>CYP51G1

Scaff LG_I (-) 4925909-4924104

fgenesh1_pm.C_LG_I000188|Poptr1

gene model correct

84% to Arab. 51G1 95% to Scaff LG_III CYP51G5 seq.

$

4925909 MTGDTDNKFLNVGLLIIATLLVAKLISALIMPRSQKRLPPVMKGWPLIGG 4925760

4925759 LIRFLKGPIVMLREEYPKLGSVFTVNLVNRKITFLIGPEVSAHFFKASEV 4925610

4925609 DLSQQEVYQFNVPTFGPGVVFDVEYSIRQEQFRFFTEALRVNKLKGYVDQ 4925460

4925459 MVVEAE 4925442 (0)

4925102 DYFLKWGDSGVVDLKYELEHLIILTASRCLLGREVRDKLFDDVAALFHD 4924956

4924955 LDNGMLPVSVLFPYLPIPAHRRRDRARKKLAEIFANIINSRKLASKSEND 4924806

4924805 MLQCFIDSKYKDGRPTTESEITGLLIAALFAGQHTSSITSTWTGAYLLRH 4924656

4924655 NEYLSAVLEEQKNLMKKHGNKVDHDILSEMDVLYRCIKEALRLHPPLIML 4924506

4924505 LRSSHSDFSVTTRDGKEYDIPKGHIVATSPAFANRLPHVFKDPDSYDPDR 4924356

4924355 FAYGREEDKAAGAFSYISFGGGRHGCLGEPFAYLQIKAIWSHLLRNFELE 4924206

4924205 LISPFPEIDWNAMVVGVKDKVMVRYKRRELSVN* 4924104

>CYP51G5

Scaff LG_III (+) 14476000-14477787

eugene3.00031308|Poptr1

gene model correct

83% to Arab. 51G1 95% to Scaff LG_I CYP51G1 seqF.

$

14476000 MTKDTDNKFLNVGLLILATLLVAKLISALIMPRSQKRLPPVMKGWPLIGG 14476149

14476150 LIRFLKGPIVMLREEYPKLGSVFTVNLANWKITFLIGPEVSAHFFKASEA 14476299

14476300 DLSQQEVYQFNVPTFGPGVVFDVDYSIRQEQFRFFTESLRVSKLKGYVDQ 14476449

14476450 MVVEAE 14476467 (0)

14476789 DYFSKWGDSGVVDIKYELEHLIILTASRCLLGREVRDKLFDDVSALFHD 14476935

14476936 LDNGMLPISVLFPYLPIPAHRRRDRARKKLAEIFANIINSRKLAGKSEND 14477085

14477086 MLQCFIDSKYKDGRPTTESEITGLLIAALFAGQHTSSITSTWTGAYLLRH 14477235

14477236 NEYLSAVLEEQKNLMKKHGNKVDQDILSEMGVLHRCIKEALRLHPPLIML 14477385

14477386 LRSSHSDFSVTTRDGKEYDIPKGHIVATSPAFANRLPHVFKDPERYDPDR 14477535

14477536 FAAGREEDKAAGAFSYISFGGGRHGCLGEPFAYLQIKAIWSHLLRNFEFE 14477685

14477686 LISPFPETDWNAMVVGVKDKVMVRYKRRELSVN* 14477787

 

>CYP71B41-de1

LG_VIII (-) 12482829-12482572

eugene3.00081725|Poptr1

N-term only

71B like 100% to LG_VIII.4 LG_VIII.10 LG_VIII.16

$

12482829 MALYVVPLWLPLILLLALLLLFMKKMEVKRQSEQLLPPSPPKLPILGNLH 12482680

12482679 QLGSLPHQSLWQLSKKYGPVMLIRLGRIPTVVISSA 12482572

>CYP71B44P

LG_I (+) 19811612-19812590

fgenesh1_pg.C_LG_I001954 [Poptr1:64602]

model short exon 1

71B like pseudogene 51% to 71B36 53% to 71B41

$

19811612 MACHDPLIMWSLPLVLFFSLLMFLLIRKKQNKQQIPPTPPRLPIIGNLHQLGDLS 19811776

19811777 QRSLWQLSKKYGPVILLKLGAVPAVVISSAEAAKEVLKTNDLHACSRPLL 19811926

19811927 AGTGRLSYNYSDVSFTYTYGDYWRKM*KICVLELCSARRVQSFLF 19812061

19812135 IREEEVALLIDTISAYSFSATPVDLSEKILSFTANITCRAAFGK 19812266

19812267 SFQEIKGFDGKRFEEVIREASAILASFSAADFFPKDGWIIERLTG 19812401

19812402 LLHSRLERSFRELDVLYRRVIDDHIKLEE 19812485

19812486 EEKEDIVGGPLKL*RDQTEFGTIQLTHDHIKAKLM 19812590 (0)

>CYP71B40v1

LG_VIII.4 (-) 12489221-12487004

eugene3.00081726|Poptr1

gene model short at N-term

71B like 53% to 71B36 97% to LG_VIII.16

$

12489221 MALYVVPLWLPLILLLALLLLFMKKMEVKRQSEQLLPPSPPKLPILGNLH 12489072

12489071 QLGSLPHQSLWQLSKKYGPVMLIRLGRIPTVVISSAEAAREVLKVHDVAF 12488922

12488921 CSRPLLAGTGRLTYNYLDIAFSPYSDHWRNMRKILTLELFSLKRVQSFRF 12488772

12488771 IREEEVSLLVNFISESSALAAPVDLTQKLYALVANITFRMAYGFNYRGTS 12488622

12488621 FDRDKFHEVVHDTVAVVGSISADESIPYLGWIVDRLTGHRARTERVFHEV 12488472

12488471 DTFFQHLIDNHLKPGRIKEHDDMVDVLLRIEKEQTELGASQFTKDNIKAILL 12488316 (0)

12487621 NLFMAGVDTSSLTVNWAMAELVRNPRVMKKVQDEVRKCVGNKGRVTESDI 12487472

12487471 DQLEYLRMVIKETLRLHPPGPLLIPRETMSHCKVSGHNIYPKMLVQINVW 12487322

12487321 AIGRDPRYWKDPEEFFPERFLDRSIDYKGQSFEYLPFGSGRRICPGMHMG 12487172

12487171 SITMEIILANLLYCFDWVFPDGMKKEDINMEEKAGVSLTTSKKTPLILVP 12487022

12487021 VNYLP* 12487004

 

>CYP71B40v2

scaffold_994 (+) 9952-10569

fgenesh1_pg.C_scaffold_994000003|Poptr1

duplicate seq

CYP71B40 100% match exon 2

$

 9952 NLFMAGVDTSSLTVNWAMAELVRNPRVMKKVQDEVRKCVGNKGRVTESDI 10101

10102 DQLEYLRMVIKETLRLHPPGPLLIPRETMSHCKVSGHNIYPKMLVQINVW 10251

10252 AIGRDPRYWKDPEEFFPERFLDRSIDYKGQSFEYLPFGSGRRICPGMHMG 10401

10402 SITMEIILANLLYCFDWVFPDGMKKEDINMEEKAGVSLTTSKKTPLILVPVNYLP* 10569

>CYP71B41

LG_VIII.16 (-) 12479032-12476806

eugene3.00081724|Poptr1

gene model short at N-term

71B like 54% to 71B36

$

12479032 MALYVVPLWLPLILLLALLLLFMKKMEVKRQSEQLLPPSPPKLPILGNLH 12478883

12478882 QLGSLPHQSLWQLSKKYGPVMLIRLGRIPTVVISSAEAAREVLKVHDLAF 12478733

12478732 CSRPLLAGTGRLTYNYLDIAFSPYSDHWRNMRKIVTLELFSLKRVQSFRF 12478583

12478582 IREEEVSLLVNFISESSALAAPVDLTQKLYALVANITFRMAYGFNYRGTS 12478433

12478432 FDRDKFHEVVHDTEAVAGSISADESIPYLGWIVDRLTGHRARTERVFHEL 12478283

12478282 DTFFQHLIDNHLKPGRIKEHDDMVDVLLRIEKEQTELGASQFTKDNIKAILL 12478127 (0)

12477423 NLFLGGVDTSSLTVNWAMAELVRNPRVMKKVQDEVRKCVGNKGRVTESDI 12477274

12477273 DQLEYLRMVIKETLRLHPPAPLLIPRETMSHCKVSGHNIYPKMLVQINVW 12477124

12477123 AIGRDPTYWKDPEEFFPERFLDSSIDYKGQSFEYLPFGSGRRICPGMHMG 12476974

12476973 FITMEIILANLLYCFDWVYPDGMKKEDINMEEKAGVSLTTSKKTPLILVP 12476824

12476823 VNYLQ* 12476806

>CYP71B38

LG_VIII.10 (-) 12547429-12545187

fgenesh1_pg.C_LG_VIII001676|Poptr1

gene model short on the N-term

71B like 54% to 71B36 97% to LG_VIII.4

$

12547429 MALYVVPLWLPLILLLALLLLFMKKMEVKRQSEQLLPPSPPKLPILGNLH 12547280

12547279 QLGSLPHQSLWQLSKKYGPVMLIRLGRIPTVVISSAEAAREVLKVHDLAF 12547130

12547129 CSRPLLAGTGRLTYNYLDIAFSPYSDHWRNMRKVLTLELFSLKRVQSFRF 12546980

12546979 IREEEVSLLVNFISESSALAAPVDLTQKLYALVANITFRMAYGFNYRGTS 12546830

12546829 FDRDKFHEVVHDTEAVAGSISADESIPYLGWIVDRLTGHRARTERVFHEL 12546680

12546679 DTFFQHLIDNHLKPGRIKEHDDMVDVLLRIEKDQTELGASQFTKDNIKAILL 12546524 (0)

12545804 NLFLGGVDTISLTVNWAMAELVRNPRVMKKVQDEVRKCVGNKGRVTESDI 12545655

12545654 DQLEYLRMVIKETLRLHPPAPLLITRETMSHCKVSGHNIYPKMLVQINVW 12545505

12545504 AIGRDPTYWKDPEEFFPERFLDSSIDYKGQSFEYLPFGSGRRICPGMHMG 12545355

12545354 FITMEIILANLLYCFDWVFPDGMKKEDINMEEKAGVSLTTSKKTPLILVP 12545205

12545204 VNYLQ* 12545187

>CYP71B43P

LG_X.28 (-) 6738703-6736564

fgenesh1_pg.C_LG_X000579|Poptr1

gene model wrong 2 frameshifts

71B like 52% to 71B36 86% to LG_VIII.4

possible pseudogene or two seq. errors.

$

6738703 MALYAVPLWLPLILLLPLLLLFMKRMKDAGQSEQLLPPGPP 6738581

6738581 KLPILGNLHQLSSLPHQSMWHLSKKYGPVMLLRLGQIPTVVISSAEAA 6738438

6738437 REVLKVHDLAFCSRPLLSGAGRLTYNYLDIAFSPYSDHWRNMRKIVTLEL 6738288

6738287 FSLKRVQSFRFIREEEVGFLVNSLSESSALAAPVDLTQKVYALVANITFR 6738138

6738137 VAYGFDYRGTTFDRDRFHEVVHDTEAVVGSISADEYVPYLG 6738015

6738015 MIVDWLTGHRARMERVFHELDTFFQHVIDNHLKPGRIKDHDDMIDV 6737878

6737877 LLRIEKEQTELGASQFTSDNIKAVLL 6737800 (0)

6737179 NLFLGGVDTSSLTVNWAMAELVRNPRVMKKVQDEVRKCVGKKGRVTEGDV 6737030

6737029 DQLEYLRMVIKETLRLHPPAPLLLPRETMSHCIVSGYNIYPKTLVHVNVW 6736880

6736879 AIGRDPKYWRDPEEFFPE 6736826

6736827 RFLDSSCDFNGQSFEYLPFGSGRRICPGIHMGSITVEIILSNLLHCFDWI 6736678

6736677 LPHGMQKEDINMEEKAGVSLAPSKKTPVILVPVNYLQ* 6736564

>CYP71B42P

LG_VIII.30 (-) 12460686-12458958

eugene3.00081722|Poptr1

gene model short, frameshifts

71B like pseudogene 95% to LG_VIII.31 54% to 71B24

$

12460686 MAFYILPLALLLLLLFPLPLILKKKQQ 12460608

12460608 KLYVLELFSLK 12460576

12460577 RVQSFRFIREEVISLLMNSISQSSSPATPVNLTQMLYSVFASIVFGMALG 12460428

12460427 KSFQGSDFHNERCRKSIHEAE 12460365

12460365 GHNRMLITGYDARIERVFLELDTLFQQVIDDHLKAERKERKEDIINVLLKMERDQT 12460198

12460197 ESSAPQLTKYNIKAVIL 12460147 (0)

12459572 NIFLGGVDTGAITVIWATAEIARNPIIMKKAQEEIRSSVGQKGRATEERT 12459423

12459422 DELQYLKMVIKETLRLHPPAPLLLPRETMSRCQINGYDIYLKTLIQVNAW 12459273

12459272 AIGRDPEYWRDSEEFFPERFVDSPIDYKGQRFEFLPFGSGRRVCPGILMG 12459123

12459122 VTMVELALANLLHCFDWKLPNAV 12459054

12459053 AINMEEAAGLTISKKNPLFLVRINYPQQAQPD 12458958

>CYP71B39P

LG_VIII.31 (-) 12534486-12532739

eugene3.00081733|Poptr1

gene model short, frameshifts

71B like pseudogene 95% to LG_VIII.30 

$

12534486 LLLLLLFPLPLILKKKQQ 12534433

12534433 KLYVLELFSLK 12534401

12534402 RVQSFRFIREEVISLLMNSISQSSSPATPVNLTQMLYSVFASIVFRMALG 12534253

12534252 KSFQGSDFHNERCRKAIHEAE 12534190

12534190 GHNRMLITGYDARIERVFLELDTLFQQVIDDHLKAERKERKEDIINVLLKMERDQT 12534023

12534022 ESSAPQLTKYNIKAVIL 12533972 (0)

12533397 NIFLGGVDTGAITVIWATAEIARNPIIMKKAQEEIRSSVGQKGRATEERT 12533248

12533247 DELQYLKMVIKETLRLHPPAPLLLPRETMSRCQINGYDIYLKTLIQV 12533107

12533107 NAWAIGRDPEYWRDSEEFFPERFVDSPIDYKGQRFEFFPFGSGRRVCPGI 12532958

12532957 VMGVTMVELALINLLYCFDWKLPNAV 12532880

12532879 DINMEEAAGLTISKKMPLFLVPINYPQRAQPDKMSRTSLLSKHTCS* 12532739

>CYP71B45P

LG_X (-) 6735316-6733923

fgenesh1_pg.C_LG_X000578|Poptr1

71 like I-helix + C-term (pseudogene?)

71 like pseudogene 75% to CYP71B42P

downstream of fgenesh1_pg.C_LG_X000579

$

6735316 ILSLGRTPTLVVSSAEAARAVLKTHDLDCCCRPRLSGSGRLTYNHVYVAF 6735167

6735166 APYGDYW*EMRKLFVLEPFILKRVQSFRFITGEVARIMNSIPQSSS 6735029

6734867 PYAG*ILDKVTDHHARIERVLH 6734802

6734482 NIFLGGVHAGAITVIWALEELAWNPRTMKKAQDEIRNSVGKKGRLAEESI 6734333

6734332 DEL 6734324

6734322 TLVIKETLRWQ 6734290

6734288 PPAPLLLPRETMSHCKINGYHIYPKILIQINV*AIGSDPTYWNDS*EFF 6734142

6734141 PERFVDSSID*KGQHFEFLPFGSGRRGCPGILMGVTMVELALANLLYCLDW 6733989

6733988 KSAKAIDINMEEAAGLTISKKM 6733923

 

>CYP71D38-de2b

scaffold_710 (-) 1341-893

eugene3.07100001|Poptr1

gene model short

pseudogene 89% to 726B1 J-helix to end

$

1341 VIKNPRVLEKAQKEGRQVFND 1279

1276 LGTIPDETSLHDSKFLKLIIKETLRLHPPAPLMIPIECRKRYNVNGYDTHVKSKVLINAWAIGRDP 1079

1078 NYWNELERFYPERFINVSTDFKGIDFEFIPFGAGKRMCPGKL 953

 953 VKRIRDLKLIPV 918

 916 SYRSLVG* 893

>CYP71D38

scaffold_710 (-) 19864-18128

eugene3.07100003|Poptr1

no comment

726A like 50% to 726A1 euphorbia

$

19864 MLISLPVFLTILLVISILWTWTKFIKSNKSSSNPPPGPWKLPFIGNLHQL 19715

19714 VHPLPHHRMRDLAKKFGPVMQLQVGEVSTVIISSSEAAKEVMKTHEINFV 19565

19564 ERPHLLAASVLFYNRKDIAFAPYGEYWRQLRKISILELLSAKRVRSFKSI 19415

19414 REEEVSNFIASIYSKEGSPINLSRMIFSLENGITARTSIGNKCKNHEGFL 19265

19264 PIVEELAEALGGLNMIDIFPSSKFLYMVSRVRSRLERMHREADEILESII 19115

19114 SERRANSALASKMGKNEEDDLLGVLLNLQDHGNLEFQLTTSTIKAVIL 18971 (0)

18748 EMFSGGGDTSSTALEWAMSELIKNPRVMEKAQKEVRQVFNDLGTIPDETS 18599

18598 LHDLKFLKLIIKETLRLHPPVPLIPRECRKRCDVNGYDIHVKSKVLINAW 18449

18448 AIGRDPNCWNEPERFYPERFINVSTDFKGSDFEFIPFGAGKRMCPGMLFA 18299

18298 TANTEFPLAQMLYHFDWKPAGGLKPENLDMTESFGGAVKRKQDLKLIPIS 18149

18148 YRSLVG* 18128

>CYP71D38-de2c

scaffold_710 (-) 21263-20928

no model

no comment

pseudogene 79% to 726B1 C-term

$

21263 NDLGTILDETS 21231

21213 LKLITEETLRLHPSAPLIPREWRKRCQVNGYD 21118

21117 NIHVKSKVLINAWA 21076

21085 CMGMLFAIA 21059

21059 HHFDWKPIDGLKPENLDMTESLGGATKRKRDLKLIFISYRSLVG 20928

>CYP71D23P

LG_XV.1 (+) 7113294-7114921

fgenesh1_pg.C_LG_XV000688|Poptr1

gene model wrong 2 frameshifts and a stop codon

71D like possible pseudogene 46% to 71D10 57% to LG_VII.22

$

7113294 MEQHFPLFAIFLTFLLFIFMVLRMRKKSETNKYLTTNPPPGPWKLPLVGN 7113443

7113444 IHHVAGHQIHHRFTDLARKYGPVMQILLGEVRFVVISSRETAKEVMKTNE 7113593

7113594 NIIVDRPDGVIPRIVFYNGKAISFTPYGEYWKQLRKSCSSKLLSPQCVRS 7113743

7113744 LIRSTMEEEVSDFVTSISSKEGSPINLSKMLFTLTFGLISRVILGKKGKN 7113893

7113894 QALLSSIEEWKQGGAGFDVADIFPSFKLFHSLGWARSKFVRQHQEIGEML 7114043

7114044 ETVINERRASKIRTKTSEHEIEEDFLDVLVNMQHALR 7114154

7114156 NLEFTNDNIKAILL 7114197 (0)

7114292 EFFLAGSDSSSAVMEWAMSEMLKNPRHMKRAQKEVRVVFTKMGNDDETRL 7114441

7114442 HELKYLQLIIKETTRLHPPAPLILRACREACKINGHDIPDRSNVMINAWA 7114591

7114592 IGRDPTYWNEA* 7114627

7114628 KFNPERFLDSSIDYMGTNFEFIPFGAGKRKCPGMAFGLAIVEMALAKLLY 7114777

7114778 IFDWKLCDGVKNEDLNMKEDTALGSTVKRKHELYLIPIPYHPSSPAK* 7114921

>CYP71D41

LG_VII.22 (+) 5888964-5891028

fgenesh1_pg.C_LG_VII000682|Poptr1

gene model correct

71D like 50% to 71D4, 75% to LG_VII.12

$

5888964 MEFPILLASLLFIFAVLRLWKKSKGNGSTLALPPGPWKLPLIGNIHQLAG 5889113

5889114 SLPHHCLTDLAKKYGPVMQLQIGEVSTVVVSSGEAAKEVMKTHEINFVER 5889263

5889264 PCLLVANIMFYNRKNIGFAPYGDYWRQMRKVCTLELFSAKRVRSFRSVRE 5889413

5889414 EEVSNFIRNIYAKAGSPINLSKMMLDLSNGVIARTSIGKKSKNQEAFLPI 5889563

5889564 IEDVAEALAGLNIVDVFPSAKFLYMISKLRSRLERSHIEADEILENIINE 5889713

5889714 RRASKEERKTDQDNEVEVLLDVLLNLQNQGNLEFPLTTDSIKAIIV 5889851 (0)

5890402 EMFGAGSETTSTLLEWSMSEMLKNPRVMKKAQEEVRQVFSDSENV 5890536

5890537 DETGLQNLKFLKLIIKETLRLHPPISLIPRECSKTCEINGYVIQAKSKVI 5890686

5890687 INAWAIGRDSNDWTEAEKFYPERFQDSSIDYKGTNFEFIPFGAGKRMCPG 5890836

5890837 MLFGIGNAELLLARLLYHFDWKLSSGAALEDLDMNEAFGGTVKKKHYLNL 5890986

5890987 IPIPYGPCPLPVE* 5891028

 

>CYP71D42

LG_VII.3 (-) 5804810-5802796

eugene3.00070713|Poptr1

gene model seems correct

71D like 49% to 71D4 99% to LG_VII.27

note these two gene names were both assigned to the same sequence

$

5804810 MDQVFQFIYILIVPFLLLIFPVLRLWKKSQGNNSSTPPPPPGPWKLPLIGNLHQLL 5804643

5804642 GSLPHQVLRDMANKYGPVMQLQIGEVPTVIISSPEAAKEAIKTHEINFVD 5804493

5804492 RPCLLVAKVMFYNSKDIAFAPYGDYWRQMKKVCVLELLSAKRVKSFRSIR 5804343

5804342 EEEVSNFMRTIYSKAGSPINLSKMMFDLLNGITARASVGKKYKHQEAFLP 5804193

5804192 IIEQVIEAMGGTNIADVFPSSKLLYMISRFRSRLERSHQDADVILENIIY 5804043

5804042 EHRVRREVAKTDEESEAEDLLDVLLNLQNHGDLGFPLTTDSIKATIL 5803902 (0)

5803416 ELFTAGSDSSSTLMEWTMSEMLRNPRVMRKAQEEVRQVFSNTEDVDETCL 5803267

5803266 HNLEFLKLIIKETLRLHPPAPFIPRECNKTCEINGYVIQAKSKVMINAWA 5803117

5803116 IGRDSDHWTEAEKFYPERFLDSSIDYMGTNFEFIPFGAGKRMCPGILFGI 5802967

5802966 ATVELPLAQLLYHFDWKLPNGDLSEDLDMNEVFVGTVRRKHQLNVIPIPF 5802817

5802816 YPSPLQ* 5802796

 

>CYP71D43

LG_VII.12 (-) 5753477-5751477

estExt_fgenesh1_pg_v1.C_LG_VII0660|Poptr1

gene model seems correct

71D like 48% to 71D4 94% to LG_VII.3

$

5753477 MEQVFQFIQILVPFLLLIFTVLRLWKKSQGNNSSTPPPP 5753361

5753360 PPPPPGPWKLPLIGNLHQLLGSLPHQVLRDMANKYGPVMQLQIGEVPTVI 5753211

5753210 ISSPEAAKEAMKTQEINFVDRPCLLVAKVMYYNSKDIGFAPYGDYWRQMK 5753061

5753060 KVCVLELLSAKRVKSFRSIREEEVSNFIRAIYSRAGSPINLSKMMFDLLN 5752911

5752910 GITARASVGKKYKHQEAFLPIIEQVIEAVGGTNIADVFPSSKLLYMISRF 5752761

5752760 RSRLERSHQDADVILENIIYEHRVRREVAKTDEESEAEDLLDVLLNLQNH 5752611

5752610 GDLGFPLTTDSIKATIL 5752560 (0)

5752097 ELFAGGSDTSSTLMEWTMSEMFRNPRVMRKAQEEVRQVFSNTENVDETCL 5751948

5751947 HNLEFLKLIIKETLRLHPPVPFIPRECNKTCEINGYVIQAKSRVMINAWA 5751798

5751797 IGRDSDHWTEAEKFYPERFLDSSIDYKGTNFDFIPFGAGKRMCPGILFGI 5751648

5751647 ATVELPLAQLLYHFDWKLPNGDLLEDLDMNEVFGGTVRRKHQLNLIPIPF 5751498

5751497 YPSPLQ* 5751477

>CYP71D24P

scaffold_228 (-) 35436-34671

eugene3.02280006|Poptr1

no comment

71D like 2 copies exon 1 pseudogene

$

35436 MQQEIPLVLGFLLLVFAVLRLGKKSKGHDSTRTPPPGPWKLPLIGNIHQLASSATMP 35266

        35266 HYLCAHWARKYG 35231

                               35234 RTPPLGPWKLPLIGNIHQLASSATMP 35157

35180 LASSATMPHYLCAHWAKKYGPIMQIQIGEVPTVIISSPDAAKEVLKT 35040

35039 QEINFAERPALLVSEIMLYNGQGMSFAKFGDHWKLMRKACIWGLFSATRK 34890

34889 LSFRSIREEEVSNLISSIRSKEGSPINLRELLLDLSNETITRTSIGKKCK 34740

34739 NKARFLHTIEQVSKSVGGVNIFL 34671

>CYP71D25Pv1

scaffold_228 (-) 39559-38903

eugene3.02280007|Poptr1

no comment

71D like 62% to LG_VII.22 41% to 71D4

exon 1 pseudogene

100% to scaffold_228  (-)    34668-35436

$

39559 MQQEIPLVLGFLLLVFAVLRLGKKSKGHDSTRTPPPGPWKLPLIGNIHQ 39413

39412 LASSATMPHYLCAHWAKKYGPIMQIQIGEVPTVIISSPDAAKEVLKT 39272

39271 QEINFAERPALLVSEIMLYNGQGMSFAKFGDHWKLMRKACIWGLFSATRK 39122

39121 LSFRSIREEEVSNLISSIRSKEGSPINLRELLLDLSNETITRTSIGKKCK 38972

38971 NKARFLHTIEQVSKSVGGVNIFL 38903

>CYP71D25Pv2

scaffold_1911 (+) 7175-8184

fgenesh1_pg.C_scaffold_1911000001|Poptr1

contains a duplication from exon 1 identical in seq to each other in overlap region

71V like 37% to 71V5

almost identical to 71D25P  2 aa diffs probable duplicate sequence

$

7175 MQQEIPLVLGFLLLVFAVLRLGKKSKGHDSTRTPPPGPWKLPLIGNIHQLASSATMPHYLCAHWAKKYG 7381

7381 TPPPGPWKLPLIGNIHQLASSATMPHYLCAHWAKKYGPIMQIQIGEVPTVII 7536

7537 SSPDAAKEVLKTQEINFAERPALLVSEIMLYNGQGMSFAKFGDHWKLMRK 7686

7687 ACIWGLFSATRKLSFRSIREEEVSNLISSIRSKAGSPINLRELLLDLSNE 7836

7837 IITRTSIGKKCKNKARFLHTIEQVSKSVGGVNIVDLFPSARLVHMISNMT 7986

7987 SSLQRLHEETDQMLEDIINERRASRVEKKTGENKIEAGDDLLDVLLNLQD 8136

8137 DGNFKVKTDSIKSIIL 8184 (0)

>CYP71D36Pv1

LG_I (-) 29491328-29490406

eugene3.00012614|Poptr1

no comment

mid regioN to EXXR 71D like

71D like EXXR 61% TO CYP71D26

$

29491328 DTVDVLLNL*GQADLEFTLTTKNIKAIIL 29491242 (0)

29490942 DMFVAGSETSSRTVEWAK 29490889

29490889 TELAKHPKVMEKAQAEARQVFANVDEAGLHKLDHLQLLIKETL 29490761

29490759 NIPPIPLLFPRESKEACKITGYDMPAQSKVTVNIWGIGREPINWTEPERFYP 29490604

29490603 ERFLDSSMDYKGIDFKFIPFGAG 29490535

29490534 ILFGMATYVVLPLAQLLCFLDWIPPNGLRSADLVTSQVFGSS* 29490406

>CYP71D36Pv2

scaffold_1517 (-) 9207-8703

eugene3.15170002|Poptr1

gene model wrong

3 aa diffs to 71D36P, duplicate seq.

$

9207 LNEMAKHPKVMEKAQAKARQVFANVDEAGLHKLDHLQLLIKETL  9076

9074 NIPPIPLLFPRESKKACKITGYDMPAQSKVTVNIWGIGREPINWTEPERFYP 8919

8918 ERFLDSSMDYKGIDFKFIPFGA 8853

8852 GILFGMATVVLPLAQLLCFLDWIPPNGLRSADLVTSQVFGSS*DEK*SLH 8703

>CYP71D35Pv1

LG_I (-) 29497891-29497622

no model exists

no comment

71B like pseudogene

98% to scaffold 1517, 93% to scaffold 6967, 47% to 71B18

$

29497891 KVTVNIWRIGREPINWTEPER 29497829

29497826 FYPERFLDSSMDYKGIDFKFIPFGAGILFGMAT 29497728

29497726 TVVLPLAQLLCFLDWIPPNGLRSADLVTSQVFGSS 29497622

>CYP71D36Pv3

scaffold_6967 (-) 2023-1561

eugene3.69670001|Poptr1

gene model wrong

100% to 71D36Pv2

$

2023 LNEMAKHPKVMEKAQAKARQVFANVDEAGLHKLDHLQLLIKETL 1892

1890 NIPPIPLLFPRESKKACKITGYDMPAQSKVTVNIWGIGREPINW 1759

1758 TEPERFYPERFLDSSMDYKGIDFKFIPFGAGILFGMATVVLPLAQLLCFL 1609

1608 DWIPPNGLRSADLVTS 1561

>CYP71D34

LG_I.29 (-) 29516258-29514652

eugene3.00012615|Poptr1

gene model short one frameshift

71D like 52% to 71D10 93% to LG_I.2

$

29516258 MEQLQTPPSLVLLPSLLFIFMVLRMLKKSKSKDLTPNLPPGPRKLPVIGN 29516109

29516108 LHQLFGSLPHHRLRDLAEKHGPIMHLQLGQVQTIVISSPETAEQVMKVHD 29515959

29515958 INFAHRPHLPVGQIIFYNCTDIATA 29515884

29515882 AAYGDYWRQLRKVSILELLSPKRVQSFRSIREEEVSSLIGSISSSAGSII 29515733

29515732 NLSRMLFSVAYNITTRAAFSKLRKEEEIFVPLVQGIIQVGAGFNISDLFP 29515583

29515582 SIKLIPWITGMRSRMERLHQEADRILESIINDHRARKAEGNSSNESKADN 29515433

29515432 LVDVLLDLQEHGNLDFSLTTDNIKAVIL 29515349 (0)

29515263 DIFIAGTETSSTILQWAMSELLKHPEVMEKAQTEVREAFGKDGSVGELNY 29515114

29515113 LKMVIKETMRLHPPLPLLLPRECREECGINGYNIPIKSRVLVNVWAIGRD 29514964

29514963 SDYWVEAERFHPERFLDSSIDYKGVNFEFTPFGAGRR 29514853

29514852 MCPGILFGISNVDLLLANLLYHFDWKLPGDMEPESLDMSEAFGATVRR 29514709

29514708 KNALHLTPILHHPHPVRS* 29514652

>CYP71D44

scaffold_11610 (-) 1395-784

eugene3.116100001|Poptr1

gene model wrong exon 2 only

71D LIKE 96% to 71D34

$

1395 DLFIAGTETSSTILEWAMSELLKHPEVMEKAQTEVREVFGKDGSVGELNY 1246

1245 LKMVIRETMRLHPPLPLLLPRECREECGINGYNIPIKSRVLVNVWAIGRD 1096

1095 SNYWVEAERFHPERFLDSAIDYKGVNFEFTPFGAGRRMCPGILFGISNVD 946

 945 LLLANLLYHFDWKLPGDMKLESLDMSEAFGATVRRKNALHLTPILHQPHPVRS* 784

>CYP71D33P

LG_I (-) 29524379-29524047

eugene3.00012616 [Poptr1:550175]

model short

71B like pseudogene

$

29524379 VWAIGRDSDYWVEAERFHPERFLDSAIDYKGVNFEFTPFGAGRR 29524248

29524247 MCPGILFGISNVDLLLANLLYHFDWKLPGDMKPESLDMSEAFGATVRR 29524104

29524103 KNALHLTPILHHPHPVRS* 29524047

>CYP71D32P

LG_I (-) 29530020-29529344

eugene3.00012617 [Poptr1:550176]

no comment

71B like pseudogene

$

29530020 MEQPQIPSCLVLLPSLLFIFMVLRMLKKSKTKDLTPNLPPGPRKLPVIGN 29529871

29529870 LHQLFGSLPHHRLRDLAEKHGPIMHLQLGQVQTIVISSPETAEQVMK 29529730

29529676 VWAIGRDSNYWVEAERFHPERFLDSAIDYKGVNFEFTPFGAGRR 29529545

29529544 MCPGILFGISNVDLLLANLLYHFDWKLPGDMKPESLDMSEAFGATVRR 29529401

29529400 KKALHLTPILHHPHPVRS* 29529344

>CYP71D31P

LG_I (-) 29532948-29532496

eugene3.00012618|Poptr1

no comment

71B like pseudogene C-term

$

29532948 VIRETMRLHPPLPLLLPRECREECGINGYNIXIKSRVLVNAWAIGRDSNY 29532799

29532798 WVEAERFHPERFLDSSIDYKGVNFEFTPFGAGRR 29532697

29532696 MCPGILFGISNVDLLLANLLYHFDWKLPGDMKPESLDMSEAFGAAVRR 29532553

29532552 KNALHLTPILHHPHPVRS* 29532496

>CYP71D30P

LG_I (-) 29540735-29539563

eugene3.00012620 [Poptr1:550179] gene start

eugene3.00012619 [Poptr1:550178] gene end

71B like PSEUDOGENE 2 models are from same gene

$

29540735 MEQLQIPTSLVLLSSLLFIFMVLRILKKSKTKDFTPNLPPGPRKLPVIGN 29540586

29540585 LHQLFCSLPHHRLR 29540544

29539973 LLPRECREECGINGYNIPIKSRVLVNVWAIGRDSNYWVEAERFQPERFLD 29539824

29539823 SSIDYKGVNFEFTPFGAGRR 29539764

29539763 MCPGILFGISNVDLLLANLLYHFDWKLPGDMKPESLDMSEAFGATVRR 29539620

29539619 KNALHLTPILHHPHPVRS* 29539563

>CYP71D29

LG_I.6 (-) 29575643-29574039

eugene3.00012625 [Poptr1:550184]

gene model wrong gene has one frameshift

71D like 54% to 71D11 93% to LG_I.29

$

29575643 MEQLQIPTSLVLLSSLLFIFMVLRILKKSKTKDFTPNLPPGPRKLPVIGN 29575494

29575493 LHQLFGSLPHHRLRDWP 29575443

29575443 EKHGPIMHLQLGQVQTIVISSPETAEQVMKVHDINFAHR 29575327

29575326 PHLLAAQIIFYNCTDIATAAYGDYWRQLRKISILELLSPKRVQSFRSIR 29575180

29575179 EEEVSSLIGSISSSAGSIVNLSRMLFSVAYNITTRAAFSKLRKEEEIFVP 29575030

29575029 LVQGIIQVGAGFNVGDLFPSIKLLPWISGMRSRMERLHQEADRILESIIK 29574880

29574879 EHRARKAEGNSSNESKADDLVDVLLDLQEHGNLDFSLTTDNIKAVIL 29574739 (0)

29574653 DLFIAGTETSSTILEWAMSELLKHPEVMEKAQTEVREVFGKDGSVGELNY 29574504

29574503 LKMVIRETMRLHPPLPLLIPRECREECGINGYNIPIKSRVLVNVWAIGRD 29574354

29574353 SNYWVEAERFQPERFLDSSIDYKGVNFEFTPFGAGRRRMCPGIMFGISNV 29574204

29574203 DLLLANLLYHFDWKLPGDMKPESLDMSEAFGAAVRRKNALHLTPILHHPH 29574054

29574053 PVRS* 29574039

>CYP71D29

scaffold_1813 (+) 7926-8444

grail3.1813000101|Poptr1

most of exon 2

71D29 100% match duplicate seq.

