584 sequences - 18 from other species = 566 cottonwood sequences

Last modified April 1, 2005  D. Nelson

Some names revised on 8/24/2006, mostly minor changes like v1 to P1 etc.


<CYP51 Clan, 2 sequences, both full length, 95% identical.



Scaff LG_I (-)4925909-4924104

84% to Arab. 51G1 95% to Scaff LG_III CYP51G5 seq.

fgenesh1_pm.C_LG_I000188|Poptr1 gene model correct

FKBP-type peptidyl-prolyl cis-trans isomerase downstream





4925459 MVVEAE 4925442 (0)









Scaff LG_III (+)14476000-14477787

83% to Arab. 51G1 95% to Scaff LG_I CYP51G1 seqF.

eugene3.00031308|Poptr1 gene model correct

FKBP-type peptidyl-prolyl cis-trans isomerase downstream





14476450 MVVEAE 14476467 (0)









<CYP71 clan 22 families, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 89,

92, 93, 98, 701, 703, 705, 706, 712, 736

66 sequences

29 nearly complete CYP71 like sequences and some related partial seqs.


<71B subfamily sequences (10 seqs all named)

three full length sequences 71B38, 71B40 and 71B41 are all about 97% identical

this is too similar for the genome duplication date.


LG_VIII (-) 12482829-12482572

71B like 100% to LG_VIII.4 LG_VIII.10 LG_VIII.16

eugene3.00081725|Poptr1 N-term only





LG_I (+) 19811612-19812590

71B like pseudogene 51% to 71B36 53% to 71B41

fgenesh1_pg.C_LG_I001954 [Poptr1:64602] model short exon 1










LG_VIII.4 (-) 12489221-12487004

71B like 53% to 71B36 97% to LG_VIII.16

eugene3.00081726|Poptr1 gene model short at N-term












12487021 VNYLP* 12487004



scaffold_994 (+) 9952-10569

CYP71B40 100% match exon 2

fgenesh1_pg.C_scaffold_994000003|Poptr1 duplicate seq







LG_VIII.16 (-) 12479032-12476806

71B like 54% to 71B36

eugene3.00081724|Poptr1 gene model short at N-term












12476823 VNYLQ* 12476806


LG_VIII.10 (-) 12547429-12545187

71B like 54% to 71B36 97% to LG_VIII.4

fgenesh1_pg.C_LG_VIII001676|Poptr1 gene model short on the N-term












12545204 VNYLQ* 12545187


LG_X.28 (-)  6738703-6736564

71B like 52% to 71B36 86% to LG_VIII.4

fgenesh1_pg.C_LG_X000579|Poptr1 gene model wrong 2 frameshifts

possible pseudogene or two seq. errors.















LG_VIII.30 (-) 12460686-12458958

71B like pseudogene 95% to LG_VIII.31 54% to 71B24

eugene3.00081722|Poptr1 gene model short, frameshifts



12460608 KLYVLELFSLK 12460576


12460427 KSFQGSDFHNERCRKSIHEAE 12460365 (small deletion here)


12460197 ESSAPQLTKYNIKAVIL 12460147 (0)





12459053 AINMEEAAGLTISKKNPLFLVRINYPQQAQPD 12458958 sequence gap here


LG_VIII.31 (-) 12534486-12532739

71B like pseudogene 95% to LG_VIII.30 

eugene3.00081733|Poptr1 gene model short, frameshifts


12534486 LLLLLLFPLPLILKKKQQ 12534433

12534433 KLYVLELFSLK 12534401


12534252 KSFQGSDFHNERCRKAIHEAE 12534190 (small deletion here)


12534022 ESSAPQLTKYNIKAVIL 12533972 (0)







LG_X (-) 6735316-6733923

71 like pseudogene new 75% to CYP71B42P

fgenesh1_pg.C_LG_X000578|Poptr1 71 like I-helix + C-term (pseudogene?)

downstream of fgenesh1_pg.C_LG_X000579






6734332 DEL 6734324

6734322 TLVIKETLRWQ 6734290





<71D subfamily 40 sequences all named



scaffold_710 (-) 1341-893

pseudogene 89% to 726B1 J-helix to end

eugene3.07100001|Poptr1 gene model short






 916 SYRSLVG* 893


scaffold_710 (-) 19864-18128

726A like 50% to 726A1 euphorbia













18148 YRSLVG* 18128


scaffold_710 (-) 21263-20928

pseudogene 79% to 726B1 C-term


21263 NDLGTILDETS 21231



21085 CMGMLFAIA 21059



LG_XV.1 (+) 7113294-7114921

71D like possible pseudogene 46% to 71D10 57% to LG_VII.22

fgenesh1_pg.C_LG_XV000688|Poptr1 gene model wrong 2 frameshifts and a stop codon








7114156 NLEFTNDNIKAILL 7114197 (0)



7114592 IGRDPTYWNEA* 7114627




LG_VII.22 (+) 5888964-5891028

71D like 50% to 71D4, 75% to LG_VII.12

fgenesh1_pg.C_LG_VII000682|Poptr1 gene model correct












5890987 IPIPYGPCPLPVE* 5891028



LG_VII.3 (-) 5804810-5802796

71D like 49% to 71D4 99% to LG_VII.27

note these two gene names were both assigned to the same sequence

eugene3.00070713|Poptr1 gene model seems correct












5802816 YPSPLQ* 5802796



LG_VII.12 (-) 5753477-5751477

  71D like 48% to 71D4 94% to LG_VII.3

estExt_fgenesh1_pg_v1.C_LG_VII0660|Poptr1 gene model seems correct








5752610 GDLGFPLTTDSIKATIL 5752560 (0)





5751497 YPSPLQ* 5751477


scaffold_228 (-) 35436-34671

71D like 2 copies exon 1 pseudogene




        35266 HYLCAHWARKYG 35231

                               35234 RTPPLGPWKLPLIGNIHQLASSATMP 35157






scaffold_228 (-) 39599-38903

71D like 62% to LG_VII.22 41% to 71D4

exon 1 pseudogene

eugene3.02280007|Poptr1 100% to scaffold_228  (-)    34668-35436








scaffold_1911 (+) 7175-8184

71V like 37% to 71V5

fgenesh1_pg.C_scaffold_1911000001|Poptr1 contains a duplication from exon 1

identical in seq to each other in overlap region

almost identical to 71D25P  2 aa diffs probable duplicate sequence










LG_I (-) 29491328-29490406

71D like EXXR 61% TO CYP71D26

eugene3.00012614|Poptr1 mid regioN to EXXR 71D like



29490942 DMFVAGSETSSRTVEWAK 29490889






scaffold_1517 (-) 9207-8703

3 aa diffs to 71D36P, duplicate seq.

eugene3.15170002|Poptr1 gene model wrong







LG_I (-) 29497891-29497622

71B like pseudogene no model exists

98% to scaffold 1517, 93% to scaffold 6967, 47% to 71B18






scaffold_6967 (-) 2023-1561

100% to 71D36Pv2

eugene3.69670001|Poptr1 gene model wrong







LG_I.29 (-) 29516258-29514652

71D like  new 52% to 71D10 93% to LG_I.2

eugene3.00012615|Poptr1 gene model short one frameshift













29514708 KNALHLTPILHHPHPVRS* 29514652


scaffold_11610 (-) 1395-784

71D LIKE 96% to 71D34

eugene3.116100001|Poptr1 gene model wrong exon 2 only







LG_I (-) 29524379-29524047

71B like pseudogene

eugene3.00012616 [Poptr1:550175] model short




29524103 KNALHLTPILHHPHPVRS* 29524047


LG_I (-) 29530020-29529344

71B like pseudogene

eugene3.00012617 [Poptr1:550176]







29529400 KKALHLTPILHHPHPVRS* 29529344


LG_I (-) 29532948-29532496

71B like pseudogene C-term






29532552 KNALHLTPILHHPHPVRS* 29532496


LG_I (-) 29540735-29539563

71B like PSEUDOGENE 2 models are from same gene

eugene3.00012620 [Poptr1:550179] gene start

eugene3.00012619 [Poptr1:550178] gene end



29540585 LHQLFCSLPHHRLR 29540544

(sequence gap)




29539619 KNALHLTPILHHPHPVRS* 29539563


LG_I.6 (-) 29575643-29574039

71D like 54% to 71D11 93% to LG_I.29

eugene3.00012625 [Poptr1:550184] gene model wrong gene has one frameshift



29575493 LHQLFGSLPHHRLRDWP 29575443










29574053 PVRS* 29574039


scaffold_1813 (+) 7926-8444

71D29 100% match duplicate seq.

