSGTRXPFGKFXD 159

 

>AW225716.1 ST71A02 Pine TriplEx shoot tip library Pinus taeda cDNA clone

BG625777.1 BG832634.1

65% to AI725152.1 50% to 90B1

7   KAREFLIKKIYESIEDRRQHPEAVHNDLLTKLLKEDSFSEEIIADFILFLLFAGHET 177

178 SSRXMSFAIKFLTDCPRALEELKAEHDALLKRKGNLKNQKLNWDDYQSLKFTQCVIH

    ETLRVGNFGPGVFRETKED

 

>AW754540.1 PC03D04 Pine TriplEx pollen cone library Pinus taeda cDNA clone

59% to CF672363 81% to 703A2

59  PFSAGKRKCPGAPLGTCFVLLALARLFHSFHW 154

 

>AW870094.1 NXNV_124_A07_F Nsf Xylem Normal wood Vertical Pinus taeda cDNA

60% to 76C2 60% to CF667935

8   PTLLKKAQAELDEVVGREKRMEESDIAKLPYLQAVVKEVLRLHPAAPLIIPRRADNSAEI 187

188 GGYVVPENTQVFVNIWGIVRDPNVWKEPLKFKPERFLXCKTDYRXXDFELIPFGAXXXIC 367

 

>BF609170.1 NXSI_041_B05_F NXSI (Nsf Xylem Side wood Inclined) Pinus taeda cDNA

CYP90 like 91% to BI398025.1

4   EDVKTKGGFVIPKGWTVYVFLTGTHLDEKYHSSALTFNPWRWQQLLQDQELSKNPSFMPF 183

184 GGGARLCPGMHLAKLELALFLHNFVTKFR 270

 

>BF610049.1 NXSI_054_B07_F NXSI (Nsf Xylem Side wood Inclined) Pinus taeda cDNA

83% to 85A1

7   FTAFGGGSRLCPGKELGLVQISMFLHHFVTRYR 105

 

>BM158852.1 NXLV_040_D06_F NXLV (Nsf Xylem Late wood Vertical) Pinus taeda cDNA

57% to 98A3 63% to CF397949

23  PFGAGTKVCPGEQLAMLLVQFPLAXLLHCFYWT 121

 

>BM428379.1 NXRV_015_D05_F NXRV (Nsf Xylem Root wood Vertical) Pinus taeda cDNA

BQ655449 BQ698991 CD024826

63% to 85A2

    MDILSTIALGFIFLCSIIALLRWNEVRYGKKGLPPGTMGWPLFGETPDFLRY 172

173 GQQFIKNRKARYGDLFKTHILGCPTVISTDPALNRYILLNXXRGLIPGXXQSML 334

335 DILGKWTIAAVQXDLHKTMXXALL 391

 

########### CYP85 search new hits

 

>BX681447   BX681447 RS Pinus pinaster cDNA clone RS59D11.

CF671620

          Length = 546

57% to 76C1 57% to 75B3

RTVWPKETVNGSDGPK

61  DLLDVLLDMRSDEFSLIDIRGYLTDLFGAGSETTSKTMEWAMAELICNPEKMKRAQAE 234

235 LDEVVGRNRRVEESDTHRLPYLCAVVKEVFRLHPVVPLLLPHRAASACEIGGYLIPK 405

406 DTQILVNVWAIARDPAIWNEPLKFMPERFMDTKMSKLDFKGQHFELL

    PFGAGRRICVGLPLASQIIHLVLASLLHYFDWAPPNGMSA

 

>CF401592  UniGene info RTWW1_13_D10.g1_A015 Well-watered loblolly pine roots WW1 Pinus

           taeda cDNA clone RTWW1_13_D10_A015 5'.

          Length = 748

69% to Sorghum bicolor BE355748

EMRDRRDVYLTALNKGLDERIANGTYKPCIQANVILDKEAKLNSEELTSISLTMLSGGLD

TITTLVAWSVAMLAQRPDIQATALKAIQETYGTDQPLCDALDDQHCQYIVALVRECLRFY

TVLRLALPRASVKDITYQGIVIPKGTVVFLNAWACNMDPNVWQDPEIFRPERWLEHEDAP

MFTYGMGYRMCAGSLLANRELYLTFIRLLNSFRIEXVDDVDVHPVRGNLDPTSLVAMPKR

YRARFVPR

 

>BE355748 Sorghum bicolor cDNA.

          Length = 653

69% to CF401592

AYDDQKCGYVVALVRECLRYYTVLRLALPRATVKDVIYDGKLIPAGSTIYLNAWACNMDP

EVWSDPDEFRPERWLEQPDAPLHSYGLGYRMCAGSLLANRELYLVFLRMLNSFELVPDSD

VDVHPVRGSSDPTSLVTMCRAYKVVFKPRNQGILREALKAADERLAEHEKS*

 

>CF672901  UniGene info RTCNT1_74_E09.g1_A029 Root control Pinus taeda cDNA clone

           RTCNT1_74_E09_A029 5'.