$

7926 LKHPEVMEKAQTEVREVFGKDGSVGELNYLKMVIRETMRLHPPLPLLIPR 8075

8076 ECREECGINGYNIPIKSRVLVNVWAIGRDSNYWVEAERFQPERFLDSSID 8225

8226 YKGVNFEFTPFGAGRRRMCPGIMFGISNVDLLLANLLYHFDWKLPGDMKP 8375

8376 ESLDMSEAFGAAVRRKNALHLTP 8444

>CYP71D29-se3[1]

scaffold_1517 (-) 4845-4513

eugene3.15170001|Poptr1

no comment

97% to 71D29 100% to scaffold_19234

$

4845 MEQLQIPTSLVLLPSLLFIFMVLRILKKSKTKDFTPNLPPGPRKLPVIGN 4696

4695 LHQLFGSLPHHRLRDLAEKHGPIMHLQLGQVQTIVISSPETAEQVMKVHD 4546

4545 INFAHRPHLLV 4513

>CYP71D29-se1[1]

scaffold_19234 (-) 368-1

no gene model

no comment

95% to 71D29 N-term no gene model at JGI

$

368 MEQLQIPTSLVLLPSLLFIFMVLRILKKSKTKDFTPNLPPGPRKLPVIGNLHQLFG 201

200 SLPHHRLRDLAEKHGPIMHLQLGQVQTIVISSPETAEQVMKVHDINFAHRPHLLVGQIIFYNCTDI 3

>CYP71D29-se2[1]

scaffold_18933 (+) 920-1111

no gene model

no comment

71B like N-term no gene model at JGI

may be same gene as scaffold_19234 1 aa diff to 71D29

$

 920 MEQLQIPTSLVLLPSLLFIFMVLRILKKSKTKDFTPNLPPGPRKLPVIGNLHQLFG 1087

1088 SLPHHRLR 1111

>CYP71D46P

scaffold_724  (+)    13518-14366

eugene3.07240004|Poptr1

missing end of exon 1 and all of exon 2

CYP71D46P 97% to 71D29 exon 1

$

13518 MEQLQIPTSLVLLSSLLFIFMVLRILKKSKTKDFTPNLPPGPRKLPVIGN 13667

13668 LHQLFGSLPHHRLRDLAEKHGPIMHLQLGQVQTIVISSPETAEQVMKVHD 13817

13818 INFAHRPHLLVGQIIFYNCTDIATAAYGDYWRQLRKISIVELLSPKRVQS 13967

13968 FRSIREEEVSSLIGSISSSAGSIINLSRMLFSVAYNITTRAAFSKLRKEE 14117

14118 EIFVPLVQGIIQVGAGFNIGDLFPSIKLLPWITGMRSRMERLHQEADRIL 14267

14268 ESIIKEHRARKAEGNSSNESKADDLVDVLL 14357

>CYP71D45P

scaffold_724 (+) 1454-2065

eugene3.07240001|Poptr1

C-term

2 aa diffs to 71D31P 95% to 71D29 exon 2

note exon 2 precedes exon 1 on scaf_724, could be a nearly intact gene if rearranged

$

1454 DLFIAGTETSSTILEWAMSELLKYPEVMEKAQTEVREVFGKNGSVGELNY 1603

1604 LNMVIRETMRLHPPLHLLLPRECREECGINGYNIPIKSRVLVNAWAIGRD 1753

1754 SNYWVEAERFHPERFLDSSIDYKGVNFEFTPFGAGRRMCPGILFGISNVD 1903

1904 LLLANLLYHFDWKLPGDMKPESLDMSEAFGAAVRRKNALHLTPILHHPHPVTS* 2065

>CYP71D28v1

LG_I.2 (-) 29606262-29604787

eugene3.00012629|Poptr1

gene model short with one frameshift

71D like 55% to 71D11 93% to LG_I.29

$

29606262 MEQLQIPSSLVLLPSLLFIFMVLRMLKKSKTKDLTPNLPPGPRKLPVIGN 29606113

29606112 LHQLFGSLPHHRLRDWP 29606062

29606062 EKQGPIMHLQLGQVQTIVISSPETAEQVIKVHDINFAHR 29605946

29605945 PHVLAAQIIFYNCTDIATAAYGDYWRQLQKISILELLSPKRVQSFRSIR 29605799

29605798 EEEVSSLIGSISSSAGSIVNLSRMLFSVAYNITTRAAFSKLRKEEEIFVP 29605649

29605648 LVQGIMQVGAGFNISDLFPSIKLLPWITGMRSRMERLHQEADRILESIIK 29605499

29605498 EHRARKAEGNSSNESKVDDLVDVLLDLQEHGNLDFSLTTDNIKAVIL 29605358 (0)

29605272 DLFIAGTETSSTILEWAMSELLKHPEVMEKAQTEVREVFGKDGSVGELNY 29605123

29605122 LKMVIRETMRLHPPLPLLFPRECREECGINGYNIPIKSRVLVNVWAIGRD 29604973

29604972 SNYWVEAERFHPERFLDSAIDYKGVNFEFTPFGAGRR 29604862

29604861 MCPGILFGISNVDLLLANLLYHFDW 29604787

>CYP71D28v2

scaffold_2240 (-) 487-3

fgenesh1_pg.C_scaffold_2240000001|Poptr1

no comment

CYP71D28v2 1 aa diff to 71D28, duplicate seq.

$

487 MEQLQIPSSLVLLPSLLFIFMVLRMLKKSKTKDLTPNLPPGPRKLPVIGN 338

337 LHQLFGSLPHHRLRDWP 287

287 EKQGPIMHLQLGQVQTIVISSPETAEQVIKVHDINFAHRPHVLAAQIIFY 138

137 NCTDIATAAYGDYWRQLQKISILELLSAKRVQSFRSIREEEVSSL 3

>CYP71D26

scaffold_228.17 (-) 105939-104306

fgenesh1_pg.C_scaffold_228000012|Poptr1

gene model wrong at N-term

71D like 54% to 71D4 60% to LG_I.29

$

105939 MEHQFASTILVTILVTSISYVILWIWKKSKV 105847

105846 RNSNLNLPPVPSQLPLIGNMHNLVGSLPHHRFRDMAKKYGPVMHLRLGEV 105697

105696 THVLISSAETAKEVMKTHDLIFAQRPAPIAAKILSYNCMDIAFAPYGDYW 105547

105546 RMLRKLCVLELLSAKRVRSFRSIREEEVWRVVRSISSSAWSPVNFSRMIS 105397

105396 SLTYCITSRAAFGKICKGEDVFIPAVKEANKAAGGYSLADLYPSIKLLSV 105247

105246 ISGMRLTLEKIHARLDKILQEIINEHRSKKEMAAKTGADEEEHDLVDVLL 105097

105096 GIQDQGDTEFSLTDNNIKAIIL 105031 (0)

104929 DLFVAGTDTSSTTVVWAMSEMVKHPRVMKKAQEEVRQVFGDKGTVDE 104789

104788 AGLHELNYLKLAIKETFRLHPPVPLLLPRESREDCKINGYDIPIKSKVIV 104639

104638 NVSAIGRDPTYWNEPERFYPERFLDNSIEYKGTDFELLPFGAGRKMCPGI 104489

104488 LFGTVNVELPLAQLLFHFDWNLPKGPKPEDLDMSEVFGAVVTRKNDLCLI 104339

104338 PIPHHPLPGN* 104306

>CYP71D27

LG_VIII.13 (+) 5139033-5140582

fgenesh1_pg.C_LG_VIII000713|Poptr1

gene model short, missing N-term

71D like 51% to 71D4 59% to LG_I.29

$

5139033 SDEEAAKEVMKTHDVTFAQRPYFLVSDIISYNSTNIAFSPFGDYWRQVRK 5139182

5139183 ICILELLRAKRVQSFQAIREEEVSNLISSINYNAGLPINLTKLLYTISFD 5139332

5139333 STSRASFGKKSKDHEAFKSVMEEIMEVSKSFIISDIFLSIKLLHLISGTR 5139482

5139483 QKLKILHQKADQILESIINEDRAREAPSNEIEADDLVHVLLNLLGHGKLE 5139632

5139633 FPLTTDNIKSVNL 5139671 (0)

5139985 DMFLGGTETSSTVLDWAIAGLLRNPRVMKKAQAEVRQVFCTAGNVDETDL 5140134

5140135 EKLKYLELVVKETLRLHPPLSLLLPRESREDCEINGFKIPAKIKVVINVW 5140284

5140285 AIGRDPAYWNEPEK 5140326

5140328 FHPERFHDSLIDYNGANFEYIPFGAGRRMCPGISFGIANVEYPLAHLL 5140471

5140472 YHFNWKLPNGLKPENLDMTEVFGVAVRRSALDSHFV* 5140582

>CYP71D22

scaffold_122.5 (+) 199976-202441

eugene3.01220022|Poptr1

gene model seems correct

71D like 45% to 71D10 54% to LG_XI.14

$

199976 MEWQLPSFSALSTFLLFMTFLLLKIFKEPKTNHNSGRNPPPGPKALRIIG 200125

200126 NLHQLGGGPSLLIRLRELAERYGPIMLLQVGEVPTIIISSPELAQEVMKT 200275

200276 HESCFDERPPFFAGNVYFYGNRDLIFAPYGDYWKQLRKIVTMEVLSPIRV 200425

200426 RTFRATREEEVASLIRTISSQQGSAINLSQILFSFTYSIISRISVGRNSK 200575

200576 NQKEFATIVKDFSTISKELSLAAGGANVVDLYPSQKLLHMFSWRKFRLGR 200725

200726 EHKKANKILERLIKERKASKRDKEIAENEVEDLLDVLLNLQLTVGLDSPL 200875

200876 TDECVKALLL 200905 (0)

201818 DMFAGGGDTTLTVLEWAMSELMKNPRVREKAQKEVRALFNDVGYIDESNV 201967

201968 HELQFLNLTLKETLRLHPPLCVYPRECKVNCKVAGYDLEAKTRVLINAWM 202117

202118 IGRDPKYWTEPEKFYPERFLDCSTDYKGANFEFLPFGSGKRICPGMAFGI 202267

202268 ATVELPLARLLLHFDWKIPNGIKPEDFDMSEIVSASVTRKNDIVLIPVTC 202417

202418 YDPPVKG* 202441

>CYP71D22P dup.

scaffold_122 (+) 221737-222360

fgenesh1_pg.C_scaffold_122000024|Poptr1

duplication, probable error in assembly

71B like 100% match to scaffold_122.5 exon 2

$

221737 DMFAGGGDTTLTVLEWAMSELMKNPRVREKAQKEVRALFNDVGYIDESNV 221886

221887 HELQFLNLTLKETLRLHPPLCVYPRECKVNCKVAGYDLEAKTRVLINAWM 222036

222037 IGRDPKYWTEPEKFYPERFLDCSTDYKGANFEFLPFGSGKRICPGMAFGI 222186

222187 ATVELPLARLLLHFDWKIPNGIKPEDFDMSEIVSASVTRKNDIVLIPVTC 222336

222337 YDPPVKG* 222360

>CYP71D37P

LG_XI (+) 12873790-12874128

eugene3.00111064|Poptr1

no comment

71B like PSEUDOGENE EXXR 86% TO LG_XI.14

$

12873790 NDLGTILDETSRRN 12873831

12873831 LLKLKLITEETLRLHPSAPLIPREWRKRCQVNGYDNIHVKSKVLINAWA 12873977

(deletion)

12873977 MLFAIA 12873994 (deletion)

12873994 HHFDWKPIDGLKPENLDMTESLGGATKRKRDLKLIFISYRSLVG* 12874128

>CYP71D38

LG_XI.8 (+) 12875195-12876930

fgenesh1_pg.C_LG_XI001081|Poptr1

gene model seems correct

71D like 52% to 71D9

93% to LG_XI.14  54% to scaffold_122.5

$

12875195 MLISLPVFLTILLVISILWTWTKFIKSNKSSSNPPPGPWKLPFIGNLHQL 12875344

12875345 VHPLPHHRMRDLAKKFGPVMQLQVGEVSTVIISSSEAAKEVMKTHEINFV 12875494

12875495 ERPHLLAASVLFYNRKDIAFAPYGEYWRQLRKISILELLSAKRVRSFKSI 12875644

12875645 REEEVSNFIASIYSKEGSPINLSRMIFSLENGITARTSIGNKCKNHEGFL 12875794

12875795 PIVEELAEALGGLNMIDMFPSSKFLYMVSRFRSRLERMHREADEILESII 12875944

12875945 SERRANSALASKMGKNEEDDLLGVLLNLQDHGNLEFQLTTSTIKAVIL 12876088 (0)

12876310 EMFSGGGDTSSTALEWAMSELIKNPRVMEKAQKEVRQVFNDLGTIPDETS 12876459

12876460 LHDLKFLKLIIKETLRLHPPVPLIPRECRKRCDVNGYDIHVKSKVLINAW 12876609

12876610 AIGRDPNCWNEPERFYPERFINVSTDFKGSDFEFIPFGAGKRMCPGMLFA 12876759

12876760 TANTEFPLAQMLYHFDWKPAGGLKPENLDMTESFGGAVKRKQDLKLIPIS 12876909

12876910 YRSLVG* 12876930

>CYP71D46P

LG_VI (+) 6134143-6134717

eugene3.00060769|Poptr1

no comment

71D like 52% to 71D38 exon 2

$

6134143 HMFLAGSDTT*FFEWALLEMIRNPRVMTRAQKEVREVGN 6134259

6134264 DESGLREVKYVKLIIKETLRLLPPVALLPRECRQSCKTQGYDIHEK 6134401

6134400 KNKAMINVWAMGRDPGYWIEPEKFYPE 6134480

6134480 RFLTCISDYISTDFEFLPFGA*RRMCPGLLLGKTTGRVATSHLLYHFD*ELPN 6134638

6134637 MDMTEAFSSVIGRKHDLIVIPIPFNS* 6134717

>CYP71D39

LG_XI.14 (+) 12884309-12886030

eugene3.00111066|Poptr1

gene model short

71D like 51% to 71D9 93% to LG_XI.8 54% to scaffold_122.5

$

12884309 MLLSLPVFLTILLVISILWTWTKLIKSNKSSSNPPPGPWKLPFIGNLHQL 12884458

12884459 VHPLPHHRLRDLAKKFGPVMQLQVGEVSTVIISSSEAAKEVV 12884584

12884584 KTHEINFVERPHLLAASVLFYNRKDIAFAPYGEYWRQLRKIS 12884709

12884710 ILELLSAKRVRSFKSIREEEVSNLITSIYSKEGSPINLSRMIFSLENGIT 12884859

12884860 ARTSIGNKCKNQEAFLPIVDELTEAL 12884937

12884938 GGFNMIDIFPSSKFIYMVSRVRSRLERMHREADEILESIISERRANSALA 12885087

12885088 SKMDKNEEDDLLGVLLNLQDHGNLEFQLTTSAIKAIIL 12885201 (0)

12885413 MFSGGGDTSSTALEWAMSELVKNPRVMEKAQKEVRQVFNDIGTIPDEASL 12885562

12885563 HDLKFLKLIIKETLRLHPSGPLIPRECRKRCNVNGYDIHVKSKVLINAWA 12885712

12885713 IGRDPNYWNEPERFYPDRFINVSTDFKGSDFEFIPFGAGKRMCPGMLFAI 12885862

12885863 ANIEFPLAQMLYHFDWKPADGLKPEDLDMTESLGGTVKRKRDLKLIPISYRSLVG* 12886030

>CYP71D40P

LG_XI.18 (+) 12892840-12894465

eugene3.00111067|Poptr1

gene model short may = scaf_4500 on the end

71D like pseudogene 48% to 71D4 95% to 71D39

$

12892840 MLLSLPVFLTILLVISILWTWTKLIKSNKSSSNPPPGPWKLPFIGNLHQL 12892989

12892990 VHPLPHHRLRDLAKKFGPVMQLQVGEVSTVIISSSEAAKEV 12893112

12893112 DVNFVERPHLLAASVLFYNRKDIAFAPYGEYWRQLRKISILELLSAKRVR 12893261

12893262 SFKSIREEEVSNLITSIHSQEGSPINLSRMIFSLENGITARTSIGNKCKN 12893411

12893412 QEAFLPIVDELTEAL 12893456

12893458 VTGGFNMIDIFPSSKFIYMVSRVRSRLERMHREADEILESIISERRANSA 12893607

12893608 LASKMDKNEEDDLLGVLLNLQDHGNLEFQLTTSAIKAIIL 12893727 (0)

12893963 EMFSGGGDTSSTALEWAMSELIKNPRVMEKAQKEVRQVFNDLGTIPDETS 12894112

12894113 LHDLKFLKLIIKETLRLHPPVPLIPRECRKRYNVNGYDTHVKSKVLINAW 12894262

12894263 AIGRDPNYWNELERFYPERFINVSTDFKGIDFEFIPFGAGKRMCPGKL 12894406

(deletion)

12894406 VKRKRDLKLIPISYRSLVG* 12894465

 

>CYP71D40P

scaffold_4500 (-) 3903-3733

no model

no comment

100% match to 71D40P

$

3903 VLINAWAIGRDPNYWNELERFYPERFINVSTDFKGIDFEFIPFGAGKRMCPGKLFAM 3733

 

>CYP71AN1

LG_XVI.15 (+) 13154281-13155936 

eugene3.00161321|Poptr1

gene model short at N-term one stop codon

71B like 46% to 71AH1 98% to CYP71AN2

96% to LG_XVI.24

$

13154281 MT*LLYFQQTWQEIRPKIGLNYLVFFLIFLSFILFLFKLTRSRKLNLP 13154424

13154425 PSPPKLPVIGNIHHLGTLPHRSLQALSEKYGPLMLLHMGHVPTLIVSSAE 13154574

13154575 AASEIMKTHDIVFANRPQTTAASIFFHGCVDVGFAPFGEYWRKVRKISVQ 13154724

13154725 ELLGPKTVQSFHHVREEEAAGLIDKIRFACHSGTSVNISEMLISVSSDIV 13154874

13154875 SRCVLGRKADKEGGNSKFGELTRTFMVQLTAFSFGDLFPYLGWMDTLTGL 13155024

13155025 IPRLKATSRALDSFLDQVIEEHRSLESDGDRCAQTDFLQALLQLQKNGKL 13155174

13155175 DVQLTRDNIIAVVL 13155216 (0)

13155325 DMFVGGTDTSSTMMEWAIAELVRNQTIMRKAQEEVRRIVGKKSKVEANDI 13155474

13155475 EEMGYLKCIIKETLRLHPAAPLLVPRETSASFELGGYYIPPKTRVLVNAF 13155624

13155625 AIQRDPSFWDRPDEFLPERFENNPVDFKGQDFQFIPFGSGRRGCPGALFG 13155774

13155775 VTAVEFMIANLLYWFDWRLPDGATQEELDMSEICGMTAYKKTPLLLVPSL 13155924

13155925 YSP* 13155936

>CYP71AN2v1

LG_XVI.26 (+) 13161865-13163520

eugene3.00161323|Poptr1

gene model short at N-term

71A like 44% to 71A12 97% to CYP71AN3

45% to 71AH1

$

13161865 MTELLYFQQTWQEIRPKIGLNYFVFFLIFLSFILFLFKLTTSRKLNLP 13162008

13162009 PSPPKLPVIGNIHHFGTLPHRSLQALSEKYGPLMLLHMGHVPTLIVSSAE 13162158

13162159 AASEIMKTHDIVFANRPQTTAASIFFHGCVDVGFAPFGEYWRKVKKISVQ 13162308

13162309 ELLGPKTVQSFHHVREEEAAGLIDKIRFACHSGTSVNISEMLISVSSDIV 13162458

13162459 SRCVLGRKADKEGGNSKFGELTRTVMVQLTAFSFGDLFPYLGWMDTLTGL 13162608

13162609 IPRLKATSRALDSFLDQVIEEHRSLESDGDRCAQTDFLQALLQLQKNGKL 13162758

13162759 DVQLTRDNIIAVVL 13162800 (0)

13162909 DMFVGGTDTSSTMMEWAIAELVRNQTIMRKAQEEVRRIVGKKSKVEANDI 13163058

13163059 EEMGYLKCIIKETLRLHPAAPLLVPRETSASFELGGYYIPPKTRVLVNAF 13163208

13163209 AIQRDPSFWDRPDEFLPERFENNPVDFKGQDFQFIPFGSGRRGCPGALFG 13163358

13163359 VTAVEFMIANLLYWFDWRLPDGATQEELDMSEICGMTAYKKTPLLLVPSL 13163508

13163509 YSP* 13163520

>CYP71AN2v2

scaffold_1240 (-) 6280-5579

eugene3.12400001|Poptr1

no comment

71AN like 98% to 71AN2, 3 aa diffs duplicate seq.

$

6280 MT*LLYFQQTWQEIRPKIGLNYLVFFLIFLSFILFLFKLTRSRKLNLPPS 6131

6130 PPKLPVIGNIHHFGTLPHRSLQALSEKYGPLMLLRMGHVPTLIVSSAEAA 5981

5980 SEIMKTHDIVFANRPQTTAASIFFHGCVDVGFAPFGEYWRKVKKISVQEL 5831

5830 LGPKTVQSFHHVREEEAAGLIDKIRFACHSGTSVNISEMLISVSSDIVSR 5681

5680 CVLGRKADKEGGNSKFGELTRTFMVQLTAFSFGD 5579

>CYP71AN3

LG_XVI.24 (+) 13169467-13171129

eugene3.00161324|Poptr1

gene model short at N-term

71A like 44% to 71A12

97% to CYP71AN2, 45% to 71AH1

$

13169467 MTELLYFQQTWQEIRPKIGLNYFVFFLIFLSFILFLFKLTTSRKLNLP 13169620

13169621 PSPPKLPVIGNIHHFGTLPHRSLQALSEKYGPLMLLHMGHVPTLIVSSAE 13169770

13169771 AASEIMKTHDIVFANRPQTTAASIFFHGCVDVGFAPFGEYWRKVRKISVQ 13169920

13169921 ELLGPKTVQSFHYVREEEAAGLIDKIRFACHSGTSVNLSEMLISVSNDIV 13170070

13170071 SRCVVGRKADKEGGNSKFGELTRTVMVQLTAFSFGDLFPYLGWMDTLTGL 13170220

13170221 IPRLKATSRTLDSLLDQVIEEHRSLESDGDRCAQTDFLLALLQLQKNGKL 13170370

13170371 DVQLTRDNIIAVVL 13170412 (0)

13170518 DMFVGGTDTSSTMMEWAIAELVRNQTIMRKAQEEVRRIVGKKSKVEANDI 13170667

13170668 EEMGYLKCIIKETLRLHPPAPLLVPRETSASVELGGYFIPPKTRVIVNAF 13170817

13170818 AIQRDPSFWDRPDEFLPERFENNPVDFKGQDFQFIPFGSGRRGCPGALFG 13170967

13170968 VTAVEFMIANLLYWFDWRLPDGATQEELDMSEICGMTAYKKTPLLLVPSL 13171117

13171118 YSP* 13171129

>CYP71AN4

LG_XII.23 (-) 10752455-10550851

fgenesh1_pg.C_LG_XII000892|Poptr1

gene model seems correct

71A like 44% to 71A22 65% to CYP71AN5

45% to 71AH1

$

10752455 MDPSIFLHQYWLELDRTILFSVLVLPFLAFCTIYFIKSIQTDKLNLPPSP 10752306

10752305 WKLPLIGNLHQVGRLPHRSLRTLSEKYGPLMLLHLGSSPALIVSSAETAK 10752156

10752155 EILKTHDKAFLDKPQTRAGDALFYGSSDIAFCSYGNYWRQAKKVCVLELL 10752006

10752005 SQRRVQAFQFAREEEVGKMVEKIQISCLSKVAIDLGAAFLTISNDILSRS 10751856

10751855 AFGRTYEEVDGQQLGELWRTAMDLIGEFCFKDFFPLLGWMDVITGLVSKL 10751706

10751705 KRTSKALDAFLDQVIEEHLVSRTEDDISDKKDLVDILLRIQKNGMTDIDL 10751556

10751555 SRDNLKAILM 10751526 (0)

10751444 DMFLGATDTTATTMEWAMAELVNNPSAMKKVQEEVRGVVGEKSKVEEI 10751301

10751300 DIDQMDFLKCIVK ETLRLHPPLFIGRRTSASLELEGYHIPANLKVLINAW 10751151

10751150 AIQRDPKLWDSPEEFIPERFANKSVDFKGQNHQFIPFGAGRRGCPGIAFA 10751001

10751000 VVEVEYVLANILYWFDWEFPEGITAEDLDMSEVFTPVIRKKSPLRLVPVA 10750851

10750850 HFPKTICN* 10750824

>CYP71AN5

LG_XV.21 (-) 6427585-6426017

fgenesh1_pg.C_LG_XV000592|Poptr1

gene model seems correct

71B like 46% to 71B2

65% to CYP71AN4, 47% to 71J1

$

6427585 MIMLNPLLCPFLLLSLLFLLRLVKRDKLNLPPSPPKLPIIGNLHQLGRLH 6427436

6427435 RSLRALSSKYGPLMLLHFGKVPTLIVSSAEVAHEVMKTHDVAFAGRPQTR 6427286

6427285 AADVLFYGCVDVAFCPYGEYWRQVKKICVLELLSQKRVQAFQFVREEEVA 6427136

6427135 NMVEKVRLSCLNGAAVDLSDMFLSVSNNIISRSALGRVYENEGCDESFGG 6426986

6426985 LSRKAIDLIASFCFKDMFHLLGWMDTLTGLVAGLKHTSKALHNFLDQVIE 6426836

6426835 EHESLMNNDESDMKDIVDILLDLQKNGTLDIDLTRENLKAILM 6426707 (0)

6426622 DMFVGGTDTTAAAMEWAMAELVKNPIVMKKAQEEVRRVVGKKSKLCE 6426482

6426481 KHINEMVYLKCVLKESLRLHAPAMIARETSEAVKLQGYDIPPKTRVLINA 6426332

6426331 WAIQRDPKQWERSEEFIPERFTNISVDFKGQHNQFMPFGGGRRLCPGLSF 6426182

6426181 AVIEAEMVLANLLYWFDWNIPHGGNPEDMDMSESHTLIIRKKTPLVLVPV 6426032

6426031 MLSP* 6426017

 

>CYP71AP1

LG_XII.7 (+) 10772698-10774358

fgenesh1_pm.C_LG_XII000331|Poptr1

gene model short at N-term

71B like 44% to 71B2 98% to CYP71AP2

$

10772698 MSLLQWLKECSKPTLFVVTIFLVVVLKFLMKDKLKKRKLNLPPSPAKLPI 10772847

10772848 IGNLHQLGNMPHISLRGLAKKYGPIIFLQLGEIPTVVISSAGLAKEVLKT 10772997

10772998 HDLVLSSRPQLFSAKHLLYGCTDIAFAPYGAYWRNIRKICILELLSAKRV 10773147

10773148 RSYSYVREEEVARLIRRIAESYPGITNLSSMIALYTNDVLCRVALGRDFS 10773297

10773298 GGGEYDRHGFQKMFDDFQALLGGFSLGDYFPSMEFVHSLTGMKSKLQYTF 10773447

10773448 RRFDQFFDEVIAEHRSSKGKQEEKKDLVDVLLDIQKDGSSEIPLTMDNIKAVIL 10773609 (0)

10773747 DMFAGGTDTTFITLDWAMTELIMNPHVMEKAQAEVRSVVGDRRVVQE 10773887

10773888 SDLPRLNYMKAVIKEILRLHPAAPVLLPRESLEDVIIDGYNIPAKTRIYV 10774037

10774038 NVWGMGRDPELWENPETFEPERFMGSGIDFKGQDFELIPFGAGRRICPAI 10774187

10774188 TFGIATVEIALAQLLHSFDWKLPPGLEAKDIDNTEAFGISMHRTVPLHVIAKPHFD* 10774358

>CYP71AP2v1

LG_XII.9 (+) 10777737-10779397

eugene3.00120825|Poptr1

gene model correct

71B like 43% to 71B2 98% to CYP71AP1

$

10777737 MSLLQWLKECSKPTLFVVTIFLVVVLKFLMKEKLKKRKLNLPPSPAKLPI 10777886

10777887 IGNLHQLGNMPHISLRGLAKKYGPIIFLQLGEIPTVVISSAGLAKEVLKT 10778036

10778037 HDLVLSSRPQLFSAKHLLYGCTDIAFAPYGAYWRNIRKICILELLSAKRV 10778186

10778187 RSYSYVREEEVARLIRRIAESYPGITNLSSMIALYANDVLCRVALGRDFS 10778336

10778337 GGGEYDRHGFQKMLDNFQALLGGFSLGDYFPSMEFVHSLTGMKSKLQYTF 10778486

10778487 RRFDQFFDEVIAEHRNSKGKQEEKKDLVDVLLDIQKDGSSEIPLTMDNIK 10778636

10778637 AVIL 10778648 (0)

10778786 DMFAGGTDTTFITLDWAMTELIMNPHVMEKAQAEVRSVVGDRRVVQE 10778926

10778927 SDLPRLNYMKAVIKEILRLHPAAPVLLPRESLEDVIIDGYNIPAKTRIYV 10779076

10779077 NVWGMGRDPELWENPETFEPERFMGSGIDFKGQDFELIPFGAGRRSCPAI 10779226

10779227 TFGIATVEIALVQLLHSFDWKLPPGLEAKDIDNTEAFGVSLHRTVPLHVI 10779376

10779377 AKPHFN* 10779397

>CYP71AP2v2

scaffold_9416 (-) 764-3

fgenesh1_pg.C_scaffold_9416000001|Poptr1

gene model short, runs off the end

1aa diff to 71AP2 duplicate seq. see LG_XII

$

764 MSLLQWLKECSKPTLFVVTIFLVVVLKFLMKEKLKKRKLNLPPSPAKLPI 615

614 IGNLHQLGNMPHISLRGLAKKYGPIIFLQLGEIPTVVISSAGLAKEVLKT 465

464 HDLVLSSRPQLFSAKHLLYGCTDIAFAPYGAYWRNIRKICILELLSAKRV 315

314 RSYSYVREEEVARLIRRIAESYPGITNLSSMIALYTNDVLCRVALGRDFS 165

164 GGGEYDRHGFQKMLDNFQALLGGFSLGDYFPSMEFVHSLTGMKSKLQYTF 15

 14 RRFD 3

>CYP71AP3

LG_XII.11 (+) 10791887-10793547

fgenesh1_pm.C_LG_XII000332|Poptr1

gene model wrong on N-term

71B like 42% to 71B2 95% to CYP71AP1

$

10791887 MALLQWLKECSKPTLLVVTIFLVVVLKFLMKEKLKKRKLNLPPSPAKLPI 10792036

10792037 IGNLHQLGNMPHISLRGLAKKYGPIIFLQLGEIPTVVISSAGLAKEVLKT 10792186

10792187 HDLVLSSRPQLFSAKHLFYGCTDIVFAPYGAYWRNIRKICILELLSAKRV 10792336

10792337 HWYSFVREEEVARLIRRIAESYPGITNLSSMIALYANDVLCRIALGKDFS 10792486

10792487 GGGEYDRHGFQKMLDDYQALLGGFSLGDYFPSMEFVHSLTGMKSKLQYTF 10792636

10792637 RRFDQFFDEVIAEHRSSKGKQEEEKDLVDVLLDIQKDGSSEIPLTMDNIK 10792786

10792787 AVIL 10792798 (0)

10792936 DMFAAGTDTNFITLDWAMTELIMNPHVMEKAQAEVRSVVGDRRV 10793067

10793068 VQESDLRRLNYMKAVIKEIFRLHPAAPVLVPRESLEDVVIDGYNIPAKTR 10793217

10793218 IYVNVWGMGRDPELWENPETFEPERFMGSGIDFKGQDFELIPFGAGRRSC 10793367

10793368 PAITFGVATVEIALAQLLHSFDWKLPPGLEAKDIDNTEAFGISMHRTVPL 10793517

10793518 HVIAKPHFD* 10793547

>CYP71AP4

LG_XV.20 (+) 6453904-655556

eugene3.00150650|Poptr1

gene model seems correct

71B like 44% to 71B2 90% to CYP71AP1

$

6453904 MAFLQWLKESSSPTLLFVTIFLLVALKFLVKGKLKNSKLNLPPSPAKLPI 6454053

6454054 IGNLHQLGNMPHISLRWLAKKYGPIIFLQLGEIPTVVISSVRLAKEVLKT 6454203

6454204 HDLVLSSRPQLFSAKHLFYGCTDIAFAPYGAYWRNIRKICILELLSAKRV 6454353

6454354 QWYSFVREEEVARLIHRIAESYPGTTNLSKMIGLYANDVLCRVALGRDFS 6454503

6454504 GGGEYDRHGFQKMLDDYQALLGGFSLGDYFPSMEFVHSLTGMKSKLQHTV 6454653

6454654 RRFDQFFDKVITEHQNSEGKQEEKKDLVDVLLDIQKDGSSEMPLTMDNIK 6454803

6454804 AVIL 6454815 (0)

6454945 DMFAAGTDTTFITLDWTMTELIMNPQVMEKAQAEVRSVVGDRIVVQESDL 6455094

6455095 PRLHYMKAVIKEIFRLHPAVPVLVPRESLEDVIIDGYNIPAKTRIYVNVW 6455244

6455245 GMGRDPELWENPETFEPERFMGSSIDFKGQDFELIPFGAGRRSCPAITFG 6455394

6455395 IATVEIALAQLLHSFDWELPPGIKAQDIDNTEAFGISMHRTVPLHVIAKP 6455544

6455545 HFN* 6455556

 

>CYP71AQ1

LG_XV.25 (+) 6442643-6444377

fgenesh1_pg.C_LG_XV000594|Poptr1

gene model seems correct

71A like 49% to 71AJ1 47% to 71A12, 47% to 71A26

$

6442643 MILHPYSLACLLFIFVTKWFFFNSARNKNLPPSPLKIPVVGNLLQLGLYP 6442792

6442793 HRSLQSLAKRHGPLMLLHLGNAPTLVVSSADGAHEILRTHDVIFSNRPDS 6442942

6442943 SIARRLLYDYKDLSLALYGEYWRQIRSICVAQLLSSKRVKLFHSIREEET 6443092

6443093 ALLVQNVELFSSRSLQVDLSELFSELTNDVVCRVSFGKKYREGGSGRKFK 6443242

6443243 KLLEEFGAVLGVFNVRDFIPWLGWINYLTGLNVRVEWVFKEFDRFLDEVI 6443392

6443393 EEFKANRVGVNEDKMNFVDVLLEIQKNSTDGASIGSDSIKAIIL 6443524 (0)

6443766 DMFAAGTDTTHTALEWTMTELLKHPEVMKKAQDEIRRITGSKIS 6443897

6443898 VTQDDVEKTLYLKAVIKESLRLHPPIPTLIPRESTKDVKVQGYDILAKTR 6444047

6444048 VIINAWAIGRDPSSWENPDEFRPERFLESAIDFKGNDFQFIPFGAGRRGC 6444197

6444198 PGTTFASSVIEITLASLLHKFNWALPGGAKPEDLDITEAPGLAIHRKFPL 6444347

6444348 VVIATPHSF* 6444377

 

>CYP71-un1 potri

LG_XIV (-) 9223410-9223207

eugene3.00141134|Poptr1

no comment

71 like 50% to 71AN4

57% to BM407381.1 potato roots EST

$

9223410 DIFSGGAGTTTTTIEWARLELMKSPRVMEKEQAELRQAFKGKSKVEEVDI 9223261

9223260 ENLDYLKAIIK*TLCLHP 9223207

>CYP71-un2 potri

LG_XIV (-) 9234477-9232794

eugene3.00141136|Poptr1

no comment

71 like 42% to 71D40P

$

9234477 MAMRRASSISHTLLQLHCSFPALSTFAIQIFLFMLVKYWKKCKTSKLPLI 9234328

9234327 GNLHQLNGGPLPHHGTTELSKKYGPAMQLQ 9234238

9233132 GMFAAGSDTTVTTIEWAMSELLSGPGGLDRAQTEV*QVFEGEN* 9233001

9233000 KSRTLGNQIIRDQLSKNLFRLHPPVPLLPREVTENQWAYDTREKQNDYNV 9232851

9232850 WAISRDPQQGIDANSFQPE 9232794

 

>CYP71-un3 potri

LG_VI (-) 1075479-1074052

no model

no comment

71 like pseudogene 40% to 71D26

$

1075479 SSPKMAGEVLKTRDIIFA* 1075423

1075422 RPERLASKILKFRIKDIVFSL* 1075357

1075356 GGYWRQMRKICTMELLSPK 1075300

XXXXXXXXXX

1075277 DEVSKLIKSIQAFTRRAMDFNEKIIFLTSVITCKTTLGN*CKD* 1075146

1075145 DAMISLTGEGSHLA* 1075101

1075100 GFNIVDLYPSLEFLLAIGIKLKLKKVLDQINTTLGSIINEHKEKLKGNIE 1074951

1074950 AVEEDLVDVLL 1074918

XXXXXXXXXXXXXXXXXXXXXXXXXXXX

1074462 TISSSTIIDWAMTEMMRNPRVLKKS*AEIRQALK* 1074358

1074357 NKTITEADIQELNYLKSVIK* 1074295

1074294 TMRLHPPIPLLLLIESREIC* 1074232

1074231 IDRYVTPIKTKVMVNAWAKMRDPEYWQNTENFIPKILNS 1074115

1074114 NTTLDFIGTNFTYMPFRVGKR 1074052

>CYP71-un4 potri

LG_XVI (+) 158690-159330

eugene3.00160030|Poptr1

gene model wrong

71 like pseudogene 47% to LG_VI (-) 1074348

40% to 71D26

$

158690 LIEFVRASAGRSMEFTEEVFFLTRV 158764

158812 DTMISLTKERSLLAGGFNVVDDLYPSLECLQGVVGMKAEKVLAQINQILDNI 158967

158968 NNEHKEMGNSETIEEDLVDMLVRLQEDGTFKCPIE 159072

159072 IFNIKVSL* 159098

159246 DMLFAGTGVHRM 159281

159280 WAMKEIMKNPRVVKKAQ 159330

>CYP71-un5 potri

LG_XI (-) 12867601-12867395

no gene model

no comment

71D like pseudogene no gene model at JGI

53% to CYP71D31P

$

12867601 ENDHFEYIPFGSGRRVCPYGVAIVEVTLASFLYLFEWELSSGMVPENLDM 12867452

12867451 DEAFGIAFRRKNNMCLIPI 12867395

 