grail3.1813000101|Poptr1 most of exon 2







scaffold_1517 (-) 4845-4513

97% to 71D29 100% to scaffold_19234





4545 INFAHRPHLLV 4513 (seq gap here)


scaffold_19234 (-) 368-1

95% to 71D29 N-term no gene model at JGI





scaffold_18933 (+) 920-1111

71B like N-term no gene model at JGI

may be same gene as scaffold_19234 1 aa diff to 71D29



1088 SLPHHRLR 1111


scaffold_724  (+)    13518-14366

CYP71D46P 97% to 71D29 exon 1

eugene3.07240004|Poptr1 missing end of exon 1 and all of exon 2









scaffold_724 (+) 1454-2065

2 aa diffs to 71D31P 95% to 71D29 exon 2

eugene3.07240001|Poptr1 C-term

note exon 2 precedes exon 1 on scaf_724, could be a nearly intact gene if rearranged







LG_I.2 (-) 29606262-29604787

71D like new 55% to 71D11 93% to LG_I.29

eugene3.00012629|Poptr1 gene model short with one frameshift



29606112 LHQLFGSLPHHRLRDWP 29606062









29604861 MCPGILFGISNVDLLLANLLYHFDW 29604787 (sequence gap)


scaffold_2240 (-) 487-3

CYP71D28v2 1 aa diff to 71D28, duplicate seq.








scaffold_228.17 (-) 105939-104306

71D like 54% to 71D4 60% to LG_I.29

fgenesh1_pg.C_scaffold_228000012|Poptr1 gene model wrong at N-term













104338 PIPHHPLPGN* 104306


LG_VIII.13 (+) 5139033-5140582

71D like 51% to 71D4 59% to LG_I.29

fgenesh1_pg.C_LG_VIII000713|Poptr1 gene model short, missing N-term






5139633 FPLTTDNIKSVNL 5139671 (0)



5140285 AIGRDPAYWNEPEK 5140326




scaffold_122.5 (+) 199976-202441

71D like 45% to 71D10 54% to LG_XI.14

eugene3.01220022|Poptr1 gene model seems correct








200876 TDECVKALLL 200905 (0)





202418 YDPPVKG* 202441

>CYP71D22P dup.

scaffold_122 (+) 221737-222360

71B like 100% match to scaffold_122.5 exon 2

fgenesh1_pg.C_scaffold_122000024|Poptr1 duplication, probable error in assembly






222337 YDPPVKG* 222360


LG_XI (+) 12873790-12874128




12873790 NDLGTILDETSRRN 12873831



12873977 MLFAIA 12873994 (deletion)



LG_XI.8 (+) 12875195-12876930

71D like 52% to 71D9

93% to LG_XI.14  54% to scaffold_122.5

fgenesh1_pg.C_LG_XI001081|Poptr1 gene model seems correct












12876910 YRSLVG* 12876930


LG_VI (+) 6134143-6134717

71D like 52% to 71D38 exon 2









LG_XI.14 (+) 12884309-12886030

71D like 51% to 71D9 93% to LG_XI.8 54% to scaffold_122.5

eugene3.00111066|Poptr1 gene model short














LG_XI.18 (+) 12892840-12894465

71D like pseudogene 48% to 71D4 95% to 71D39

eugene3.00111067|Poptr1 gene model short may = scaf_4500 on the end






12893412 QEAFLPIVDELTEAL 12893456







12894406 VKRKRDLKLIPISYRSLVG* 12894465



scaffold_4500 (-) 3903-3733

100% match to 71D40P




<CYP71AN new subfamily 6 sequences



LG_XVI.15 (+) 13154281-13155936 

71B like 46% to 71AH1 98% to CYP71AN2

96% to LG_XVI.24

eugene3.00161321|Poptr1 gene model short at N-term one stop codon








13155175 DVQLTRDNIIAVVL 13155216 (0)





13155925 YSP* 13155936


LG_XVI.26 (+) 13161865-13163520

71A like 44% to 71A12 97% to CYP71AN3

45% to 71AH1

eugene3.00161323|Poptr1 gene model short at N-term








13162759 DVQLTRDNIIAVVL 13162800 (0)





13163509 YSP* 13163520


scaffold_1240 (-) 6280-5579

71AN like 98% to 71AN2, 3 aa diffs duplicate seq.









LG_XVI.24 (+) 13169467-13171129

71A like 44% to 71A12

97% to CYP71AN2, 45% to 71AH1

eugene3.00161324|Poptr1 gene model short at N-term








13170371 DVQLTRDNIIAVVL 13170412 (0)





13171118 YSP* 13171129


LG_XII.23 (-) 10752455-10550851

71A like 44% to 71A22 65% to CYP71AN5

45% to 71AH1

fgenesh1_pg.C_LG_XII000892|Poptr1 gene model seems correct








10751555 SRDNLKAILM 10751526 (0)





10750850 HFPKTICN* 10750824


LG_XV.21 (-) 6427585-6426017

71B like 46% to 71B2

65% to CYP71AN4, 47% to 71J1

fgenesh1_pg.C_LG_XV000592|Poptr1 gene model seems correct












6426031 MLSP* 6426017


<CYP71AP new subfamily about equally similar to 71B and 71D (5 sequences, all named)



LG_XII.7 (+) 10772698-10774358

71B like 44% to 71B2 98% to CYP71AP2

fgenesh1_pm.C_LG_XII000331|Poptr1 gene model short at N-term













LG_XII.9 (+) 10777737-10779397

71B like 43% to 71B2 98% to CYP71AP1

eugene3.00120825|Poptr1 gene model correct








10778637 AVIL 10778648 (0)





10779377 AKPHFN* 10779397


scaffold_9416 (-) 764-3

1aa diff to 71AP2 duplicate seq. see LG_XII

fgenesh1_pg.C_scaffold_9416000001|Poptr1 gene model short, runs off the end







 14 RRFD 3


LG_XII.11 (+) 10791887-10793547

71B like 42% to 71B2 95% to CYP71AP1

fgenesh1_pm.C_LG_XII000332|Poptr1 gene model wrong on N-term








10792787 AVIL 10792798 (0)





10793518 HVIAKPHFD* 10793547


LG_XV.20 (+) 6453904-655556

71B like 44% to 71B2 90% to CYP71AP1

eugene3.00150650|Poptr1 gene model seems correct








6454804 AVIL 6454815 (0)





6455545 HFN* 6455556


<CYP71AQ new subfamily one sequence



LG_XV.25 (+) 6442643-6444377

71A like 49% to 71AJ1 47% to 71A12, 47% to 71A26

fgenesh1_pg.C_LG_XV000594|Poptr1 gene model seems correct












6444348 VVIATPHSF* 6444377


<CYP71 two unassigned pseudogenes about 9kb apart


>CYP71-un1 potri

LG_XIV (-) 9223410-9223207

71 like 50% to 71AN4

 57% to BM407381.1 potato roots EST




9223260 ENLDYLKAIIK*TLCLHP 9223207

>CYP71-un2 potri

LG_XIV (-) 9234477-9232794

71 like 42% to 71D40P





(sequence not identified here)





3 more weak pseudogenes similar to the CYP71 family


>CYP71-un3 potri

LG_VI (-) 1075479-1074052

71 like pseudogene 40% to 71D26







1075145 DAMISLTGEGSHLA* 1075101


1074950 AVEEDLVDVLL 1074918







>CYP71-un4 potri

LG_XVI (+) 158690-159330

71 like pseudogene 47% to LG_VI (-) 1074348

40% to 71D26

eugene3.00160030|Poptr1 gene model wrong





159072 IFNIKVSL* 159098

159246 DMLFAGTGVHRM 159281


>CYP71-un5 potri

LG_XI (-) 12867601-12867395

71D like pseudogene no gene model at JGI

53% to CYP71D31P





<CYP73 family 4 sequences



LG_XIII (-)12825303-12821368

85% to 73A5, 2 introns, 96% TO 73A43 10989681-10992498

eugene3.00131281|Poptr1 gene model correct 98% to 73A13 98% to 73A16

surrounding genes do not match with 73A43, not from a genome duplication















LG_XIX (+)10989681-10992498

84% to 73A5, 2 introns, 96% TO 73A42 12825303-12821368

estExt_Genewise1_v1.C_LG_XIX2612|Poptr1 gene model corrrect

RNA helicase upstream







10990413 VKERRLQLFKDYFVEERK 10990466 (2)







Scaffold_164 (+)432328-434026

65% to 73A5, 1 intron 66% to 73A42 and 73A43

79% to 73A27 tobacco

eugene3.01640067 |Poptr1 gene model correct

Carbamoyl-phosphate synthetase upstream, Nuclear exosomal RNA helicase downstream














LG_VI (-)5146670-5145983

pseudogene 82% to 73A44

eugene3.00060651|Poptr1 gene model short


Carbamoyl-phosphate synthetase upstream, Nuclear exosomal RNA helicase downstream