          Length = 758

55% to 89A5

RRRQRDTMLSLIHGSRSAAGGGYVDSLFTLTVDNGRRLEDDDLVSLCSEFIHAGTDTTAT

CLQWLMANLVIRPDVQARLYDEIVGVVGKGRPVESADVQHMPFLHAVVKESLRCHPPGHF

VMPHAVSQPCQLGGYDIPTEAWVNFFVTAIATDPGAWEKPLEFRPERFADEGAEADLTGT

KEIKMMPFSAGRRICPGIELGLLHMHLVVARLVQEFKWECKAGETVDLSELQELTMVLKH

PLPAIIKERARD

 

>CF478844 Pinus taeda cDNA clone RTWW3_15_B06_A022 5'.

          Length = 701

92% to BG318205.1

    IYRWWNAQTGQRKTHTEKNQAVH

71  LPPGSTGWPLIGETYSYYRSMTSNRPRQFIDDREKRYDSDIFVSHLFGSQTVVSADPQFN 250

251 KYVLQNEGRLFQAQYPKALKALMGDYGLLSVHGDLQRKLHGIAVNLLSFERLKFDFMVEI 430

431 QNLVHSTLDRWVDEKEIFLQNECHQMVLNLMAKQLLDLSPSKETNEICELFVDYNNAMIA 610

611 IPIKIPGSTYAKGLKARKVLIRKIFNIIKE 700

 

>CF664384  UniGene info RTCNT1_9_A08.g1_A029 Root control Pinus taeda cDNA clone

           RTCNT1_9_A08_A029 5'.

          Length = 756

51% to 707A5

VSCCKLAVERFTAESLCEFVSLSAEIVAFYIRINVSFFFCSQLMVVVVCAG

RYGDIFKTHMLGCPCIMMASPEAAKFVLTSHAHLFKPTFPASKERLLGPQALFFHQGDYHARLRKLXXXXXX

LPGKIRSIVAHIESIALHALDSWEDSTVNTFQEMKRYSFEVGLFSIFRNQYHEILEKEELKQSYYT 564

565 LERGYNSMPLNLPGTPFQQAMKARKRLSKILSKLIAERRSSTEWKEGLLETMISSEDER 741

 

>CF671084  UniGene info RTCNT1_54_D03.g1_A029 Root control Pinus taeda cDNA clone

CF671014

80% to CF390581

QHPDEAVHYDFLGELLKEDLHSEEVIADLVLFLLFAGHETSASAMVFSIKFLTDCPRALH

ELKEEHGALLKRKGSPRNQKLTWDDYRSMKFTECVIYETLRLANVASAIYREAKEDIKIK

GGFVIPRGWTVMVLLNSMHLDEKYHSSALTFDPWRWQRQLENNELSKNPSFIPFGGGARL

CPGMHLAKLELALFLHNFVTKFRWEALEEDKISYFPVSHLTKGFPIRLHHFQERMDD*

 

>CF670819  UniGene info RTCNT1_52_F07.g1_A029 Root control Pinus taeda cDNA clone

CF670745

59% to 89C2 64% to CF672901

APPPAGGAYVDTLFNLRVDGGRSLNDDELVTVSFEFITGGTDTTTTSLQWLMANLVIRQD

IQTRLYDEIAGVTGKGKVAEEKDLQRMPYLDAVVKETLRRHPAAHFVLSHAVTRPCELAG

YKVPADASINFYVAGIGMDPAVWPSPSEFKPERFVDEGVEVDLTGTKEIKMMPFGAGRRV

CPGLGMAMLHLNIIVARLVQEFTWECKPGETVDLSETQEFTTVMKYPLQAVIKKRERIHN*

 

>CF667474  UniGene info RTCNT1_30_B10.g1_A029 Root control Pinus taeda cDNA clone

VVAMAVWYLLVQYQQPKQSHNVPRETLPPGSVGWPFLGEIISFYFRTPDFVKQRRGRYGN

LFRTVLIGYPTVISTDPEVNKFILNNDGRLFVPAYPSYWSQIIGECNIFVARGDFHKRMR

GAFLHFISISVVKNRLLSEIQNIITFSLAGWEGRNVNVLHEAEEMIFSVMANHMLSLSAG

TALESMKRDFLVMMKGLRSLPLRVPGTTFYKSLQKKQVLFNQIKSIIEERKLNMSAYDSY

DDLLSSILKSASEKEFTTTQIVDLIVQSVIGSLET

 

>CF385604  UniGene info RTDR1_5_F02.b1_A015 Loblolly pine roots recovering from drought DR1

           Pinus taeda cDNA clone RTDR1_5_F02_A015 3'.

          Length = 519

80% to CF667047

4   FVPFGGGPRICPGNEFARMEILVFLYNIVKNFRWNLVNPCEQVIMDPMPSPVDGLPIKL 180

 

>CF395628 loblolly pine roots DS2 Pinus taeda cDNA.

          Length = 774

different from other pine P450s 50% to 548A1 Neurospora (fungal contaminant)

732 EQMQKRIQAEEEAKNSGKKLRKDFVHYLLESRDPKTGVGYTKLELEADSILLI 574

573 AAGSDTVSTAIAAALFYLLRNPRTLEKATAEVRRIFSDASQIHSGSDLNRCVYLQA 406

405 AIDETLRYSPPAASSLPREVMRGGINVDGHHIPAGIVVGVSSYAIHHNEDYFPRSWEFWP 226

225 ERWLPSQESGVSEASVKLAHRAACPFSIGSRGCLGRGVAYMEVKLTLANMLFRFD 61