>CYP73A42

LG_XIII (-)12825303-12821368

eugene3.00131281|Poptr1

gene model correct

98% to 73A13 98% to 73A16

85% to 73A5, 2 introns, 96% TO 73A43 10989681-10992498

$

12825303 MDLLLLEKTLLGSFVAILVAILVSKLRGKRFK 12825208

12825207 LPPGPIPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLVVVS 12825058

12825057 SPDLSKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRI 12824908

12824907 MTVPFFTNKVVQQYRYGWEEEAAQVVEDVKKNPEAATNGIVLRRRLQLMM 12824758

12824757 YNNMYRIMFDRRFESEDDPLFNKLKALNGERSRLAQSFDYNYGDFIPILR 12824608

12824607 PFLRGYLKICQEVKERRLQLFKDYFVDERK 12824518 (2)

12823513 KLASTKNMNNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVA 12823382 (1)

12821967 AIETTLWSIEWGIAELVNHPEIQKKLRHELDTLLGP 12821860

12821859 GHQITEPDTYKLPYLNAVIKETLRLRMAIPLLVPHMNLHDAKLGGFDIPA 12821710

12821709 ESKILVNAWWLANNPAHWKNPEEFRPERFLEEEAKVEANGN 12821587

12821586 DFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTAE 12821437

12821436 KGGQFSLHILKHSTIVAKPRSF* 12821368

>CYP73A43

LG_XIX (+)10989681-10992498

estExt_Genewise1_v1.C_LG_XIX2612|Poptr1

gene model corrrect

84% to 73A5, 2 introns, 96% TO 73A42 12825303-12821368

$

10989681 MDLLLLEKTLLGSFVAILVAILVSQLRGKRFKLPPGPLPVPVFG 10989812

10989813 NWLQVGDDLNHRNLTDLAKKFGDILLLRMGQRNLVVVSSPDLAKEVLHTQ 10989962

10989963 GVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQ 10990112

10990113 QYRYGWEEEAAQVVEDVKKNPEAATHGIVLRRRLQLMMYNNMYRIMFDRR 10990262

10990263 FESEEDPLFNKLKALNGERSRLAQSFDYNYGDFIPILRPFLRGYLKICKE 10990412

10990413 VKERRLQLFKDYFVEERK 10990466 (2)

10990867 KLGSTKSMSNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVA 10990998 (1)

10991899 AIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGHQITEPDTNKLPY 10992048

10992049 LNAVIKETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANN 10992198

10992199 PAKWKNPEEFRPERFFEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPI 10992348

10992349 LGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVAKPRSF* 10992498

>CYP73A44

Scaffold_164 (+)432328-434026

eugene3.01640067 |Poptr1

gene model correct

65% to 73A5, 1 intron 66% to 73A42 and 73A43

79% to 73A27 tobacco

$

432328 MASFVTKSMGFTLLAVASVSCIKFACPNLSTYFSPLPISVILPLLPLIVYLFSSVFTK 432501

432502 SSTGDLPPGPVSYPMFGNWLQVGNDLNHRLLASMSQTYGPVFLLKLGSKN 432651

432652 LAVVSDPELANQVLHTQGVEFGSRPRNVVFDIFTGNGQDMVFTIYGEHWR 432801

432802 KMRRIMTLPFFTNKVVNQYSTSWEQEMDLVVDDLRANEKVRTEGIVIRKR 432951

432952 LQLMLYNIMYRMMFDAKFQSQEDPLFVQATRFNSERSRLAQSFEYNYGDF 433101

433102 IPWLRPFLRGYLNKCRDLQQRRLAFFNNYYIEKRR 433206 (2)

433292 KIMAANGEKHKVSCAMDHIIQAQMKGEISEENVLYIVENINVAAIETTL 433438

433439 WSMEWAIAELVNHPTVQRKIRDEIRAVLKGSPVTESNLHELPYLQATIKE 433588

433589 TLRLHTPIPLLVPHMNLEEAKLGGFTIPKESKVVVNAWWLANNPEWWEKP 433738

433739 SEFRPERFLEEERDTEAIVGGKVDFRFLPFGVGRRSCPGIILAMPILGLI 433888

433889 VARLVSNFEMIAPPGMEKIDVSEKGGQFSLHIASHSTVVFKPIKA* 434026

>CYP73A45P

LG_VI (-)5146670-5145983

eugene3.00060651|Poptr1

eugene3.00060650|Poptr1 gene model short

pseudogene 82% to 73A44

$

5146670 SCAMDHMIHAQMKGVTSEENVLYIAENINVAGIETALWS 5146554

5146553 TAELVNHPTVQKKIRDEITTVLKGKPVTESNLHELPY*QATIKET 5146419

5146416 LHAPIPLLVPRMNLEEAKLGGFTIPKESKVVVNAWWLSNNPDW*EKPSEF 5146267

5146266 RPERVLEEDRDTESVVGGKVDFRFASY 5146186

5146189 LPFGVGRRSCPGIILAMPIMGLVNARLVSNFEMKAPPATGKID 5146061

5146060 ASEEGGQFSLHIANHSAVVFDPIKA* 5145983

 

>CYP75A13

LG_I (+) 19972937-19975122

fgenesh1_pg.C_LG_I001972 [Poptr1:64620]

no comment

80% to 75A8 87% to CYP75A12

flavonoid 3',5'-hydroxylase

$

19972937 MDVDPVLPGKLTLAALLFFISYQFTGSFIRKLLHRYPPGPRGWPIIGAIP 19973086

19973087 LLGDMPHVTLAKMAKKHGPVMYLKMGTRDMVVASNPDAARAFLKTLDLNF 19973236

19973237 SNRPIDGGPTHLAYNAQDMVFADYGPRWKLLRKLSNLHMLGGKALEDWAP 19973386

19973387 VRVTELGHMLRAMCEASRKGDPVVVPEMLTYAMANMIGQIILSRRVFVTK 19973536

19973537 GSESNEFKDMVVELMTSGGFFNIGDFIPSVAWMDLQGIERGMKKLHRRFD 19973686

19973687 VLLTKMIEDHSATSHERKGKPDFLDVLMANQENSDGARLCLTNIKALLL 19973833 (0)

19974493 DLFTAGTDTSSSVIEWALAEMLKNQSILKRAQEEMDQVIGRNRRLVESDI 19974642

19974643 PKLPYLQAVCKETFRKHPSTPLNLPRIADQACEVNGYYIPKGARLSVNIW 19974792

19974793 AIGRDPDVWDNPEVFTPERFFTEKYAKINPRGNDFELIPFGAGRRICAGA 19974942

19974943 RMGIVLVEYILGTLVHSFDWKLPEDVDLNMDEVFGLALQKAVPLSAMVSP 19975092

19975093 RLEPNAYLA* 19975122

>CYP75A12

LG_IX (-) 6112639-6110882

fgenesh1_pm.C_LG_IX000390|Poptr1

no comment

87% to CYP75A13

$

6112639 MVLLWELTMAALFFFINYLLTRCLIRKLSTRQL 6112541

6112540 PPGPRGWPIIGAIPVLGAMPHAALAKMAKQYGPVMYLKMGTCNMVVASTP 6112391

6112390 DAARAFLKTLDLNFSNRPPNAGATHLAYNAQDMVFADYGPRWKLLRKLSN 6112241

6112240 LHMLGGKALEDWAHVRVSELGHMLRAMCEASRKGEPVVVPEMLTYAMANM 6112091

6112090 IGQIILSRRVFVTKGSESNEFKDMVVELMTSAGLFNVGDYIPSVAWMDLQ 6111941

6111940 GIERGMKRLHRRFDVLLTKMMEEHIATAHERKGKPDFLDVLMANQENLDG 6111791

6111790 EKLSFTNIKALLL 6111752 (0)

6111511 NLFTAGTDTSSSIIEWSLAEMLKNPRILKQAQDEMDQVIGRNRRLEESDI 6111362

6111361 PKLPYLQAICKETFRKHPSTPLNLPRIADQACEVNGYYIPKGTRLSVNIW 6111212

6111211 AIGRDPDVWDNPLDFTPERFFSEKYAKINPQGNDFELIPFGAGRRICAGT 6111062

6111061 RMGIVLVQYILGTLVHSFDWKLPKDVELNMDEVFGLALQKAVPLSAMVTP 6110912

6110911 RLEPNAYLA* 6110882

>CYP75B12

LG_XIII (-) 6200373-6197990

estExt_fgenesh1_pg_v1.C_LG_XIII0709|Poptr1

no comment

75B like 75% to 75B1

$

6200373 MSPLILYSALLAIFVYCLLQLRSLRDRHGKPLPPGPKPWPLVGNLPHLGP 6200224

6200223 MPHHSMAALAKTYGPLMHLRFGFVDVVVAASASVAAQFLKVHDSNFSSRP 6200074

6200073 PNSGAKHIAYNYQDLVFAPYGPRWRMLRKISSVHLFSAKSLDDFRHIRQ 6199927 (0)

6199385 EEVAVLTGALTRSGPTTPVNLGQLLNVCTANALGRVMLGRRVFGDGSGD 6199239

6199238 GDPKADEFKSMVVEVMVLAGVFNIGDFVPALEWLDLQGVAAKMKKLHKRF 6199089

6199088 DAFLTNIVEEHKTSSSTASVRSEKHTDLLSTLIALKEQQDVDGEEGKLTD 6198939

6198938 TEIKALLL 6198915 (0)

6198643 LQNMFTAGTDTSSSTVEWAIAELIRHPDILAQVKQELDSVVGRDRLVTEL 6198494

6198493 DLAQLTYLQAVVKETFRLHPSTPLSLPRIAAESCEIGGYHIPKGSTVLVN 6198344

6198343 VWAIARDPDVWTKPLEFRPERFLPGGDKADVDVKGNDFELIPFGAGRRIC 6198194

6198193 AGMSLGLRMVQLLTATLIHAFDWDLADGLVPEKLNMDEAYGLTLQRADPL 6198044

6198043 MVHPRPRLSPKVYRTPN* 6197990

 

>CYP76A8

LG_VI (-) 6443611-6441801

eugene3.00060817|Poptr1

gene model seems correct

76C like 49% to 76G1

52% to scaffold_28  (+)  3043896

$

6443611 MEWLWPSNLSISLSLFSLALLSLLLLRAKSSQKRHPPGPSGWPIFGNLFD 6443462

6443461 LGSMPHRTLTDMRQKYGNVIWLRLGAMNTMVILSAKAATEFFKNHDLSFA 6443312

6443311 DRTITETMRAHGYDQGSLALAPYGSYWRVLRRLVTVDMIVTKRINETASI 6443162

6443161 RRKCVDDMLQWIEEESCKVGKAAGIHVSRFVFLMTFNMLGNLMLSRDLLD 6443012

6443011 PESKVGSEFFDAMMGLMEWSGHANLADFFPWLRRLDLQGLRKNMERDLGK 6442862

6442861 AMEIASKFVKERVEDKIVTSDSRKDFLDVLLEFRGSGKDEPDKLSERDVN 6442712

6442711 IFIL 6442700 (0)

6442415 EIFLAGSETTSSTVEWALTELLCNPESMIKVKAELAQVVRASKKVEES 6442272

6442271 DMENLPFLQAVVKETLRLHPPIPFLVPRRAMQDTNFMGYDIPKNTQVLVN 6442122

6442121 AWAIGRDPDAWDDPSCFMPERFIGKRVDYRGQDLEFIPFGAGRRMCAGVP 6441972

6441971 LAHRVLHLILGSLLHHFDWEFEANVNPASVDKKDRMGITVRKSEPLMAVP 6441822

6441821 KRFNKA* 6441801

>CYP76A9P

scaffold_28 (+) 3042728-3044399

eugene3.00280293|Poptr1

gene model short missing EXXR and heme signature

76G like pseudogene 41% to 76G1

52% to LG_VI (-)  6442139

$

3042728 MESAWNLLAG*GLFS 3042782

3042784 LKQRKLRVDTKQQQPGPPAWPVF 3042852

3042853 GNIFDLGAIPHQTLYKLKEKYGPVIWLKLGYTNTLVIQSAETAAGLFKNH 3043002

3043003 DLAFSDRKVLLVFTAHNYYQGSLALGWYGPNWRMLQ 3043110

3043113 SLLNKAHDKLITKQIDQTAVLRQKCIDDMIRYIEEDVAEAQAQGESGEIK 3043262

3043263 GAHYLFLMTFNLIGNLVLSRDLVNPRSKDGHKFYDAMNNVMKRAGTRNVA 3043412

3043413 EFLTFLKWLDPQGIMRNMVQDMRQTMRIVEKFVKERTEEWKSGRKKTNDF 3043562

3043563 LDALLEHEGDEKDGPDVISDQNRLIIIL 3043646 (0)

3043773 EMSFGGSETTSTAMEWAMTELLRNPMVMG*ATEELHQVVGPK* 3043901

3043902 KVEESDIDQLPYLQPVVKETLRLHPVIPLLLPQNTLEDTNFMGHLIPKDT 3044051

3044052 QVFAKA*GIGRDPDSWEDPMSFKPERFLGSNIEYRGQNFEFIPFGSGR* 3044198

3044199 ICVGMLLAHRVVLLGLASLLHCFDWELGSNYAPGTIDVNERMGLTVQKLI 3044348

3044349 PLKAKPKQIGRMINVK* 3044399

>CYP76A9P-de2b

scaffold_28 (+) 3040250-3041175

no model

no comment

76 like two C-TERM fragments

$

3040250 MASLLHSFDWEISSGTNPETLD 3040315

3041175 TLDMNWWMGITVRKLVPLYAIPRKI 3041249

>CYP76F3

LG_Ia (-) 8580345-8578719

fgenesh1_pm.C_LG_I000361 [Poptr1:48778]

gene model wrong at N-term

47% to 76C4, 71% to LG_III (+) 11354190

$

8580345 MESLINLLLCVLFTFVL 8580295

8580294 VKILHFIARGSKTESSGKLPPGPAALPIIGSLLDLGDKPHKSLARLAKTH 8580145

8580144 GPLMSLKLGQITTIVISSPTLAKEVLQKHDVSFSNRTIPDALRAHKHHEL 8579995

8579994 GLPWVPIAMRWRNLRKVCNSYIFTNQKLDANQDLRRKKIQELVALVQEHC 8579845

8579844 LAGEAMDIGQAAFTTALNALSNSIFSLNLSDSNSETASQLKEVVGGIMEE 8579695

8579694 AGKPNLADYFPVLRRIDLQGIKRRMTIHFGKILNIFDGIVNERLQLRKMQ 8579545

8579544 GYVPVNDMLDTLLTISEDNNEDIMETSQIKHLFL 8579443 (0)

8579324 DLFAAGTDTTSSTLEWAMAELLHNPRTLSIARTELEQTIGKGSLIEE 8579184

8579183 SDIVRLPYLQAVIKETFRLHPAVPLLLPRKAGENVEISGYTIPKGAQLFV 8579034

8579033 NAWAIGRDPSLWEDPESFVPERFLGSDIDARGRNFELIPFGAGRRICPGL 8578884

8578883 PLAMRMLHMMLGSLIHSFDWKLENGVTPESMDMEDKFGITLGKARSLRAV 8578734

8578733 PIQL* 8578719

>CYP76F4

LG_III (+) 11353007-11354677

estExt_Genewise1_v1.C_LG_III0204|Poptr1

gene model seems correct

76C like 47% to 76C4

71% to LG_I   (-)  8580324

$

11353007 MNFFISVLLYFLLTFAVIQSLDYILRRSKRKSGKLPPGPSRLPIVGNLLD 11353156

11353157 LGDKPHKSLAKLAKTHGQLMSLKLGQVTTIVVSSATMAKEVLQKHDLTFC 11353306

11353307 NRTVVDAVRALDHHEAGIAWLPVATRWRNLRKICNSHIFTAQKLDANQDL 11353456

11353457 RRKKVQDLLAEVQERCLVGEAVDLRQAAFTATLNALSNTVLSLDLTDLSS 11353606

11353607 DIAREFKEHISCIMDEAGKPNLVDYFPLLRRIDPQGIRRRTAIHFGKVFD 11353756

11353757 LFDRLIIERLQLRKVKGYIPLDDMLDTLLTISEVNNEEMDATRIKHFFL 11353903 (0)

11354058 DLFGAGTDTTSSTLEWAMAELLHSPKTLLKARAELERTIGEGNLLEESDI 11354207

11354208 TRLPYLQAVIKETLRLHPAVPFLLPHKAGADAEIGGFTVPKNAQVLVNVW 11354357

11354358 AIGRDPSMWEDPNSFVPERFLESGIDHRGQNFEFIPFGSGRRICPGLPLA 11354507

11354508 MRMLPLMLGSLILSFDWKLADGVTPENLNMDDKFGLTLLKAQPLRAIPIT 11354657

11354658 RELKHG* 11354677

>CYP76G-se1[2]

scaffold_256 (+) 532-1167

eugene3.02560001|Poptr1

no comment

76G like exon 2 only

97% to scaffold_256 (+) 69529

$

 532 EMFTAGTDTTTSTLEWAMAELLRNPKVMKTVQSELRSTIGLNKKLEDKDI 681

 682 ENLPYLKAVIRETLRLHPPLPFLVPHMAMNPCKMLGYYIPKETTILVNVW 831

 832 AIGRDSKTWDDPLVFKPERFLEPNMVDYKGRHFEFIPFGSGRRMCPAMPL 981

 982 ASRVLPLALGSLLLSFDWILPVGLKPEDMDMTEKIGITLRKSVPLKVIPT 1131

1132 PYKGSSNHYGF* 1167

>CYP76G-se2[1]

scaffold_256 (+) 26660-27136

eugene3.02560004|Poptr1

no comment

76G like exon 1 fragment

1 aa diff to scaffold_256  6  (+)    34579

$

26660 MDYEIAGLVLAVLLWVAWAVVTQRRYRRFEEQGQLPPGPRPLPVVGNIFL 26809

26810 LGWAPHESFANLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLA 26959

26960 GRKIYEAIRGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVSSRLDAMQGARTRVHRWHA 27136

>CYP76G2

scaffold_256 (+) 32430-34839

fgenesh1_pg.C_scaffold_256000007|Poptr1

gene model correct

76G like 66% to 76G1

97% to scaffold_256 (+) 69529

$

32430 MDYEIAGLVLAVLLWVAWAVVTQRRYRRFEEQGQLPPGPRPLPVVGNIFL 32579

32580 LGWAPHESFANLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLA 32729

32730 GRKIYEAIRGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVTSRLDAMQGA 32879

32880 RTRCIDGMLQYIEDDSANGTSAIDLGRYFFLMAFNLIGNLMFSKDLLDPK 33029

33030 SEKGAKFFQHAGIVLELAGKPNMADFFPILRWLDPQGVRRKTQFHVARAF 33179

33180 EIAGGFIKERTESTQKENSRDDKRKDYLDVLLEFRGDGVEEPSRFSSTTI 33329

33330 NAIVL 33344 (0)

34204 EMFTAGTDTTTSTLEWAMAELLRNPNVMKTVQSELRSTIGPNKKLEDKDI 34353

34354 ENLPYLKAVIRETLRLHPPLPFLVSHMAMNPCKMLGYYVPKETTILVNVW 34503

34504 AIGRDSKTWDDPLVFKPERFLEPNMVDYKGRHFEFIPFGSGRRMCPAMPL 34653

34654 ASRVLHLALGSLLLSFDWILPDGLKPEDMDMTEKIGITLRKNVPLKVIPT 34803

34804 PYKGSSHHYGF* 34839

>CYP76G3

scaffold_256 (+) 67375-69789

eugene3.02560008|Poptr1

gene model correct

76G like 66% to 76G1

97% to scaffold_256 (+) 34579

$

67375 MDYEIAGLVLAVLLWVAWAVVTERRYRRFEEQGQLPPGPRPLPVVGNIFL 67524

67525 LGWAPHESFANLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLA 67674

67675 GRKIYEAIRGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVTSRLDAMQGA 67824

67825 RTRCIDGMLQYIEDDSANGTSAIDLGRYIFLMAFNLIGNLMFSKDLLDPK 67974

67975 SEKGAKFFQHAGKVVELAGKPNMADCFPILRWLDPQGIRRKTQFHVARAF 68124

68125 EIAGGFIKERTESTQKENSRDDKRKDYLDVLLEFRGDGVEEPSRFSSTTI 68274

68275 NAIVL 68289 (0)

69154 EMFTAGTDTTTSTLEWAMAELLHNPKVMKTVQSELRSTIGPNKKLEDKDI 69303

69304 ENLPYLKAVIRETLRLHPPLPFLVPHMAMNPCKMLGYYIPKETTILVNVW 69453

69454 AIGRDSKTWDDPLVFKPERFLEPNMVDYKGRHFEFIPFGSGRRMCPAMPL 69603

69604 ASRVLYLALGSLLLSFDWILPDGLKPEDMDMTEKIGITLRKSVPLKVIPT 69753

69754 PYKGSSNHDGF* 69789

>CYP76G4

scaffold_256 (+) 78586-81678

fgenesh1_pg.C_scaffold_256000012|Poptr1

gene model seems correct

76G like 68% to 76G1

97% to scaffold_256 (+)   100990

$

78586 MDYEIAGLVLAVLLWVAWAVVTERRYRRSEEQGQLPPGPRPLPVVGNIFQ 78735

78736 LGWAPHESFTNLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLA 78885

78886 GRKIYEAMKGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVTSRLDAMQGA 79035

79036 RTRCIDGMLQYIEDGSANGTRAIDLGRYIFLMAFNLIGNLMFSKDLLDPK 79185

79186 SEKGAKFFQHAGKVTELAGKPNMADFLPILRWLDPQGIRRKTQFHVARAF 79335

79336 EIAGGFIKERTESVQKENSRDDKRKDYLDVILEFRGDGVEEPSRFSSTTI 79485

79486 NVIVF 79500 (0)

81043 EMFTAGTDTTTSTLEWAMAELLHNPKVLKTVQSELRSTIGPNKKLEDKDV 81192

81193 ENLPYLKAVIRETLRLHPPLPFLVPHMAMNPCKMLGYYVPKETTILVNVW 81342

81343 AIGRDSKTWDDPLVFKPERFLEANMVDYKGRHFEFIPFGSGRRMCPAMPL 81492

81493 ASRVLPLALGSLLLSFDWILPDGLKPENMDMTEKIGITLRKSVPLKVIPT 81642

81643 PYKGSSNHDGF* 81678

>CYP76G5

scaffold_256 (+) 98560-101256

eugene3.02560012|Poptr1

gene model correct

76G like 68% to 76G1

97% to scaffold_256 (+) 81418

$

 98560 MDYEIAGLVLAVLLWVAWAVVTERRYRRSEEQGQLPPGPRPLPVVGNIFQ 98709

 98710 LGWAPHESFTNLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLA 98859

 98860 GRKIYEAMKGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVTSRLDAMQGA 99009

 99010 RTRCIDGMLQYIEDGSANGTSAIDLGRYIFLMAFNLIGNLMFSKDLLDPK 99159

 99160 SEKGAKFFQHAGKVMELAGKPNMADFLTILRWLDPQGIRRKTQFHVARAF 99309

 99310 EIAGGFIKERTESMQKENSRDDKRKDYLDVLLEFRGDGVEEPSRFSSTTI 99459

 99460 NVIVF 99474 (0)

100624 EMFTAGTDTTTSTLEWAMAELLRNPKVLKTVQSELRSTIGPNKKLEDKDI 100773

100774 ENLPYLKAVIRETLRLHPPLPFLVPHMAMNPCKMLGYYIPKETTILVNVW 100923

100924 AIGRDSKTWDDPLVFKPERFLESNMVDYKGRHFEFIPFGSGRRMCPAMPL 101073

101074 ASRVLPLALGSLLLSFDWILPEGLKPEDMDMTEKMGITLRKSVPLKVIPT 101223

101224 PYKRSSDHYGF 101256

>CYP76T1

LG_II (+) 11243028-11244627

eugene3.00021389 [Poptr1:552074]

gene model short at N-term, frameshift

76C like 51% to 76C4

97% to LG_II    (+) 11302436

$

11243028 MEYLFYLLLISFCWACLHVLNASVLLRRKSGCTVLPPA 11243141

11243141 PRQLPIIGNILALGDKPHRTLAKLSQTYGPLMTLKLGRITTIVISSP 11243281

11243282 NIAKEALQKHDQALSSRTVPDALHVQYYNYHKNSMIWLPASTQWKFLRKL 11243431

11243432 TATQMFTSQRLDASRALRGKKVQELLEYVHEKCNNGHAVDVGRSVFTTVL 11243581

11243582 NLISNTFFSLDVTNYNSDLSQEFSNLVVGFLEQIGKPNIADYFPILRLVD 11243731

11243732 PQGIRRKTNNYLKRLTQIFDSIINERTRLRSSSVASKASHDVLDALLILA 11243881

11243882 KENNTELSSTDIQVLLI 11243932 (0)

11244034 DFFIAGTDTTSSTVEWAMTELLLNPDKMVKAKNELQQVEGPVQESDISKC 11244183

11244184 PYLQAIVKETFRLHPPSPFLPRKAVSEVEMQGFTVPKNAQVLITIWAIGR 11244333

11244334 DPAIWPEPNSFKPERFLECQADVKGRDFELIPFGAGRRICPGLPLGHKMV 11244483

11244484 HLTLASLIHSFDWKIADDLTPEDIDMSETFGFTLHKSEPLRAIPMKT* 11244627

>CYP76T2

LG_II (+) 11302436-11304039

eugene3.00021394|Poptr1

gene model seems correct

76C like 50% to 76C4

96% to LG_II       (+) 11371594

$

11302436 MEYLFYLLLISFCWACLHVLNASVLLRRKSGCTVLPPGPRQLPIIGNILA 11302585

11302586 LGDKPHRTLAKLSQTYGPLMTLKLGRITTIVISSPNIAKEALQKHDQALS 11302735

11302736 SRTVPDALHVQYYN 11302777

11302778 YHKNSMVWLPASTHWKFLRKLTATQMFTSQRLDASRALRGKKVQELLEYV 11302927

11302928 HEKCNNGHAVDVGRSVFTTVLNLISNTFFSLDVTNYNSDLSQEFSNLVVG 11303077

11303078 VLEQIGKPNIADYFPILRLVDPQGIRRKTNNYLKRLTQIFDSIINERTRL 11303227

11303228 RSSSVASKASHDVLDALLILAKENNTELSSTDIQVLLI 11303341 (0)

11303443 DFFIAGTDTTSSTVEWAMTELLLNPDKMVKAKNELQQVEGPVQESDISKC 11303592

11303593 PYLQAIVKETFRLHPPSPLLLPRKAVSEVEMQGFTVPKNAQILINIWAIG 11303742

11303743 RDPAIWPDPNSFKPERFLECQADVKGRDFELIPFGAGRRICPGLPLGHKM 11303892

11303893 VHLTLASLIHSFDWKIAGDLTPEDIDTSETFGLTLHKSEPLRAIPMKT* 11304039

>CYP76T3

LG_II (+) 11339047-11340633

fgenesh1_pm.C_LG_II000640 [Poptr1:342710]

gene model seems correct

76C like 52% to 76C4

95% to LG_II      (+) 11302436-11304039

$

11339047 MEYLFYLLLISFCWACLHVLNASVLLRRKSGCTILPPGPRQLPIIGNILA 11339196

11339197 LGDKPHRTLAKLSQTYGPLMTLKLGRITTIVISSPNIAKEALQKHDQALS 11339346

11339347 SRTVPDAVRGHHKNSILWLPASSHWKFLKKLTATQMFTSQRLDASRALRG 11339496

11339497 KKVQELLEYVHEKCNNGHAVDVGRSVFTTVLNLISNTFFSLDIANYNSDL 11339646

11339647 SQEFSYLVVGVMEQIGKANIADYFPILRLVDPQGIRRKTNNYLKRLTQIF 11339796

11339797 DSIINERTRLRSSSVASKASHDVLDALLILAKENNTELSSTDIQVLLL 11339940 (0)

11340037 DFFIAGTDTTSSTVEWAMTELLLNPDKMVKAKNELQQVEGPVQESDISKC 11340186

11340187 PYLQAIVKETFRLHPPAPLLLPRKAVSEVEMQGFTVPKNAQILINIWAIG 11340336

11340337 RDPTIWPDPNSFKPERFLECQADVKGRDFELIPFGAGRRICPGLPLGHKM 11340486

11340487 VHLALASLIHSFDWKIADDLTPEDIDTSETFGITLHKSEPLRAIPMKT* 11340633

>CYP76T4

LG_II (+) 11361815-11362516

eugene3.00021397|Poptr1

no comment

76C like 93% to LG_II    (+) 11371594

(sequence gap)

$

11361815 RRKSGCTVLPPGPRQLQIIGNILALGDKPHRTLAKLSQTYGPLMTLKLGR 11361964

11361965 ITTIVISSPNIAKEALQKHDQALSSRTVPDALRVHHRNSILWLPASTHWK 11362114

11362115 FLRKLTATQMFTSQRLDASQALRGKKAQEMLEYVHENCNNGHAVDIRRSV 11362264

11362265 FTTSLNLISNTFFSLDIANYNSDLSQEFSDLVVGVTEQIGKPNIADYFPI 11362414

11362415 LRLVDPQGVRRKTNNYLKRLTQIFDSIINERTRP 11362516

>CYP76T5

LG_II (+) 11370278-11371869

fgenesh1_pg.C_LG_II001397 [Poptr1:347891]

gene model seems correct

76C like 52% to 76C4

96% to LG_II         (+) 11302436

$

11370278 MEYLFFVLLISFTWACLHVPIASILLRRKSGCTVLPPGPRQLPIIGNILA 11370427

11370428 LGDKPHRTLANLSQTYGPLMTLKLGRITTIVISSPNIAKEALQKHDQALS 11370577

11370578 SRTVPDALRVHHKNSMIWLPASTHWKFLRKLTATQMFTSQRLDASRALRG 11370727

11370728 KKVQELLEYVHENCNNGHAVDVGRSVFTTVLNLISNTFFSLDVTNYNSDL 11370877

11370878 SQEFSDLVVGVMEQIGKPNIADYFPILRLVDPQGIRRKTNNYLKRLTQIF 11371027

11371028 DSIINERTRLRSSSVASKASHDVLDALLILAKENNTELSSTDIQVLLI 11371171 (0)

11371273 DFFIAGTDTTSSTVEWAMTELLLNPDKMVKAKNELQQVEGPVQESDISKC 11371422

11371423 PYLQAIVKETFRLHPPVPLLLPRKAVSEVEMQGFTVPKNAQILINIWAIG 11371572

11371573 RDPAIWPDPNSFKPERFLECQADVKGRDFELIPFGAGRRICPGLPLGHKM 11371722

11371723 VHLTLASLIHSFDWKIADDLTPEDIDTSETFGITLHKSEPLRAIPMKT* 11371869

>CYP76T6

scaffold_5854 (+) 673-2263

eugene3.58540001|Poptr1

gene model short in middle 1 frameshift

76 like 51% to 76C4 50% to 76F2 Vitis vinifera

97% to LG_II   (+) 11340358

$

 673 MEYLFYLLLISFCWACLHVLNASVLLRRKSGCTILPPGPRQLPIIGNILA 822

 823 LGDKPHRTLAKLSQTYGPLMTLKLGRITTIVISSPNIAKEALQKHDQALS 972

 973 SRTVPDAVRGHHKNSILWLPASSHWKFLKKLTATQMFTSQRLDASRALRG 1122

1123 KKVQELLEYVHEKCN 1167

1167 QGHAVDVGRSVFTTVLNLISNTFFSLDIANYNSDLSQEFSYLVVGVM 1307

1308 EQIGKANIADYFPILRLVDPQGIRRKTNNYLKRLTQIFDSIINERTRLRS 1457

1458 SSVASKASHDVLDALLILAKENNTELSSTDIQILLL 1565 (0)

1667 DFFNAGTDTTSSTVEWAMTELLLNPDKMVKAKNELQEIEGPVQESDISKC 1816

1817 PYLQAIVKETFRLHPPAPLLLPRRAVSEVEMQGFTVPKNAQILINIWAIG 1966

1967 RDPAIWPDPNSFKPERFLECQADVKGRDFELIPFGAGRRICPGLPLAHKM 2116

2117 VHLTLASLIHSFDWKIADDLTPEDIDMSETFGLTLHKSEPLRAIPMKT* 2263

 

>CYP80C1

LG_XII (-) 13076542-13074912

estExt_fgenesh1_pg_v1.C_LG_XII0135|Poptr1

gene model seems correct

76G like 45% to 76C2 49% to 80B2

66% to LG_XV        (-) 10045180

$

13076542 MDQRFLQRLFSLVSSAEILFLLLLPLTFIILKNIIRSCSESKYLPPGPKP 13076393

13076392 WPIIGNLLHVGNQPHVSLAEIAKIHGPLISLRLGTQLLVVGSSAKAAAEI 13076243

13076242 LKTHDRFLSARHVPQVIPRESHVLRRVALVWCPESIDTWKLLRGLCRTEL 13076093

13076092 FSAKAIESSATLREKKVGELMDFLVAREGKVVSIGEVVFSTVFNTISNLL 13075943

13075942 FSNDLAGLEEKGMSSGLKSHVRKLMLLVATPNIADFYPIFAGLDPQGLRR 13075793

13075792 KLSKLVEETFAIWAINIKERRNSYVHDSPKRDFLDVFLANGFDDDQINWLAA 13075637 (0)

13075517 ELFSAGTDTTATTIEWAVAEILKNKEVMKKVDEELEREITKNTISESDVS 13075368

13075367 GLPYLNACIKETLRLHPPVPLLVPHRATETCEVMKYTIPKDSQVLVNVWA 13075218

13075217 ISRDPSTWEDPLSFKPDRFLGSNLEFKGGNYEFLPFGAGRRICPGLPMAN 13075068

13075067 KLVPLILASLIRCFDWSLPNGEDLAKLDMKDKFGVVLQKEQPLVLVPKRRL* 13074912

>CYP80C-se1[1]

scaffold_12820 (-) 312-52

no gene model

no comment

76C like N-term 50% to 76C3 no gene model at JGI

probable pseudogene 65% to LG_XII      (-) 13076542

$

312 ILKCVSSPSSKNQSLPPGPKPWPIIGNILHFGKKPHISTAYFAKTHGPLISLKLGKQLLIVGSSKR 115

114 AATXILKSHDRLLSARYVFKA 52

>CYP80C2

LG_XV (-) 10046207-10044971

fgenesh1_pg.C_LG_XV001071|Poptr1

Missing N-term in a seq gap

76C like 43% to 76C2

68% to LG_XII    (-) 13075301

 (seq gap)

$

10046207 RISIVWATQCSDGWKSLRALCRNELFSAKAIESQAVLREKKMGEMVGFIG 10046058

10046057 RREGEVVGIGEVVLAIVFNTIANLLFSVDLIGLEDDGATTGLKSLMWRMM 10045908

10045907 KLGATPNIADFYPILGGIDPQGLKRKMAVCVNQMFDIWGKYINERREKHV 10045758

10045757 HDGPRSDFLDVFLANGFEDLQINWLAL 10045677 (0)

10045576 ELLSAGTDTTATTVEWAIAELLKNKEVLKKVSEEIKRETDTNSLKESHVS 10045427

10045426 QLPYLNACVKETLRLHPPVPFLIPRRALETCKVMDYTIPRDSEVIVNVWA 10045277

10045276 VGRDPSLWEDPLSFKPERFLGSDLDFKGQDFEFLPFGAGRRICPGLPMAA 10045127

10045126 KQVHLIIATLLYYFDWSLPNGEDPAMLDMSEKFGITLQKEQPLLVVPRRRI* 10044971

>CYP80D-se1[1]