<CYP75 family 3 sequences



LG_I (+) 19972937-19975122

80% to 75A8 87% to CYP75A12

flavonoid 3',5'-hydroxylase

fgenesh1_pg.C_LG_I001972 [Poptr1:64620]

gene duplication with Cpn10 upstream and calcium/calmodulin kinase dowstream












19975093 RLEPNAYLA* 19975122


LG_IX (-) 6112639-6110882

87% to CYP75A13


gene duplication with Cpn10 upstream and calcium/calmodulin kinase dowstream








6111790 EKLSFTNIKALLL 6111752 (0)





6110911 RLEPNAYLA* 6110882


LG_XIII (-) 6200373-6197990

75B like 75% to 75B1









6198938 TEIKALLL 6198915 (0)





6198043 MVHPRPRLSPKVYRTPN* 6197990


<CYP76 family 17 sequences



LG_VI (-) 6443611-6441801

76C like 49% to 76G1

52% to scaffold_28  (+)  3043896

eugene3.00060817|Poptr1 gene model seems correct








6442711 IFIL 6442700 (0)





6441821 KRFNKA* 6441801


scaffold_28 (+) 3042728-3044399

76G like pseudogene 41% to 76G1

52% to LG_VI (-)  6442139

eugene3.00280293|Poptr1 gene model short missing EXXR and heme signature


3042728 MESAWNLLAG*GLFS 3042782












3044349 PLKAKPKQIGRMINVK* 3044399


scaffold_28 (+) 3040250-3041175

76 like two C-TERM fragments





LG_Ia (-) 8580345-8578719

47% to 76C4, 71% to LG_III (+) 11354190

fgenesh1_pm.C_LG_I000361 [Poptr1:48778] gene model wrong at N-term













8578733 PIQL* 8578719


LG_III (+) 11353007-11354677

76C like 47% to 76C4

71% to LG_I   (-)  8580324

estExt_Genewise1_v1.C_LG_III0204|Poptr1 gene model seems correct












11354658 RELKHG* 11354677


scaffold_256 (+) 532-1167

76G like exon 2 only

97% to scaffold_256 (+) 69529







1132 PYKGSSNHYGF* 1167


scaffold_256 (+) 26660-27136

76G like exon 1 fragment

1 aa diff to scaffold_256  6  (+)    34579







scaffold_256 (+) 32430-34839

76G like 66% to 76G1

97% to scaffold_256 (+) 69529

fgenesh1_pg.C_scaffold_256000007|Poptr1 gene model correct








33330 NAIVL 33344 (0)





34804 PYKGSSHHYGF* 34839


scaffold_256 (+) 67375-69789

76G like 66% to 76G1

97% to scaffold_256 (+) 34579

eugene3.02560008|Poptr1 gene model correct








68275 NAIVL 68289 (0)





69754 PYKGSSNHDGF* 69789


scaffold_256 (+) 78586-81678

76G like 68% to 76G1

97% to scaffold_256 (+)   100990

fgenesh1_pg.C_scaffold_256000012|Poptr1 gene model seems correct








79486 NVIVF 79500 (0)





81643 PYKGSSNHDGF* 81678


scaffold_256 (+) 98560-101256

76G like 68% to 76G1

97% to scaffold_256 (+) 81418

eugene3.02560012|Poptr1 gene model correct








 99460 NVIVF 99474 (0)





101224 PYKRSSDHYGF 101256


LG_II (+) 11243028-11244627

76C like 51% to 76C4

97% to LG_II    (+) 11302436

eugene3.00021389 [Poptr1:552074] gene model short at N-term, frameshift








11243882 KENNTELSSTDIQVLLI 11243932 (0)






LG_II (+) 11302436-11304039

76C like new 50% to 76C4

96% to LG_II       (+) 11371594

eugene3.00021394|Poptr1 gene model seems correct




11302736 SRTVPDALHVQYYN 11302777










LG_II (+) 11339047-11340633

76C like 52% to 76C4

95% to LG_II      (+) 11302436-11304039

fgenesh1_pm.C_LG_II000640 [Poptr1:342710] gene model seems correct













LG_II (+) 11361815-11362516

76C like

93% to LG_II    (+) 11371594


(sequence gap)







(sequence gap)


LG_II (+) 11370278-11371869

76C like 52% to 76C4

96% to LG_II         (+) 11302436

fgenesh1_pg.C_LG_II001397 [Poptr1:347891] gene model seems correct













scaffold_5854 (+) 673-2263

76 like 51% to 76C4 50% to 76F2 Vitis vinifera

97% to LG_II   (+) 11340358

eugene3.58540001|Poptr1 gene model short in middle 1 frameshift














<CYP80 family 8 sequences



LG_XII (-) 13076542-13074912

76G like 45% to 76C2 49% to 80B2

66% to LG_XV        (-) 10045180

estExt_fgenesh1_pg_v1.C_LG_XII0135|Poptr1 gene model seems correct













scaffold_12820 (-) 312-52

76C like N-term 50% to 76C3 no gene model at JGI

probable pseudogene 65% to LG_XII      (-) 13076542





LG_XV (-) 10046207-10044971

76C like 43% to 76C2

68% to LG_XII    (-) 13075301

fgenesh1_pg.C_LG_XV001071|Poptr1 Missing N-term in a seq gap

(seq gap)











LG_XII (-) 13112302-13111922

76C like pseudogene

80% to LG_XII     (-) 13087099






>CYP80D1 LG_XII        (-) 13100933-13099325    76G like 41% to 76C2

97% to LG_XII     (-) 13087099

eugene3.00121149|Poptr1 gene model seems correct













LG_XII (-) 13087162-13085557

76G like 42% to 76C2

97% to LG_XII        (-) 13100870

eugene3.00121147|Poptr1 gene model seems correct








13086262 SFFV 13086251 (0)






LG_I (+) 2171265-2172908

39% to 76C4

58% to LG_I       (+)  8156063

eugene3.00010276 [Poptr1:547835] gene model correct












2172891 PKIKN* 2172908


LG_I (+) 8155946-8158046

76G like  41% to   76G1

58% to LG_I       (+) 2172267

estExt_fgenesh1_pg_v1.C_LG_I0934 [Poptr1:691155] gene model seems correct












8158020 LLVPTSKK* 8158046


<CYP77 family 4 sequences



LG_VIII (-) 1164925-1163381

no introns 72% to 77A4

fgenesh1_pg.C_LG_VIII000203 gene model correct

Transcription factor GT-2 related protein upstream, E3 ubiquitin ligase downstream












1163425 SMKNSLRAMIKPRV* 1163381


LG_X (-) 21016073-21015481

pseudogene 64% to 77A10



Transcription factor GT-2 related protein upstream, E3 ubiquitin ligase downstream



21015998 EIKSTAGDRKVDEKDVEK 21015945


21015649 ICPGLWLATVHLHLMVAK 21015596



LG_IV (-) 589294-587777

68% to 77B1 71% to CYP77B4


tandem duplication not genome duplication, 16kb from 77B4












587794 VILPR* 587777


LG_IV (+) 605695-607218

66% to 77B1 no introns 71% to CYP77B3

fgenesh1_pm.C_LG_IV000021|Poptr1 gene model has wrong N-term

tandem duplication not genome duplication, 16kb from 77B3












607195 KAVILPR* 607218


<CYP78 family 14 sequences

Note: The CYP78 family had four subfamilies, three were added in rice, but

due to early naming decisions, sequences in the logical B and C subfamilies

were named as 78A sequences.  Five of these now have publications, so to

avoid confusion. the B and C subfamilies are being included as part of a

larger A subfamily.  Renamed rice sequences are CYP78B4P = 78A12P,

78B5 = 78A13, 78B6 = 78A14,78C5 = 78A15, 78C6 = 78A16, 78C7 = 78A17

(the names 78B1 to B3 and C1 to C4 were never used.  They were reserved in

case name changes were made to some of the 78A sequences).