LG_XII (-) 13112302-13111922

eugene3.00121151|Poptr1

no comment

76C like pseudogene

80% to LG_XII     (-) 13087099

$

13112302 SFFLLAILFLLSIVLKHKSSLAIPPWPNSWPIIGNELQMGNKPHIFLQVD 13112153

13112152 GPLTSLRLGTQLVVVGSSRKAASEILKTHDRELSGRCVPNVPFAKDPKLN 13112003

13112002 GDSIAWTVECTDRWKFFRSRIINELFL 13111922

>CYP80D1

LG_XII (-) 13100933-13099325

eugene3.00121149|Poptr1

gene model seems correct

76G like 41% to 76C2

97% to LG_XII     (-) 13087099

$

13100933 MVSISVLANSYPSFPMLFLLAILLLLSLVLKHKSSKVPAIPPGPKSWPII 13100784

13100783 GNVLQMGNKPHISLTKLAQVYGPLMSLRLGTQLVVVGSSREAASEILKTH 13100634

13100633 DRELSGRCVPHASFAKDPKLNEDSIAWTFECTDRWRFFRSLMRNELFSSK 13100484

13100483 VVDGQSRTRETKAREMIDFLKKKEGEGVKIRDIVFVYTFNVLANIYLSKD 13100334

13100333 LIDYDQTGECQRVCGLVREMMELHTTLNISDLYPILGSLDLQGVSRKCNE 13100184

13100183 CESRIQELWGSVIKERREGRNDTGDDDDNSSKRKDFLDVLLDGEFSDEQISLFFV 13100019 (0)

13099933 QELLAAVSDSTSSTVEWAMAELMRNPQAMKQLREELAGETPEDLITESSL 13099784

13099783 AKFPYLHLCVKETLRLHPPAPFLIPHRATEDCQVLDCTIPKDTQVLVNVW 13099634

13099633 AIARDPASWEDPLCFKPERFLNSDLDYKGNHFEFLPFGSGRRICAGLPMA 13099484

13099483 VKKVQLALANLIHGFDWSLPNNMLPDELNMDEKYGITLMKEQPLKLIPKLRK* 13099325

>CYP80D2

LG_XII (-) 13087162-13085557

eugene3.00121147|Poptr1

gene model seems correct

76G like 42% to 76C2

97% to LG_XII        (-) 13100870

$

13087162 MVSISVLANSYPSFPMLFLLAILLLLSLVLKHKSSKVPAIPPGPKSWPII 13087013

13087012 GNVLQMGNKPHISLTKLAQVYGPLMSLRLGTQLVVVGSSREAASEILKTH 13086863

13086862 DRELSGRCVPHASFAKDPKLNEDSIAWTFECTDRWRFFRSLMRNELFSSK 13086713

13086712 VVDGQSSTRETKAKEMIDFLKKKEGEGVKIRDIVFVYTFNVLANIYLSKD 13086563

13086562 LIDYDQTGECQRVCGLVREMMELHTTLNISDLYPILGSLDLQGLSRKTNE 13086413

13086412 CGSRIQELWRSIIKERREGRNDTGDDDNSSKRKDFLDVLLDGEFSDEQIS 13086263

13086262 SFFV 13086251 (0)

13086165 QELLAAVSDSSSSTIEWAMAELMRNPQAMKQLREELAGETPEDLITESSL 13086016

13086015 AKFPYLHLCVKETLRLHPPAPLLIPHRATEDCQVLDCTIPKDTQVLVNVW 13085866

13085865 AIARDPASWEDPLCFKPERFLNSDLDYKGNHFEFLPFGSGRRICAGLPMA 13085716

13085715 VKKVQLALANLIHGFDWSLPNNMLPDELDMAEKYGITLMKEQPLKLIPKLRK* 13085557

>CYP80E1

LG_I (+) 2171265-2172908

eugene3.00010276 [Poptr1:547835]

gene model correct

39% to 76C4

58% to LG_I       (+)  8156063

$

2171265 MATIVTEISSNTLFTILFLLPLIYLIAKQLKALYSSRFAPLPPGPYSWPI 2171414

2171415 LGNALQIGNSPHITLASLAKTYGPLFSLRLGSQLVIVAASQEAATEILKT 2171564

2171565 QDRFLSGRFVPDVIPAKWLKLENLSLGWIGEVNNEFKFLRTVCQSKLFSN 2171714

2171715 KALLSQSCLREKKAADTVRFIRTMEGKVLKIKKVAFAAVFSMLTNILISS 2171864

2171865 DLISMEQESTEGEMTEIIRNIFEVGAAPNISDLFPILAPFDLQNLRKKSK 2172014

2172015 ELYLRFSTMFEAIIEERRERKMSSDNASGKEDFLDTLISNGSSNEHINVLLL 2172170 (0)

2172303 ELLVAGSDTSTSAIEWAMAELLRNPQCMKKAQAELASEINQDLIQE 2172440

2172441 SDLPRLKFLHACLKESMRLHPPGPLLLPHRAVNSCKVMGYTIPKNSQVLV 2172590

2172591 NAYAIGRDPKSWKDPLDYKPERFLTSNMDFRGSNIEFIPFGAGRRACPGQ 2172740

2172741 PMATKHVPLVLASLLHFFDWSLPTGHDPKDIDMSDKFHTSLQKKQPLLLI 2172890

2172891 PKIKN* 2172908

>CYP80E2

LG_I (+) 8155946-8158046

estExt_fgenesh1_pg_v1.C_LG_I0934 [Poptr1:691155]

gene model seems correct

76G like  41% to   76G1

58% to LG_I       (+) 2172267

$

8155946 MAQTSLTQAIDLFSPILLLLPLLLLIVLKHFRHNSSPPFPPGPYPWPILG 8156095

8156096 NILQLGDKPHITLTHFAKIHGPIFSLRLGTQLVVVGSSQAAAIAILKTHD 8156245

8156246 RILSGRHVPHMAPSKSSELNKLSLGWVVECNERWRYLRTICKSELFSLKA 8156395

8156396 LESQACIRERKAKEMIGFINKMEGKVVKIREVATATVFNMLSNILVSRDL 8156545

8156546 VSLEHESEDGGMSSVLKDIARLASTPNISDFYPILGPLDLQGLRKKTMEL 8156695

8156696 HRRSFNMCEAIIQERREGGEGKRDGPDASRRRDFLDALILNGSSDDQIDILLM 8156854 (0)

8157432 ELLSAGTDTSSSTIEWTMAELIKNPRCLKKVQEEIANVINMNRDTG 8157569

8157570 FKESHLPQLTYLQACVKETLRLHPPGPFLLPHRAIDSCQVMNYTIPKNTQ 8157719

8157720 VLVNYWAIGRDPKSWEEPVVFNPERFLSSNLDFKGNDFEFIPFGSGRRIC 8157869

8157870 PGLPMAAKHVALIIAYLILFFDWSLPCGKNPTDLDMSENYGLTLRKEQPL 8158019

8158020 LLVPTSKK* 8158046

 

>CYP77A10

LG_VIII (-) 1164925-1163381

fgenesh1_pg.C_LG_VIII000203

gene model correct

no introns 72% to 77A4

$

1164925 MSLLSFSSATLDPYYHLFFTILALFISGLIFLLSRKPKSKRSHLPPGPPG 1164776

1164775 WPIVGNLFQVAQSGKPFFEYVDDIRSKYGSIFTLKMGTRTMIIISDAKLA 1164626

1164625 HEALIERGACFASRPKENPTRTIFSCNKFSVNAAVYGSVWRSLRRNMVQN 1164476

1164475 MLSSSRIKEFRNVRDSAMDTLINRLRTEAEANSGDVWVIKNVRFAVFCIL 1164326

1164325 LAMCFGIEMDDETIEKMDQVMKSVLIVLDPRIDDFLPILSPFFSKQRKRA 1164176

1164175 SEVRKAQVNFMVSFIEKRRNAIRNPGSDKSAMSFSYLDTLFDLTFE GRKS 1164026

1164025 TPSNEELVTLCSEFLNGGTDTTA TAVEWGIAQLIANPEVQTKLYNEIKST 1163876

1163875 VGDRKVDEKDVEKMEYLHAVVKELLRKHPPTYFVLSHAVTEPTTLAGYDI 1163726

1163725 PLDASVEFFSYGIGEDPKVWNNPEKFNPDRF ISDGEDADITGVTGVKMMP 1163576

1163575 FGVGRRI CPGLGLATVHLHLMIARMVQEFEWTA YPPNSKLDFSGKLEFTV 1163426

1163425 SMKNSLRAMIKPRV* 1163381

>CYP77A11P

LG_X (-) 210156073-21015481

eugene3.00102536|Poptr1

join with eugene3.00102535|Poptr1

pseudogene 64% to 77A10

$

21016073 KSSPSNEELVTLCSEFLNGGTDTTG 21015999

21015998 EIKSTAGDRKVDEKDVEK 21015945

21015827 DLPINANVEFYSHGTG*NTKV*TNPEKYNPDRFMSGREDADTTGVTGVKAMHFGVGRR 21015654

21015649 ICPGLWLATVHLHLMVAK 21015596

21015561 KLDISVKLEFTVVMKNSLSAMVKPRA* 21015481

>CYP77B3

LG_IV (-) 589294-587777

eugene3.00040066|Poptr1

no comment

68% to 77B1 71% to CYP77B4

$

589294 MDLIDLLILCIALMFARLWWRHWSVTGGGPRNLPPGPPGWPIVGNLFQII 589145

589144 LQRRPFIYVVRDLRAKYGPIFTLQMGQRTLVIVTSSELIHEALVQRGPTF 588995

588994 ASRPADSPIRLVFSVGKCAINSAEYGPLWRSLRKNFVTQFINPVRIKQCS 588845

588844 WVRECASENHMKRLKTEALENGFVEVMSNCRLTICSILICLCFGARISEE 588695

588694 RIKSIEAILKEVMLMTTPKLPDFLPILAPLFRKKMEEAKELRRKQMECLV 588545

588544 PLIRNRRAFVEKGENPDLEMASPVGAAYIDSLFAMKPVNRGPLGEQEFVT 588395

588394 LCSEVISAGTDTSATTIEWALLNLVQNQEIQEKLYQEIIGCVGKHGVVKE 588245

588244 EDTEKMPYLGAIVKETFRRHPPSHFVLSHAATNETQLAGYTIPADVNVEF 588095

588094 YTAWLTEDPDLWKDPGEFRPERFLEGDGVDVDMTGTRGVKMMPFGVGRRI 587945

587944 CPAWSLGVLHVNMLLARMVHAFKWLPCPTAPPDPTETFAFTVVMKNPLKA 587795

587794 VILPR* 587777

>CYP77B4

LG_IV (+) 605695-607218

fgenesh1_pm.C_LG_IV000021|Poptr1

gene model has wrong N-term

66% to 77B1 no introns 71% to CYP77B3

$

605695 MELIDLLILGLTLFFLAIWWRSFSVVNGGGAKNLPPGPPGWPLVGNLFQI 605844

605845 ILERRHFIFVIRDLRKKYGPIFSMQMGQSTLVIVTSPDLIHEALVQKGPI 605994

605995 FASRPPDSPIRLVFSVGKCAVNSAEYGPLWRTLRRNFVTELISPVRIRQC 606144

606145 SWIREWALESHMKRLKSEALENGYVDVMDVCRFTVCSILVFICFGAKISE 606294

606295 HWIHDIDNVTKDVMLISIPQLPDFLPILTPLFRKQMKRAKDLRKTQIECL 606444

606445 VPLIRNRRAFVEKGENPKMEMLSPVGAAYVDSLFTLKAPGRGLLGEEELV 606594

606595 TVCSELFVAGIDTSTSVLQWVFLELVLNQDIQEKLYREIVESVGKDGVIN 606744

606745 EEDVEKMNYLNAVVKETLRVHSPAHFTLSHATTEETELGGYKIPSNVNVE 606894

606895 FYIEWMTEDPSLWKDPGIFRPERFIDGDGVNVDMTGTKGKVKMLPFGAGR 607044

607045 RTCPGLALGLLHVNLMLARMVQAFKWLPAPNAPPDPTEAFAFTVVMKNPL 607194

607195 KAVILPR* 607218

 

>CYP78A18

LG_Vb (-) 1989840-1988143

estExt_fgenesh1_pg_v1.C_LG_V0235|Poptr1

gene model seems correct

78A like 70% to 78A7

$

1989840 MEIDLATKDTSWWVYTLPAFLGSEILIDGYVLFSLVMAFVTLGILTWAFA 1989691

1989690 VGGVAWKNGRNRRGHRLIPGPRGLPVFGSLLTLCRGLAHRTLASMACSRD 1989541

1989540 NTQLMAFSLGSTPVVVASDPHTAREILTSIHFADRPIKLSAKSLMFSRAI 1989391

1989390 GFAPSGTYWRLLRRIASGHLFSPRRISAHESLRQLECSTMLRDMTNEQEL 1989241

1989240 NGFVSLRKHLQFASLNNIMGSVFGKRYDMVHDSQDLEELRGMVREGFELL 1989091

1989090 GAFNWCDYLPWLSYFYDPFRINERCLKLVPRVRKLVKGIIEEHRISKSRN 1988941

1988940 VGDSCDFVDVLLSLDGEEKLQDDDMVAVLW 1988851 (0)

1988754 EMIFRGTDTTALLTEWVMAELVLHPEIQEKLHSELDMAVKD 1988632

1988631 GSLAALTDADVEKLPYLQAVVKETLRVHPPGPLLSWARLSTSDVQLNNGM 1988482

1988481 VIPANTTAMVNMWAITHDPNVWEDPLEFKPERFIEADVDVRGNDLRLAPF 1988332

1988331 GAGRRVCPGKKLGLVTVTLWVAKLVHCFKWNRDVDHPVDLSEVLKLSCEM 1988182

1988181 KYPLHAVAVGRK* 1988143

>CYP78A19

LG_Va (-) 13684462-13682757  

fgenesh1_pm.C_LG_V000403|Poptr1

gene model correct

78A like 68% to 78A7

$

13684462 MDLFPTPVDSSWWMFALPAMLQIQKLSNPLILLFVLASFLVITVLNWAFS 13684313

13684312 TGGLAWKNGRNQKGNVPIPGPRGLPLFGSLFSLSRGLAHRTLACMASSQA 13684163

13684162 ATQLMAFSLGSTPAIVTSDPQIAREILTSPHFADRPIKLSAKSIMFSRAI 13684013

13684012 GFAPNGAYWRLLRRIASNHLFAPRRIAAYEPWRQLDCANMLSGIYNEQSL 13683863

13683862 RGIVCLRKHLQNASINNIMGTVFGKRYDLMHNNEEAKELQELVREGFELL 13683713

13683712 GAFNWSDYLPWLNYFYDPSRIKQRCCLLVPRVKKLVKKIIDEHRIMKPKN 13683563

13683562 EFQNADFVHVLLSLEGEEKLDEDDMVAVLW 13683473 (0)

13683371 EMIFRGTDTTALLTEWIMAELVLNPEIQAKLRNELNFIVGNRSV 13683240

13683239 KDADVAKLPYLQAVIKETLRVHPPGPLLSWARLSTSDVHLSNGMVVPTNT 13683090

13683089 TAMVNMWAITHDPRVWEDALVFKPERFLERQGGADVDVRGGDLRLAPFGA 13682940

13682939 GRRVCPGKNIGLVTVSLWVAKLVHHFEWVQDTHNPVDLSEVLRLSCEMKK 13682790

13682789 PLSAVAIPKE* 13682757

>CYP78A20

LG_II (+)  4123900-4125604

fgenesh1_pg.C_LG_II000566 [Poptr1:347060]

gene model correct

78A like 67% to 78A7

$

4123900 MELVPSSVDSSWWMFALPAMLQTENLSNPLILLFVLISFLVITLLTWAFS 4124049

4124050 TGGLAWKNGRNHKGSVSIPGPRGLPFFGSLFSLSRGLAHRTLACMASSQA 4124199

4124200 ATQLMAFSLGSTPAIVTSDPQIAREILTSPHFADRPIKLSAKSLMFSRAI 4124349

4124350 GFAPNGAYWRLMRRIASTHLFAPRRIAAHEPWRQLDCAKMLSGIYDDQSL 4124499

4124500 HGVVYLRKHLQDASLNNIMGTVFGKRYDLMQFNEEAKELQELVIEGFELL 4124649

4124650 GAFNWSDYLPWLNYFYDPFRIKERCCQLVPRVKKLVKQIIEEHRIKKPKN 4124799

4124800 VFDNADFVDVLLSLEGEEKLEEDDMVAVLW 4124889 (0)

4124990 EMIFRGTDTTALLTEWVMAELVLNQEIQAKLGKELNLVVGNRSVTDADVA 4125139

4125140 DLPYLQAVIKETLRVHPPGPLLSWARLSTSDVHLSNGMVVPVNTTAMVNM 4125289

4125290 WAITHDPRVWEDALVFKPERFMESQGGADVDVRGGDLRLAPFGAGRRVCP 4125439

4125440 GKNLGLVTVSLWVAKLVHHFEWVQDMHSPVDLSEMLKLSCEMKKPLSAVA 4125589

4125590 IPRN* 4125604

>CYP78A21v1

LG_VII (-) 5114877-5113187

eugene3.00070646|Poptr1

gene model correct

78A like 69% to 78A7

$

5114877 MELDLVTKDTSWWVFTLPAFLGSKSLLDGFILFSLSMAFVSLAFLTWAFA 5114728

5114727 VGGIAWKNGRNRKGHRSIPGPRGLPIFGSLFTLSRGLAHRTLASMAWRRA 5114578

5114577 NTQLMAFSLGSTPVVVASDPHIAREILTSPYFADRPIKQSAKSLMFSRAI 5114428

5114427 GFAPSGAYWRLLRRIASTHLFSPRRILAHESLRQLESTTMLRNITNEQRR 5114278

5114277 NGFVTLRKHLQFASLNNIMGSVFGKTYDMSQDRQELEELRDMVSEGFELL 5114128

5114127 GAFNWCDYLTWLNYFYDPFRIQKRCSKLVPRVRKLVKDIIEEHRLGEPGK 5113978

5113977 VGDDGDFVDVLLSLEGEEKLQDDDMVAVLW 5113888 (0)

5113801 EMIFRGTDTTALLTEWVMAELVLHTEVQEKLRRELDMAVKDRSLSELT 5113658

5113657 DSEVSKLPYLQAVVKEALRVHPPGPLLSWARLCSSDVQLSNGMVIPADTT 5113508

5113507 AMVNMWAITHDPHVWEDPLEFKPERFIE 5113424

5113423 ADVDVRGGDLRLAPFGAGRRVCPGKNLGLVTVTLWVAKLVHHFKW 5113289

5113288 VHDGEHPVDLSEVLKLSCEMKYPLHAVALQMNN* 5113187

>CYP78A21v2

scaffold_2390 (-) 7318-5629

eugene3.23900001|Poptr1

gene model missing some seq before the PERF motif

78A like 69% to 78A7

$

7318 MELDLVTKDTSWWVFTLPAFLGSKSLLDGFILFSLSMAFVSLAFLTWAFA 7169

7168 VGGIAWKNGRNRKGHRSIPGPRGLPIFGSLFTLSRGLAHRTLASMAWRRA 7019

7018 NTQLMAFSLGSTPVVVASDPHIAREILTSPYFADRPIKQSAKSLMFSRAI 6869

6868 GFAPSGAYWRLLRRIASTHLFSPRRILAHESLRQLESTTMLRNITNEQRR 6719

6718 NGFVTLRKHLQFASLNNIMGSVFGKTYDMSQDRQELEELRDMVSEGFELL 6569

6568 GAFNWCDYLTWLNYFYDPFRIQKRCSKLVPRVRKLVKDIIEEHRLGEPGK 6419

6418 VGDDGDFVDVLLSLEGEEKLQDDDMVAVLW 6329 (0)

6242 EMIFRGTDTTALLTEWVMAELVLHTEVQEKLRRELDMAVKDRSLSELT 6099

6098 DSEVSKLPYLQAVVKEALRVHPPGPLLSXARLCSSDVQLSNGMVIPADTTAMV 5940

5940 HMWAITHDPHVWEDPLEFKPERFIE 5866

5865 ADVDVRGGDLRLAPFGAGRRVCPGKNLGLVTVTLWVAKLVHHFKW 5731

5730 VHDGEHPVDLSEVLKLSCEMKYPLHAVALQMNN* 5629

>CYP78A2

LG_Ib (+) 6124306-6126694

eugene3.00010701 [Poptr1:548260]

gene model correct

68% to  78A9

$

6124306 METQIDSFWVLVLVSKCKAFSAQNPIFLLVSVFLAWLAMALCYWVYPGGPAWGNYLRKK 6124482

6124483 GISCSRAKMIPGPRGFPVIGSMNLMVNLAHHKLAAAAKAFKAERLMAFS 6124629

6124630 LGETKVIITCNPDVAKEILNSSVFADRPVKESAYQLMFNRAIGFAPYGVY 6124779

6124780 WRTLRRIAATHLFCPKQISSTESQRFNIASQMVSAIASQGGDYFCVRGIL 6124929

6124930 KKASLNNMMCSVFGRKYDLGSSNSETEELRRLVDEGYDLLGKLNWSDHLP 6125079

6125080 WLANLDLQRIRFRCSNLVPKVNRFVNRVIEEHREDQTGQRRNDFVDVLLS 6125229

6125230 LHGPDKLSHHDMIAVLW 6125280 (0)

6126071 EMIFRGTDTVAVLIEWILARMVLHRDIQSKVHDELDQVVGRSRP 6126202

6126203 LMEADIQSMVYLPAVVKEVLRLHPPGPLLSWARLAITDTNVDGYDVPAGT 6126352

6126353 TAMVNMWAITRDPQVWANPLRFLPERFLCKDATADVEFSVSGSDLKLAPF 6126502

6126503 GSGRRTCPGKALGLATVSFWVGVLLHEFEWVQCDHEPVDLSEVLRLSCEM 6126652

6126653 SNPLTIKVNPRRR* 6126694

>CYP78A23

LG_IIIb (-) 13439255-13437042

eugene3.00031195|Poptr1

gene model correct

78A like 68% to 78A9

$

13439255 METQIDSFWVLALVSKCKAFSSQDPIFLLLSLFLAWLAIALCYWVYPGGP 13439106

13439105 AWGKYWLKRATCSKAKMIPGPRGFPVIGSMNLMVNLAHHKLAAAAKTLKA 13438956

13438955 KRLMAFSMGETRVIITCNPDVAKDILNSSVFADRPVKESAYQLMFNRAIG 13438806

13438805 FAPYGVYWRTLRRIAATHLLCPKQISSTEPQRLDIASQMVSVMACQGGDY 13438656

13438655 FRVRDILRKASLNNMMCSVFGRKYDLGTSNNEIEELGGLVDEGYDLLGKL 13438506

13438505 NWSDHLPWLANFDLQKIRFRCSNLVPKVNRFVNRVIQEHREDQSGQRRND 13438356

13438355 FVDVLLSLHGPDKLSDHDMVAVLW 13438284 (0)

13437665 EMIFRGTDTVAVLIEWILARMILHPDIQSKVHDELDQVAGRSRPLME 13437525

13437524 ADIRSMVYLPAVVKEVLRLHPPGPLLSWARLAITDTDVDGYDVPAGTTAM 13437375

13437374 VNMWAITRDPQVWVDPLKFSPERFLSKEVTADVEFSVSGSDLRLAPFGSG 13437225

13437224 RRTCPGRTLGLATVSFWVGSLLHEFEWARCGHEPVDLSEVLRLSCEMAKP 13437075

13437074 LTVKVNPRRR* 13437042

>CYP78A24

LG_IIc (+) 13511138-13512986

eugene3.00021624 [Poptr1:552309]

gene model seems correct

78A like 72% to 78A9

$

13511138 MRTDIDNFWIFALASKCRVFTQENIAWSLLIMGLAWIATTLIYWAYPGGP 13511287

13511288 AWGKYKLKNTSFTISKPIPGPRGLPLIGGMRLMTSLAHHKIAAAADACKA 13511437

13511438 RRLMAFSLGDTRVIVTCNPDVAKEILNSSVFADRPVKESAYSLMFNRAIG 13511587

13511588 FAPYGVYWRTLRKIASTHLFCPKQIKTAASQRRRIASETVSMFNDHEGSG 13511737

13511738 FTVRGILKRASLNNMMCSVFGREYELDSCNSEVEELRALVDEGYDLLGTL 13511887

13511888 NWTDHLPWLADFDPQKIRFRCSNLVPKVNRFVSRILAEHR 13512007

13512008 AQAGNETPDFVDVLLSLQGHDKLSDSDMIAVLW 13512106 (0)

13512321 EMIFRGTDTVAVLMEWILARMVLHPDVLSKVHDELDKVVGRSRAVAESDI 13512470

13512471 TAMVYLQAAVKEVLRLHPPGPLLSWARLAITDTTIDGYHVPKGTTAMVNM 13512620

13512621 WAISRDPDSWEDPLEFMPERFVTKKG 13512698

13512699 ELEFSVLGSDLRLAPFGSGRRTCPGKTLGLTTVTFWVASLLHEYEWLPCD 13512848

13512849 GNKVDLSEVLGLSCEMANPLTVKLRPRR 13512932

13512933 SHYKPTVLGVQNYVLDV* 13512986

>CYP78A25

LG_XIV (-)  3837010-3835172

estExt_fgenesh1_pg_v1.C_LG_XIV0445|Poptr1

gene model seems correct

78A like 72% to 78A9

$

3837010 MRTDIDSFWIFALASKCRAFTQENIAWSLLIIGLAWIVVTLIYWAYPGGP 3836861

3836860 AWGKYKLKNTSLTISNPIPGPRGFPITGSMKLMTSLAHHKIAAAADACKA 3836711

3836710 RRLMAFSLGDTRVIVTCNPDVAKEILNSSVFADRPVKESAYSLMFNRAIG 3836561

3836560 FAPYGVYWRTLRKIASTHLFCPKQIKAAESQRLQIASQMVSTFNDREKSS 3836411

3836410 FSVREVLKRASLNNMMCSVFGREYKLDSFNNEVEELRALVEEGYDLLGTL 3836261

3836260 NWSDHLPWLADFDPQKIRFRCSNLVPKVNRFVSRIIAEHRALTRSENPDF 3836111

3836110 VDVLLSLQGHDKLSDSDMIAVLW 3836042 (0)

3835810 EMIFRGTDTVAVLIEWILARMVLHPDVQSKVHDELYKVVGRSRAVAESDI 3835661

3835660 TAMVYLQAVVKEVLRLHPPGPLLSWARLAITDTTIDGYHVPKGTTAMVNM 3835511

3835510 WAISRDPEFWEDPLEFMPERFVVTKEDVLEFSVLGSDLRLAPFGSGRRTC 3835361

3835360 PGKTLGITTVTFWVASLLHEYEWVPGEENNVDLSEVLRLSCEMANPLTVK 3835211

3835210 VRPRRSSQSPLY* 3835172

>CYP78A26P

scaffold_3645 (-) 4941-3651

eugene3.36450001|Poptr1

no comment

78A like PSEUDOGENE 64% to 78A10

$

4941 FLSKLGPSTGPGLELILGIVLFVFIFSFWLAPGGLAWDLSKTRTTIPGPS 4792

4791 GWPILGMVLAFTGSLTHRVLARISELLKAKPLMVFSVGFPRFIISSHPETAKEILNSSAFA 4609

4607 IKESAYELLFHKAMGFAHFGDCWRNLRRISATHLFSPNKRIAALGEFIRD 4458

4457 IGLKMVSEIKSLAERNGEVLEIRKVLHFGSLDNVMKRVFGRSYEFGDESK 4308

4307 VGVCELEGLVSERYELLGIFNWSDHF 4230

4231 FPILGWLDLQGVRKRCRNLAAKVNVFVEKIIDEHKMKRVESDKNEDIIKS 4082

4081 DESSSDFVDVLLDLQKENKL 4022

4019 CSDMIAVLW 3993

3870 EMIFR 3856

3854 GTDTVAILLEWILARMVLHPVIQAKVQAEIDNVVGSSRSVSDFVLPNLPY 3705

3704 LRAVVRETLRVLPPGPLL 3651

>CYP78D2

LG_IIIa (+) 15447061-15449577

fgenesh1_pg.C_LG_III001462|Poptr1

gene model short at N-term

78A like 50% to 78A5

$

15447061 MKSIPANLSSILFCLAVITHQTPWPVALLLFSLSSFFAFSLNYWLVPGGFAW 15447216

15447217 RNHHDNQNPSRFRGPIGWPIVGTLPQMGSLAHRKLASMAASLGATKLMAF 15447366

15447367 SLGSTRVIISSHPDTAREILCGCSFADRPIKESARLLMFERAIGFAPSGD 15447516

15447517 YWRHLRRIAANYMFSPRKISALEPLRQRLANEMVAEVREEMKERRVVVLR 15447666

15447667 DILQKGSLSNVLESVFGSDVSIEREELGFMVKEGFDLIAEFNLDDYFPLR 15447816

15447817 FLDFHGVKRRCCQLAGKVNSVVGQIVKERKGAGDSRSGSDFLSALLSLPE 15447966

15447967 EDQLNESDMVALLW 15448008 (0)

15448966 EMIFRGTDTVALLLEWIMARMVVHPEIQAKAQEELDTCIGGHREVQDSDI 15449115

15449116 PNLPYLRAIVKEVLRLHPPGPLLSWARLAIHDVHVDKTFIPAGTTVMVNM 15449265

15449266 WAITHDPSIWRDPWSFNPDRFIEEDVLIMGSDLRLAPFGAGRRVCPGKAL 15449415

15449416 GLATVHLWLARLLHEYRWLPAKPVDLSECLRLSLEMKRPLECHVVQRRSKVTQ* 15449577

>CYP78D3v1

LG_Ia (-)  3924905-3921817

fgenesh1_pg.C_LG_I000468 [Poptr1:63116]

gene model correct

51% to 78A5

$

3924905 MMSLLANLSFLLFFLAIITHQTPWPITVLLLSLFSS FALSLNYWLVPGGFA 3924753

3924752 WRNHHDNQNPSKFRGPIGWPVFGTLPQMGSLAHRKLASMATSLGATKLMA 3924603

3924602 FSLGTTRVIISSHPDTAREILWGSSFADRPVKESARLLMFERAIGFAPSG 3924453

3924452 DYWRHLRRIAANHMFSPKKISGLEPLRQRLANEMLAEVSGEMKERRAVVL 3924303

3924302 RGILQKSSLSNVLESVLGSDVHVKREELGFMAQEGFDLVSRFNLEDYFPL 3924153

3924152 RFLDFYGVKRRCYKLAGKVNSLVGQIVRERKRAGDFRSRTDFLSALLSLP 3924003

3924002 EQERLDESDMVPLLW 3923958 (0)

3922440 EMIFRGTDTVAILLEWIMARMVLHPEIQAKAQQELEKFIGNHRRVQDSDI 3922291

3922290 PNLPYLQAIVKEVLRLHPPGPLLSWARLAIHDVHVDKMSIPAGTTAMVNM 3922141

3922140 WAITHDPSIWRDPWAFNPDRFMEEDVLIMGSDLRLAPFGSGRRVCPGKAL 3921991

3921990 GLATVHLWLARLLHEYKWLPAKPVDLSECLRLSLEMKRPLECHVVPWSKV 3921841

3921840 ADFDQKT* 3921817

>CYP78D3v2

scaffold_1387 (-) 6082-5135

estExt_Genewise1_v1.C_13870002|Poptr1

runs off end in intron seq

78A like 1 aa diff to LG_I 3922062

probable duplicate seq of LG_I 3922062

$

6082 MMSLLANLSFLLFFLAIITHQTPWPITVLLLSLFSSFALSINYWLVPGGFA 5930

5929 WRNHHDNQNPSKFRGPIGWPVFGTLPQMGSLAHRKLASMATSLGATKLMA 5780

5779 FSLGTTRVIISSHPDTAREILWGSSFADRPVKESARLLMFERAIGFAPSG 5630

5629 DYWRHLRRIAANHMFSPKKISGLEPLRQRLANEMLAEVSGEMKERRAVVL 5480

5479 RGILQKSSLSNVLESVLGSDVHVKREELGFMAQEGFDLVSRFNLEDYFPL 5330

5329 RFLDFYGVKRRCYKLAGKVNSLVGQIVRERKRAGDFRSRTDFLSALLSLP 5180

5179 EQERLDESDMVPLLW 5135 (0)

>CYP78D-se1[2]

LG_IX (+) 340405-340566

No model

no comment

CYP78 like pseudogene

69% to LG_I (-)  3924905

$

340405 PLLSWGRLAFHDTQVGPHVIPAGITAMVNMWSITHDERIWSDKNSISTARIYNQ 340566

 

>CYP79D5

LG_XIII (+) 12617173-12619030

eugene3.00131268|Poptr1

gene model seems correct

79D like 58% to 79D1

$

12617173 MEYLSATSFTALLSFPTSLLVLAIILFYFIQSHRNVKKHPLPPGPKPWPI 12617322

12617323 VGCLPTMLRNKPVYRWIHNLMKEMNTEIACIRLGNVLVIPVICPDIACEF 12617472

12617473 LKAQDNTFASRPNTMTTDLISRGYLATILSPSGDQWNKMKKVLMTHVLSP 12617622

12617623 KKHQWLYSKRVEEADHLVHYVYNQCKKSVHQGGIVNLRTAARHYCANVTR 12617772

12617773 KMLFNKRFFGEGMKDGGPGFEEEEYMDALFSCLKHIYAFCISDFLPSLIG 12617922

12617923 LDLDGHEKVVMENHRIINKYHDPIIHERVQQWKDGAKKDTEDLLDILITL 12618072

12618073 KDRNGNPLLSKDEIKAQIT 12618129 (0)

12618407 EIMVAAVDNPSNACEWAFAEMLNQPEILEKATEELDRVVGKERLVQES 12618550

12618551 DFAHLNYVKACAREAFRLHPFAPFNVPHVSAADTTVANYFIPKGSYVLLS 12618700

12618701 RLGLGRNPKVWDEPLKFKPERHLNEMEKVVLTENNLRFISFSTGKRGCKG 12618850

12618851 VTLGTSMTTMLFARLLQAFTWSLPPRQSSIDLTIAEDSMALAKPLCALAK 12619000

12619001 PRLRPQVYPGY* 12619036

>CYP79D6v1

LG_XIII (+) 12759202-12761058

fgenesh1_pg.C_LG_XIII001242|Poptr1

gene model seems correct

79B like 57% to 79D1 95% to 79D5

$

12759202 MEYLAPTSFTTLLSFTASLLVLAIILFYFIQSHKNVKKHPLPPGPKRWPV 12759351

12759352 VGCLPTMLRNKPVYRWIHNLMKEMNTEIACIRLGNVHVIPVICPDIACEF 12759501

12759502 LKAQDNTFASRPHTMTTDLISRGYLTTALSPSGDQWNKMKKVLMTHVLSP 12759651

12759652 KKHQWLYSKRVEEADHLVHYVYNQCKKSVHQGGIVNLRTAAQHYCANLTR 12759801

12759802 KMLFNKRFFGEGMKDGGPGFEEEEYVDALFSCLNHIYAFCISDFLPSLIG 12759951

12759952 LDLDGHEKVVMENHRIINKYHDPIIHERVQQWKDGAKKDTEDLLDILITL 12760101

12760102 KDRHGNPLLSKDEIKAQIT 12760158 (0)

12760435 EIMVAAVDNPSNACEWAFAEMLNQPEILEKASEELDRVVGKERLVQES 12760578

12760579 DFAHLNYVKACAREAFRLHPVAPFNVPHVSAADTTVANYFIPKGSYVLLS 12760728

12760729 RLGLGRNPKVWDEPLKFKPERHLNEMEKVVLTENNLRFISFSTGKRGCIG 12760878

12760879 VTLGTSMTTMLFARLLQAFTWSLPPSQSSIDLTIAEDSMALAKPLCALAK 12761028

12761029 PRLPPQVYPGY* 12761064

>CYP79D6v2

scaffold_1585 (-) 9137-7275

eugene3.15850001|Poptr1

gene model seems correct

only 2aa diffs to 79D6 possible duplicate

79B like 58% to 79D1 95% to 79D5

$

9137 MEYLAPTSFTTLLSFTASLLVLAIILFYFIQSHKNVKKHPLPPGPKRWPV 8988

8987 VGCLPTMLRNKPVYRWIHNLMKEMNTEIACIRLGNVHVIPVICPDIACEF 8838

8837 LKAQDNTFASRPHTMTTDLISRGYLTTALSPSGDQWNKMKKVLMTHVLSP 8688

8687 KKHQWLYSKRVEEADHLVHYVYNQCKKSVHQGGIVNLRTAAQHYCANLTR 8538

8537 KMLFNKRFFGEGMKDGGPGFEEEEYVDALFSCLNHIYAFCISDFLPSLIG 8388

8387 LDLDGHEKVVMENHRIINKYHDPIIHERVQQWKDGAKKDTEDLLDILITL 8238

8237 KDRHGNPLLSKDEIKAQIT 8181 (0)

7904 EIMVAAVDNPSNACEWAFAEMLNQPEILEKATEELDRVVGKERLVQES 7761

7760 DFAHLNYVKACAREAFRLHPVAPFNVPHVSAADTTVANYFIPKGSYVLLS 7611

7610 RLGLGRNPKVWDEPLKFKPERHLNEMEKVVLTENNLRFISFSTGKRGCIG 7461

7460 VTLGTSMTTMLFARLLQAFTWSLPPSQSSIDLTIAEDSMALAKPLSALAK 7311

7310 PRLPPQVYPGY* 7275

>CYP79D7

LG_XIII (+) 12783206-12785069

eugene3.00131275|Poptr1

gene model seems correct

only 5aa diffs to 79D5, seems odd

79B like 58% to 79D1, 99% to 79D5

$

12783206 MEYLSATSFTALLSFPTSLLVLAIILFYFIQSHRNVKKHPLPPGPKPWPI 12783355

12783356 VGCLPTMLRNKPVYRWIHNLMKEMNTEIACIRLGNVLVIPVICPDIACEF 12783505

12783506 LKAQDNTFASRPNTMTTDLISRGYLATILSPSGDQWNKMKKVLMTHVLSP 12783655

12783656 KKHQWLYSKRVEEADHLVHYVYNQCKKSVHQGGIVNLRTAARHYCANVTR 12783805

12783806 KMLFNKRFFGEGMKDGGPGFEEEEYVDALFSCLNHIYAFCISDFLPSLIG 12783955

12783956 LDLDGHEKVVMENHRIINKYHDPIIHERVQQWKDGAKKDTEDLLDILITL 12784105

12784106 KDRNGNPLLSKDEIKAQIT 12784162 (0)

12784440 EIMVAAVDNPSNACEWAFAEMLNQPEILEKATEELDRVVGKERLVQES 12784583

12784584 DFAHLNYVKACAREAFRLHPLAPFNVPHVSAADTTVANYFIPKGSYVLLS 12784733

12784734 RLGLGRNPKVWDEPLKFKPERHLNEMEKVVLTENNLRFISFSTGKRGCIG 12784883

12784884 VTLGTSMTTMLFARLLQAFTWSLPPRQSSIDLTIAEDSMALAKPLCALAK 12785033

12785034 PRLPPQVYPGY* 12785069

>CYP79D8

LG_IV (+) 3871814-3873941

eugene3.00040407|Poptr1

gene model seems correct

79A like 56% to 79D1 73% to 79D5

$

3871814 MDYFPSTSSFIILLSFPILFLVLAITLFSFIQSSKNVKQYSLPPGPRPWPLVGSL 3871978

3871979 PTMLRNKPVYQWIHNLMKEMNTEIACIRLGNIHVIPVTCPNIACEFLKEQ 3872128

3872129 DDVFSSRPETISSYLASNGYLATVVSPFGDQWKKMKSVMATQVLSPTRHQ 3872278

3872279 WLHKKRVEEGDNLVRLVYKQCQESD 3872353

3872354 QDGIVNLRFTSQHYCANVIRKLMFNKRYFGVGMENGGPGFEEEQHVDALF 3872503

3872504 TILSHLFSFCVSDFLSFLTWLDLDGHEKVMKEKDKIIKKYHDPIIDDRIQ 3872653

3872654 QWKDGKKKDIEDLLDVLITLKDDNGNPLLSKDEIKAQVE 3872770

3873315 DIILAAVDNPSNACEWAFAEMLNNPEILETAVEELDRVVGKQRLVQESDF 3873464

3873465 AQLNYVKACAREAFRLHPVAPFNVPHVSMADTVVAKHFIPKGSYVILSRL 3873614

3873615 GLGRNPKVWDEPLEFKPERHLKGTGNVVLAENGLRFISFSTGKRGCMAVT 3873764

3873765 LGSSMTNMLFARLLHGFSWSLPSNESSIDLSTAKDSMALAKPLLAVAKPR 3873914

3873915 LPAHLYPK* 3873941

>CYP79D9P

LG_II (-) 16041237-16040849

fgenesh1_pg.C_LG_II001846|Poptr1

no comment

79D like 78% to 79D8

$

16041237 DIILATVDNPSNACEWAFAEVLNSPGILKMFVEELDRVVGKQQLVQESD 16041091

16041090 SALLNYVEVCAREAFRLHPVAPLNIPRVSMADTVVSNHFIPRGSYAILSRLG 16040935

16040935 DLKVWDEPLRFKPECHLTRTGHVVLAENG 16040849

 