LG_Vb (-) 1989840-1988143

78A like 70% to 78A7

estExt_fgenesh1_pg_v1.C_LG_V0235|Poptr1 gene model seems correct













1988181 KYPLHAVAVGRK* 1988143


LG_Va (-) 13684462-13682757  

78A like 68% to 78A7

fgenesh1_pm.C_LG_V000403|Poptr1 gene model correct













13682789 PLSAVAIPKE* 13682757


LG_II (+)  4123900-4125604

78A like 67% to 78A7

fgenesh1_pg.C_LG_II000566 [Poptr1:347060] gene model correct













4125590 IPRN* 4125604


LG_VII (-) 5114877-5113187

78A like 69% to 78A7

eugene3.00070646|Poptr1 gene model correct















scaffold_2390 (-) 7318-5629

78A like 69% to 78A7

eugene3.23900001|Poptr1 gene model missing some seq before the PERF motif















LG_Ib (+) 6124306-6126694

68% to  78A9

eugene3.00010701 [Poptr1:548260] gene model correct








6125230 LHGPDKLSHHDMIAVLW 6125280 (0)





6126653 SNPLTIKVNPRRR* 6126694


LG_IIIb (-) 13439255-13437042

78A like 68% to 78A9

eugene3.00031195|Poptr1 gene model correct













13437074 LTVKVNPRRR* 13437042


LG_IIc (+) 13511138-13512986

78A like 72% to 78A9

eugene3.00021624 [Poptr1:552309] gene model seems correct














13512933 SHYKPTVLGVQNYVLDV* 13512986


LG_XIV (-)  3837010-3835172

78A like 72% to 78A9

estExt_fgenesh1_pg_v1.C_LG_XIV0445|Poptr1 gene model seems correct













3835210 VRPRRSSQSPLY* 3835172


scaffold_3645 (-) 4941-3651

78A like PSEUDOGENE 64% to 78A10










4019 CSDMIAVLW 3993

3870 EMIFR 3856




LG_IIIa (+) 15447061-15449577

78A like 50% to 78A5

fgenesh1_pg.C_LG_III001462|Poptr1 gene model short at N-term








15447967 EDQLNESDMVALLW 15448008 (0)






LG_Ia (-)  3924905-3921817

51% to 78A5

fgenesh1_pg.C_LG_I000468 [Poptr1:63116] gene model correct








3924002 EQERLDESDMVPLLW 3923958 (0)





3921840 ADFDQKT* 3921817


scaffold_1387 (-) 6082-5135

78A like 1 aa diff to LG_I 3922062

estExt_Genewise1_v1.C_13870002|Poptr1 runs off end in intron seq

probable duplicate seq of LG_I 3922062










LG_IX 340405-340566

CYP78 like pseudogene

69% to LG_I (-)  3924905




<CYP79 family 6 sequences



LG_XIII (+) 12617173-12619030

79D like 58% to 79D1

eugene3.00131268|Poptr1 gene model seems correct








12618073 KDRNGNPLLSKDEIKAQIT 12618129 (0)





12619001 PRLRPQVYPGY* 12619036


LG_XIII (+) 12759202-12761058

79B like 57% to 79D1 95% to 79D5

fgenesh1_pg.C_LG_XIII001242|Poptr1 gene model seems correct








12760102 KDRHGNPLLSKDEIKAQIT 12760158 (0)





12761029 PRLPPQVYPGY* 12761064


scaffold_1585 (-) 9137-7275

79B like 58% to 79D1 95% to 79D5

eugene3.15850001|Poptr1 gene model seems correct only 2aa diffs to 79D6 possible duplicate













7310 PRLPPQVYPGY* 7275


LG_XIII (+) 12783206-12785069

79B like 58% to 79D1, 99% to 79D5

eugene3.00131275|Poptr1 gene model seems correct only 5aa diffs to 79D5, seems odd








12784106 KDRNGNPLLSKDEIKAQIT 12784162 (0)





12785034 PRLPPQVYPGY* 12785069


LG_IV (+) 3871814-3873941

79A like 56% to 79D1 73% to 79D5

eugene3.00040407|Poptr1 gene model seems correct













3873915 LPAHLYPK* 3873941


LG_II (-) 16041237-16040849

79D like 78% to 79D8







<CYP81 family 50 sequences



LG_IIc (-) 9154259-9152268

81D like 47% to 81D8

59% to LG_II        (-)  9149602

fgenesh1_pg.C_LG_II001121 [Poptr1:347615] gene model short in middle, one frameshift













scaffold_1047 (+) 16009-16578

81D like  46% to 81D6 N-term no model at JGI

100% to LG_II       (-)  9152501 duplicate seq







LG_IId (-) 9151207-9149369

81D like 49% to 81D2

95% to scaffold_1047  (+)     5087

fgenesh1_pm.C_LG_II000512 [Poptr1:342582] gene model seems correct












9149398 SMANLLSQI* 9149369


LG_IIb (-) 9145798-9143865

81D like 50% to 81D8

78% to LG_XIV      (-)   929000

eugene3.00021123 [Poptr1:551808] gene model short on N-term













scaffold_1047 (+) 3473-5320

81D like 51% to 81D3

95% to LG_II        (-)  9149602

eugene3.10470001|Poptr1 gene model seems correct












5291 SMANLLSQI* 5320


scaffold_1047 (+) 8471-9091

81D like duplicate seq

100% to scaffold_1047  (+) 3473-5320

eugene3.10470002|Poptr1 exon 2 only







9062 SMANLLSQI* 9091


LG_XIV (-) 930738-928767

81D like 51% to 81D8

93% to scaffold_40  (+)  2691314

eugene3.00140107|Poptr1 gene model seems correct












928787 TLLSQI* 928767


scaffold_40 (+) 2662475-2663606

81D like pseudogene N-term

73% to LG_IIc  (-)  9152501



2662625 NLSN













scaffold_40 (+) 2666003-2667947

81D like pseudogene, one frameshift

98% to scaffold_40  (+)  2687031

91% to LG_XIV       (-)   929000 with one frameshift

fgenesh1_pg.C_scaffold_40000328 [Poptr1:94216] model short (2 genes fused?)





2666453 SMICVLFRNQNQ 2666488










scaffold_40 (+) 2671685-2672180

81D like pseudogene exon 2 only




2671983 WAIQNDPKIWRDPTKF 2672030




scaffold_40 (+) 2676659-2676886

81D like N-term frag.

100% match to scaffold_40   (-)  2662499



2676809 NLSN



(sequence gap)


scaffold_40 (+) 2684818-2685009

81D like N-term frag.

 scaffold_40   (+)  2685841-2687264          81D like

98% to scaffold_40     (+)  2667714

fgenesh1_pg.C_scaffold_40000329 [Poptr1:94217] model short

(N-term in a sequence gap)



2684968 RTLSKISDKHGPVI 2685009

(sequence gap)



2686141 LQETEPEYYTDDIIKGLVV 2686197 (0)







scaffold_40 (+) 2689865-2690096







scaffold_40.6 (+) 2691314-2693223

81D like 51% to 81D8

94% to LG_XIV      (-)   929000

fgenesh1_pg.C_scaffold_40000330 [Poptr1:94218] gene model short, 2 frameshifts















scaffold_40 (+) 2695016-2695445

81D like N-term frag.





scaffold_40.7 (+) 2698671-2700987

81D like 51% to 81D8

88% to LG_XIV      (-)   929000

fgenesh1_pg.C_scaffold_40000331 [Poptr1:94219] bad boundary, gene model too long













scaffold_40 (+) 2701996-2702187

81D like 84% to 40.7



2702146 CRPRPSMLGHISQI 2702187


scaffold_10588 (+) 2-1138

81D like runs off the end

 89% to scaffold_40  (+)  2687031










scaffold_40.4 (-) 2639518-2637241

81D like 45% to 81A7

3 aa diffs to scaffold_40   (-) 2633172

fgenesh1_pg.C_scaffold_40000322 [Poptr1:94210] gene model seems correct








2638618 KSTVL 2638604 (0)





2637258 LLSHL* 2637241


scaffold_40.3 (-) 2633172-2630892

81D like 45% to 81A7

3 aa diffs to scaffold_40   (-)  2637726 duplicate seq

fgenesh1_pg.C_scaffold_40000321 [Poptr1:94209] gene model seems correct








2632272 KSTVL 2632258 (0)





2630909 LLSHL* 2630892


LG_IIa (+) 9173256-9175652

81K like 51% to 81K1

72% to scaffold_40  (-)  2637726

fgenesh1_pg.C_LG_II001124 [Poptr1:347618] gene model seems correct








9174156 LS 9174161 (0)





9175623 DLTTLLYHP* 9175652


scaffold_64 (-) 903647-903045

81K like pseudogene 37% to 81K2 aa107-293

86% to scaffold_64   (-)   863860

eugene3.00640126|Poptr1 gene model wrong


903647 SYSYTAFLFAP 903615








scaffold_64 (-) 881364-879605

81K like 43% to 81K1

2 aa diffs to scaffold_64    (-)   863860 duplicate seq

92% to scaffold_279  (-)    94272

eugene3.00640125|Poptr1 gene model seems correct








880464 KGTMA 880450 (0)





879628 TTLISPP* 879605


scaffold_64a (-) 865374-863615

81K like 41% to 81K1

2 aa diffs to scaffold_64   (-)   879850 duplicate seq

eugene3.00640122|Poptr1 gene model seems correct








864474 KGTMA 864460 (0)





863638 TTLISPP* 863615


scaffold_279 (-) 96174-94443

81D like 43% to 81K1 43% to 81A6

92% to scaffold_64   (-)   879850

eugene3.02790010|Poptr1 gene model seems correct, short at XXXXXXX












94466 TSLISPP* 94443


scaffold_279 (-) 99748-99595

pseudogene PKG-PERF region of 81 like

78% to scaffold_64   (-)   879850






scaffold_40.2 (-) 2629530-2627051

81D like 50% to 81K2

scaffold_40   (-)  2625145          81D like

56% to scaffold_64  (-)   879850

fgenesh1_pg.C_scaffold_40000320 [Poptr1:94208] 2 genes fused?












2627071 NLFSQL* 2627051


scaffold_40 (-) 2625277-2624657

81D like exon 2 94% to40.2






2624677 NLFSQL* 2624657


scaffold_2410 (+) 3342-5208

81D like 43% to 81A6

90% to scaffold_150   (+)   568752

fgenesh1_pg.C_scaffold_2410000001|Poptr1 gene model seems correct short at N-term














scaffold_816 (-) 15204-14722

81D like

1 aa diff to scaffold_2410  (+)     4972 duplicate seq

eugene3.08160005|Poptr1 gene model short





14754 MLLSLSGQKI* 14722


scaffold_86 (-) 269140-268941

81D like pseudogene

74% to scaffold_816  (-)     1148





268979 SSDCTIGGYNPPD 268941


scaffold_816 (-) 1920-927

81D like

95% to scaffold_2410  (+)     4972


(sequence gap)







 950 ILDMLLS* 927


scaffold_150b (+) 437927-439595

81D like 51% to 81D6

68% to scaffold_150  (+)   568752

estExt_Genewise1_v1.C_1500155|Poptr1 gene model seems correct












439575 NVLSRA* 439595


scaffold_150 (+) 506775-507275

81D like duplicate seq

100% match to scaffold_2410 (+)     4972








scaffold_150c (+) 551355-553284

81D like 53% to 81D8

88% to scaffold_2410 (+)     4972

eugene3.01500069|Poptr1 gene model short on N-term (seq gap at N-term)












553243 ILDMLLSLSGQKI* 553284


scaffold_150 (+) 562399-563313

81F like 52% to 81D6 exon 1 only

96% to scaffold_150  0  (+)   568752









563299 KGHVL 563313 (0)


scaffold_150a (+) 567120-568973

81D like 54% to 81D8

89% to scaffold_2410  (+)     4972

eugene3.01500072|Poptr1 gene model correct








568020 KGHVL 568034 (0)





568950 ILDMLLS* 568973


LG_Va (+) 5628907-5630507

81D like 55% to 81D8

74% to LG_VIII       (-) 14685473

grail3.0027010302|Poptr1 gene model seems correct














LG_Vb (+) 5648929-5650535

81D like 51% to 81D8

91% to LG_VII      (+) 1874399

eugene3.00050527|Poptr1 gene model seems correct












5650503 ARSDLDNIIS* 5650535


LG_V (+) 5671068-5672773

81D like 51% to 81D1

91% to scaffold_205  (-)    33143

estExt_Genewise1_v1.C_LG_V4163|Poptr1 gene model seems correct












5672747 PNTHNLLA* 5672773


LG_IV (+) 7961227-7961940

81D like pseudogene

66% to LG_Va       (+)  5630262








scaffold_205a (-) 68149-59691

81D like 56% to 81D3

56% to scaffold_150  (+)   439368

fgenesh1_pg.C_scaffold_205000005|Poptr1 gene model seems correct














scaffold_205b (-) 34570-32904

81D like 49% to 81D8

91% to LG_V   (+)  5672534

fgenesh1_pg.C_scaffold_205000003|Poptr1 gene model seems correct












32933 RPNTHSLLA* 32904


scaffold_11555 (-) 1500-306

81D like 51% to 81D8

98% to scaffold_205  (-)    33143 duplicate sequence

fgenesh1_pg.C_scaffold_11555000001|Poptr1 gene model missing N-term 175aa

runs off the contig end









 335 RPNTHNLLA* 306


LG_VII (+) 1874399-1875984

81D like 52% to 81D8

91% to LG_V        (+)  5650287

fgenesh1_pg.C_LG_VII000292|Poptr1 gene model seems correct













LG_VIII (-) 14685512-14683933

81D like 53% to 81D8

74% to LG_V     (+)  5630262

estExt_fgenesh1_pm_v1.C_LG_VIII0029|Poptr1 gene model seems correct













scaffold_5464 (-) 3066-2671

81D like

100% to LG_VIII    (-) 14685473 duplicate sequence runs off the end







scaffold_40.1 (-) 2622115-2620377

49% to 81D2 like may be too long at CYAN

52% to scaffold_1047  (+)     5087

eugene3.00400361 [Poptr1:592016] gene model wrong at C-term








2621215 TDQTIKGVIM 2621186 (0)





2620400 VNLLSSM* 2620377


scaffold_40 (-) 2620375-2620241

81D like pseudogene

repeat of C-terminal right after the gene




scaffold_40 (-) 2619478-2619251

81D pseudogene heme signature 72% to 81D2



2619295 KAMFKARMSMIDVLA* 2619248


<CYP82 family 36 sequences



scaffold_40d (-) 1598233-1596082

82C like 68% to 82C4 Arab.

65% TO 82C2, 63% to 82C3, 58% to scaffold_130  0  (-)   99503

eugene3.00400215 [Poptr1:591870] gene model short at N-term

1598233 MDPSPQLIAIALFFPCVL 1598180 repeat of N-term seq.





1597726 ASRPTTVAAKH 1597694 (?)









1596108 LPPKLYGY* 1596082


scaffold_40 (-) 1585647-1585558

82C like N-term seq

2aa diffs to 82C5





1585260 SFWREMRKIA 1585231


scaffold_40 (-) 1589818-1590441

82C like new

97% (6aa diffs) to CYP82C8v1

eugene3.00400214|Poptr1 82C like middle







scaffold_40 (-) 1572611-1572060

82C like N-term

98% to scaffold_15402  (+)     392

eugene3.00400213|Poptr1 Gene model short N-term only






1572098 QWIGNKSNSQKLV 1572060


scaffold_15402 (+) 209-760

82C like

98% (3 aa diffs to scaffold_40  (-)  1572611

97% (4 aa diffs) to scaffold_829  (-)   129175








scaffold_5894 (-) 2108-2

82C like 47% to 82C4

95% to scaf_5606 runs off end

94% to scaffold_829   (-)   129175

eugene3.58940001|Poptr1 gene model short












scaffold_40 (-) 1565307-1564681

81D like

96% to scaffold_829  (-)   129175

first part 100% to 82C8v1, may be the C-term of 82C8v1

eugene3.00400211 [Poptr1:591866] gene model short, only last exon






1564704 PGLYDLQ* 1564681


scaffold_40 (-) 1555735-1555331

82C like

97% to scaffold_829  (-)   129175

100% to CYP82C8v2

eugene3.00400209 [Poptr1:591864] gene model short






scaffold_829 (-) 131153-128927

82C like 50% to 82C4

94% to scaffold_5894 (-)     2108

eugene3.08290002|Poptr1 gene model seems correct













128956 LSPGLYDLQ* 128927


scaffold_5606 (-) 1564-608

82C like

2 aa diffs to scaffold_829  (-)   129175 duplicate seq











scaffold_40 (-) 1551888-1550208

82C like

99% (3 aa diffs) to scaffold_829   (-)   129175 duplicate seq

eugene3.00400208 [Poptr1:591863] gene model short at N-term









1550243 PRLSPGLYDLQ* 1550208


scaffold_40b (-) 1533682-1531659

82C like 50% to 82C4

98% to scaffold_40  (-) 1522560

fgenesh1_pg.C_scaffold_40000184 [Poptr1:94072] gene model correct













1531685 LSSRLYGH* 1531659


scaffold_397 (-) 54684-54058

100% match to scaffold_40 (-) 1533682

fgenesh1_pg.C_scaffold_397000004|Poptr1 duplicate seq exon 2






54087 RLSSRLYGH* 54058


scaffold_40a (-) 1522560-1520144

82C like

98% to scaffold_40  (-)  1533682

fgenesh1_pg.C_scaffold_40000183 [Poptr1:94071] gene model short at N-term













1520170 LPSRLYGH* 1520144


scaffold_7290 (+) 1373-2155

82C like exon 1 partial seq

100% to scaffold_40  (-)  1522560 duplicate seq










scaffold_13620 (-) 1352-2

82C like 52% to 82C4 no gene model at JGI

97% (3 aa diffs ) to scaffold_40  (-)  1522560 duplicate seq






scaffold_1564 (+) 5393-6497

82C like missing N-term

91% to LG_IX     (-)  3542415









6480 IAYEF* 6497


scaffold_1564 (+) 2035-2163

82C like C-term pseudogene fragment




scaffold_18213 (+) 303-1138

82C like runs off both ends

2 aa diffs to scaffold_1564  (+)     5989 duplicate seq








scaffold_5479 (+) 1092-2785

82C like partial seq

92% to CYP82C9v1

2aa diffs to scaffold_40  0   (-)  1555735










2759 SPGLYDLQ* 2785


scaffold_130 (-) 112070-99249

82C like pseudogene 52% to 82C4

69% to scaffold_2789  (+)     4238

fgenesh1_pg.C_scaffold_130000005|Poptr1 gene model seems wrong

large insertion in exon 1 no good boundary for insertion

other CYP71 clan sequences only have one intron.