>CYP81B3v1

LG_IIc (-) 9154259-9152268

fgenesh1_pg.C_LG_II001121 [Poptr1:347615]

gene model short in middle, one frameshift

81D like 47% to 81D8

59% to LG_II        (-)  9149602

$

9154259 MEISFYSCFMLFLMFYFLSKHLCKISKNLPPSPGLSLPIIGHLYLIKKPLHQTLANLSNKYGPILFI 9154059

9154058 QFGSRPVILVSSPSVAEECLSKNDIIFANRPRLLAGKHLGYNYTTLTWASYGNHWRNLRRIAALEI 9153861

9153860 LSTNRLKMFYHIRADEVRLLVHKLFKGCRGGEFMSIDAKSTFFDLTLNVITRMIAGKRYYGEDLAEL 9153660

9153659 GEARQFKEIVRETFELSGATNIGDFVPALKWIGLNNIEKRLAILHRKRDEFVQDLILEHRKVKSEFA 9153459

9153458 SHQGSSKTMINVLLTLQETEPEYYTDEIIRGLMT 9153357 (0)

9152886 VILSAGTDTSAGTMEWALSLLLNNPQALMKAQIEIDTIIGPS 9152760

9152759 KLIEESDLLKLPYLQGIIKETLRMYPP 9152680

9152678 PHLPPHESSEECTVGGFRVPRGTMLLVNMRSVHNDPNLWE 9152559

9152558 EPTKFKPERFHGPEGKRDGFIYLPFGAGRRGCPGEGLATRIIGLALGSLIQCFEWERVCGELVDMS 9152361

9152360 EGTGLTMPKAQNLWAKCRPRPAMVNQLSQT* 9152268

>CYP81B3v2

scaffold_1047 (+) 16009-16578

no model

no comment

81D like  46% to 81D6 N-term no model at JGI

100% to LG_II       (-)  9152501 duplicate seq

$

16009 MEISFYSCFMLFLMFYFLSKHLCKISKNLPPSPGLSLPIIGHLYLIKKPL 16158

16159 HQTLANLSNKYGPILFIQFGSRPVILVSSPSVAEECLSKNDIIFANRPRL 16308

16309 LAGKHLGYNYTTLTWASYGNHWRNLRRIAALEILSTNRLKMFYHIRADEV 16458

16459 RLLVHKLFKGCRGGEFMSIDAKSTFFDLTLNVITRM 16566

>CYP81B4

LG_IId (-) 9151207-9149369

fgenesh1_pm.C_LG_II000512 [Poptr1:342582]

gene model seems correct

81D like 49% to 81D2

95% to scaffold_1047  (+)     5087

$

9151207 MFLHFLLLYLVLYVLTNHFRNKIQNLPPSPFPALPIIGHLHLLKKPLHRS 9151058

9151057 LSKISNRHGPVVLLQLGSRRVLVVSSPSAAEECFTKNDIVFANRPHLLAG 9150908

9150907 KHLGRNYTTLSWAPHGDLWRNLRKISSLEILSSNRLQLFSSIRTEEVKFL 9150758

9150757 IRRLFKNNDEIIDLKSSFFELMLNVMMRMIAGKRYYGENEAEVEEGRRFR 9150608

9150607 EIVTETFQVSGASAVGDFLHVLAVIGGTEKRLMKLQEKRDGFLQELVDEH 9150458

9150457 RRRMGNNKSCFSNERNYKTMIEVLLTLQESEPEYYKDETIKDLMV 9150323 (0)

9149989 VLLSAGTETTAGTMEWALSLLLNNPLILRKAQNEIDKVVGHDRLIDE 9149849

9149848 SDVVKLPYLHCVIKETMRMYPIGPLLVPHRSSEECGVGGFQIPSGTMLLV 9149699

9149698 NMWAIQNDPKIWDDAAKFKPERFEGSVGVRDGFKLMPFGSGRRRCPGEGL 9149549

9149548 AIRMVGLTLGSLLQCFEWDRVSQEMVDMTGGTGLTMPKAQPLLARCTSRP 9149399

9149398 SMANLLSQI* 9149369

>CYP81B5

LG_IIb (-) 9145798-9143865

eugene3.00021123 [Poptr1:551808]

gene model short on N-term

81D like 50% to 81D8

78% to LG_XIV      (-)   929000

$

9145798 MATLFLYFPFFLALYMITRHLLDKIQNLPPSPFLSLPIIGHLYLFKKPIY 9145649

9145648 RTLSNISNRYGQLVVLLRLGSRRVLVVSSPSIAEECFTKNDVVFANRPRL 9145499

9145498 LIGKHLGYNCTNLFWASYGDHWRNLRKIVSIEVLSAYRLQMHSATHLEEV 9145349

9145348 KWMIGWLFRNQNQVVDMKKAFLELTLNIIMRMIAGKRYYGDDVSDVEQAQ 9145199

9145198 RFRAIHAEMYTLIGQTIIGDYVPWIKSKKMEKRLIECRVKRDSFMQCLIE 9145049

9145048 EQRRVLLESDCCGERKRTMIQVLLSLQETEPEYYTDDIIKGLML 9144914 (0)

9144482 VLLFAGTDTSSSIMEWALSLLLNHSEVLLKAQKEIDEYIGPDRLIDEADL 9144333

9144332 AQLPYLRSIINETLRMYPPAPLLVPHESSEECLVGGFRIPHGTMLFVNMW 9144183

9144182 AIHNDPKIWLDPRKFRPDRFNGLEGARDGFRLMPFGYGRRSCPGEGLALR 9144033

9144032 MVGLALGSLIQCFEWQRIDDKSVDMTERPGFTMAKAQPLKAICRPRLSMLKLFSQ* 9143865

>CYP81B6

scaffold_1047 (+) 3473-5320

eugene3.10470001|Poptr1

gene model seems correct

81D like 51% to 81D3

95% to LG_II        (-)  9149602

$

3473 MFLHFLLLYLVLYVLTNHFRNKIQNLPPSPFPALPIIGHLHLLKKPLHRS 3622

3623 LSKISNRHGPVVLLQLGSRRVLVVSSPSAAEECFTKNDIVFANRPHLLAG 3772

3773 KHLGRNYTTLPWAPHGDLWRNLRKISSLEILSSNRLQLLSSIRTEEVKLL 3922

3923 IRRLFKNNDQIIDLKSSFFELMLNVMMRMIAGKRYYGENEAEVEEGRRFR 4072

4073 EIVTETFQVSGASAVGDFLHVLAVIGGTEKRFMKLQEKRDGFMQELVDEP 4222

4223 RRRMGNNKSCFSNERNYKTMIEVLLTLQESEPEYYKDETIKDLMV 4357 (0)

4700 VLLSAGTDTTAGTVEWALSLLLNNPLILKKAQNEIDKVVGQDRLIDE 4840

4841 SDVAKLPYLHCVIKETMRMYPVGPLLVPHESSEECVVGGFQIPRGTMLLV 4990

4991 NIWAIQNDPKIWDDAAKFKPERFDGSEGVRDGFKLMPFGSGRRSCPGEGL 5140

5141 AMRMAGLTLGSLLQCFEWDRVSQEMVDLTEGTGLSMPKAQPLLARCTSRP 5290

5291 SMANLLSQI* 5320

>CYP81B6P

scaffold_1047 (+) 8471-9091

eugene3.10470002|Poptr1

exon 2 only

81D like duplicate seq

100% to scaffold_1047  (+) 3473-5320

$

8471 VLLSAGTDTTAGTVEWALSLLLNNPLILKKAQNEIDKVVGQDRLIDE 8611

8612 SDVAKLPYLHCVIKETMRMYPVGPLLVPHESSEECVVGGFQIPRGTMLLV 8761

8762 NIWAIQNDPKIWDDAAKFKPERFDGSEGVRDGFKLMPFGSGRRSCPGEGL 8911

8912 AMRMAGLTLGSLLQCFEWDRVSQEMVDLTEGTGLSMPKAQPLLARCTSRP 9061

9062 SMANLLSQI* 9091

>CYP81B7

LG_XIV (-) 930738-928767

eugene3.00140107|Poptr1

gene model seems correct

81D like 51% to 81D8

93% to scaffold_40  (+)  2691314

$

930738 MATLILYFPVILALYIITSHFLDKIRNFPPGPFPSLPIIGHLYLLKKPIY 930589

930588 RTLSKISSKHGPVLLLQLGSRRLLVVSSPSIAEECFTKNDVVFANRPRLL 930439

930438 IAKHLAYNSTSLVWAPYGDHWRNLRRIVSIEVLSAYRLQMLSAIRLEEVK 930289

930288 SMVCVLFRNQKHTVDMKTVFFELTLNIMMRMIAGKRYYGENVSDVEEAKR 930139

930138 FRALHAESFLLGGKTIIGDYIPWIKSKKMEKRLIECNLKRDSFLQCLIEE 929989

929988 QRRKILEGDCCGEKKKNLIQVLLSLQETEPEYYTDDIIKGLVV 929860 (0)

929387 VILFAGTDTSSTTMEWALSLLLNHPEVLEKAKREIDEHIGHDRLMDEGDL 929238

929237 AQLPYLRSILNETLRMYPPAPLLVPHESSEECLVGGFRIPRGTMLSVNMW 929088

929087 AIQNDPKIWRDPTKFRPERFDNPEGGRYEFKLMPFGHGRRSCPGEGLALK 928938

928937 VVGLALGSLLQCFEWQKIGDKMVDMTESPGFTVPKAKQLEAICRARPRML 928788

928787 TLLSQI* 928767

>CYP81B8P1

scaffold_40 (+) 2662475-2663606

no model

no comment

81D like pseudogene N-term

73% to LG_IIc  (-)  9152501

$

2662475 YYYFLLFLMFRVLSKHLRKINKNLPPSPGLSLPITGHLYLIKKPLRQTLA 2662624

2662625 NLSN

        QYGPILF

        IKFGSRTVILV*SPSVAGEC 2662717

        GIILANLPRLVGP

2662762 GKHLGYIYTTLAWASYGKHWRNLRRISALEILSTNRLQMFCHIRAH 2662899

        RRLYKGSKGGEFMTN

2662947 DAKSTFFYLTLDVIMRMIAGKRYHGENPAELGESRKVKEIVTETFELSGA 2663096

2663097 TNTGDFVPVLKWFEMNHNEKRLAVLHSKRDKFLQDLIEAHRKVKDES 2663237

        ASDQGSG*

2663262 TTIDILLALQETEPEFYTYEIIRGMMT 2663345 (0)

2663366 RRSCPEKGLALCMVGLTLES 2663425

2663428 FEWERVSEEMAGMTEGIGLSMPRAHPLLAKCRLCPSMVSLLSRI 2663559

>CYP81B9P

scaffold_40 (+) 2666003-2667947

fgenesh1_pg.C_scaffold_40000328 [Poptr1:94216]

model short (2 genes fused?)

81D like pseudogene, one frameshift

98% to scaffold_40  (+)  2687031

91% to LG_XIV       (-)   929000 with one frameshift

$

2666003 MATLFLYFPVFLALYIISTHFLNKIRNFPPSPFPSLPIIGHLYLLKKPLY 2666152

2666153 RTLSKISDKHGPVILLQLGSRRQLVVSSPSIAEECFTKNDVVFANRPRLL 2666302

2666303 IAKHLAYNSTSLVWAPYGDHWRNLRKIVSIEVLSAYRLQMLSSIRLEEVR 2666452

2666453 SMICVLFRNQNQ 2666488

2666488 VVDMRTVFFELTLNIMMRMIAGKRYYGENVSDVEEAKRFRAIHAESFLLG 2666637

2666638 GKTIIGDYIPWIKSKEMEKRLIECNLKRDSFLQCLIEEQRRKILEGDCCG 2666787

2666788 EKKKNLIQVLLSLQETEPEYYTDDIIKGLVV 2666880 (0)

2667327 VILLAGTHTSSSTMEWALSLLLNHPQVLEKAKREIDEHIGHDRLMDEADL 2667476

2667477 AQLPYLRSILNETLRMYPAAPLLVPHESSEECLVGGFRIPRGTMLSVNVW 2667626

2667627 AIQNDPKIWRDPTKFRPER 2667683

2667684 FDNLEGGRDEFKLMPFGHGRRSCPGEGLALRVVGLALGSLLQCFEW 2667821

2667822 QKIGDKMVDMTEASGSAISKAQPLKAICRARPSMLTHLSQI* 2667947

>CYP81B-se1[2]

scaffold_40 (+) 2671685-2672180

no model

no comment

81D like pseudogene exon 2 only

$

2671685 VILLAGTHTSSSTMEWALSLLLNHPQVLEKAKREIDEHIGHDRLMDEADLAQ 2671840

2671842 LPYLRSILNETLRMYPAAPLLVPHESSEECLVGGFRIPRGTMLSVNV 2671982

2671983 WAIQNDPKIWRDPTKF 2672030

2672031 RPERFDNLEGGRDEFKLMPFGHGRRSCPGEGLALRVVGLALGSLLQCFEW 2672180

2672181 QKIGDKMVDMTEASGSAISKAQPLEAICRARPSMLTHLSQI 2672303

>CYP81B8P2

scaffold_40 (+) 2676659-2676886

no model

no comment

81D like N-term frag.

100% match to scaffold_40   (-)  2662499

$

2676659 YYYFLLFLMFRVLSKHLRKINKNLPPSPGLSLPITGHLYLIKKPLRQTLA 2676808

2676809 NLSN

QYGPILF

IKFGSRTVILV*SPS 2676886

>CYP81B10

scaffold_40 (+) 2684818-2685009

fgenesh1_pg.C_scaffold_40000329 [Poptr1:94217]

model short (N-term in a sequence gap)

81D like N-term frag.

scaffold_40   (+)  2685841-2687264          81D like

98% to scaffold_40     (+)  2667714

$

2684818 MATLFLYFPVFLALYIISTHFLNRIRNFPPSPLPSLPIIGHLYLLKKPLY 2684967

2684968 RTLSKISDKHGPVI 2685009

2685841 LNIMMRMIAEKRYYGGNVSDVEEAKRFRAIHAESFLLGGKTIIGDYIPWI 2685990

2685991 KSKEMEKRLIECNLKRDSFLQCLIEEQRRKILEGDCCGEKKKNLIQVLLS 2686140

2686141 LQETEPEYYTDDIIKGLVV 2686197 (0)

2686644 VILLAGTHTSSSTMEWALSLLLNHPQVLEKAKREIDEHIGHDRLMDEADL 2686793

2686794 AQLPYLRSILNETLRMYPAAPLLVPHESSEECLVGGFRIPRGTMLSVNVW 2686943

2686944 AIQNDPKIWRDPTKFRPER 2687000

2687001 FDNLEGGRDEFKLMPFGHGRRSCPGEGLALRVVGLALGSLLQCFEW 2687138

2687139 QKIGDKMVDMTEASGSAISKAQPLEAICRARPSMLTHLSQI* 2687264

>CYP81B-se2[1]

scaffold_40 (+) 2689865-2690096

no model

no comment

N-term

$

2689865 PPRPFPSPPVTGHLYLH*KSIYWT 2689936

2689938 LSKFACQHGPAILLTFGSRRALSDSSPSIAEQCFT 2690042

2690043 NLAWPPRGDCWRKLRKIL 2690096

>CYP81B11

scaffold_40.6 (+) 2691314-2693223

fgenesh1_pg.C_scaffold_40000330 [Poptr1:94218]

gene model short, 2 frameshifts

81D like 51% to 81D8

94% to LG_XIV      (-)   929000

$

2691314 MATLILYFLVILALYIITRHFLT 2691382

2691382 KIRNFPPGPFPSLPIIGHLYLLKKPIYRTLSKISSKHGPVILLQLGSRR 2691528

2691529 LLVVSSPSIAEECFTKNDVVFANRPRLLIAKHLAYNSTSLVWAPYGDHWR 2691678

2691679 NLRRIVSIEVLSAYRLQMLSAIRLEEVKSMICVLFRNQKQIVDMKTVFFE 2691828

2691829 LTLNIMMRMIAGKRYYGESVSDVEEAKKFRAIHAETFLIGGKTIIGDYIP 2691978

2691979 WIKSKKMEKRMIECHIKRDSFMQYLIEEQRRKILESDCCGEKKTNLIQVL 2692128

2692129 LSLQETEPEYYTDDIIKGIML 2692191 (0)

2692602 VLLLAGTDTSSTTMEWALSLLLNHPEVLEKAQREIDEHIGHDRLMDEGDLAQ 2692757

2692759 LPYLRSILNETLRMYPPAPLLVPHESSEECLVGGFRIPRGTMLSVNV 2692899

2692900 WAIQNDPKIWRDPTKFRPER 2692959

2692960 FDNLEGGRYEFKLMPFGHGRRSCPGEGLALKVVGLALGSLLQCFEW 2693097

2693098 QKIGDKMVDMTESPGFTVPKAKQLEAICRARPRMLTLLSQI* 2693223

>CYP81B-se3[1]

scaffold_40 (+) 2695016-2695445

no model

no comment

81D like N-term frag.

$

2695016 LLFSVFLGLYIITKHFLNEIQNLPPSPFPS 2695105

2695359 QPSFAAAKHLAYNCTNFAGPPYGDYW*NV 2695445

>CYP81B12

scaffold_40.7 (+) 2698671-2700987

fgenesh1_pg.C_scaffold_40000331 [Poptr1:94219]

bad boundary, gene model too long

81D like 51% to 81D8

88% to LG_XIV      (-)   929000

$

2698671 MATFFLHFSVFLALYIITRHFLNKIRNFPPSPFPSLPIIGHLYLLKKPIY 2698820

2698821 RALSKISSKHGPVILLQLGSRRQLVVSSPSIAEECFTKNDVVFANRPGYL 2698970

2698971 IAKHLAYNTTGLLWAPYGDHWRNLRRIVSIEVLSAYRLQMLSSIRLEEVR 2699120

2699121 SMICVLFRNQNQIVDMKTVFFELTLNIMMRMIAGKRYYGEDVSDVEEAKR 2699270

2699271 FRAIHAETLLLGGKTIIGDYVPWIKSKKMLKRVIECHLKSDSFMQYLIEE 2699420

2699421 QRRKILESDCCGEKKRNLIQVLLSLQENEPGYYTDDIIKGIML 2699549 (0)

2700385 VLLLAGTDTSSATMEWALSLLLNHPRVLEKAQREIDEHIGHDRLMDEGDL 2700534

2700535 AQLPYLRSILNETLRMYPPAPLLIPHESSEECLVGGFRIPRGTMLSVNMW 2700684

2700685 AIQNDPKIWPDPTKFRPERFDNPEGARDGFKLMPFGHGRRSCPGEGLALK 2700834

2700835 VVGLALGSLLQCFKWQKISDKMVDMTEGPGFTSTKAQPLEAI*RPRPSMHT 2700987

>CYP81B12-de2b

scaffold_40 (+) 2701996-2702187

no model

no comment

81D like 84% to 40.7

$

2701996 PGEGSALRVVGLALGSLLQCF*WQKIGDKMVDMTESPGFTALKAKPLEAI 2702145

2702146 CRPRPSMLGHISQI 2702187

>CYP81B13P

scaffold_10588 (+) 2-1138

eugene3.105880001|Poptr1

no comment

81D like runs off the end

89% to scaffold_40  (+)  2687031

$

   2 EPEYYTDDIIKGLVV (0) 46

 518 VILFAGTHTSSTTMEWALSLLLNHPEVLEKAKREIDEQIG 637

 638 HDRLMDEADLAQLPYLRSVLNETLRMYPAAPLLVPHESSEECLVGGFRIPR 790

 791 GTMLSVNVWAIQNDPKIWRDPTKFRPERFDN 883

 884 PEVARDGFKLMPFGYGRRSCPGESMALRVMGLALGSLLQCFEWQKIGDKMVDMTE 1048

1049 ASGFTIPKAKPLKVICRPRPDMLRHLS* 1138

>CYP81C3

scaffold_40.4 (-) 2639518-2637241

fgenesh1_pg.C_scaffold_40000322 [Poptr1:94210]

gene model seems correct

81D like 45% to 81A7

3 aa diffs to scaffold_40   (-) 2633172

$

2639518 MEFLYYHLALLFFLFIVVKNLFHRKRNLPPAPFALPVIGHLYLLKQPLYK 2639369

2639368 SLHALLSRYGPALSLRFGSRFVIVVSSPSVVEECFTKNDKIFANRPKSMA 2639219

2639218 GDRLTYNYSAFVWAPYGDLWRKLRRLAVAEIFSSKSLRKSSTVREEEVSC 2639069

2639068 LIRRLLKVSTSGTQNVELRLLFSILASNVVMIVSAGKRCVEEEHAGTKME 2638919

2638918 KQLFQDFKDKFFPSLAMNICDFIPILRVIGFKGLEKNMKKLHGIRDEFLQ 2638769

2638768 NLIDEIRLKLKKTTSLKTDEVTDGEERRSVAEILLCLQESEPEFYTDEVI 2638619

2638618 KSTVL 2638604 (0)

2637858 MMFIAGTETSAITLEWAMTLLLNHPKVMQKVKAEIDEHVGHGRLLNESDI 2637709

2637708 VKLPYLRCVINETLRLYPPAPLLLPHFSSEACTAGGFDIPQGTMLVVNAW 2637559

2637558 TMHRDPKLWEEPNEFKPERFEAGLGEGDGFKYIPFGIGRRVCPGASMGLQ 2637409

2637408 IVSLALGVLVQCFEWDKVGTVEDTSHGLGMILSKAKPLEALCSPRRDLIT 2637259

2637258 LLSHL* 2637241

>CYP81C4

scaffold_40.3 (-) 2633172-2630892

fgenesh1_pg.C_scaffold_40000321 [Poptr1:94209]

gene model seems correct

81D like 45% to 81A7

3 aa diffs to scaffold_40   (-)  2637726 duplicate seq

$

2633172 MEFLYYHLALLFFLFIVVKNLFHRKRNLPPAPFALPVIGHLYLLKQPLYK 2633023

2633022 SLHALLSRYGPALSLRFGSRFVIVVSSPSVVEECFTKNDKIFANRPKSMA 2632873

2632872 GDRLTYNYSAFVWAPYGDLWRKLRRLAVAEIFSSKSLRKSSTVREEEVSC 2632723

2632722 LIRRLLKVSTSGTQNVELRLLFSILASNVVMIVSAGKRCVEEEHAGTKME 2632573

2632572 KQLFQDFKDKFFPSLAMNICDFIPILRVIGFKGLEKNMKKLHGIRDEFLQ 2632423

2632422 NLIDEIRLKLKKTTSLKTDEVTDGEERRSVAEILLCLQESEPEFYTDEVI 2632273

2632272 KSTVL 2632258 (0)

2631509 MMFVAGTETSAITLEWALTLLLNHPKVMQKVKAEIDEHVGHGRLLNESDI 2631360

2631359 VKLPYLRCVINETLRLYPPAPLLLPHFSSEACTAGGFDIPQGTMLVVNAW 2631210

2631209 TMHRDPKLWEEPNEFKPERFEASLGEGDGFKYIPFGIGRRVCPGASMGLQ 2631060

2631059 IVSLALGVLVQCFEWDKVGTVEDTSHGLGMILSKAKPLEALCSPRRDLIT 2630910

2630909 LLSHL* 2630892

>CYP81C5

LG_IIa (+) 9173256-9175652

fgenesh1_pg.C_LG_II001124 [Poptr1:347618]

gene model seems correct

81K like 51% to 81K1

72% to scaffold_40  (-)  2637726

$

9173256 MESLYHHLALLFFLFLVVKILFRQKQNLPPSPFALPIIGHLHLFKHPQSL 9173405

9173406 QTLSSQYGPILFLKFGCRSTLVVSSPSAVEECFTKNDIIFANRPQSMAGD 9173555

9173556 HLTYNYTGFVWAPYGHLWRSLRRISVIEIFASKSLQKSSIIREEEVCSLL 9173705

9173706 RRLLKAKNGVTAKVDLKFLFSLLTCNVMMRLAAGKPCIDEEVAGTKVEKQ 9173855

9173856 LFQEFKERFSPGLGMNICDFIPILRLIGYKGLEKSTKKLQSTRDKYLQHL 9174005

9174006 IDEIRMRRTSSSSKTAEQWKREGKSSVIETFLSLQDLEPEFLTDTVIKSV 9174155

9174156 LS 9174161 (0)

9175035 MMFVAGTETSAVTLEWAMALLLNHPKAMQKLKAEIDEHVGHGRLLN 9175172

9175173 ESNIVKLPYLRCVIKETLRLYPPAPLLLPHFSSGACTVGGFDIPQGTTLV 9175322

9175323 VNAWAMHRDPKLWEESNEFKPERFEAGLGEQEGFKYIPFGTGRRVCPGAS 9175472

9175473 MGLQMVSIALGALVQCFEWDKVAPVEDMSHSPGISLSKVKPLEALCCPRG 9175622

9175623 DLTTLLYHP* 9175652

>CYP81R1P

scaffold_64 (-) 903647-903045

eugene3.00640126|Poptr1

gene model wrong

81K like pseudogene 37% to 81K2 aa107-293

86% to scaffold_64   (-)   863860

$

903647 SYSYTAFLFAP 903615

903607 YGHLWRTPRRFSVSELFSRGCLDWSTAITEEVRTLLRLILSKVSDDRAKK 903458

903457 VDLNYFFTITSLNVIMKMNAGKKRVEEEKAACIDSEKQCIEDVQKIFPSNPGTSL 903293

903292 LDFFPILKWIGYNGDIEESTVI 903227

903227 KERDEFLQGLIEEVKRKETSS 903165

903162 DTSNTEEVKDQTTVIG 903115

903113 SLLALQKSDPELFTDVVVKGTAI 903045

>CYP81R2

scaffold_64 (-) 881364-879605

eugene3.00640125|Poptr1

gene model seems correct

81K like 43% to 81K1

2 aa diffs to scaffold_64    (-)   863860 duplicate seq

92% to scaffold_279  (-)    94272

$

881364 MNYMYYCLAFFLSSFLVFKLVFQRSRNLPPSPFGFPIIGHLHLVSKPPMH 881215

881214 KVLAILSNKCGPVFTLKLGSRNIVAVCSLSAAEECYIKNDIVFANRPQSI 881065

881064 FVHYWSYNYAAFLFAPYGHLWRTLRRFSVTELFSRSCLDRSAAISEEVRT 880915

880914 LVRLILSKVSDDGAKKVDLNYFFTITSLNVIMKMNAGKKWVEEEKAACID 880765

880764 SGKQCIEDVQKIFPSNPGTTVLDFFPFLKWFGYRGEEESVIKVYKERDEF 880615

880614 LQGLIEEVKRKETSSVTSNPAEGVKDQTTVIGSLLALQKSDPELYTDEVV 880465

880464 KGTMA 880450 (0)

880228 TLYLAGVDTVDFTTEWAMTFLLNHPERLERVKAEIDREVGHERLVQESDL 880079

880078 PKLRYVRCVVNETLRLYPPAPLLLPHAPSEDCIVGGYKIPRGTIVMVNAW 879929

879928 AIHRDPKLWEDPESFKPERFEGLNNEGEKQGFIPFGIGRRACPGNHMAMR 879779

879778 RVMLALAALIQCFEWERVGKELVDMSIVDALISVQKAKPLEAICTPRPFT 879629

879628 TTLISPP* 879605

>CYP81R1

scaffold_64a (-) 865374-863615

eugene3.00640122|Poptr1

gene model seems correct

81K like 41% to 81K1

2 aa diffs to scaffold_64   (-)   879850 duplicate seq

$

865374 MNYMYYCLAFFLSSFLVFKLVFQRSRNLPPSPFGFPIIGHLHLVSKPPMH 865225

865224 KVLAILSNKCGPVFTLKLGSRNIVAVCSLSAAEECYIKNDIVFANRPQSI 865075

865074 FVHYWSYNYAAFLFAPYGHLWRTLRRFSVTELFSRSCLDRSTAISEEVRT 864925

864924 LVRLILSKVSDDGAKKVDLNYFFTITSLNVIMKMNAGKKWVEEEKAACID 864775

864774 SGKQCIEDVQKIFPSNPGTTVLDFFPFLKWFGYRGEEESVIKVYKERDEF 864625

864624 LQGLIEEVKRKETSSVTSNPAEGVKDQTTVIGSLLALQKSDPELYTDEVV 864475

864474 KGTMA 864460 (0)

864238 TLYLAGVDTVDFTAEWAMTFLLNHPERLERVKAEIDREVGHERLVQESDL 864089

864088 PKLRYVRCVVNETLRLYPPAPLLLPHAPSEDCIVGGYKIPRGTIVMVNAW 863939

863938 AIHRDPKLWEDPESFKPERFEGLNNEGEKQGFIPFGIGRRACPGNHMAMR 863789

863788 RVMLALAALIQCFEWERVGKELVDMSIVDALISVQKAKPLEAICTPRPFT 863639

863638 TTLISPP* 863615

>CYP81R6

scaffold_279 (-) 96174-94443

eugene3.02790010|Poptr1

gene model seems correct

81D like 43% to 81K1 43% to 81A6

92% to scaffold_64   (-)   879850

$

96174 MDYMYYCLAFFLSSFLVFKLVFQRSRNLPPSPFRFPIIGHLHLVTKPPMH 96025

96024 KVLAILSNKCGPIFTLKLGSKNIVAVCSLSAAEECFLKNDIVFANRPQSI 95875

95874 FFHYWSYNYAAFLFAPYGHLWRTLRRFSVTELFSRSCLDRSTAITEEVRT 95725

95724 LLRLILSKVSDDGAKNVDLNYFFTITSLNVIMKMIAGKKWVEEEKAACID 95575

95574 SGKQCLEDVQKIFPSNTGTILKWVGYKVKEESVIKVFKERDEFLQGLIEEVKRKETSSVTSNPA 95383

95382 AEGVKDQKTVIGSLLALQKSDPELYTDEVVKGTMA 95278 (0)

95066 TFYLAGVDTVDFTTEWAMTFLLNHPERLERVKAEIDREVGHERLVQESDL 94917

94916 PKLRYLRCVVNETLRLYPPAPLLLPHAPSEDCTIGGYEIPRGTIVMVNVW 94767

94766 AIHRDPKLWEDPESFKPERFEGLNNEGEKQGFIPFGIGRRACPGNHMAMR 94617

94616 RVMLALAALIQCFEWERVGQELIDMSIVKALISVQKAKPLEATCTPRPFT 94467

94466 TSLISPP* 94443

>CYP81R6-de2b

scaffold_279 (-) 99748-99595

eugene3.02790011|Poptr1

pseudogene

PKG-PERF region of 81 like

78% to scaffold_64   (-)   879850

$

99748 SPLLLPHAPSEDCIVGGYKIPRGMIVMVSVWA 99653

99651 VHRDPKSWEGSESFKLEKY 99595

>CYP81R4

scaffold_40.2 (-) 2629530-2627051

fgenesh1_pg.C_scaffold_40000320 [Poptr1:94208]

model has 2 genes fused?

81D like 50% to 81K2

scaffold_40   (-)  2625145          81D like

56% to scaffold_64  (-)   879850

$

2629530 MLSYCCLAFFFLIFLVIKYVFHGNKNLPPSPPSLPIIGHLHLLKPPLHQT 2629381

2629380 LQTLLQQYGPVLSLKAGCRSMLVLSSPSAVEECFTKNDVVLSNRPTFLAG 2629231

2629230 DHLTYNYTTIIFSPYGHLWRTLRRFAVLEMFSQKGLNKFSAVRKEEVCSL 2629081

2629080 LRQLSKVSCSGNKKVDLHYFFSLLSFNVAMRMSAGKKCIEEEVACSDLGK 2628931

2628930 QDLTELKKIFHPPLSTGLCDFFPALKWIDYKGFEKSVIKVRDGRDGFSQD 2628781

2628780 LIDEIRQKKTSSCSSPDAGPEKTTMIETLLSLQEQEPDFYTDDIIKGLVV 2628631 (0)

2627671 AIFAAGTDTVAVTMEWAMSLLLNHPEILQKVREEIDSEVGHTRLVEELDL 2627522

2627521 PKLKYLRCVINETLRLYPVVPLLLPRCPSEDCTVAGYKVPKGTILLVNAF 2627372

2627371 AMHRDPKMWEQPDRFKPERFEVTEEEKEGIKFIPFGMGRRACPGSNMGMR 2627222

2627221 AIMLAMAALFQCFEWERTGPEMVDMTVAAAISMVKATPLEAFCKPYHSMA 2627072

2627071 NLFSQL* 2627051

>CYP81R5P

scaffold_40 (-) 2625277-2624657

no model

no comment

81D like exon 2 94% to40.2

$

2625277 AMFSAGTDTVAVTMEWAMALLLNHPEILQKVRVEIDSQVGHTRLVEEVDL 2625128

2625127 PKLKYLRCVINETLRLYPVVPLLLPRCPSEDCTVAGYNVPKGTILLVNAF 2624978

2624977 AMHRDPKMWEQPDRFKPERFEATVEEKEGIKFIPFGMGRRACPGSNMGMR 2624828

2624827 AIMLAMAALFQCFEWERTGQEMVDMTVAAAISMVKAKPLEAFCKPYHSMA 2624678

2624677 NLFSQL* 2624657

>CYP81S1v1

scaffold_2410 (+) 3342-5208

fgenesh1_pg.C_scaffold_2410000001|Poptr1

gene model seems correct short at N-term

81D like 43% to 81A6

90% to scaffold_150   (+)   568752

$

3342 MEEDYSASLWLRYSFLLPCMVFLVLSTKFLLHKRKQGKINHLPPSPFALP 3491

3492 IIGHLYLLKQPIHRTLHSLSKKYGPIFSIKLGSRLAVVISSPSAVEECFT 3641

3642 KNDIVLANRPYFLSSKYLNYNNTTMGSVEYGEHWRNLRRISALEIFSPPR 3791

3792 LTSLFSIRREEVMALLRRLHGVSKHGNYAKVELRSMLLDLTSNIIMRMVA 3941

3942 GKRYYGEDVKEIEEARIFKEIMEEFAECIAVRNLGDMIPLLQWIDFTGHL 4091

4092 KKLDRLSKKMDVFLQGLVDEHRDDRDRNTMINRFLALQEEQPEYYTDEVI4242 KGHVL 4256 (0)

4582 VLLIGGTETAATSMEWALANLLNHPNVLKKAKAELDAQVGDRLID 4716

4717 ESDFAKLHYLQSIISENLRLCPVTPLIPPHMPSSDCTIGGYHVPAGTILF 4866

4867 VNAWSLHRDPTLWDEPTSFKPERFESAGRVDACKFIPFGMGRRACPGDGL 5016

5017 ANRVMTLTLGSLIQCFEWERVGENKIDMTEKTAMTMFKVEPLELMCRARP 5166

5167 ILDMLLSLSGQKI* 5208

>CYP81S1v2

scaffold_816 (-) 15204-14722

eugene3.08160005|Poptr1

gene model short

81D like

1 aa diff to scaffold_2410  (+)     4972 duplicate seq

$

15204 FAKLHYLQSIISENLRLCPVTXLIPPHMPSSDCTIGGYHVPAGTILFVNA 15055

15054 WSLHRDPTLWDEPTSFKPERFESAGRVDACKFIPFGMGRRACPGDGLANR 14905

14904 VMTLTLGSLIQCLEWERVGENKIDMTEKTAMTMFKVEPLELMCRARPILD 14755

14754 MLLSLSGQKI* 14722

>CYP81S-se1[2]

scaffold_86 (-) 269140-268941

eugene3.00860032|Poptr1

no comment

81D like pseudogene

74% to scaffold_816  (-)     1148

$

269140 MEWALANLLNHPEVLKK 269090

269089 KAKTELDILVGDHLINKSDFAELQYLQCIISEDSRLY 268979

268979 SSDCTIGGYNPPD 268941

>CYP81S2

scaffold_816 (-) 1920-927

eugene3.08160002|Poptr1

no comment

81D like

95% to scaffold_2410  (+)     4972

 (sequence gap)

$

1920 ALQEEQPEYYTDEVIKGHVL 1861 (0)

1535 VLLIGGTETSATAMEWALANLLNHPDVLRKAKAELDAQVGDRLID 1401

1400 ESDFAKLHYLQSIISENLRLCPVTPLIPPHMPSSDCTIGGYHVPAGTILF 1251

1250 VNAWSLHRDPTLWDEPTSFKPERFESAGRVDACKFIPFGMGRRACPGDGL 1101

1100 AKRVMILTLGSLIQCFEWNRVGESKIDMAEKTALTMFKVEPLELMCRARP 951

 950 ILDMLLS* 927

>CYP81S3

scaffold_150b (+) 437927-439595

estExt_Genewise1_v1.C_1500155|Poptr1

gene model seems correct

81D like 51% to 81D6

68% to scaffold_150  (+)   568752

$

437927 MENTLLYSVILFALFLVLSINLLLRTRKQRKTLPPSPLSLPVIGHFHLLR 438076

438077 QPIHRTLEALSQKYGPVFSLKFGSRLAIIVSSPSGVEECLIKKDIVFANR 438226

438227 PHVLIGRILNYNNTTMGTADYGDHWRNLRRISAIEIFSSTRLNAFLGMRK 438376

438377 DEVKLLLSRLYRVSMHGFAKVELRPLLFDLTSNIMMRMVAGKRYYGEGVH 438526

438527 EVDKAREFREMMEEFIHYSGAATAGDFLPFLQWLDLNGYVNKLDRLSKRM 438676

438677 DAFFQGLIDEHRVDRNRNTMISHFLTLQESQPEYYTDEIIKGHVL 438811 (0)

438975 TLLVAGIETSATSLEWAMANLLNQPEVLKKAKEELDTSQVGQDELIDESD 439124

439125 LPKLHYLHDIISENLRLYPVAPLLVPHMSSADSTVGGYHVPARTMLFINA 439274

439275 WAIHRDPTLWDEPTSFKPERFENGRVDQACKLMPFGLGRRACPGDGLANR 439424

439425 VMALTLGSLIQCFEWKRVSEKEIDMAEFTTITICKVEPLVAMCKARPILD 439574

439575 NVLSRA* 439595

>CYP81S1v3

scaffold_150 (+) 506775-507275

81D like duplicate seq

100% match to scaffold_2410 (+)     4972

eugene3.01500062|Poptr1

$

506775 LIDESDFAKLHYLQSIISENLRLCPVTPLIPPHMPSSDCTIGGYHVPAGT 506924

506925 ILFVNAWSLHRDPTLWDEPTSFKPERFESAGRVDACKFIPFGMGRRACPG 507074

507075 DGLANRVMTLTLGSLIQCFEWERVGENKIDMTEKTAMTMFKVEPLELMCR 507224

507225 ARPILDMLLSLSGQKI* 507275

>CYP81S4

scaffold_150c (+) 551355-553284

eugene3.01500069|Poptr1

gene model short on N-term (seq gap at N-term)