111620 KHVRDTETKLLLKDLHDRSINTTKKMG 111540 (large insertion here)








 99275 LHSSLYEC* 99249


LG_IX (-) 3544141-3542158

82C like 49% to 82C2

98% (6 aa diffs to scaffold_2789 duplicate seq

fgenesh1_pg.C_LG_IX000559|Poptr1 gene model short at N-term 1 stop, 1 frameshift









3543224 ADTTVKATCL 3543195 (0)





3542184 LPSIAYEF* 3542158


scaffold_2789 (+) 2508-4492

82C like 51% to 82C4

98% to LG_IX   (-)  3542415

estExt_Genewise1_v1.C_27890004|Poptr1 gene model short on N-term













4466 LPSIAYEF* 4492


scaffold_20448 (+) 647-1056

82C like

1 aa diff to scaffold_2789  (+)     4238 duplicate seq








scaffold_40 (-) 1539510-1539424

82C like pseudogene no model exists




scaffold_40 (-) 1527266-1527180

82C like pseudogene no gene model at JGI

79% to scaffold_40   (-)  1533682




LG_II (-) 16609905-16609795

82C like heme region, no gene model exists

67% to scaffold_40   (-)  1555735




LG_X (-) 7735686-7735582

82C like 65% to scaffold_40     (-)  1598233

68% to 82C4 C-helix region probable pseudogene




scaffold_7045 (+) 1877-1981

82C like pseudogene

C-helix region 68% to 82C4

100% to LG_X    (-)  7735674

65% to scaffold_40     (-)  1598233




scaffold_40c (-) 1540989-1542721

82C like 50% to 82C4

58% to 82D1, 55% to scaffold_40     (-)  1598233

eugene3.00400207 [Poptr1:591862] gene model correct








1541821 LAGYDADTVRKATSL 1541777 (0?)





1541039 VLVKPRLPASVYEYRF* 1540989


LG_I (-) 23341018-23339071

82C like 50% to 82C2

51% to scaffold_40  (-)  1598233

eugene3.00012095 [Poptr1:549654] gene model short at N-term








23340118 DDSMFGYSRETIIKATAM 23340065 (0)





23339100 LSPELYYEC* 23339071


LG_I (-) 23611288-23610335

82C like

100% to LG_I          (-) 23339331 duplicate seq, assembly error?

eugene3.00012097 [Poptr1:549656] model short








23610388 DDSMFGYSRETIIKATAM 23610335 (0)


scaffold_173 (+) 109052-112871

82C like pseudogene

first part 76% to LG_I (-) 23339331, second part 60%

eugene3.01730007|Poptr1 gene model wrong












112860 ILNF 112871


LG_XVI (-) 168971-167389

82C like 49% to 82C4

55% to scaffold_40     (-)  1598233

fgenesh1_pg.C_LG_XVI000029|Poptr1 gene model seems correct












167415 LENEIYQH* 167389


LG_IV (+) 8826205-8827922

82G like 55% to 82G1

82% to scaffold_142    (-)   531695

estExt_Genewise1_v1.C_LG_IV4159|Poptr1 gene model seems correct








8827105 RDVVIKATAL 8827134 (0)





8827902 LGLELY* 8827922


scaffold_142 (-) 531878-529641

82G like 55% to 82G1

82% to LG_IV   (+)  8827671

eugene3.01420074|Poptr1 gene model seems correct








530978 ATTL 530967 (0)





529664 LGLPLYN* 529641


<CYP83 family 21 sequences



LG_II (-)1594296-1594132

83F pseudogene N-term fragment

100% to CYP83F1v1




LG_II (-) 1597238-1596704

83F like no gene model exists 48% to 71A25

3aa diffs to 83F1 probable duplicate







LG_II (-) 1617938-1616292

83A like 53% to 83A2

fgenesh1_pg.C_LG_II000227 [Poptr1:346721] gene model seems correct












1616327 PKAYAVMGNDA* 1616292


LG_II (+) 1630135-1630206

CYP83F N-term fragment




LG_II (+) 1650845-1651086

83F like pseudogene no model exists 42% to 71B14






LG_II (+) 1655600-1657684

83A like 48% to 83A2

eugene3.00020232 [Poptr1:550917] gene model seems correct














LG_II (+) 1667099-1667266

83F like pseudogene 100% to 1702772

eugene3.00020233 [Poptr1:550918]





LG_II (+) 1671977-1672045

CYP83F N-term fragment




LG_II (+) 1685541-1685612

CYP83F N-term fragment




LG_II (+)  1688396-1689904

95% to 83F3v1

eugene3.00020236 [Poptr1:550921]

eugene3.00020237 [Poptr1:550922] same gene 95% to 83F3v1




1688696 HIKAILT 1688716 (0)







LG_II (+) 1697711-1697881

83F like pseudogene no gene  model exists

nearly same seq as above





LG_II (+) 1702691-1702858

83F like pseudogene no gene model exists

almost 90% to 83F2 with one deletion of 15 aa





LG_II (+) 1707953-1708189

83F like 100% to 83F2

eugene3.00020238 [Poptr1:550923] N-term only may be an assembly error



1708103 NLHQYLWKLSQKHGPLVYLRLGFKPALIV 1708189 (sequence gap)


LG_II (+) 1708840-1710924

83A like 48% to 83A2

eugene3.00020239 [Poptr1:550924] gene model seems correct














scaffold_16122 (-) 481-1221

83A like 45% to 83A2

fgenesh1_pg.C_scaffold_16122000001|Poptr1 exon 1 runs off end

3aa diffs to LG_II (+)  1708800-1710800, possible duplicate








scaffold_16034 (+) 2-547

83F like C-term

94% to CYP83F3v1








scaffold_1594 4660-3013

53% to 83A2/83B1 1 intron

eugene3.15940001|Poptr1 gene model correct












3048 PKAYAVMGNDA* 3013


scaffold_1594 10925-10809

C-terminal duplication of CYP83A no gene model




LG_V (-) 16417765-16416052

83A like 50% to 83A2

fgenesh1_pg.C_LG_V001516|Poptr1 two genes fused, or extra exon at C-term end

internal intron boundary wrong, frameshift








16416745 NI 16416740







LG_V (-) 16414413-16413906

83F like pseudogene exon 2 missing PERF motif

77% to CYP83F3v1







scaffold_2741 (-) 1250-743

83F like pseudogene 65% to 83F2 duplicate seq

fgenesh1_pg.C_scaffold_2741000001|Poptr1 100% match to LG_V  (-) 16414413







<CYP84 family 4 sequences, 3 full length, 1 pseudogene

all four genes have the same neighbors



scaffold_57 (-) 1038584-1035782

84A like 76% to 84A1

91% to LG_VII (+) 11484731, 66% to LG_IX  (-)  2646866

80% to AY621153.1   Camptotheca acuminata

79% to AF139532 Liquidambar styraciflua aldehyde 5-hydroxylase

eugene3.00570124|Poptr1 gene model short add 12 aa to N-term

GATA-4/5/6 transcription factor upstream, Calcium-binding EF-hand protein downstream

RNA polymerase I transcription factor UAF further downstream












1035802 RVVCPL* 1035782


LG_VII (+) 11484731-11486533

84A like 73% to 84A1

eugene3.00071182|Poptr1 gene model correct

GATA-4/5/6 transcription factor upstream, Uncharacterized membrane protein downstream

Calcium-binding EF-hand protein further downstream

RNA polymerase I transcription factor UAF even further downstream








11485631 DNIKAIIM 11485654 (0)





11486492 LVAVPSKRVLCPL* 11486533


LG_IX (-) 2646866-2644256

84A like 69% to 84A1

68% to LG_VII (+) 11484731, 83% to pseudogene LG_IV (+) 15006407

fgenesh1_pg.C_LG_IX000422|Poptr1 gene model correct

GATA-4/5/6 transcription factor upstream, Uncharacterized membrane protein downstream

RNA polymerase I transcription factor UAF further downstream








2645966 VKFNKDHIKALIM 2645928 (0)







LG_IV (+) 15006407-15008324

84A like pseudogene 65% to 84A1

fgenesh1pg.C_LG_IV001352|Poptr1 gene model wrong, missing C-term

multiple frameshifts

GATA-4/5/6 transcription factor upstream, RNA polymerase I transcription factor UAF downstream








15007320 NNFDESKSTIKFNKDNIKALIM 15007385 (0)





<CYP89 family 19 sequences



LG_XIIIa (-) 6605099-6603552

60% to 89A5

fgenesh1_pg.C_LG_XIII000744|Poptr1 no introns

78% to LG_XIII    (-) 6638846

grail3.0055004201|Poptr1 same gene as above join












6603599 NPLHAHISRRSRSKV* 6603552


LG_XV (+) 7140835-7141622

89A like 80% to LG_XIII  (-) 6605099

eugene3.00150747|Poptr1 gene model wrong probable pseudogene





7141581 MTPFGVGRRMCPGY 7141622


LG_XIIIb (-) 6638846-6637305

63% to 89A5

97% to LG_XIII    (-) 6648270

grail3.0055004301|Poptr1 gene model correct no introns












6637346 NPLRAHLSRRVAS* 6637305


LG_XIIIc (-) 6648270-6646729

63% to 89A5

eugene3.00130759|Poptr1 gene model correct no introns












6646770 NPLRAHLSRRVAS* 6646729


scaffold_1182 (+) 2410-3939

64% to 89A5

eugene3.11820001|Poptr1 gene model correct no introns












3910 QAQICPRLK* 3939


scaffold_1691 (-) 2042-808

89A like 2 aa diffs to scaf_1182 duplicate


eugene3.16910001|Poptr1 part of the same gene as above




(sequence gap)









scaffold_18069 (+) 2-552

89A like duplicate

100% to scaf 1691 and scaf 1182








scaffold_8029 (+) 3-257

89A like C-term 68% to 89A9 no gene model at JGI

95% to scaf 1182 probable pseudogene





LG_VII (+) 4351919-4358145

89A like 63% to 89A5 possible pseudogene

fgenesh1_pm.C_LG_VII000171|Poptr1 gene model short at N-term and heme signature

possible insertion in no intron gene, CYP89 genes usually have no introns











4353170 EDPMAFKPERFLSSGGETFDITGSREIKMMPF 4353265 (4700bp insertion)


4358095 VVMKNPLQAQICPRVK* 4358145


LG_V (+) 1583967-1585490

63% to 89A5

85% to scaffold_1182

eugene3.00050187|Poptr1 gene model correct no introns












1585452 NPLQAQICPRLK* 1585490


scaffold_9149 (-) 618-1

89A like runs off end

95% to scaf 1182

eugene3.91490001|Poptr1 gene model is wrong






 18 KIMEVQ 1


scaffold_19769 (+) 488-1081

89A like runs off end

97% to LG_VII      (+)  4357945 4 aa diffs

eugene3.197690001|Poptr1 gene model wrong







scaffold_1954 (-) 5819-5235

89A like

97% to LG_VII      (+)  4357945

eugene3.19540001|Poptr1 gene model is short, missing C-term half






(sequence gap here)


LG_XV (+) 412465-414027

89A like 52% to 89A5

76% to LG_VIII    (+)  6182991

eugene3.00150072|Poptr1 gene model seems correct














LG_VIII (+) 6182991-6184553

89A like 56% to 89A4

76% to LG_XV  (+)   413539

fgenesh1_pg.C_LG_VIII000875|Poptr1 join two models










6184191 EYLIPETAAINFLVAE 6184238



6184536 HLSPR* 6184553


scaffold_15445 (+) 1-348

89A like 87% to LG_VIII (+)  6182991

fgenesh1_kg.C_scaffold_15445000001|Poptr1 model runs off the end






LG_I (-) 24001619-24000402

89A like 53% to 89A5

83% to LG_VIII  (+)  6182991

fgenesh1_pg.C_LG_I002304 [Poptr1:64952] gene model short missing C-term










24000419 NEYLIP 24000402 sequence gap here


LG_III (+) 10170571-10172100

89A like 48% to 89A5 no introns

52% to LG_XIII   (-) 6638846

fgenesh1_pg.C_LG_III000826|Poptr1 gene model correct












10172071 PLRVHISPRTC* 10172100


scaffold_29 (+) 3163988-3165482

89A like pseudogene 53% to 89A3

74% to LG_III (+) 10171903

eugene3.00290314|Poptr1 gene model fuses two genes, an F-box cyclin and a P450 C-term






3164606 SQIFLKFNLL 3164635







3165137 DVPKNSIINFTVADMA* 3165187



3165437 KHE 3165445

3165447 NPLLVHICPRTC 3165482


<CYP92 family 13 sequences



scaffold_158a (-) 58842-57112

92A like 72% to 92A9 95% to LG_III (+)  3650544

eugene3.01580006|Poptr1 gene model correct












57147 EPRLPAHVYPK* 57112


scaffold_3771 (-) 2060-330

92A like  71% to 92A9 

100% to CYP92A17v1 duplicate seq.

grail3.3771000201|Poptr1 gene model short at C-term













scaffold_158b (-) 69821-67869

92A like 61% to 92A9

estExt_fgenesh1_pg_v1.C_1580005|Poptr1 gene model correct













67907 AEPRLPPHLYSV* 67869


LG_IIIa (+) 3649066-3651041

92A like 71% to 92A9

eugene3.00030242|Poptr1 gene model correct












3651006 EPRLPAHVYPK* 3651041


LG_III (+)  3641419-3641829

92A like 72% to 92A8

100% to LG_III  I        (+)  3650544 duplicate seq

eugene3.00030241|Poptr1 sequence runs into a seq gap






LG_III (+) 3610917-3612657

92A like 63% to 92A9

1 aa diff to LG_III    (+)  3593164

71% to LG_VII      (-)  9437395

72% to LG_III   (+)  3641408


grail3.0037002701|Poptr1 part of same gene as above













3612619 LEPRLPAHMYSM* 3612657


LG_III (+) 3593032-3593661

92A like exon 2

grail3.0037002501|Poptr1 1 aa diff to LG_III (+)  3612160 duplicate






3593623 LEPRLPAHMYSM* 3593661


LG_IIIb (+) 3591921-3593661

92A like 3 aa diffs to LG_III (+) 3610917













3593623 LEPRLPAHMYSM* 3593661


LG_VII (-) 9437395-9434788

92A like 63% to 92A9

fgenesh1_pm.C_LG_VII000297|Poptr1 gene model correct








9436495 FTQ 9436487 (0)





9434820 PRLPSELYSL* 9434788


scaffold_2179 (+) 3774-4172

92A like middle 100% match to LG_VII (-)  9437395

eugene3.21790001|Poptr1 duplicate seq






scaffold_1142 (-) 11129-8170

92A like pseudogene

66% to scaffold_158  8  (-)    68093











scaffold_28 (-) 306996-304599

92A like 59% to 92A9

eugene3.00280025|Poptr1 gene model correct












304625 RLPLHLYN* 304599


LG_XVIII (+) 2833441-2835456

92A like 62% to 92A9

estExt_fgenesh1_pm_v1.C_LG_XVIII0052|Poptr1 short at N-term, wrong first exon













2835430 RLPLHLYN* 2835456


<CYP93 family 9 sequences. 

2 are pseudogenes and 3 seem to be duplicates.

That leaves 4 sequences.  Two are CYP93B sequences that are 73% identical.

These may recognize different R groups at the 5 position of the flavanone, since that position is variable in flavonoids.  The other two are CYP93A sequences. There is no clear CYP93C ortholog, so the IFS, isoflavone synthase (2-hydroxyisoflavanone synthase) may be missing. 


CYP93A          makes a phytoalexin in soybeans

CYP93B FSII     flavone synthase II

CYP93C IFS      isoflavone synthase (2-hydroxyisoflavanone synthase)



LG_XVI (-) 3135000-3133112

93D like 54% to 93D1

66% to scaffold_152 (+) 154010, 55% to LG_XIII (-)  1795947

61% to 93A1 63% to 93A2, 70% to Medicago truncatula AC141114.14 20271-18191

fgenesh1_pg.C_LG_XVI000375|Poptr1 gene model seems correct














scaffold_152 (+) 158255-159380

93D like pseudogene 49% to 93D1

 84% to LG_XVI      (-)  3133324

fgenesh1_pg.C_scaffold_152000017|Poptr1 missing middle part








159155 IKAFIL 159172 (0)

(sequence gap)




scaffold_152 (+) 154010-155780

93G like 57% to 93D1

66% to LG_XVI (-) 3135000, 51% to LG_XIII (-) 1795947

56% to 93A1, 56% to 93A2, 56% to 93A3

eugene3.01520023|Poptr1 gene model seems correct








154910 AFIM 154921 (0)





155742 LVCIPVSRPCPF* 155780


LG_XVI (-) 3142068-3136957

93 like pseudogene 89% to scaffold_152 (+) 155571


eugene3.00160430|Poptr1  join with eugene3.00160432




3141768 RPKVS 3141754










>#CYP93A8  AC141114.14   Medicago truncatula clone mth2-8g20, complete sequence

70% to LG_XVI (-)  3135000, 49% to 93D1 51% to 93F1 45% to 93G1 64% to 93A1

65% to 93A2






19371 AFIL 19360 (0)






LG_XIII (-) 1795947-1794304

93 like 43% to 93D1

73% to scaffold_70  (+)  1409929, 62% to 93B3, 58% to 93B2

estExt_fgenesh1_pg_v1.C_LG_XIII0255|Poptr1 gene model seems correct














scaffold_70 (+) 1407665-1410186

43% to 93D1, 45% to 93F1

73% to CYP93B7, 52% to LG_XVI (-) 3135000, 51% to scaf_152 154010

57% to 93B2 58% to 93B3

eugene3.00700209|Poptr1 gene model seems correct














scaffold_70 (-) 1388718-1387837

93 like 39% to 93D1, 40% to 93G1

100% to scaffold_70   (+)  1409929 probable duplicate sequence

fgenesh1_pg.C_scaffold_70000201|Poptr1 exon 1 only, exon 2 in a seq gap









scaffold_1994 (-) 5560-3035

57% to 93B2 58% to 93B3

46% TO 93C1v1 soybean

eugene3.19940001|Poptr1 gene model seems correct but possible assembly error

duplicate seq 1aa diff to scaffold_70   (+)  1409929














scaffold_70 (-) 1392931-1392122

100% match to scaf_1994

eugene3.00700208|Poptr1 duplicate sequence










<CYP98 family 6 sequences, 4 full length, 2 partials

CYP98 sequences have one extra intron compared to other CYP71 clan memebers.