81D like 53% to 81D8

88% to scaffold_2410 (+)     4972

$

551355 CYSLLLSCFVFLALSTKFLLQKRKQGKISNLPPSPFALPIVGHLHLLKQP 551504

551505 IQRTLHSLSEKHGPIFSLKLGSRLAVVISSPSAVEECFTKNDIVLANRPP 551654

551655 LLITKYLNYNNTTMGSVEYGDHWRNLRRISAIEIFSPARLTSLFSIRREE 551804

551805 VMALLHRLHSVSKHGNYAKVELRSMLLDLTSNIIMRMVAGKRYYGVDVKE 551954

551955 IEEARIFREILEEFFACLAMINVGDLIPMLQWVDIITGHLKKLDRLSKKM 552104

552105 DVFLQVLVDEHRDDRDRNTMINRFLALQEEQPEYYTDDIIKGHVL 552239 (0)

552658 ELFLAGTESSATAMEWALANLLNHPDVLKKAKAEVDAQVGDRLIE 552792

552793 ESDFAKLHYLQSIISENLRLCPVTPLIPPHMPSSDCTIGGYHVPAGTILL 552942

552943 VNAWSLHRDPTLWDEPTSFKPERFESAGRVDASKFIPFGMGRRACPGDGL 553092

553093 ANRVMTLTLGSLIQCFELGRVGENKIDMAEKTAVSMSKLEPLELMCRARP 553242

553243 ILDMLLSLSGQKI* 553284

>CYP81S5P

scaffold_150 (+) 562399-563313

eugene3.01500071|Poptr1

no comment

81F like 52% to 81D6 exon 1 only

96% to scaffold_150  0  (+)   568752

$

562399 MEEDYSTLQRLCNTLLLPCFVFLALSTKFLLHKRKQGKISNLPPSPFALP 562548

562549 IIGHLYLLKQPVHRTLHSLSQKHGPIFSLRFGSRLAVVISSPSAVEECFT 562698

562699 KNDIVLANRPHFVSGKYLNYNNTTMGKVEYGDHWRNLRRISALEIFSSPR 562848

562849 LTSLFSIRREEVMALLRRLHGVSKHGNYAKVELRSMLLDLTSNIIMRMVA 562998

562999 GKRYYGEDVKEIEEARIFKEIMEEFAECIAVRNLGDMIPLLQWIDFTGHL 563148

563149 KKLDRLSKKMDVFLQGLVDEHRDDRDRNTMINRFLALQEEQPEYYTDEVI 563298

563299 KGHVL 563313 (0)

>CYP81S6

scaffold_150a (+) 567120-568973

eugene3.01500072|Poptr1

gene model correct

81D like 54% to 81D8

89% to scaffold_2410  (+)     4972

$

567120 MEEDYSTLQRLCNTLLLPCFVFLALSTKFLLHKRKQGKISNLPPSPFALP 567269

567270 IIGHLYLLKQPVHRTLHSLSQKHGPIFSLRFGSRLAVVISSPSAVEECFT 567419

567420 KNDIVLANRPHFVSGKYLNYNNTTMGKVEYGDHWRNLRRISALEIFSSPR 567569

567570 LTSLFSIRREEVMALLRRLHSVSKHGNYAKVELRSMLLDLTCNIMMRMVA 567719

567720 GKRYYGDDVKEIEEARIFKEIMEEFAECIVMTNVGDLIPMLQWVDFTGHL 567869

567870 KKLDRLSKKMDVFLQGLVDEHRDNRDRNTMINRFLALQEEQPEYYTDEVI 568019

568020 KGHVL 568034 (0)

568365 VLLIGGTETSATAMEWALANLLNHPDVLRKAKAELDAQVGDRLID 568499

568500 ESDFAKLHYLQSIISENLRLCPVTPLIPPHMSSSDCTIGGYHVPAGTILF 568649

568650 VNAWSLHRDPTLWDEPTSFKPERFESAGRVDACKFIPFGMGRRACPGDGL 568799

568800 AKRVMILTLGSLIQCFEWNRVGESKIDMAEKTALTMFKVEPLELMCRARP 568949

568950 ILDMLLS* 568973

>CYP81S7

LG_Va (+) 5628907-5630507

grail3.0027010302|Poptr1

gene model seems correct

81D like 55% to 81D8

74% to LG_VIII       (-) 14685473

$

5628907 MQMEETHVYSFLCLLLVIVAVK 5628972

5628973 LLLQTRKKRRNLPPSPPAIPFIGHLHLLRQPIHRSLENLSKKYGPIISLR 5629122

5629123 LGPRPVVVVSSPSAVEECFTKNDIVFANRPQFLAGKHLHYNNTTLASASY 5629272

5629273 GDHWRNLRRICAIEIFSSSRLNAFLAIRKDEIRRLVCRLHRDSSDGFAKV 5629422

5629423 ELRSMFMDFTFNIVMRMIAGKRYYGEDVKLVEEATKFKETLQGYAALSEL 5629572

5629573 TNLGDVFPIFQSVDYNGFIKRCTGLSNRMDLILQGLIDELRREKNGNTMI 5629722

5629723 NHLLTLQESEPEYYTEEIIKGLIL 5629794 (0)

5629899 IMLLAGTKTLVTSIEWGVCNLFNHPDVVKKAREELDTQIGHERLIDESDF 5630048

5630049 SKLHYLQSIILENLRLYPVVPLLAPHMSSADCEVGGYDVPAGTILLVNAW 5630198

5630199 AIHRDPQIWEDPESFKPERFENWKSEAYKHLPFGLGRRACPGEVLAHKIM 5630348

5630349 ALTLGSLIQCFDWEGVGGKEIDMTEKMVNLMSRAEPLEVMCKARPNLNNILS* 5630507

>CYP81S8

LG_Vb (+) 5648929-5650535

eugene3.00050527|Poptr1

gene model seems correct

81D like 51% to 81D8

91% to LG_VII      (+) 1874399

$

5648929 MEESIMFLVLTISFVILALNFLLKTKKQEYKNLPPSPFALPIIGHLHLMK 5649078

5649079 QPIYRTIHNLSQKYGPIMSLRFGSRFVVIVNSPEAVEECFTKNDVILANR 5649228

5649229 PPFCHGKYLNYNFTTMGAANYGDHWRNLRRIGNNEIFSPKRLNGFQELRK 5649378

5649379 KEVKNLMKRVSRVSGENAGKVELRSMILDLTFNIVMTMLAGKRYYGEDVS 5649528

5649529 ELEDALQFRDMMNQYAEFAKEAHLGDLFPILSNIDYNGFVKRMKTLSKNM 5649678

5649679 DLFLQRLIEEHRADRERNTMVNHLLALQETQPQYYTDSIIKGLIL 5649813 (0)

5649927 IMAVAGTRTSAASLEWAICNLLNNRHVLKKAKEELDTQLGQD 5650052

5650053 HLIEEEDISKLHYLQGIISENLRLYPVAAMLVPHVASDYCTIGGYDVPPG 5650202

5650203 TMVFANAWSIQRDPKVWDDPLNFKPERFLDGKAEAYKVMPFGLGRRSCPG 5650352

5650353 EGLAHRLMTLTLGSLIQCFEWDTVDGKEINMDEKVATLMSRVHPLEVVLK 5650502

5650503 ARSDLDNIIS* 5650535

>CYP81S9

LG_V (+) 5671068-5672773

estExt_Genewise1_v1.C_LG_V4163|Poptr1

gene model seems correct

81D like 51% to 81D1

91% to scaffold_205  (-)    33143

$

5671068 MEEMMQYSLLGGFFLLLAVTLLQKARKHRMKLPPSPPGRLILGHLPLLKQ 5671217

5671218 PKAIHRTLHDISQKYGPIVTLKFGFRTVIIVSSPAAVEECFTKNDITLAN 5671367

5671368 RPPFLNGKVLNYNFTTLAAAPYGDHWRNLRRLTAIEVFSASRLNTFASIR 5671517

5671518 REEVKNLLRKIHKLCGDGSAVIELRTMLLDLNFNVMMRMVAGKKYYGEDV 5671667

5671668 DGLEESKRFKDMMHEFSECTRVTNLGDLFPILQCIDYDGFKNRMTQLGKR 5671817

5671818 MDAFWQGLIDEHRVDKTRNTMVSHLLALQESEPEYYTDEIIKGIIL 5671955 (0)

5672165 MMLVAGTKTSALSLEWAFSNLLNNPHALKKAVDEVDTQVGEGRL 5672296

5672297 ADEPDFANLHYIQCIIHENLRLCPPAPLLVPHVASERCTLGGYDIPSGAM 5672446

5672447 VLVNAWSIHRNPNVWDDPLSFKPERFENGKGEPYRLLPFGLGRRGCPGEA 5672596

5672597 MAFRVINLVMSQLLQCFEFSTVDGKEVDMTETAATLMLKITPLHLVCKAR 5672746

5672747 PNTHNLLA* 5672773

>CYP81S10P

LG_IV (+) 7961227-7961940

fgenesh1_pg.C_LG_IV000827|Poptr1

no comment

81D like pseudogene

66% to LG_Va       (+)  5630262

$

7961277 RKKD*NTMINHLLTLQEAQSEYYTDDTIKGLIL 7961375 (0)

7961682 IMLLAGTRTVTTPLEWAVC 7961738

7961740 DVITKAREDLETEFVQDRLVEESDSSKIIYLQHIIFENLRLYPVVPLLAS 7961889

7961890 HMSSAEHAVGGYDIPAG 7961940

>CYP81S11

scaffold_205a (-) 68149-59691

fgenesh1_pg.C_scaffold_205000005|Poptr1

gene model seems correct

81D like 56% to 81D3

56% to scaffold_150  (+)   439368

$

68149 MEVRVFYVSLSLLFFLLALKLHLSRKHKNSALPPSPPALPVIGHLHLLKR 68000

67999 RPMHLTFYSLAKKYGPIISLRFGSRLVVLISSPSPFEECFTKNDVVLANR 67850

67849 PKLLLGKHLAYNHTTLLQAPYGDHWRNLRRMGAVEIFSTYRINKFVSIRK 67700

67699 DEIKQLLIKLSHNSLQNFGKVELKSMFQELTFNIMMRMAAGKRYYVDDVT 67550

67549 DEEEARQFREIMTEAVTFAGASNPGDFLPILNWIDGGEFEKTVIRLGKRM 67400

67399 DMFLQGLVDEHKRKEDLESMNTMIGHLISLQVTQPEYYTDGIIEGLVL 67256 (0)

60296 VMLGAGTDTSAVTLE*AMSNLLNNPNTLKKARDELDTQVGEEFLLDE 60156

60155 THLSKLQYLQNIISETLRLNPAAPLLVPHESSESCSVGGYNVPRDTILLV 60006

60005 NAWAIHRDSTVWDDPTSFKPDRFDN 59931

59930 EGEDRKLIAFGCGRRSCPGAGLAQRVVGSTLGSLIQCFEWKRVSEKEV 59787

59786 DMTEGRGITLQKVVPLEAICKSRPIMDRILC* 59691

>CYP81S12v1

scaffold_205b (-) 34570-32904

fgenesh1_pg.C_scaffold_205000003|Poptr1

gene model seems correct

81D like 49% to 81D8

91% to LG_V   (+)  5672534

$

34570 MEDILQYSLLGGFFLLLVVTLLQHARKYRMKLPPSPPGRLILGHLPLLKQ 34421

34420 PRAIHRTLHDIAQKNGPIVTLKFGFRTVIIVSSPSAVEECFTKNDIILAN 34271

34270 RPPFLNGKVLNYNFTTLAAAPYGDHWRNLRRLTAIEVFSSSRLNTFSSVR 34121

34120 REEIKNLLRKIHKTCGDGSAVIELRTMLLDLNFNIMMRMVAGKKYYGEDV 33971

33970 DGLEESRRFKDMMQEFSECTRVTNLGDLFPILQCIDYDGFKNRMTQLGKR 33821

33820 MDAFWQGLIDEHRVDKDRNTMVSHLLALQESEPEYYTDEIIKGIIL 33683 (0)

33511 MMLVAGTKTSAMSLEWAFSNLLNNPRVLKKAIDEVDTQVGQDR 33384

33383 LVDEPDFSNLHYIQCIIYENLRLCPPAPLLVPHVASERCSLGGYDIPSGA 33234

33233 MVLVNAWSIHRNPDVWEDPLSFKPERFENGKGEPYRLMPFGLGRRGCPGE 33084

33083 AMALRVINMVMGQLLQCFEFSTIDGKDVDMTETAATLMLKITPLQLICKV 32934

32933 RPNTHSLLA* 32904

>CYP81S12v2

scaffold_11555 (-) 1500-306

fgenesh1_pg.C_scaffold_11555000001|Poptr1

gene model missing N-term 175aa runs off the contig end

81D like 51% to 81D8

98% to scaffold_205  (-)    33143 duplicate sequence

$

1500 LRKIHKTCGDGSAVIELRTMLLDLNFNIMMRMVAGKKYYGEDVDGLEESR 1351

1350 RFKDMMQEFSECTRVTNLGDLFPILQCIDYDGFKNRMTQLGKRMDAFWQG 1201

1200 LIDEHRVDKDRNTMVSHLLALQESEPEYYTDEIIKGIIL 1084 (0)

 914 MMLVAGTKTSAMSLEWAFSNLLNNPRVLKKAIDEVDTQVGQDR 786

 785 LVDEPDFSNLHYIQCIIYENLRLCPPAPLLVPHVASERCSLGGYDIPSGA 636

 635 MVLVNAWSIHRNPDVWEDPLSFKPERFENGKGEPYRLMPFGLGRRGCPGE 486

 485 AMALRVINMVMSQLLQCFEFSTIDGKEVDMTETAATLMLKITPLHLVCKA 336

 335 RPNTHNLLA* 306

>CYP81S13

LG_VII (+) 1874399-1875984

fgenesh1_pg.C_LG_VII000292|Poptr1

gene model seems correct

81D like 52% to 81D8

91% to LG_V        (+)  5650287

$

1874399 MEDTMMFLILTISFVVIALSFLLQTRKQYKNLPPGPFALPIIGHLHLMKQ 1874548

1874549 PIYQTIHNLSQRFGPIMSLRFGSRFVIIVNSPEAVEECFTKNDVILANRP 1874698

1874699 PFCHGKYLNYNFTTMGAANYGDHWRSLRRIGNNEIFSPKRLNGFQELRKK 1874848

1874849 EVTNLMKRVSRVSGENAGKVELRSMILDLTFNIVMTMLAGKRYYGEDVSE 1874998

1874999 LEEALQFRDMMNQYGEFAKETHLGDLFPILSNIDYNGFVKRMKTLSKNMD 1875148

1875149 LFLQRLIDEHRADRDRNTMVSHLLTLQEAQPQSYTDSIIKGLIM 1875280 (0)

1875376 IMAVAGTRTSAASLEWAICNLLNNRHVLKKAKEELDTQLGKDHLIEEPDI 1875525

1875526 SKLHYLQGIISENLRLYPVAAMLVPHVASEHCTIGGYDVPPGTMVFANAW 1875675

1875676 SIQRDPKVWDDALSFKPERFLNGKTEAYKLMPFGLGRRSCPGEGLAYRLM 1875825

1875826 TLTLGSLIQCFEWDTVDGKEINVDEKVATLMSRVQPLEVVMKARPDLDDILA* 1875984

>CYP81S14v1

LG_VIII (-) 14685512-14683933

estExt_fgenesh1_pm_v1.C_LG_VIII0029|Poptr1

gene model seems correct

81D like 53% to 81D8

74% to LG_V     (+)  5630262

$

14685512 MPNTHLYSLFGFFLLVLAVKFLLPTGKKRKNLPPSPPAIPIIGHLHLLKQ 14685363

14685362 PIHRTLENLSRKYGPIVFLRFGSRSVILVSSPSLAEECFTKNDINFANRP 14685213

14685212 PFLNGKHLHYNFTTVASANYGDHWRNLRRICAIEIFSSSRLNSSSGIRRD 14685063

14685062 EIKHLARRLQQVSNTGFAKVDLRSMFTDLTFNIVMRMIAGKRYYGEDVNL 14684913

14684912 IEEAKKFKETMQEYADLGGLTNLADVFPIFQSVDYNGFVKKCVGLSKRMD 14684763

14684762 LILQGLVDEHRRDRDRNTMINHLLTLQDSQPEYYTEDIIKGLIL 14684631 (0)

14684541 IMLLAGTRTLSTSLEWAVCNLLNHPDVERKAREELDTQIGQDHMVDE 14684401

14684400 ADISKLPYLQSVILESLRLHPVVPLLAPHMSSADCTIGGYDVPAGTILFA 14684251

14684250 NAWAIHRDPTLWNDPTSFKPGRFENWKSEAYTHMPFGMGRRACPGEGLAQ 14684101

14684100 RIMAITLGSLIQCFEWEKVDGKDIDMTDKMHTLMCRVEPAEAMCRVRPDMVDLLS* 14683933

>CYP81S14v2

scaffold_5464 (-) 3066-2671

fgenesh1_pg.C_scaffold_5464000002|Poptr1

no comment

81D like

100% to LG_VIII    (-) 14685473 duplicate sequence runs off the end

$

3066 LLAPHMSSADCTIGGYDVPAGTILFANAWAIHRDPTLWNDPTSFKPGRFE 2917

2916 NWKSEAYTHMPFGMGRRACPGEGLAQRIMAITLGSLIQCFEWEKVDGKDI 2767

2766 DMTDKMHTLMCRVEPAEAMCRVRPDMVDLLS* 2671

>CYP81T1

scaffold_40.1 (-) 2622115-2620377

eugene3.00400361 [Poptr1:592016]

gene model wrong at C-term

49% to 81D2 like may be too long at CYAN

52% to scaffold_1047  (+)     5087

$

2622115 MEVSHWFNFAALFFFFVLASKLVIYKLGNPKNLPPSPPSRPIIGHLHLLK 2621966

2621965 QPIHRTLCELSKKYGDILFLRFGARKVLVISSPSAVEECFTRKDVIFANR 2621816

2621815 PRTLAGKHLNYNSTTMGFSSYGEHWRNLRRLTTIELFSASRVASFSDIRK 2621666

2621665 EEVQLLLNQLFRDSSKQQAKVGLTASFMELTFNVMMRMIAGKRYYGKEVV 2621516

2621515 DEEAGQFQNIIKEMEALRGSSNMNDFFPVLQWIDFQGLEKRMMGLKKKMD 2621366

2621365 KFLQDLIEEHQKVRSQSSQSTKITGLGNQKRNMTLIDVMLSLKETEPEFY 2621216

2621215 TDQTIKGVIM 2621186 (0)

2620991 STLTAGSQTSAATLEWAMSLLLNNPETMRKASEEIDAIVGTEHILDEV 2620848

2620847 DVTKLSYLQNILNETFRLFPPAPLLLPHESSEDCTISGFHVPRGTMLLVN 2620698

2620697 TWSIHRDTKLWVEPTKFMPERFEGGEGEGYKLLPFGAGRRACPGAGLAKR 2620548

2620547 IIGLTLGVLIQCFEWDRVSKEEINLTEGTGLTIPKAEPLEALCRPRQSM 2620401

2620400 VNLLSSM* 2620377

>CYP81T1-de2b

scaffold_40 (-) 2620375-2620241

no model

no comment

81D like pseudogene

repeat of C-terminal right after the gene

$

2620375 FEWDRVSKEEINLTEGTGLPMPKAEPLEALCRPRQSMVNLLSSM* 2620241

>CYP81T1-de2c

scaffold_40 (-) 2619478-2619251

no model

no comment

81D pseudogene heme signature 72% to 81D2

$

2619478 GLKLTPFGVGRRSCPGAGLANRVVGLALASLIQCFEWERIREEEVDMSEGSGITMLKAKPL 2619296

2619295 KAMFKARMSMIDVLA* 2619248

 

>CYP82C5

scaffold_40d (-) 1598233-1596082

eugene3.00400215 [Poptr1:591870]

gene model short at N-term

82C like 68% to 82C4 Arab.

65% TO 82C2, 63% to 82C3, 58% to scaffold_130  0  (-)   99503

1598233 MDPSPQLIAIALFFPCVL 1598180 repeat of N-term seq.

$

1598039 MDPSPQLIAIALFFSCILLYNALT 1597968

1597966 KKNSIKGNQIKEAPEPAGAWPIIGHLHLLGG 1597874

1597873 GDQLLYRTLGAMADKHGSAFTIRLGSRRAFVVSSWEVVKECFTINDKAL 1597727

1597726 ASRPTTVAAKH 1597694 (?)

1597634 SGYNYAVFGFAPYSSFWREMRKIATLELLSNRRLEMLKHVRASEVDIGIRDNIN 1597473

1597472 SWANNSSSPVVVELKQWLEDLTLNVVVRMVAGKRYFGSAAASDDGE 1597335

1597334 ARRCQKAINQFFRLIGIFVVSDALPFLGWLDLQGHERAMKNTAKELDAIL 1597185

1597184 EGWLDEHRQRRVSAGIKDEGEQDFIDVMLSLKEEGQLSNFQYDANTSIKSTCL 1587026 (0)

1596708 ALILGGSDTTAGTLTWAISLLLNNRHMLKKAQEELDLHVGKERQVEDSDV 1596559

1596558 KNLVYLQTIIKETLRLYPAGPLLGPREAMEDCKVAGYHVPAGTRLIVNVW 1596409

1596408 KIQRDPRVWTKTSAFLPERFLTSHGDVDVRGQQFELIPFGSGRRSCPGVS 1596259

1596258 FALQVLHLTLARLLHSFELATPMDQPVDLTESSGLTIPKATPLEVILTPR 1596109

1596108 LPPKLYGY* 1596082

>CYP82C5P

scaffold_40 (-) 1585647-1585558

no model

no comment

82C like N-term seq

2aa diffs to 82C5

$

1585647 MDPSPQLIAIALFFSCILLYNALIKKNSIK 1585558

1585557 GNQIKEAPEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKHGSAFTIRL 1585411

1585410 GSRRAFVVSSWEVVKECFTINDKALASRPTTVAAKHMGYNYAVFGFAPYS 1585261

1585260 SFWREMRKIA 1585231

>CYP82C6P

scaffold_40 (-)1590441-1589818

eugene3.00400214|Poptr1 82C like middle

no comment

82C like

97% (6aa diffs) to CYP82C8v1

$

1590441 TLAMDILGYNYSILSFSPYGTYWRLIRKIVTLEVLSNHRLEMFKHVREDEVRDAVGALYQQWIG 1590250

1590249 NKSNSQKLLVEMKRWFGDITLNVILKIIVSKRYVDYASHGEEKPSDEWRD 1590100

1590099 SLRKFLELSGMFVVSDALPFLRWLDLGGAEKAMRRTSKNLDHAVEKWLEE 1589950

1589949 HKQKKASGTAKGEEDFMDLMLSALDDAKELSNRSADTINKATCL 1589818 (0)

>CYP82C7Pv1

scaffold_40 (-) 1572611-1572060

eugene3.00400213|Poptr1 Gene model short N-term only

no comment

82C like N-term

98% to scaffold_15402  (+)     392

$

1572611 MDFPFQFSATAVLIMFAFITP 1572549

1572548 SIYYLFRIPGKEISKKRAPPEAAGAWPLIGHLHLLGGSQPPHITLGNLAD 1572399

1572398 KYGPIFTVKLGVHRTLIVSNWEMAKECLRTNDKAFATRPKTLAMDILGYN 1572249

1572248 YSILGFSPYGTYWRLIRKIVTLEVLSNHRLEMFTHVREDEVRDAIGALYQ 1572099

1572098 QWIGNKSNSQKLV 1572060

>CYP82C7Pv2

scaffold_15402 (+) 209-760

eugene3.154020001|Poptr1

no comment

82C like

98% (3 aa diffs to scaffold_40  (-)  1572611

97% (4 aa diffs) to scaffold_829  (-)   129175

$

209 MDFPFQFSATAVLILFAFITPSIYYLFRIPGKETSKKRAPPEAAGAWPLI 358

359 GHLHLLGGSQPPHITLGNLADKYGPIFTVKLGVHRTLIVSNWEMAKECLR 508

509 TNDKAFATRPKTLAMDILGYNYSMLGFSPYGTYWRLIRKIVTLEVLSNHR 658

659 LEMFTHVREDEVRDAIGALYQQWIGNKSNSQKLV 760 (0)

>CYP82C8P1

scaffold_5894 (-) 2108-2

eugene3.58940001|Poptr1

gene model short

82C like 47% to 82C4

95% to scaf_5606 runs off end

94% to scaffold_829   (-)   129175

$

2108 MDFPFQFSATAVLILFAFITPSIYYLFRIPGKERSKKRAPPEAAGAWPLI 1959

1958 GHLHLLGGSQPPHITLGNLADKYGPIFTVKLGVHRTLIVSNWEMAKECLR 1809

1808 TNDKAFATRPKTLAMDILGYNYSILSFSPYGTYWRLIRKIVTLEVLSNHR 1659

1658 LEMFKHVREDEVRDAVGALYQQWIGNKSNSQKLLVEMKRWFGDITLNVIL 1509

1508 KIIVSKRYVDYASPGEEKPSDEWRDSLRAFLELSGMFVVSDALPFLRWLD 1359

1358 LGGAEKAMKRTAKNLDHAVEKWLEEHKQKKASGTAKGEEDFMDLMLSVLD 1209

1208 DGKELSNRSADTINKATCL 1152 (0)

 226 AILAASDTTSVTLTWTLSLLLNNHEVLKKSQDELDIHIGRERQVKESDMKN 74

  73 LVYLQAIIKETFRLYPAAPLSVPH 2

>CYP82C8P2

scaffold_40 (-) 1565307-1564681

eugene3.00400211 [Poptr1:591866]

gene model short, only last exon

81D like

96% to scaffold_829  (-)   129175

first part 100% to 82C8v1, may be the C-term of 82C8v1

$

1565307 AILAASDTTSVTLTWTLSLLLNNHEVLKKSQDELDIHIGRERQVKESDMKN 1565155

1565154 LVYLQAIIKETFRLYPAAPLSVPH ESMEECTVGGYHIPAGTRLFTNLSKI 1565005

1565004 HRDPQVWSDPDEFQPERFLTTHKDCDFRGQHFELIPFGSGRRMCPGVSFA 1564855

1564854 LQVLNLALATLLHGFDIETLDDAPIDMTETGGITNIKATPLEALLTPRLS 1564705

1564704 PGLYDLQ* 1564681

>CYP82C8P3

scaffold_40 (-) 1555735-1555331

eugene3.00400209 [Poptr1:591864]

gene model short

82C like

97% to scaffold_829  (-)   129175

100% to CYP82C8v2

$

1555735 HESMEECTVGGYHIPAGTRLFTNLSKIHRDPQVWSDPDEFQPERFLTTHK 1555586

1555585 DCDFRGQHFELIPFGSGRRMCPGVSFALQVLNLALATLLHGFDIETLDDA 1555436

1555435 PIDMTETGGITNIKATPLEALLTPRLSPGLYDLQ* 1555331

>CYP82C9

scaffold_829 (-) 131153-128927

eugene3.08290002|Poptr1

gene model seems correct

82C like 50% to 82C4

94% to scaffold_5894 (-)     2108

$

131153 MDFPFQFSATAVLILFAFITPSIYYLFRIPGKETSKKRAPPEAAGAWPLI 131004

131003 GHLHLLGGSQPPHITLGNLADKYGPIFTVKLGVHRTLIVSNWEMAKECLR 130854

130853 TNDKAFATRPKTLAMDILGYNYSMLGFSPYGTYWRLIRKIVTLEVLSNHR 130704

130703 LEMFKHVREDEVRDAVGALYQQWTGNKSNSQKLLVEMKRWFSDITLNVIL 130554

130553 KIIVSKRYVDYVSRGEEKPSHEWGDSIRTFLELAGMFVVSDALPFLRWLD 130404

130403 LGGVEKAMKRTSKNIDRAVEKWLEEHKQKKASGTAKGEEDFMDLMLSVLD 130254

130253 DAKELSNRSADTINKATCL 130197 (0)

129556 ALILAASDTTSVTLTWTLSLLLNNREILKKAQDELDIHVGRERQVKESDM 129407

129406 KNLVYLQAIIKETFRLYPAAPLSVPHESMEECTVGGYQIPAGTRLFTNLS 129257

129256 KIHRDPQVWSDPDEFQPERFLTTQKDCDFRGQHFELIPFGSGRRMCPGVS 129107

129106 FALQVVNLALATLLHGFDIETVDDAPIDMTETGGITNIKATPLEALLTPR 128957

128956 LSPGLYDLQ* 128927

>CYP82C9P2

scaffold_5606 (-) 1564-608

eugene3.56060001|Poptr1

no comment

82C like

2 aa diffs to scaffold_829  (-)   129175 duplicate seq

$

1564 MDFPFQFSATAVLILFAFITPSIYYLFRIPGKEISKKRAPPEAAGAWPLI 1415

1414 GHLHLLGGSQPPHITLGNLADKYGPIFTVKLGVHRTLIVSNWEMAKECLR 1265

1264 TNDKAFATRPKTLAMDILGYNYSMLSFSPYGTYWRLIRKIVTLEVLSNHR 1115

1114 LEMFKHVREDEVRDAVGALYQQWTGNKSNSQKLLVEMKRWFSDITLNVIL 965

 964 KIIVSKRYVDYVSRGEEKPSHEWGDSIRTFLELAGMFVVSDALPFLRWLD 815

 814 LGGVEKAMKRTSKNIDRAVEKWLEEHKQKKASGTAKGEEDFMDLMLSVLD 665

 664 DAKELSNRSADTINKATCL 608 (0)

>CYP82C9P1

scaffold_40 (-) 1551888-1550208

eugene3.00400208 [Poptr1:591863]

gene model short at N-term

82C like

99% (3 aa diffs) to scaffold_829   (-)   129175 duplicate seq

$

1551888 LLVEMKRWFSDITLNVILKIIVSKRYVDYVSRGEEKPSHEWGDSIRTFLE 1551739

1551738 LAGMFVVSDALPFLRWLDLGGVEKAMKRTSKNIDRAVEKWLEEHKQKKAS 1551589

1551588 GTAKGEEDFMDLMLSVLDDAKELSNRSADTINKATCL 1551478 (0?)

1550837 TLVLAAADTTSVTLTWTLSLLLNNREILKKAQDELDIHVGRERQVKES 1550694

1550693 DMKNLVYLQAIIKETFRLYPAAPLSVPHESMEECTVGGYQIPAGTRLFTN 1550544

1550543 LSKIHRDPQVWSDPDEFQPERFLTTQKDCDFRGQHFELIPFGSGRRMCPG 1550394

1550393 VSFALQVVNLALATLLHGFDIETVDDAPIDMTETGGITNIKATPLEALLT 1550244

1550243 PRLSPGLYDLQ* 1550208

>CYP82C10

scaffold_40b (-) 1533682-1531659

fgenesh1_pg.C_scaffold_40000184 [Poptr1:94072]

gene model correct

82C like 50% to 82C4

98% to scaffold_40  (-) 1522560

$

1533682 MEFFNLPFLTNNMTSNPMFFIFIFICSIFWISRKFLAGTGKKKAAPKAGG 1533533

1533532 AWPVIGHLHLLGGAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSNWETA 1533383

1533382 KECFTTHDKAFSGRPRTLASELLTYDGAMLGFSPYGPYWRQVRKITTVEL 1533233

1533232 LSNYRLEKLKDVRESEVRAFLKELYKLWDENRGSASKSKSNLVLVEMKRW 1533083

1533082 FGDLTLNIVLRTIVGKTVGYITNVEDEESVEGWKKGLKDFFHWTRVFSVS 1532933

1532932 DALPFLRFLDLGGHGEAMKKTAKELDLVVEDWLKEHKRKRAAGIVKGKED 1532783

1532782 FMDVMLDVFDNDAEAVQGGDSDTTIKATSL 1532693 (0)

1532285 ALILAASDTTAVTLIWALSLLVNNPNVLKKAQLELDTHVGKERQVEESDV 1532136

1532135 QNLVYLKAVLKETLRLYPAAPLSLPHEAIEDCTIDGYHVPRGTRLLVNVS 1531986

1531985 KIHRDERVWSNPNEFDPERFLTTHRGFDVRGKNFEFSPFGSGRRMCPGVS 1531836

1531835 FALHVMDLALATLLHGFDFATPSGEPVDMHESSGLTNLRATPLEVLLSPR 1531686

1531685 LSSRLYGH* 1531659

>CYP82C10P

scaffold_397 (-) 54684-54058

fgenesh1_pg.C_scaffold_397000004|Poptr1

duplicate seq exon 2

100% match to scaffold_40 (-) 1533682

$

54684 ALILAASDTTAVTLIWALSLLVNNPNVLKKAQLELDTHVGKERQVEESDV 54535

54534 QNLVYLKAVLKETLRLYPAAPLSLPHEAIEDCTIDGYHVPRGTRLLVNVS 54385

54384 KIHRDERVWSNPNEFDPERFLTTHRGFDVRGKNFEFSPFGSGRRMCPGV 54238

54237 SFALHVMDLALATLLHGFDFATPSGEPVDMHESSGLTNLRATPLEVLLSP 54088

54087 RLSSRLYGH* 54058

>CYP82C11

scaffold_40a (-) 1522560-1520144

fgenesh1_pg.C_scaffold_40000183 [Poptr1:94071]

gene model short at N-term

82C like

98% to scaffold_40  (-)  1533682

$

1522560 MDVFYLPFLTNNMTTNPMFLIFIFICSIFWISRKFLAGTGKKKAAPKAGG 1522411

1522410 AWPVIGHLHLLGGAEPPHKVLGNMAEKYGPIFTIKMGVHRALVVSNWETA 1522261

1522260 KECFTTHDKAFSGRPRTLASELLTYDGAMVGFSPYGPYWRQVRKITTVEL 1522111

1522110 LSNYRLEKLKDVRESEVRAFLKELYKLWDENRGSASKSKSNLALVEMKRW 1521961

1521960 FGDLTLNIVLRTIVGKTVGYITNVEDEESVEGWKKGLKDFFHWTGVFSVS 1521811

1521810 DALPFLRFLDLGGHGEAMKKTAKELDLVVEDWLKEHKRKRAAGIVKGKED 1521661

1521660 FMDVMLDVFDNDAEAVQGGDSDTTIKATSL 1521571 (0)

1520770 ALILAASDTTAVTLIWALSLLVNNPNVLKKAQLELDTHVGKERQVEESDV 1520621

1520620 QNLVYLKAVLKETLRLYPAAPLSLPHEAIEDCTIDGYHVPRGTRLLVNVS 1520471

1520470 KIHRDERVWSNPNEFDPERFLTTHRGFDVRGKNFEFSPFGSGRRMCPGVS 1520321

1520320 FALHVMDLALATLLHGFDFATPSGEPVDMHESSGLTNLRATPLEVLLSPR 1520171

1520170 LPSRLYGH* 1520144

>CYP82C11P1

scaffold_7290 (+) 1373-2155

eugene3.72900001|Poptr1

no comment

82C like exon 1 partial seq

100% to scaffold_40  (-)  1522560 duplicate seq

$

1373 MTTNPMFLIFIFICSIFWISRKFLAGTGKKKAAPKAGGAWPVIGHLHLLGGA 1528

1529 EPPHKVLGNMAEKYGPIFTIKMGVHRALVVSNWETAKECFTTHDKAFSGR 1678

1679 PRTLASELLTYDGAMVGFSPYGPYWRQVRKITTVELLSNYRLEKLKDVRE 1828

1829 SEVRAFLKELYKLWDENRG 1885

1886 SASKSKSNLALVEMKRWFGDLTLNIVLRTIVGKTVGYITNVEDEESVEGW 2035

2036 KKGLKDFFHWTGVFSVSDALPFLRFLDLGGHGEAMKKTAK 2155

>CYP82C11P2

scaffold_13620 (-) 1352-2

no model

no comment

82C like 52% to 82C4 no gene model at JGI

97% (3 aa diffs ) to scaffold_40  (-)  1522560 duplicate seq

$

1352 KRAAGIVKGKEDFMDLMLDVFDNDAEAVQGGDSDTTIKATSL 1227 (0)

 217 ALILAASNTTAVTLIWALSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVYLKAVL 38

  37 KETLRLYPAGPL 2

>CYP82C12P1

scaffold_1564 (+) 5393-6497

eugene3.15640002|Poptr1

no comment

82C like missing N-term

91% to LG_IX     (-)  3542415

$

5393 LKGYIGKMKRTARELDFVLGSWVDEHRRIRLNRSINEEEKDFIYVMLSIM 5542

5543 DDNNLSVDEADTTVKATCL 5599 (0)

5869 SLLSGGSDTTTIAVTWALALLLNNRNMLKKAQCELDTHVGKHRQVAETDI 6018

6019 KNLVYLQAIVKETFRLHPPGPL SAPREAMADCTVAGFHIPAGTRLVVNLW 6168

6169 KLHRDPNIWANPLEFQPERFLKEHANLDVRGQDFEFTPFGSGRRMCRCKGSFAK 6330

6330 EVVHLTLARLLHGFELRTVSDTPVDMTESPGLAVPKATPLEVVLRPRLPS 6479

6480 IAYEF* 6497

>CYP82C12P1-de2b

scaffold_1564 (+) 2035-2163

no model

no comment

82C like C-term pseudogene fragment

$

2035 FELRTVSDNPVDMTESPGLTVPKATPLEVVLRPRLPSIAYEF* 2163

>CYP82C12P2

scaffold_18213 (+) 303-1138

eugene3.182130001|Poptr1

no comment

82C like runs off both ends

2 aa diffs to scaffold_1564  (+)     5989 duplicate seq

$

 303 LKGYIGKMKRTARELDFVLGSWVDEHRRIRLNRSINEEEKDFIYVMLSIM 452

 453 DDSNLSVDEADTTVKATCL 509 (0)

 923 SLLSGGSDTTTIAVTWALALLLNNRNMLKKAQCELDTHVGKHRQVAETDI 1072

1073 KNLVYLQAIVKETFRLHPPGPL 1138

>CYP82C13P

scaffold_5479 (+) 1092-2785

fgenesh1_pg.C_scaffold_5479000001|Poptr1

no comment

82C like partial seq

92% to CYP82C9v1

2aa diffs to scaffold_40  0   (-)  1555735

$

1092 ILKIIVSKRYVDYASPGEEKPSDEWRDSLRAFLELSGMFVVSDALPFLRW 1241

1242 LDLGGAEKAMKRTAKNLDHAVEKWLEEHKQKKASGTAKGEEDFMDLMLSV 1391

1392 LDDGKELSNRSADTINKATCL 1454 (0)

2156 TLILAASDTTSVTLTWTLSLLLNNREVLKKAQDELDIYIGRERQVKESDMK 2308

2309 NLVYLQATIKETFRLYPAAPLSVTHESMEECTVGGYHIPAGTRLFTNLSK 2458

2459 IHRDPQVWSDPDEFQPERFLTTHKDCDFRGQHFELIPFGSGRRMCPGVSF 2608

2609 ALQVLNLALATLLHGFDIETLDDAPIDMTETGGLTNIKATPLKALLTPRL 2758

2759 SPGLYDLQ* 2785

>CYP82C14P

scaffold_130 (-) 112070-99249

fgenesh1_pg.C_scaffold_130000005|Poptr1

gene model seems wrong

82C like pseudogene 52% to 82C4

69% to scaffold_2789  (+)     4238

large insertion in exon 1 no good boundary for insertion

other CYP71 clan sequences only have one intron.