One of the partials is 100% identical to a full seq, so it is probably a duplicate contig.  The other short sequence is on the same contig as a full sequence and it is 94-95% identical to other sequences.  It runs off the end, so it may be a real full length P450.  Scaffold 1454 and XVI are 98% identical.

This seems outside the error range for sequencing, so these might be due to a very recent duplication.  The pair are 92-93% identical to scaffold 3616.

The ancestor of the pair and the 3616 sequence may have originated from a single sequence at the genome duplication.  The partial seq on 3616 would be from a more recent tandem duplication.  The last sequence is the most distant,

about 81-83% identical to the others.  If it was duplicated in the past the partner has been lost.  The ancestor before the genome duplication probably had only two CYP98A sequences.  Since there are potentially several substrates

(p-coumaroyl shikimate, p-coumaroyl quinate, p-coumaroyl CoA,

p-coumaraldehyde, p-coumaryl alchohol) these P450s could be specializing, or they could be expressed in different tissues like roots, stems, leaves, etc.



LG_XVI (-) 1542608-1539021

98A like 76% to 98A3

eugene3.00160247|Poptr1 gene model correct





1542146 IFKDCTNP 1542123 (1)








1539065 RLPSHLYKRMASDM* 1539021


scaffold_1454 (+) 1851-5548

98A like 76% to 98A3

98% to LG_XVI (-) 1542608 (8 aa diffs)

eugene3.14540001|Poptr1 gene model seems correct duplicate? allele?





2313 IFKDCTNP 2336 (1)










scaffold_3616 (+) 3009-5285

98A like 74% to 98A3

93% to scaffold_1454, 92% to LG_XVI (-) 1542608, 81% to LG_VI (-) 1982315

eugene3.36160002|Poptr1 gene model correct





3471 IFKDCTNP 3494 (1)










scaffold_21067 (+) 515-913

98A like 100% to scaffold_3616 (+) 4923 duplicate seq

eugene3.210670001|Poptr1 exon 2 only






scaffold_3616 (+) 3-478

98A like runs off the end of the clone

95% to scaffold_1454, 93% (9aa diffs) to scaffold_3616 (+) 4923

possible tandem duplication of the full length gene on this scaffold.








LG_VI (-) 1982315-1979658

98A like 81% to 98A3

83% to LG_XVI (-) 1542608, 83% to scaffold_1454, 81% to scaffold_3616

estExt_fgenesh1_pm_v1.C_LG_VI0711|Poptr1 gene model correct





1981865 VESIFNDCTNP 1981833 (1)








1979696 RLPSHLYKRVAVDI* 1979658



<CYP701 family 1 sequence



LG_II (-)  9774605-9770969

68% to 701A3 8 exons not CYP71 clan

fgenesh1_pg.C_LG_II001196 [Poptr1:347690] N-term

eugene3.00021204 [Poptr1:551889] C-term














<CYP703 family 2 sequences



LG_II (-) 13208335-13206633

703A like 78% to 703A2

fgenesh1_pg.C_LG_II001592 [Poptr1:348086] gene model correct








13207435 DVEIKALIQ 13207409 (0)





13206671 MARPRLAEHMYH* 13206633


LG_XIV (-) 3557159-3556743

703A like pseudogene 76% to 703A4

eugene3.00140448|Poptr1 N-term gene model wrong


3557159 MDLVAAQCFILLFV 3557115





<CYP705 family 8 sequences



LG_IX (+) 6276537-6278244

705A like 46% to 705A2

97% to LG_IX (+) 6288042

fgenesh1_pg.C_LG_IX000935|Poptr1 gene model seems correct












6278215 VLRRNLFSA* 6278244


LG_IX (+) 6288042-6289749

705A like 46% to 705A2

97% to LG_IX (+) 6276537 87% to LG_I  (-) 19703740

estExt_fgenesh1_pg_v1.C_LG_IX0927|Poptr1 gene model correct












6289723 VLHSNLFSA* 6289749


LG_IX (+)  6356567-6357732

705A like pseudogene 48% to 705A12

fgenesh1_pg.C_LG_IX000946|Poptr1 gene model wrong 57% to LG_IX (+)  6358443

EXXR motif mutated





6356963 VQMKMEQSLT 6356992

second C-term piece



LG_IX (+) 6358443-6360623

705A like pseudogene

 57% to LG_IX  X         (+)  6369234

fgenesh1_pg.C_LG_IX000947|Poptr1 gene model short at N-term frameshift, insertion



6358593 GHLHYLSPAA 6358622













scaffold_4756 (-) 3708-3244

705A pseudogene 1aa diff to LG_IX (+)  6360333

fgenesh1_pg.C_scaffold_4756000001|Poptr1 duplicate seq






LG_IX (+) 6367706-6369461

705A like 45% to 705A2

92% to LG_I 19702300

eugene3.00091000|Poptr1 gene model seems correct












6369423 SNPVLHRNLFSA* 6369461


LG_I (-) 19703740-19702073

705A like 44% to 705A2

92% to LG_IX (+)  6369234

fgenesh1_pg.C_LG_I001940 [Poptr1:64588] gene model seems correct















LG_XVI (+) 7802640-7803110

705A like no model at JGI

45% to 705A16 N-term, two frameshifts, no C-term, probable pseudogene

54% to LG_IX  (+)  6360333 705A like







<CYP706 family 5 sequences



scaffold_127 (-) 281038-279097

706B like 52% to 706B1

55% to 706B2
















scaffold_70 (-) 879822-876621

706C like 75% to scaffold_127 288016

47% to 706B1, 56% to 706C4

fgenesh1_pg.C_scaffold_70000124 [Poptr1:95599]














scaffold_127 (-) 288016-285624

706C like 55% to 706C1
















LG_III (+) 11000576-11004081

706A like 98% to scaf_796

50% to 706B1

fgenesh1_pg.C_LG_III000920|Poptr1 duplicate seq.













11004055 LSNLNLYA* 11004081


scaffold_796 (+) 8760-12990

706A like 49% to 706A5

50% to 706B1, 49% to 706A5, 45% to 706C1














12964 LSNLNLYA* 12990


<CYP712 family 7 sequences



scaffold_152a (+) 143579-145208

712A like 71% to 712A1 only 4aa diffs to scaffold_4672

eugene3.01520021|Poptr1 gene model seems correct duplicate seq.












145179 YPIKHMNAY* 145208


scaffold_4672 (-) 2892-1263

712A like 71% to 712A1

4 aa diffs to scaffold_152  (+) 143579 duplicate seq

eugene3.46720001|Poptr1 gene model seems correct












1292 YPIKHMNAY* 1263


LG_X (-) 19404794-19403073

712A pseudogene 70% to scaffold_4672


eugene3.00102217|Poptr1 same gene as above



19404644 LLGPVLP 19404624

19404622 NLANRYGPLMQIRLGTY 19404572

19404573 TCVIASNAAVAKEIFKTH 19404520







19403943 KDPAAEIRLSKNDIKSFLL 19403887 (0)







LG_XVIa (-) 3144892-3142631

712A like 51% to 712A2

 80% to scaffold_152  (+)   146873, 48% to scaffold_152  (+) 143579

fgenesh1_pg.C_LG_XVI000378|Poptr1 gene model seems correct














scaffold_152b (+) 146873-148630

712A like 52% to 712A2 80% to LG_XVI (-)  3142631

fgenesh1_pg.C_scaffold_152000015|Poptr1 gene model correct








147773 LTRRHIKKFFL 147805 (0)







LG_XVIb (+) 3309276-3311130

712A like 52% to 712A1

67% to LG_VI         (+) 11287066

fgenesh1_pg.C_LG_XVI000395|Poptr1 gene model seems correct








3310176 EIKAFFL 3310196 (0)





3311077 ITHMNPFELGLDMAEPE* 3311130


LG_VI (+) 11287066-11288715

712A like 55% to 712A1









11287966 DIKAFFL 11287986 (0)





11288671 YPITRFNPLSFNKR* 11288715


<CYP736 family 25 sequences



LG_VII (+) 4652216-4653805

CYP736A like 53% to 736A1

95% to LG_VII    (+)  4685384

grail3.0011020802|Poptr1 gene model short












4653788 PTYRLNK* 4653811


scaffold_1769 (-) 9485-8871

736 like  exon2

98% (4 aa diffs) to LG_VII (+)  4652216

fgenesh1_pg.C_scaffold_1769000002|Poptr1 duplicate seq.







LG_VII (+) 4667173-4668746

736A like 53% to 736A1

96% to LG_VII (+) 4834273