$

112070 MELQEITLYALLLGIISLFLSTKYATTNKKKGKMPPEPAGSWPIIGHLHL 111921

111920 LGGANQLLHRTFGVMADKYGPIFSVCHGIRRVLVVSNWEIVKECLATNDM 111771

111770 VFAARPKYLAVKIMGYDHAMLGFAPYGQYWRDMRKLTMVELLSNSRLEML 111621

111620 KHVRDTETKLLLKDLHDRSINTTKKMG 111540

101043 GQVMVEMKEKFGNLAMNIIVRMLAGKRYFGTDTNGDEESRRFQKALGDFF 100894

100893 YLLGLFLVSDAVPFLGWLDFVKGIVGKMKRTATEIDCVFSSWVEDHRRNR 100744

100743 LNGSINEEERDFIHVMLSNLEDGKISAVDTDTAIKGTCL 100627 (0)

 99875 SLILGGHDTTFVTLTWALSLILNNREVLEKAQDELDIQVGKHRQVDETDI 99726

 99725 KNLVYLQAIVKETMRLYPAAPLSAPRQAMEDCTVAGFHIPAGTRLLVNLW 99576

 99575 KLHRDPNIWSNPLEFQPERFLKEHANLDVRGQDFEYVPFGSGRRMCPGIS 99426

 99425 LALQVLHLTLARLLHGFEMGTVSDALIDMSEGPGITIPKETPLEVILRPR 99276

 99275 LHSSLYEC* 99249

>CYP82C15v1

LG_IX (-) 3544141-3542158

fgenesh1_pg.C_LG_IX000559|Poptr1

gene model short at N-term 1 stop, 1 frameshift

82C like 49% to 82C2

98% (6 aa diffs to scaffold_2789 duplicate seq

$

3544141 MKTLIELREISFFALLLAIISVVLATICAKGNK 3544043

3544042 *SGKMPPEVAGSWPVIGHLHLLGRRNQLL 3543956

3543955 HKTLGGMADDYGSIFSIRLGIHPTIVVSDWEIVKECFTANDRVF 3543824

3543824 STRPKSLALKIMGYNQTTFGFAPYGRYWRDMRKLVMVELLSNHRLELLKH 3543675

3543674 VRDTETSLLMKDFYEKSSRNGGQVVVEMKQRLADMATNITVRMISGKRYF 3543525

3543524 SADAKGNQQAKRCQEALRNFFYLVGLNLASDAVPLFSWLDLVKGYIGKMK 3543375

3543374 RTARELDCVLGSWVDEHRRIRLNRSISEEEKDFIHVMLSIMDDSNISVDE 3543225

3543224 ADTTVKATCL 3543195 (0)

3542784 SLLLGGSDTTAIALTWALALLLNNRNMLKKAQCELDTHVGKHREVAETDI 3542635

3542634 KNLVYMQAIVKETFRLHQPAPL SGPREAMEDCTVAGFHIPAGTRLVVNLW 3542485

3542484 KLHRDPNIWANPLEFQPERFLKEHANLDVRGQDFEFTPFGSGRRMCPAVS 3542335

3542334 FAVQVVHLTLARLLHGFELRTVSDTPVDMTESPGLAVPKATPLEVVLRPR 3542185

3542184 LPSIAYEF* 3542158

>CYP82C15v2

scaffold_2789 (+) 2508-4492

estExt_Genewise1_v1.C_27890004|Poptr1

gene model short on N-term

82C like 51% to 82C4

98% to LG_IX   (-)  3542415

$

2508 MKTLIELREISFFALLLAIISVVLATICAKGNK 2606

2607 KSGKMPPEVAGSWPVIGHLHLLGGRNQLL 2693

2694 HKTLGGMADNYGSIFSIRLGIHPTIVVSDWEIVKECFTANDRVFSTRPKS 2843

2844 LALKIMGYNQTTFGFAPYGRYWRDMRKLVMVELLSNHRLELLKHVRDTET 2993

2994 SLLMKDFYEKSSRNGGQVVVEMKQRLADMATNITVRMISGKRYFSADAKG 3143

3144 NQQAKRCQEALRNFFYLVGLNLASDAVPLFSWLDLVKGYIGKMKRTAREL 3293

3294 DCVLGSWVDEHRRIRLNRSISEEEKDFIHVMLSIMDDSNISVDEADTTVKATCL 3455 (0)

3866 SLLLGGSDTTAIALTWALALLLNNRNMLKKAQCELDTHVGKHREVAETDI 4015

4016 KNLVYMQAIVKETFRLHQPAPLSGPREAMEDCTVAGFHIPAGTRLVVNLW 4165

4166 KLHRDPNIWSNPLEFQPERFLKEHANLDVRGQDFEFTPFGSGRRMCPAVS 4315

4316 FAVQVVHLTLARLLHGFELRTVSDNPVDMTESPGLTVPKATPLEVVLRPR 4465

4466 LPSIAYEF* 4492

>CYP82C15v3

scaffold_20448 (+) 647-1056

eugene3.204480001|Poptr1

no comment

82C like

1 aa diff to scaffold_2789  (+)     4238 duplicate seq

$

647 MKTLIELREISFFALLLAIISVVLATICAKGNK 745

746 KSGKMPPEVAGSWPVIGHLHLLGGRNQLL 832

833 HKTLGGMADKYGSIFSIRLGIHPTIVVSDWEIVKECFTANDRVF 964

964 STRPKFLALKIMGYNQTMFGFAPYGRYWRDM 1056

>CYP82C-se1[2]

scaffold_40 (-) 1539510-1539424

no model

no comment

82C like pseudogene no model exists

$

1539510 SGRRMCPGESFAL*VRQLALASLLHGF*F 1539424

>CYP82C-se2[2]

scaffold_40 (-) 1527266-1527180

no model

no comment

82C like pseudogene no gene model at JGI

79% to scaffold_40   (-)  1533682

$

1527266 SGRRMCPGESFAL*VRQLALASLLHGF*F 1527180

>CYP82C-se3[2]

LG_II (-) 16609905-16609795

no model

no comment

82C like heme region, no gene model exists

67% to scaffold_40   (-)  1555735

$

16609905 EEFAITRKDLEVRGQSFELLPLGSGRKMCPGVSFALK 16609795

>CYP82C-se4[2]

LG_X (-) 7735686-7735582

no model

no comment

82C like 65% to scaffold_40     (-)  1598233

68% to 82C4 C-helix region probable pseudogene

$

7735686 AVKCLSYNFAVFSFAPQGPYWREMRKIAITELLSN 7735582

>CYP82C-se5[2]

scaffold_7045 (+) 1877-1981

no model

no comment

82C like pseudogene

C-helix region 68% to 82C4

100% to LG_X    (-)  7735674

65% to scaffold_40     (-)  1598233

$

1877 AVKCLSYNFAVFSFAPQGPYWREMRKIAITELLSN 1981

>CYP82D2

scaffold_40c (-) 1542721-1540989

eugene3.00400207 [Poptr1:591862]

gene model correct

82C like 50% to 82C4

58% to 82D1, 55% to scaffold_40     (-)  1598233

$

1542721 MDILLPYLSTIIPTAIVLFSCYLLRRSKSSKTKLAPEASGAWPIIGHLPL 1542572

1542571 LAGAELPHLRLGALADKYGPIFTIRIGMYPALVVSSWELAKELFTTNDAI 1542422

1542421 VSSRPKLTASKILGYNFASFGFSPYGEFFRGIRKIVASELLSNRRLELLK 1542272

1542271 HVRASEVEVSVKELYKLWYSKDKNEESQILVNIKQWTADMNLNLMLRMIA 1542122

1542121 GKRYDDAGIVTEENEARRCQRAMREFFHLTGLFVLRDAVPFLGWLDWGGY 1541972

1541971 EKAMKRNAEELDNIFDEWLAEHRRKRDSGESANKEQDFMDVMLYALDGIN 1541822

1541821 LAGYDADTVRKATSL 1541777 (0?)

1541621 SLIIGGTDTVTVTITWALSLLLNNTVALKSAQEELDVHVGKERL 1541490

1541489 VNESDIEKLTYLQACVKEALRLYPAGPLGGFREFTADCTIGGYYVPAGTR 1541340

1541339 LLLNIHKIQRDPRVWPNPTEFKPERLLGSHKAVDVMGQHFELIPFGAGRR 1541190

1541189 ACPGATLGLRMSHLVLASILQAFEISPPSNAPIDMTGTAGLTCSQATPLQ 1541040

1541039 VLVKPRLPASVYEYRF* 1540989

>CYP82J1

LG_I (-) 23341018-23339071

eugene3.00012095 [Poptr1:549654]

gene model short at N-term

82C like 50% to 82C2

51% to scaffold_40  (-)  1598233

$

23341018 MDFSFHLLAVSTVLALVLWYTLRRVRETRRKTEKGLQPPEPSGALPLIGH 23340869

23340868 LHLLGAQKTLARTLAAMADKYGPIFTIRLGKHPTVVVSNLEAIKECFTTH 23340719

23340718 DRILSSRPRSSHGEHLSYNYAAFGFNNSGPFWREMRKIVTIQLLSSHRLK 23340569

23340568 SLRHVQVSEVNTLINDLYLLSKSNKQGSTKIDISECFERM TINMITRMIA 23340419

23340418 GKRYFSSTEAEKEDEGKRIGKLMKEFMYISGVFVPSDVIPFLGWMNNFLG 23340269

23340268 SVKTMKRLSRELDSLMESWIQEHKLKRLESTENTNKMEDDDFIDVMLSLL 23340119

23340118 DDSMFGYSRETIIKATAM 23340065 (0)

23339700 TLIIAGADTTSITLTWILSNLLNNRRSLQLAQEELDLKVGRERWAEDSDI 23339551

23339550 GNLVYIQAIIKETLRLYPPGPLSVPHEATKDFCVAGYHIPKGTRLFANLW 23339401

23339400 KLHRDPNLWSNPDEYMPERFLTDHANVDVLGHHFELIPFGSG RRSCPGIT 23339251

23339250 FALQVLHLTFARLLQGFDMKTPTGESVDMTEGVAITLPKATPLEIQITPR 23339101

23339100 LSPELYYEC* 23339071

>CYP82J1P

LG_I (-) 23611288-23610335

eugene3.00012097 [Poptr1:549656]

model short

82C like

100% to LG_I          (-) 23339331 duplicate seq, assembly error?

$

23611288 MDFSFHLLAVSTVLALVLWYTLRRVRETRRKTEKGLQPPEPSGALPLIGH 23611139

23611138 LHLLGAQKTLARTLAAMADKYGPIFTIRLGKHPTVVVSNLEAIKECFTTH 23610989

23610988 DRILSSRPRSSHGEHLSYNYAAFGFNNSGPFWREMRKIVTIQLLSSHRLK 23610839

23610838 SLRHVQVSEVNTLINDLYLLSKSNKQGSTKIDISECFERMTINMITRMIA 23610689

23610688 GKRYFSSTEAEKEDEGKRIGKLMKEFMYISGVFVPSDVIPFLGWMNNFLG 23610539

23610538 SVKTMKRLSRELDSLMESWIQEHKLKRLESTENTNKMEDDDFIDVMLSLL 23610389

23610388 DDSMFGYSRETIIKATAM 23610335 (0)

>CYP82J2P

scaffold_173 (+) 109052-112871

eugene3.01730007|Poptr1

gene model wrong

82C like pseudogene

first part 76% to LG_I (-) 23339331, second part 60%

$

109052 SLKIATSEWLQGITINMITRIIAGKRYFSSAKAENEEGKRTGKLMKEFMI 109201

109202 ISGVFVPSDLIPFLGWINNFLGSMKNIKIPSRELDSLMESWI 109327

109359 EDFGDVLLSTKDDCMFGHSREIIF*ATAV 109445 (0)

109992 TLFLAGADTISLTLTWISSNLLNNRRSLQLAQEEQDLKSWQ 110114

110114 EDSDIENLKYIQAIAK 110161

110163 ETLRLYPTAPMSIPQEAIEDCCIGRX 110237

110241 HIPKCTRLFVNLWKLAS 110291

110313 LDGYTPERFLTDQANFEILDQHFMFKPIRSG 110405

112710 QLLHLTLARLLQRFSMTTSMDGTIDITEGLGITLPKANLLEIIIIPRLAS 112859

112860 ILNF 112871

>CYP82K1

LG_XVI (-) 168971-167389

fgenesh1_pg.C_LG_XVI000029|Poptr1

gene model seems correct

82C like 49% to 82C4

55% to scaffold_40     (-)  1598233

$

168971 MIIWRILSTSHKRNKTLPPPEPSGAWPLIGHLRILNSQIPFFRILGDLAV 168822

168821 KHGPVFSIRLGMRRTLVISSWESVKECFKTNDRKFLNRPSFAASKYMGYD 168672

168671 DAFFGFHPYGEYWLEMRKIATQELLSNRRLELLKHVRVSEIETCIKELHT 168522

168521 TCSNGSVLVDMSQWFSCVVANVMFRLIAGKRYCSGIGKDSGAFGRLVREF 168372

168371 FYLGGVLVISDLIPFTEWMDLQGHVKSMKRVAKELDHVVSGWLVEHLQRR 168222

168221 EEGRVRKEEKDFMDVMLESLAVGDDPIFGYKRETIVKATAL 168099 (0)

168015 NLILAGTDTTSVTLTWALSLLLNHTEVLKRAQKEIDVHVGTTRWVEESDI 167866

167865 KNLVYLQAIVKETLRLYPPGPLLVPRESLEDCYVDGYLVPRGTQLLVNAW 167716

167715 KLHRDARIWENPYEFHPERFLTSHGSTDVRGQQFEYVPFGSGRRLCPGIS 167566

167565 SSLQMLHLTLSRLLQGFNFSTPMNAQVDMSEGLGLTLPKATPLEVVLTPR 167416

167415 LENEIYQH* 167389

>CYP82L1

LG_IV (+) 8826205-8827922

estExt_Genewise1_v1.C_LG_IV4159|Poptr1

gene model seems correct

82G like 55% to 82G1

82% to scaffold_142    (-)   531695

$

8826205 MILEALILVFLYGFWKILARNSEGKKSTRAPEPSGAWPLFGHLPSLVGKD 8826354

8826355 PACKTLGAIADKYGPIYSLKFGIHRTLVVSSWETVKDCLNTNDRVLATRA 8826504

8826505 GIAAGKHMFYNNAAFALAPYGQYWRDVRKLATLQLLSNQRLEMLKHVRVS 8826654

8826655 EVDTFIKGLHSFYAGNVDSPAKVNISKLLESLTFNINLRTIVGKRYCSST 8826804

8826805 YDKENSEPWRYKKAIKKALYLSGIFVMSDAIPFLEWLDYQGHVSAMKKTA 8826954

8826955 KELDAVIRNWLEEHLKKKIDGELGSDRESDFMDVMISNLAEGPDRISGYS 8827104

8827105 RDVVIKATAL 8827134 (0)

8827302 ILTLTGAGSTATTLVWTLSLLLNNPTVLKAAQEELDKQVGRERWVEESDI 8827451

8827452 QNLKYLQAIVKETLRLYPPGPLTGIREAMEDCSIGGYDVPKGTRLVVNIW 8827601

8827602 KLHRDPRVWKNPNEFKPDRFLTTHADLDFRGQNMEFIPFSSGRRSCPAIN 8827751

8827752 LGLIVVHLTLARILQGFDLTTVAGLPVDMIEGPGIALPKETPLEVVIKPR 8827901

8827902 LGLELY* 8827922

>CYP82L2

scaffold_142 (-) 531878-529641

eugene3.01420074|Poptr1

gene model seems correct

82G like 55% to 82G1

82% to LG_IV   (+)  8827671

$

531878 MILGALVLLILYGFWKTLARERESKKLARAPEPSGAWPVIGHLPRLRGQD 531729

531728 PACKTLAAIADKYGPIYSLRLGSHRIVVVSSWETVKDCLTTNDRILATRA 531579

531578 NIAAGKHMGYNNAAFALSPYGKYWRDVRKLVTLQLLSNHRLEMLKHVRVL 531429

531428 EVDAFIKGLHNSYAETAEYPAKVTMSKLFESLTFNISLRTIVGKRYCSSL 531279

531278 YDKENSEPWRYKKAIEKALYLSGIFVMSDAIPWLEWIDFQGHISAMKRTA 531129

531128 KELDAVIGSWLEEHLKKEIQGESDFMDVIISNLADGAAEMSGYSRDVVIK 530979

530978 ATTL 530967 (0)

530264 ILTLTGAGSTAVTLTWALSLLLNHPSVLKAAQEELDKQVGREKWVEESDI 530115

530114 QNLMYLQAIVKETLRLYPPGPLTGIREAMEDCHICGYYVPKGTRLVVNIW 529965

529964 KLHRDPRVWKNPDDFQPERFLTTHADLDFRGQDFEFIPFSSGRRSCPAIN 529815

529814 LGMAVVHLTLARLLQGFDLTTVAGLPVDMNEGPGIALPKLIPLEAVIKPR 529665

529664 LGLPLYN* 529641

 

>CYP83F1-se1[1]

LG_II (-)1594296-1594132

no model

no comment

83F pseudogene N-term fragment

100% to CYP83F1v1

$

1594296 MALLIFVILFLSIIFLFLLKKNKISKRACFPPGPNGLPLIGNLHQLDSSNLQTQL 1594132

>CYP83F1-se2[1]

LG_II (-) 1597238-1596704

no model

no comment

83F like no gene model exists 48% to 71A25

3aa diffs to 83F1 probable duplicate

$

1597238 MALIIFVILFLSIIFLFLLKKNKISKRACFPPGPNGLPLIGNLHQLDSSN 1597089

1597088 LQTQLWKLSQKYGPLMSLKLGFKRTLVVSSAKMAEEVLKTHDLEFCSRPL 1596939

1596938 LTGQQKFSYNGLDVAFSPYGAYWREMKKICVVHLLNSTRVQ 1596816

1596811 SFRTNREDEVSHMIEKISKAALASKPFNLTEGMLSL 1596704

>CYP83F1v1

LG_II (-) 1617938-1616292

fgenesh1_pg.C_LG_II000227 [Poptr1:346721]

gene model seems correct

83A like 53% to 83A2

$

1617938 MALLIFVILFLSIIFLFLLKKNKISKRACFPPGPNGLPLIGNLHQLDSSN 1617789

1617788 LQTQLWKLSQKYGPLMSLKLGFKRTLVISSAKMAEEVLKTHDLEFCSRPL 1617639

1617638 LTGQQKFSYNGLDLAFSPYGAYWREMKKICVVHLLNSTRVQSFRTNREDE 1617489

1617488 VSHMIEKISKAALASKPFNLTEGMLSLTSTAICRTAFGKRYEDGGIEGSR 1617339

1617338 FLALLNETEALFTMFFLSDYFPYMGWVDRLTGRAHRLEKNFREFDVFYQQ 1617189

1617188 IIDEHLDPERPKPDHEDILDVLLQIYKDRTFKVQLTLDHIKAILM 1617054 (0)

1616921 NIFVGGTDTAAATVIWAMSLLMKNPEAMRKAQEEVRKVIGDKGFVYED 1616778

1616777 DVQQLPYLKAVVKETMRLQPTAPLLVPRETTTECNIGGYEIPAKTLVYVN 1616628

1616627 AWAIGRDTEVWENPYVFIPDRFLGSSIDLKGQDFELIPFGAGRRICPGIY 1616478

1616477 MGIATVELSLSNLLYKFDWEMPGGMKREDIDVDHTQPGLAMHTRDALCLV 1616328

1616327 PKAYAVMGNDA* 1616292

>CYP83F2-se1[1]

LG_II (+) 1630135-1630206

no model

no comment

CYP83F N-term fragment

$

1630135 MALSDFLILSVPIFLLFLLIKRNK 1630206

>CYP83F2-se2[2]

LG_II (+) 1650845-1651086

no model

no comment

83F like pseudogene no model exists 42% to 71B14

$

1650845 RETKECYLGGYEIPTKTLVYVSAWAVGR 1650928

1650929 FLGSSIDLKGNDFELRPFGASRRICPGI 1651012

1651015 ANLLHIFVWEMPSVVNREEIDIDD 1651086

>CYP83F2

LG_II (+) 1655600-1657684

eugene3.00020232 [Poptr1:550917]

gene model seems correct

83A like 48% to 83A2

$

1655600 MALFDFLILSVPIFLLFLLIKRNKTTKKACLPPGPDGLPFIGNLHQLGNS 1655749

1655750 NLHQYLWKLSQKHGPLVYLRLGFKPALIVSSAKMAREILKTHDLEFCSRP 1655899

1655900 ALTVMKKFSYNGLDLALAPYGAYWREVKKICVVRVFSSIRAQSFRPIRED 1656049

1656050 EVSRMIENISKSALASKPFNLTEELVSLTSTTICRVAFGKRYEIGGSDKN 1656199

1656200 RFLELLHEIQAMVSSFFLSDYFPCLGWLVDKLTGLSYRLEKSFKEFDAFF 1656349

1656350 KGIIDDKLDPNRPKPEREDTILDFLLQIYKDGSFKVQLTLDHIKAILM 1656493 (0)

1657037 DIFLAGTDTSAVTMNWAMTFLMKNPKAMRKAQEEVRNLFGNKGFVH 1657174

1657175 EDDVQQLPYLKAVVKETMRLQPTAPLLIPRETTKECCVGGYEIPAKTLVY 1657324

1657325 VSAWAVGRDPEAWENPYEFNPDRFLGSSIDLKGNDFELIPFGAGRRICPG 1657474

1657475 IFIALATVELSLANLLHKFDWEMPSGVEDIDMDDVLPGLVPHMRDALCLV 1657624

1657625 PKFVCDGETGHKGTAVHDY* 1657684

>CYP83F2-se3[2]

LG_II (+) 1667099-1667266

eugene3.00020233 [Poptr1:550918]

no comment

83F like pseudogene 100% to 1702772

$

1667099 QRNKECYLGGYEIPTKTLVYVSAWAVGR 1667182

1667183 FLGSSIDLKGNDFELRPFGASRRICPGI 1667266

>CYP83F2-se4[1]

LG_II (+) 1671977-1672045

no model

no comment

CYP83F N-term fragment

$

1671977 MALLDFLILSVPIFLLFLLIKRN 1672045

>CYP83F2-se5[1]

LG_II (+) 1685541-1685612

no model

no comment

CYP83F N-term fragment

$

1685541 MALSDFLILSVPIFLLFLLIKRNK 1685612

>CYP83F3v3

LG_II (+)  1688396-1689904

eugene3.00020236 [Poptr1:550921]

join with eugene3.00020237 [Poptr1:550922]

same gene 95% to 83F3v1

95% to 83F3v1

$

1688396 YEIGGSDKNRFLELLDESQAMASSFFLSDYFPCLGWLVDKLTGLSYRLEK 1688545

1688546 SFKEFDAFYKGIIDDNIDPNRPKPEREDTILDFLLQIHKEGSFKVQLTLD 1688695

1688696 HIKAILT 1688716 (0)

1689257 DIFLAGTDTGAVTVIWAMTFLMKNPKAMRKAQEEVRNLFGNKGFVH 1689394

1689395 EDDVQQLPYLKAVVKETMRLQPPAPLLLPRETTKQCYVGGYEIPAKTLVY 1689544

1689545 VSAWAVGRDPEAWENPYEFNPDRFLGSSIDLKGNDFELIPFGAGRRICPG 1689694

1689695 IFIALATVELSLANLLHKFDWEMPSGVEDIDMDDVLPGIVPHMRDALCLV 1689844

1689845 PKLVCDGEMGHKGTGAHDY* 1689904

>CYP83F3-se1[2]

LG_II (+) 1697711-1697881

no model

no comment

83F like pseudogene no gene  model exists

nearly same seq as above

$

1697711 RETTKECYLGGYEIPTKTLVYVSAWAVGR 1697797

1697798 FLGSSIDLKGNDFELRPFGASRRICPGI 1697881

>CYP83F3-se2[2]

LG_II (+) 1702691-1702858

no model

no comment

83F like pseudogene no gene model exists

almost 90% to 83F2 with one deletion of 15 aa

$

1702691 QRNKECYLGGYEIPTKTLVYVSAWAVGR 1702774

1702775 FLGSSIDLKGNDFELRPFGASRRICPGI 1702858

>CYP83F3v1-de1b

LG_II (+) 1707953-1708189

eugene3.00020238 [Poptr1:550923]

N-term only may be an assembly error

83F like 100% to 83F2

$

1707953 MALFDFLILSVPIFLLFLLIKRNKTTKKACLPPGPDGLPFIGNLHQLGNS 1708102

1708103 NLHQYLWKLSQKHGPLVYLRLGFKPALIV 1708189 (sequence gap)

>CYP83F3v1

LG_II (+) 1708840-1710924

eugene3.00020239 [Poptr1:550924]

gene model seems correct

83A like 48% to 83A2

$

1708840 MALSDFLILSVPIFLLFLLIKRNKTTKKACLPPGPDGLPFIGNLHQLGNS 1708989

1708990 NLHQYLWKLSQKHGPLMHLRLGFKPALIVSSAKMAREILKTHDLEFCSRP 1709139

1709140 ALTATKKMTYNGLDLAFAPYGAYWREVKKICVVRVFSSIRAQSFRPIRED 1709289

1709290 EVSRMIENISKSALASKPFNLTEELVSLTSTTICRVAFGKRYEIGGSDKN 1709439

1709440 RFLELLHEIQAMASSFFLSDYFPCLGWLVDKLTGLSYRLEKSFKEFDAFY 1709589

1709590 KGIIDDNIDPNRPKPEREDTILDFLLQIYKEGSFKVQLTLDHIKAILM 1709733 (0)

1710277 DIFLAGTDTSAVTMNWAMTFLMKNPKAMRKAQEEVRNLFGNKGFVD 1710414

1710415 EDDVQQLPYLKAVVKETMRLQPTAPLLIPRETTKECCVGGYEIPAKTLVY 1710564

1710565 VSAWAVGRDPEAWENPYEFNPDRFLGSSIDLKGNDFELIPFGAGRRICPG 1710714

1710715 IFIALATVELSLANLLHKFDWEMPSGVEDIDMDDVLPGLVPHMRDALCLV 1710864

1710865 PKLVCDGEIGHKGTAVHDY* 1710924

>CYP83F3v2

scaffold_16122 (-) 1221-481

fgenesh1_pg.C_scaffold_16122000001|Poptr1

exon 1 runs off end

83A like 45% to 83A2

3aa diffs to LG_II (+)  1708800-1710800, possible duplicate

$

1221 LHQYLWKLSQKHGPLMHLRLGFKPALIVSSAKMAREILKTHDLEFCSRPA 1072

1071 LTATKKMTYNGLDLAFAPYGAYWREVKKICVVRVFSSIRAQSFRPIREDE 922

 921 VSRMIENISKSALASKPFNLTEELVSLTSTTICRVAFGKRYEIGGSDKNR 772

 771 FLELLDESQAMASSFFLSDYFPCLGWLVDKLTGLSYRLEKSFKEFDAFYK 622

 621 GIIDDNIDPNRPKPEREDTILDFLLQIHKEGSFKVQLTLDHIKAILT 481 (0)

>CYP83F3-se3[2]

scaffold_16034 (+) 2-547

fgenesh1_pg.C_scaffold_16034000001|Poptr1

no comment

83F like C-term

94% to CYP83F3v1

$

2 LRIPIWNKGFVDDDDVQQLPYLKAVVKETMRLQPTAPLLLPRETTKECYL 151

152 GGYEIPAKTLVYVSAWAVGRDPKAWENPYEFNPDRFLGS 268

269 SIDLKGNDFELIPFGAGRRICPGIFIALATVELSLANLLHKFDWEMPSG 415

416 VEDIDMDDVLPGLIPHMRDALCLVPKLVCDGKMGHKGTGAHDY* 547

>CYP83F4

scaffold_1594 4660-3013

eugene3.15940001|Poptr1

gene model correct

53% to 83A2/83B1 1 intron

$

4660 MALLIFVILFLSIIFLFLLKKNKISKRARFPPGPNGLPLIGNLHQLDSSN 4511

4510 LQTHLWKLSQKYGPLMSLKLGFKRTLVISSAKMAEEVLKTHDLEFCSRPL 4361

4360 LTGQQKFSYNGLDLAFSPYGAYWREMKKICVVHLLNSTRVQSFRTNREDE 4211

4210 VSHMIEKISKAALASKPFNLTEAMLSLTSTAICRTAFGKRYEDGGIQGSR 4061

4060 FHALLNETQALFTMFYLSDYFPYMGWVDRLTGLAHRLEKNFREFDVFYQE 3911

3910 IIDEHLDPERPKPDHEDILDVLIQIYKDRTFKVQLTLDHIKAILM 3776 (0)

3642 NIFVGGTDTAAATVIWAMSLLMKNPEAMRKAQEEVRKVIGDKGFVYED 3499

3498 DVQQLPYLKAVVKETMRLQPTAPLLIPRETTTECNIGGYEIPAKTLVYVN 3349

3348 AWAIGRDTEVWENPYVFIPDRFLGSSIDLKGQDFELIPFGAGRRICPGIY 3199

3198 MGIATVELSLSNLLYKFDWEMPGGMKREDIDVVHTQPGLAMRTRDALCLV 3049

3048 PKAYAVMGNDA* 3013

>CYP83F4-de2b

scaffold_1594 10925-10809

no model

no comment

C-terminal duplication of CYP83A no gene model

$

10925 GGMKREDIDVVHTQPGLAMHTRDALCLVPKAYAVMGNAA 10809

>CYP83F5

LG_V (-) 16417765-16416052

fgenesh1_pg.C_LG_V001516|Poptr1

two genes fused, or extra exon at C-term end internal intron boundary wrong, frameshift

83A like 50% to 83A2

$

16417765 MAMFFFLGAFFIFVLFLLQTYRTKRKILLPPGPYGLPLIGNLHQFVQYKS 16417616

16417615 PPHHYLWQLSHKYGPLMSLRRGFVPTLVVSSAKMAKEVMGKHYLEFSGRP 16417466

16417465 SLHGQQKLSYNGLDLAFTPYGDYWREMRKICVLRLFNLKRVQSFHSIREN 16417316

16417315 EVSCMIQKIRKAADASRTANLSEAVTALTSFIVCRVAFGKSYEDQGSERS 16417166

16417165 KFHNLLNEAQAMAASLFVSDYLPFMGWIDKLTGLMARLEKNFSEFDVFYQ 16417016

16417015 EIIDEHLDPKRTKPEKEDIIDVLLRLKKERSFAFDLNRDHIKAVLM 16416878 (0)

16416745 NI 16416740

16416735 FVAGTDTSAGTLEWAMTALMKEPRVMNKVQEEVRNLVGDRKLVKEDDLLR 16416586

16416585 LPCLKAVVKETWRLHPAAPLLLPRETIQNCNIDGYDIPARTLVFVNAWAI 16416436

16416435 GRDPEAWEIPEEFYPERFFGKSVDFKGQDYELIPFGTGRRGCPGIHMGAV 16416286

16416285 TVELALANLLYNFDWEMPQGLKAEDIDMDVLPGLSTHKKNALCALCLGTI 16416136

16416135 FIYQVFDVVMYYTEPYQSVSFYPHKQG* 16416052

>CYP83F5-de2bv1

LG_V (-) 16414413-16413906

no model

no comment

83F like pseudogene exon 2 missing PERF motif

77% to CYP83F3v1

$

16414413 DIVLGGTGQKHLLLLLMGHDLSMKNPEAMKKAQEEEVRIFSGKER 16414279

16414277 FANEDDVQQLPYLKAVVKENMRSQPPAPL 16414191

16414190 LNGYEIPAETLVYVNAWAIRRDPKAWKNPFELSSTDLKGSDFELIPFGAG 16414041

16414040 RRICPGIFIGLATVELSLANLLHKFDWEMPSGTLMMCSPVLFLA* 16413906

>CYP83F5-de2bv2

scaffold_2741 (-) 1250-743

fgenesh1_pg.C_scaffold_2741000001|Poptr1

100% match to LG_V  (-) 16414413

83F like pseudogene 65% to 83F2 duplicate seq

$

1250 DIVLGGTGQKHLLLLLMGHDLSVKNPEAMKKAQEEEVRIFSGKER 1116

1114 FANEDDVQQLPYLKAVVKENMRSQPPAPL 1028

1027 LNGYEIPAETLVYVNAWAIRRDPKAWKNPFELSSTDLKGSDFELIPFGAG 878

 877 RRICPGIFIGLATVELSLANLLHKFDWEMPSGTLMMCSPVLFLA* 743

 

>CYP84A10

scaffold_57 (-) 1038584-1035782

eugene3.00570124|Poptr1

gene model short add 12 aa to N-term

84A like 76% to 84A1

91% to LG_VII (+) 11484731, 66% to LG_IX  (-)  2646866

80% to AY621153.1   Camptotheca acuminata

79% to AF139532 Liquidambar styraciflua aldehyde 5-hydroxylase

$

1038584 MDSLLQSLQTLPMSFFLIIISSIFFLGLISRLRRRSPYPPGPKGFPLIGSMHLMDQLTHRGL 1038399

1038398 AKLAKQYGGLFHMRMGYLHMVAVSSPEVARQVLQVQDNIFSNRPANIAIS 1038249

1038248 YLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDEVDSMVK 1038099

1038098 TVESNIGKPVNVGELIFTLTMNITYRAAFGAKNEGQDEFIKILQEFSKLF 1037949

1037948 GAFNISDFIPWLGWIDPQGLTARLVKARKALDKFIDHIIDDHIQKRKQNN 1037799

1037798 YSEEAETDMVDDMLTFYSEETKVNESDDLQNAIKLTRDNIKAIIM 1037664 (0)

1036402 DVMFGGTETVASAIEWAMAELLKSPEDIKRVQQELADVVGLERRVEESDF 1036253

1036252 DKLTFFKCTLKETLRLHPPIPLLLHETSEDAEVAGYYVPKKTRVMINAYA 1036103

1036102 IGRDKNSWEDPDSFKPSRFLEPGVPDFKGNHFEFIPFGSGRRSCPGMQLG 1035953

1035952 LYALDLAVAHLLHCFTWELPDGMKPSELDMTDMFGLTAPRATRLVAVPRK 1035803

1035802 RVVCPL* 1035782

>CYP84A11

LG_VII (+) 11484731-1486533

eugene3.00071182|Poptr1

gene model correct

84A like 73% to 84A1

$

11484731 MDSLVQSLQASPMSFFLIAITSLFFLGLLSRLRRRLPYPPGPKGLPLVGS 11484880

11484881 MHMMDQITHRGLAKLAKQYGGLFHMRMGYLHMVTVSSPEIARQVLQVQDN 11485030

11485031 IFSNRPANIAIRYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESW 11485180

11485181 ESVRDEVDSMLKTVEANIGKPVNLGELIFTLTMNITYRAAFGAKNEGQDE 11485330

11485331 FIKILQEFSKLFGAFNMSDFIPWLGWIDPQGLSARLVKARKALDKFIDSI 11485480

11485481 IDDHIQKRKQNNFSEDAETDMVDDMLAFYSEEARKVDESDDLQKAISLTK 11485630

11485631 DNIKAIIM 11485654 (0)

11485913 DVMFGGTETVASAIEWVMAELMKSPEDQKRVQQELADVVGLER 11486041

11486042 RVEESDIEKLTFLKCALKETLRMHPPIPLLLHETSEDAEVAGYFIPKQTR 11486191

11486192 VMINAYAIGRDKNSWEDPDAFKPSRFLKPGVPDFKGNHFEFIPFGSGRRS 11486341

11486342 CPGMQLGLYTLDLAVAHLLHCFTWELPDGMKPSELDMTDMFGLTAPRATR 11486491

11486492 LVAVPSKRVLCPL* 11486533

>CYP84A12

LG_IX (-) 2646866-2644256

fgenesh1_pg.C_LG_IX000422|Poptr1

gene model correct

84A like 69% to 84A1

68% to LG_VII (+) 11484731, 83% to pseudogene LG_IV (+) 15006407

$

2646866 MDSPLLQSLQSPSTLFILASLFVSLILWFLIRKKLPYPPGPKGYPIIGNL 2646717

2646716 GMVDQLTHRGLASLSKRYGGLCHLQMGGLHVVAVSTPEIAREVLQAQDVV 2646567

2646566 FANRPANVAIVYLTYDRADMAFANYGPFWRQTRKICVMKLFSRKRAESWA 2646417

2646416 SVRDEVEFTVRRVSEKTGEPVNIGELVFALTRSITYKAAFGSSSNEGQEE 2646267

2646266 FMEILQEFSKLFGAFNVADFFPWLGWVNAQDFNKRLAKARNSLDGFIDTI 2646117

2646116 IDEHIAKKNNTKSLNAKDENEEVDSDMVDELLAFYSEDASKNDFDESRST 2645967

2645966 VKFNKDHIKALIM 2645928 (0)

2644876 DVMFGGTETVASAIEWAIAELMKSPEDLKKVHQEL 2644772

2644771 MDVVGLNRTVHESDLEKLIYLKCAMKETLRLHPPIPLLLHETAKDTVLNG 2644622

2644621 YRIPARSRVMINAWAIGRDPNAWEDPDKFNPSRFLDGKAPDFRGMDFEFL 2644472

2644471 PFGSGRRSCPGMQLGLYALELAVAHLLHCFNWELPHGMKPAELDMNDVFG 2644322

2644321 LTAPRAVRLVAVPTYRLNCPL* 2644256

>CYP84A13P

LG_IV (+) 15006407-15008324

fgenesh1pg.C_LG_IV001352|Poptr1

gene model wrong, missing C-term multiple frameshifts

84A like pseudogene 65% to 84A1

$

15006407 MDSLQSLQISPMLFFILVSLSVSIIVLIPMRKKLPYPPGPRGYPIIGNMGMMDQLTHRG 15006583

15006584 LARLSRQYGGLCHLQMRGLHVVVVSTPEIAREVLQVQDIVFANRPANVAI 15006733

15006734 VYLTYDRADLGCANYGSFWCQMRKVCVMKLFSRKRAESWASVRDEVEFII 15006883

15006884 RQVLKKTGEPVNIGELVFALTRSITYKAAFGSSPNEG 15006994

15006995 QEEFVSILQEFSKLFGAYNVADFFPWLGWIHARDFNKRLAKAGN 15007127

15007170 SLDGFIETIIDEHLIKKKTSESLNSKDENEEVDTDMVDELLAFYSEDASK 15007319

15007320 NNFDESKSTIKFNKDNIKALIM 15007385 (0)

15008002 DVMFGGTETVASAIERAVAELMKSPDDLKRVQQELEDVVGFNRKVHESDLE 15008154

15008156 LTYLKCAMKETLRLHPPIPLLLHETAED 15008239

15008241 YTILNGYRVPARSRVMINAWAIGRDPNA 15008324

 

>CYP89A11

LG_XIIIa (-) 6605099-6603552

fgenesh1_pg.C_LG_XIII000744|Poptr1

no introns

60% to 89A5

78% to LG_XIII    (-) 6638846

grail3.0055004201|Poptr1 same gene as above join

$

6605099 MEIWFLILVSLSLSAFLIAFFNLFFPCKTHKLPPGPLAFPIIGNILWLSK 6604950

6604949 SFADLEPTLRSLTQKLGPMVTLHIFSRPAIFISDRSLGSQALILNGSVFG 6604800

6604799 NRPSALATSRVLNSNQQTISSSFYGPTWRLLRRNLTSEILHSSRVKTFGH 6604650

6604649 ARKWVLQILKNQFDLLSRSGDPVRVVDHVQFAMFCLLVLMCFGDKLEEKQ 6604500

6604499 VKEIERVERRMIENMRRFNILNFWPSLSKIVLRKQWAEFLQLRKDQEDVI 6604350

6604349 IPLIRARKKLKEEKLGKSNVEGKKDEYVVSYVDTLLDLQLPGEKRKLNEI 6604200

6604199 EMVTLCIEFLAAGVDTTTTALKWIMANLVKYPQIQEKLFSEMKEVVGEGE 6604050

6604049 GEVKEDDLQKMPYLKAIILEGLRRHPPGHFVLPHAVTEDTVLGGYLIPKN 6603900

6603899 GTVNFMVADMGWDPKVWEDPMAFKPERFLNGEGEAFDITGSREIKMMPFG 6603750

6603749 V*RRICPGYGLAMLHLEYFVANLVWNFEWKAVDGDVIDLSEKQQLAVTMK 6603600

6603599 NPLHAHISRRSRSKV* 6603552

>CYP89A14P

LG_XV (+) 7140835-7141622

eugene3.00150747|Poptr1

gene model wrong probable pseudogene

89A like 80% to LG_XIII  (-) 6605099

$

7140835 LANLVKYQEIQEKLLLEIKGAAGDGD 7140912

7141171 G*KRHPPSHFALPHAVTEDTMLNE 7141242

7141242 IIFMAADMGWDPNVWEDPMAFEPERFLNSSGGEASDITGSREIKR 7141376 (0)

7141581 MTPFGVGRRMCPGY 7141622

>CYP89A12

LG_XIIIb (-) 6638846-6637305

grail3.0055004301|Poptr1

gene model correct no introns

63% to 89A5

97% to LG_XIII    (-) 6648270

$

6638846 MEIWLLVLISLSLCAFLKALFNHVFLSQTHNLPPAPFTFPVIGNILWIRK 6638697

6638696 STSELERAIRSLNQKLGPMVTLHMGSRPAIFIADRSLAYIALIQKGAVFA 6638547

6638546 NRPPAPATSRVLGSNQHNINSSFYGPTWRLLRRNLTSEILHPSRVKTFGH 6638397

6638396 ARKWVLNILMNQFKLLSKSGDPVRVVDHFQYAMFCLLVFMCFGDKLEVKQ 6638247

6638246 IQEIEQVQRRMVVNISRFNILNFWPSLSKIVLRKRWAEFLQLHKDQEDVI 6638097

6638096 LPLIRARKKLKEQRLRKLNMEENKDDYVLSYVDTLLDLQLPDEKRKLNDL 6637947

6637946 EIVSLCNEFLNGGTDTTTTALQWILANLVKHPQIQEKLLLEIKEVVGEGE 6637797

6637796 EVVKEDDLQKMPYLKAIILEGLRRHPPARMVLPHAVTEDTVLGGFLVPKN 6637647

6637646 GTVNFLVADIGWDSKAWEDPMAFKPERFLNSEREAFDITGSREIKMMPFG 6637497

6637496 AGRRICPGYGLAMLHLEYFVANLILNFEWKAVDGDDIDLSEKQELTIVMK 6637347

6637346 NPLRAHLSRRVAS* 6637305

>CYP89A13

LG_XIIIc (-) 6648270-6646729

eugene3.00130759|Poptr1

gene model correct no introns

63% to 89A5

$

6648270 MEIWLLVLISLSLCAFLKALFNHVFLSQTHNLPPAPFTFPVIGNILWIRK 6648121

6648120 STFELERTIRSLNQKLGPMVTLHMGSRPAIFIADRSLAYIALIQKGAVFA 6647971

6647970 NRPPAPATSRVLGSNQHNISSSFYGPTWRLLRRTLTSEILHPSRVKRFGH 6647821

6647820 ARKWVLNILMNQFKLLSKSGDPVCVVDHLQYAMFCLLVFMCFGDKLEVKQ 6647671

6647670 IQEIEQVQRRMVVKLSRFNILNFWPSLSKIVLRKQWAEFLQLRKDQEDVI 6647521

6647520 LPLIRARKKLKEQRLRKLNMEENKDDYVLSYVDTLLDLQLPDEKRKLNDL 6647371

6647370 EIVSLCNEFLNGGTDTTTTALQWILANLVKHPQIQEKLLLEIKEVVGEGE 6647221

6647220 EVVKEDDLQKMPYLKAIILEGLRRHPPARMVLPHAVTEDTVLGGFLVPKN 6647071

6647070 GTVNFMVADIGWDSKAWEDPMAFKPERFLNSEREAFDITGSREIKMMPFG 6646921

6646920 AGRRICPGYGLAMLHLEYFVANLVLNFEWKAVDGDDIDLSEKQELTIVMK 6646771

6646770 NPLRAHLSRRVAS* 6646729

>CYP89A15v1

scaffold_1182 (+) 2410-3939

eugene3.11820001|Poptr1

gene model correct no introns

64% to 89A5

$

2410 MESWFLILVSISISLFLKTIFNNFLTSKNLPPGPLSFPFIGHLLWLRMSA 2559

2560 LKIEPILRSLHAKFGPMVTLRIGTRPAIFVADRTLAHEALIHGGAVFADR 2709

2710 PPAVATKKIITSNQHNISSSSYGPTWRLLRRNLTAEILHPSRVKSYTHAR 2859

2860 NWVLQILQNRFESQAKAGRPICVKEHFQYAMFCLLVLMCFGEKLDENQIK 3009

3010 KIMEVMTVNFGRFNILNFWPGVTKIVLRNRWRELFRLRRCQENVLIPLIR 3159

3160 ARKKAKEERVNKSKEDKKDYEDEYVLSYVDTILALELPEEKRKLNEEEMV 3309

3310 SLCREFLDAGTDSTSTALQWIMANLVKYPQIQEKLFMEIKGVVQDGEENI 3459

3460 KEEELQKMPYLKAIILEGLRRHPPGHFVLPHAVTEDAVLGKYVVPKDGTI 3609

3610 NFMVAEMGWNPKVWEDPMAFKPERFLSSGGETFDITGSREIKMMPFGAGR 3759

3760 RICPAYGLAILHLEYFVANLIWRFEWKAVDGDDVDLSEKEEFTVVMKNPL 3909

3910 QAQICPRLK* 3939

>CYP89A15v2

scaffold_1691 (-) 2042-808

eugene3.16910002|Poptr1

join with eugene3.16910001|Poptr1 part of the same gene as above

89A like 2 aa diffs to scaf_1182 duplicate

$

2042 MESWFLILVSISVSLFLKTIFNNFLTSKNLPPGPLSFPFIGHLLW

1907 LRMSAFKIEPILRSLHAKFGPMVTLRIGTRPAIFVADRTLAHEALIHGGAVFADRPPAVATRK 1719

1590 RARKKAKEERVNKSKEDKKDYEDE 1519

1518 YVLSYVDTLLALDLPEEKRKLNEEEMVSLCREFL 1417

1416 DAGTDSTSTALQWIMANLVKYPQIQEKLFMEIKGVVQDGE 1297

1296 ENIKEEELQKMPYLKAIILEGLRRHPPGHFVLPHAVTEDAVL 1171

1170 GKYVVPKDGTINFMVAEMGWNPKVWEDPMAFKPERFLS 1057

1056 SGGETFDITGSREIKMMPFGAGRRICPAYGLAILHLEYFVANLIWRFEWKAV 901

900 DGDDVDLSEKEEFTVVMKNPLQAQICPRLK* 808

>CYP89A15v3

scaffold_18069 (+) 2-552

fgenesh1_pg.C_scaffold_18069000001|Poptr1

no comment

89A like duplicate

100% to scaf 1691 and scaf 1182

$

  2 KYPQIQEKLFMEIKGVVQDGEENIKEEELQKMPYLKAIILEGLRRHPPGHFVL 160

163 HAVTEDAVLGKYVVPKDGTINFMVAEMGWNPKVWEDPMAFKPERFLSS 306

307 GGETFDITGSREIKMMPFGAGRRICPAYGLAILHLEYFVANLIWRFEWKAVDGDDVDLSE 486

487 KEEFTVVMKNPLQAQICPRLK* 552

>CYP89A16P

scaffold_8029 (+) 3-257

no model

no comment

89A like C-term 68% to 89A9 no gene model at JGI

95% to scaf 1182 probable pseudogene

$

  3 LNSGGEFDITGSREIKMMPFGAGRRICPAYDLAMLH*EYFVANLIWRFEWKAVDGDDVDLSEKEEF 203

204 TVVMKNPLQAQICPRLK* 257

>CYP89A17

LG_VII (+) 4351919-4358145

fgenesh1_pm.C_LG_VII000171|Poptr1

gene model short at N-term and heme signature

89A like 63% to 89A5 possible pseudogene

possible insertion in no intron gene, CYP89 genes usually have no introns

$

4351919 MESWFLILVSISVSLFLKTIFNNFLTSKNLPPGPLSFPFIGHLLWLRMSA 4352068

4352069 FKIEPILRSLHAKFGPMVTLRIGTRPAIFVADRTLAHEALIHGGAVFADR 4352218

4352219 PPAVATRKIITSNQHNISSSSYGPTWRLLRRNLTAEILHPSRVKSYTHAR 4352368

4352369 NWVLQILQNRFESQAKAGRPICVMEHFQYAMFCLLVLMCFGDKLDENQIK 4352518

4352519 KIMEVQRQMIVNFGRFNILNFWPGVTKIVLRNRWRELFCLRKCQEDVLIP 4352668

4352669 LIRARKKAKEDRVNKSKEDKKDYEDEYVLCYVDTILALELPEEKRKLNEE 4352818

4352819 EMVSLCSEFLNGGTDTTSKALQWIMANLVKYPQIQEKLFMEIKGVVQDGE 4352968

4352969 ENIKEEELHKMPYLKAIILEGLRRHPPAHFVLPHAVTEDAALGKYVVPKD 4353118

4353119 GTINFKVAEMGWNPKVW 4353169

4353170 EDPMAFKPERFLSSGGETFDITGSREIKMMPF 4353265

4357954 GAGRRICLAYGLAILHLEYFVANLIWRFEWKAVDGDDVDLSEKEEFT 4358094

4358095 VVMKNPLQAQICPRVK* 4358145

>CYP89A18

LG_V (+) 1583967-1585490

eugene3.00050187|Poptr1

gene model correct no introns

63% to 89A5

85% to scaffold_1182

$

1583967 METWLLILVSISISLFLKFIFNNFLTTKKLPPGPVTFPIIGNLLWLRLSS 1584116

1584117 FKLEPILRSLHAKFGPMVTLRIGTRPVIFIADRALAHRALIHKGAVYADR 1584266

1584267 PPAFATRNQLNISSSSYGPTWRLLRRNLM 1584353

1584354 AEILHPSRVKSYSHARNWVLQILQNRFESEAKSGRPVRVMEHFQYAMFCL 1584503

1584504 LVLMCFGDKLDESQIEKIEEVLRHMLVNIGKFNILNCWPRVTKIVLRKRWNELFRLRKLQEDVLIP 1584701

1584702 LIRARKKAKEERIRRGKEDKKGHEDEYVLSYVDTLLSLELPEEKRKLEEG 1584851

1584852 EMVSLCSEFLNGGTDTTSTALQWIMANLVKYPQIQEKLFMEIKGVVRDGE 1585001

1585002 ENIKEDELQKMPYLKAIILEGLRRHPPGHFVLPHAVTEDVVLDKYVIPKD 1585151

1585152 GTINFMVAEMGWDPKVWEDPMAFKPERFLNGGGETFDITGSREIKMMPFG 1585301

1585302 AGRRICPGYGLAMLHLEYFVANLIWKFEWKAVDGDDVDLSEKEEFTVVMK 1585451

1585452 NPLQAQICPRLK* 1585490

>CYP89A19P

scaffold_9149 (-) 618-1

eugene3.91490001|Poptr1

gene model is wrong

89A like runs off end

95% to scaf 1182

$

618 MESWFLILVSISISLFLKIIFNNFLTSKNLPPGPLSFPFIGHLLWIRMSA 469

468 FKIEPILRSLHAKFGPMVTLRIGTRPAIFVADRTLAHEALIHGGAVFAGR 319

318 PPAVATSKIITSNQHNISSSSYGPTWRLLRRNLTAEILHPSRVKSYTHAR 169

168 NWVLQILQNRFESQAKAGRPIWVMEHFQYAMFCLLVLMCFGDKLDENQLK 19

 18 KIMEVQ 1

>CYP89A20P

scaffold_19769 (+) 488-1081

eugene3.197690001|Poptr1

gene model wrong

89A like runs off end

97% to LG_VII      (+)  4357945 4 aa diffs

$

488 MESWFLILVSISVSLFLKTIFNNFLTSKNLPPGPLSFPFIGHLLWLRMSA 637

638 FKIEPILRSLHAKFGPMVTLRIGTRPAIFVADRTLAHEALIHGGAVFADR 787

788 PPAVATRKFLTSNQHNISSSFYGPTWRLLRRNLTAEILHPSRVKSYTHAR 937

938 NWVLQILQNRFESQAKAGRPICVMEHFQYAMFCLLVLMCFGDKHDENQ 1081

>CYP89A21P

scaffold_1954 (-) 5819-5235

eugene3.19540001|Poptr1

gene model is short, missing C-term half

89A like

97% to LG_VII      (+)  4357945

$

5819 MESWFLILVSISVSLFLKTIFNNFLTSKNLPPGPLSFPFIGHLLWLRMSA 5670

5669 FKIEPILRSLHAKFGPMVTLRIGTRPAIFVADRTLAHGALIHGGAVFAGR 5520

5519 PPAVATSKIITSNQHNISSSSYGPTWRLLRRNLTAEILHPSRVKSYTDAR 5370

5369 NWVLQILQNRIESQAKAGRPICVMEHFQYAMFCLLVLMCFGDKLD 5235

>CYP89A22

LG_XV (+) 412465-414027

eugene3.00150072|Poptr1

gene model seems correct

89A like 52% to 89A5

76% to LG_VIII    (+)  6182991

$

412465 MDHWFLILISISLSISIPGLLKFILNRYFISKKPAHHKLPPSPQSIPVIS 412614

412615 NFLWLGRISPSNIHSILNPLHAKLGPILTIYFGFRPVIFIADRFLAHKAL 412764

412765 IQKGALFASRPPASETQRFRGSNRRLVSLSFYGPTWRLLRQNLTKNVLHP 412914

412915 SCAKYSAHSRRWALQILKNRLESQAKSGQPVCLREHFLYAIFCLLGVICF 413064

413065 GDKVDEDQIKQIQEVVHRAFLSSRRFDTLNLWPRVTKIVLRRRWEELLQL 413214

413215 RQSVQDVTIPLIRARKKLQEEERTGMDTHHDHVVPYVDTLLALEFPDDKR 413364

413365 KLDEEEISNLCGEFLNAGTDTTTTALEWIMANLVKYPKIQEKLFMEIKGV 413514

413515 VGDGDVKEVNESDLKKMSYLKAVILEGLRRHSPARFLIPHAVTEDFVLNN 413664

413665 EYLIPKNAAINFLVAEMGWDPKVWEDPMAFKPERFLNHENGITKEFDITG 413814

413815 SREIKMMPFGAGRRICPGYQLSMLLLEFYVANLVWKYEWKAVDGNDVDLS 413964

413965 EKIEHIMAMRNPLQVHLSPR* 414027

>CYP89A23

LG_VIII (+) 6182991-6184553

fgenesh1_pg.C_LG_VIII000875|Poptr1

join two models

89A like 56% to 89A4

76% to LG_XV  (+)   413539

$

6182991 MNHWLLILFSIFISISVSGILRFILNRYFINTKPTLYKLPPSPQSIPVIS 6183140

6183141 NLLQLVRITPSDIHSNLNSLHAKLGPIITIYSGSRPVIFIADRFLAHKVL 6183290

6183291 IQNGAMFANRPPASATQKIVSSNQRIISLAFYGPTWRLLRRNLTENFLHP 6183440

6183441 SRAKCFSLSRRWVLQILMNRLESQEKSGQPICVREHFLYAMFCLLVVMCF 6183590

6183591 GDNINETQIKQIEEVQRRAFLSFNKFNILNLWPRMTKIVLRRRWEEFYQL 6183740

6183741 RKCQQDVSIPLIRARKNLQEEERKRMETQHH HVVSYVDTLLGLELPDENK 6183890

6183891 KLNEVEIANLCSEFLNAGTDTTTTALEWIMANLVKYPKIQDKLFMEIKGV 6184040

6184041 VGNGDREEVSESDLKRLPYLKAVVLEGLRRHPPARLLAPHAAREDVVLNN 6184190

6184191 EYLIPETAAINFLVAE 6184238

6184239 MGWDPKAWEDPLAFKPERFLNHDNGIGREFDITGSREIKMMPFGAGRRI 6184385

6184386 CPGYQLAMLHLEYYVANLIWKFEWKAVDGDDVDLSEKAERTMVMKNPLQV 6184535

6184536 HLSPR* 6184553

>CYP89A24P

scaffold_15445 (+) 1-348

fgenesh1_kg.C_scaffold_15445000001|Poptr1

model runs off the end

89A like 87% to LG_VIII (+)  6182991

$

  1 KNAAINFLVAEMGWDPEAWEDPLTFKPERFLNHDNGIRQEFDITGSREIK 150

151 MMPFGAGRRICPGYQLGMLHLEYYVANLVCKFEWRAVDGDGVDLSEKAER 300

301 TMVMKNPLRVRISPR* 348

>CYP89A25

LG_I (-) 24001619-24000402

fgenesh1_pg.C_LG_I002304 [Poptr1:64952]

gene model short missing C-term

89A like 53% to 89A5

83% to LG_VIII  (+)  6182991

$

24001619 MNRWFLILLSISISISISGILKFIVNRCFINTKPTTLYKLPPSPKSIPVI 24001470

24001469 SNLLWLRRISPSNIHSILNSLHARLGPIITIYLGSRPLIFIADRLLAHKA 24001320

24001319 LIQNGAAFANRPPASATQKIVTSNQRNVSLAFYGPIWRLLRRNLTENFLH 24001170

24001169 PSRAKSFSHSRRWALQVLKNRLASHEKSGQPICVREHFQYTMFCLLVVIC 24001020

24001019 FGDNVDENQIKQIEEAQRRAFLSFNKFNILNLWPRVTKIVLRRRWEEFYQ 24000870

24000869 LRKCQLDVSIPLIRTRKNMQEEDRKSMEPHHDRALCYVDTLLSLEFPDEE 24000720

24000719 RKINEEEIANLCSEFLNAGTDTTTTSLEWIMANLVKYPKIQDRLFMEIKE 24000570

24000569 VVGNGDQEEVSESDLKRMPYLKAVVLEGLRRHPPARLLIPHAVMEDVVLN 24000420

24000419 NEYLIP 24000402

>CYP89A26

LG_III (+) 10170571-10172100

fgenesh1_pg.C_LG_III000826|Poptr1

gene model correct

89A like 48% to 89A5 no introns

52% to LG_XIII   (-) 6638846

$

10170571 MEFWLLLIAFLCLFVFLLSFLDLSHKNKKLPPGPPTLPVLGNFLWLLRSS 10170720

10170721 NNFSSLEPVLRQLRAQYGPIVTLHLGSEPSIFITTAEAAHKALVRSGSIF 10170870

10170871 ASRPPALETTRIMLSNETTVTTAPYGPLWLQLRQNFMSAFHPSRLHLYSD 10171020

10171021 GRKWAMNILRSKLLEEARPNHEAIVVVDHFQHAVFCLLIYLCFGEKYEES 10171170

10171171 VIRQITSVQRAIIKNFVKFNLLNFMPKLGKILFHKLWKELLETRRELENV 10171320

10171321 LLPLIDAQREKKHQKLMDEGGGESILSYVDTLIDFQLPDSGRKYSDEELV 10171470

10171471 SLCSEFFHGGTDTSITTLQWAMANIVKHQHIQETLHKEINAAVKPGEEIT 10171620

10171621 EEDLKRMPYLKAVILETLRRHPPGHFILPHGVTEDTKLEGYDVPKNSIIN 10171770

10171771 FTVADMGWDADVWEDPMEFRPERFLKNGNGQEVVFDMKGIKEIKMMPFGA 10171920

10171921 GRRACPAIAMALLHQEYFVANLVRDFTWTAENGCAIDLSEKQDFTMVMKN 10172070

10172071 PLRVHISPRTC* 10172100

>CYP89A27P

scaffold_29 (+) 3163988-3165482

eugene3.00290314|Poptr1

gene model fuses two genes, an F-box cyclin and a P450 C-term

89A like pseudogene 53% to 89A3

74% to LG_III (+) 10171903

$

3163988 MELCLLLIAFLCLCVFLLSFLHLSHNNKNLPPGPLTLPFPGNISRNFSSL* 3164140

3164141 PVLRKLCAQHGPVIILHLGSEPSIFLTTPEAAHMVPVQNGSTFASHPPAL 3164290

3164291 ETTRVMSSNETTAVTTAPYGPQWLQLRQNSMSAFHPSRLHLYFDCRKWAL 3164440

3164441 NIPRKKLLEAAGLDHKAIVVVDHFQRAVSCLLIYLCFGDKYEECY*TSQQCNVQ* 3164605

3164606 SQIFLKFNLL 3164635

3164635 NFMPRSGKILFHKLWKELLEVR* 3164703

3164704 QLENVPLPLIDAQREKRHKKLMDKGEESILSYV 3164802

3164805 TLTDFQFPHGGRQYSDEELVSLCS 3164876

3164876 EYFHGGTDNSITTLQSAMANIVSHQHIQ* 3164962

3164963 TLLKEINAAVKPGEEIEEEGLKRMSCLKPVILETP* 3165070

3165071 RRPRGHFTLRHRVTEDTKLEG* 3165136

3165137 DVPKNSIINFTVADMA* 3165187

3165188 DANVGEDPKEFRPERFLKNGDDREVVYDMKGV* 3165286

3165287 KRSKLYLFGAGRRACPAITMALLHREFFVTNLVRDFAWTAENGCDNDLSE 3165436

3165437 KHE 3165445

3165447 NPLLVHICPRTC 3165482

 

>CYP92A17v1

scaffold_158a (-) 58842-57112

eugene3.01580006|Poptr1

gene model correct

92A like 72% to 92A9 95% to LG_III (+)  3650544

$

58842 METWVSYAFAWLATVSLILLASRLRRRKLKLPPGPKPWPIIGNLNLIGEL 58693

58692 PHRSLHALSQKYGPIMQVQFGSFPVVVGSSVEMAKTILKTHDVIFSGRPK 58543

58542 TAAGKYTTYNYSDITWSPYGPYWRQARKMCLMELFSAKRLESYEYIRVEE 58393

58392 LKALLKTLHKSSGRPINLKDHLTDVSLNVISRMVLGKKYTVKSSENEKEI 58243

58242 VTPEEFKEMLDELFLLNGVLDIGDSIPWIAFLDLQGYIKRMKVLSKKFDK 58093

58092 FMEHVLDEHESRRKTEDENWEPKDMVDVLLQLASDPNLEVKLERHGVKAFSQ 57937 (0)

57741 DLIAGGTESSAVTVEWAISEILRKPEVFEKASEELDRVIGRERWVEEK 57598

57597 DMVNLPYIYAIAKEVMRLHPVAPMLVPREAREDINVNGYDIKKGSRVLVN 57448

57447 VWTIGRDPKVWDKPDEFCPERFIGNSIDVRGHDYELLPFGAGRRMCPGYP 57298

57297 LGLKVIQATLSNLLHGFKWRLPDGVRKEELSMEEIFGLSTPKKYPLVAVA 57148

57147 EPRLPAHVYPK* 57112

>CYP92A17v2

scaffold_3771 (-) 2060-330

grail3.3771000201|Poptr1

gene model short at C-term

92A like  71% to 92A9 

100% to CYP92A17v1 duplicate seq.

$

2060 METWVSYAFAWLATVSLILLASRLRRRKLKLPPGPKPWPIIGNLNLIGEL 1911

1910 PHRSLHALSQKYGPIMQVQFGSFPVVVGSSVEMAKTILKTHDVIFSGRPK 1761

1760 TAAGKYTTYNYSDITWSPYGPYWRQARKMCLMELFSAKRLESYEYIRVEE 1611

1610 LKALLKTLHKSSGRPINLKDHLTDVSLNVISRMVLGKKYTVKSSENEKEI 1461

1460 VTPEEFKEMLDELFLLNGVLDIGDSIPWIAFLDLQGYIKRMKVLSKKFDK 1311

1310 FMEHVLDEHESRRKTEDENWEPKDMVDVLLQLASDPNLEVKLERHGVKAFSQ 1155 (0)

 959 DLIAGGTESSAVTVEWAISEILRKPEVFEKASEELDRVIGRERWVEEKDMVNLPYIYA 786

 785 IAKEVMRLHPVAPMLVPREAREDINVNGYDIKKGSRVLVNVWTIGRDPKVWDKPDEFCPE 606

 605 RFIGNSIDVRGHDYELLPFGAGRRMCPGYPLGLKVIQATLSNLLHGFKWRLPDGVRKEEL 426

 425 SMEEIFGLSTPKKYPLVAVAEPRLPAHVYPK* 330

>CYP92A18

scaffold_158b (-) 69821-67869

estExt_fgenesh1_pg_v1.C_1580005|Poptr1

gene model correct

92A like 61% to 92A9

$

69821 MDNPPPPAITYTAAGLATVVLILLSRRLFSRKLKLPPGPKPWPIIGNFNLIGPLPHRS 69648

69647 LHELAKKYGPIMQIKFGSIPVVVGSSAEVAEAILKTHDISLADRPKIAAG 69498

69497 KYTTYNYSDITWSQYGPYWSHLRKFCNMEIFSPKRLDFYQHVRVEELHSL 69348

69347 LKSLYKTSGTPFKTREKFSDLSLSVISRLVLGRNYTLESEKGK 69219

69218 GVYTPHEFKKILDELFVLNGVLEIGDWIPWLSYFDLQGNIKKMKA 69084

69083 VAKKVDRFIEHELEEHDARR 69024

69023 NGVKNYVAKDMMDILLQLSDDPSLDVEFGRTGVKALTL 68910 (0)

68498 DLIAGGTESTAVTAEWALAELLKKPEIFEKATEELDRVIGRERWVEE 68358

68357 KDIVDLPYVTAIMKETMRLHNVSPLLVPRVAREDVQISGYDIPKGTVVMV 68208

68207 NVWTIGRDPKIWDNPNEFCPERFLGEEIEVEGQNFKLMPFGAGKRICVGY 68058

68057 PLGLKIIQSSVANLLHGFNWKLPKGMKKEDLDMEEIFALSTPKKNPLVAV 67908

67907 AEPRLPPHLYSV* 67869

>CYP92A19

LG_IIIa (+) 3649066-3651041

eugene3.00030242|Poptr1

gene model correct

92A like 71% to 92A9

$

3649066 METPTWMSYAFAWLATVSLILLASRLRRRKLNPPPGPKSWPIIGNLNLIG 3649215

3649216 ELPHRSLHALSQKYGPLMQVKFGSFPVVVGSSVEMAKTILKTHDVIFSGR 3649365

3649366 PKTAAGKYTTYNYSDITWSPYGPYWRQARKMCLMELFSAKRLESYEYIRV 3649515

3649516 EELRALLKTLNKSSGRPINLKDHLADVSLNVISRMVLGKKYTVKSSENEK 3649665

3649666 EIVTPEEFKEMLDELFLLNGVLDIGDSIPWIAFLDLQGYIKRMKTLSKKF 3649815

3649816 DKFMEHVLDEHEARRKEDKNWEPKDMVDVLLQLASDPNLEIKLERHGVKAFSQ 3649974 (0)

3650412 DLIAGGTESSAVTVEWGISEILRKPEVFEKATEELDRVIGRERWVEEK 3650555

3650556 DMVNLPYIYAIAKEVMRLHPVAPMLVPRAAREDININGYDIKKGSRVLVN 3650705

3650706 VWTIGRDPKVWDKPDEFFPERFIGNSIDVRGHDYELLPFGAGRRMCPGYP 3650855

3650856 LGLKVIQATLSNLLHGFKWRLPDGQKKDDLNMDEIFGLSTPKKYPLVAVA 3651005

3651006 EPRLPAHVYPK* 3651041

>CYP92A19P

LG_III (+)  3641419-3641829

eugene3.00030241|Poptr1

sequence runs into a seq gap

92A like 72% to 92A8

100% to LG_III  I        (+)  3650544 duplicate seq

$

3641419 METPTWMSYAFAWLATVSLILLASRLRRRKLNPPPGPKSWPIIGNLNLIG 3641568

3641569 ELPHRSLHALSQKYGPLMQVKFGSFPVVVGSSVEMAKTILKTHDVIFSGR 3641718

3641719 PKTAAGKYTTYNYSDITWSPYGPYWRQARKMCLMELF 3641829

>CYP92A20

LG_III (+) 3610917-3612657

grail3.0037002601|Poptr1

join with grail3.0037002701|Poptr1 part of same gene as above

92A like 63% to 92A9

1 aa diff to LG_III    (+)  3593164

71% to LG_VII      (-)  9437395

72% to LG_III   (+)  3641408

$

3610917 MPIIQKVCPINRLITSSAWITASTQITLTTVKMELSTFAALLLATVAVIT 3611066

3611067 LFRHLTRPKLNLPPGPKPWPIIGNLNLLTGPLPHRNMHALVQKYGPIMQL 3611216

3611217 KFGSFPVVVGSSVEMAEAVLKTNDVKLADRPKIAAGKYTTYNYSNITWSQ 3611366

3611367 YGPYWRQARKICLMEIFSPKRLDQFETVRVQELHALLRKLFVSAGKPINA 3611516

3611517 RDEFSDLSLSVISRLVLGKNYTVKTGNQKQYMSPKEFKEMIDELFLLNGV 3611666

3611667 LDIGDSIPWLAFLDLQGYIKRMKAVGQLFDGFLEYTLNEHQQRRKGVKDY 3611816

3611817 VPQDMMDILLQLSDDPNLEVQLDRTAVKAFTM 3611912 (0)

3612028 DLIAGGTESSAVTTEWAMAELLKKPEYFKRANEELDRVIGRDRWIEE 3612168

3612169 KDIVNLPFINAICKETMRLHPVSPFLVPRLAREDIQLGGYDIPKGTRVMV 3612318

3612319 NVWTIGRDASIWEKPHEFCPERFIGKSIDVKGHNFELLPFGAGRRMCVGY 3612468

3612469 SLGLKVIQASVANLLHGFKWKLPGDMKTEELNMQEIFGLSTPKQIPLVAE 3612618

3612619 LEPRLPAHMYSM* 3612657

>CYP92A20P

LG_III (+) 3593032-3593661

grail3.0037002501|Poptr1

1 aa diff to LG_III (+)  3612160 duplicate

92A like exon 2

$

3593032 DLIAGGTESSAVTTEWAMAELLKKPEYFKRANEELDRVIGRDRWIEE 3593172

3593173 KDIVNLPFINAICKETMRLHPVSPFLVPRLAREDIQLGGYDIPKGTRVMV 3593322

3593323 NVWTIGRDASIWEKPHEFCPERFIGKSIDVKGHNFELLPFGAGRRMCVGY 3593472

3593473 SLGLKVIQASVANLLHGFKWKLPGDMKTEELNMQEIFGLSTPKQIALVAE 3593622

3593623 LEPRLPAHMYSM* 3593661

>CYP92A21

LG_IIIb (+) 3591921-3593661

no model

no comment

92A like 3 aa diffs to LG_III (+) 3610917

$

3592017 MELSTFAALLLATVAVIT 3592070

3592071 LFRHLTRPKLNLPPGPKPWPIIGNLNLLTGPLPHRNMHALVQKYGPIMQL 3592220

3592221 KFGSFPVVVGSSVEMAEAVLKTNDVKLADRPKIAAGKYTTYNYSNITWSQ 3592370

3592371 YGPYWRQARKICLMEIFSPKRLDQFETVRVQELHALLRKLFVSAGKPINA 3592520

3592521 RDEFSDLSLSVISRLVLGKNYTVKTGNQKQYMSPKEFKEMIDELFLLNGV 3592670

3592671 LDIGDSIPWLAFLDLQGYIKRMKAVGQLFDGFLEYTLNEHQQRRKGVKDY 3592820

3592821 VPQDMMDILLQLSDDPNLEVQLDRTAVKAFTM 3592916 (0)

3593032 DLIAGGTESSAVTTEWAMAELLKKPEYFKRANEELDRVIGRDRWIEE 3593172

3593173 KDIVNLPFINAICKETMRLHPVSPFLVPRLAREDIQLGGYDIPKGTRVMV 3593322

3593323 NVWTIGRDASIWEKPHEFCPERFIGKSIDVKGHNFELLPFGAGRRMCVGY 3593472

3593473 SLGLKVIQASVANLLHGFKWKLPGDMKTEELNMQEIFGLSTPKQIALVAE 3593622

3593623 LEPRLPAHMYSM* 3593661

>CYP92A22

LG_VII (-) 9437395-9434788

fgenesh1_pm.C_LG_VII000297|Poptr1

gene model correct

92A like 63% to 92A9

$

9437395 MEITSTWVSYAAPLLATITLILLGRLIRRRKLHLPPGPKPWPIIGNLNLM 9437246

9437245 GELPHRSLEALSKKYGSLMQVKFGSHPVVVGSSVEMARAILKTHDLSLAG 9437096

9437095 RPKTASGKYTTYNYQNITWAPYGPYWRQARKLCLIELFSPKRLDQFEYIR 9436946

9436945 VEENLKFLNTLFQKRGKPITVRDHFSDLSFSVISRLVLGRKYMAESEDEK 9436796

9436795 DMLSLKELKEVLDEMFLLNGVLVIGDFIPWLAFLDLQGYIKRMKAVAKKM 9436646

9436645 DMFMEHALEEHHARRKGVKDYEPRDMLDILLQVADDPNLEVKLDRIGVKA 9436496

9436495 FTQ 9436487 (0)

9435417 DLINGGTESSAVTTEWALAEIMKKPEIFDKATEELDRVIGRERWVQEND 9435271

9435270 IDNLPFINAIVKETMRLHPVAPLLVPRLAREDIQIAGYDIPKGTRVLVNA 9435121

9435120 SAIGRDPSLWDKPKEFCPERFIGKSVDVKGHDFELLPFGAGRRICPGYPL 9434971

9434970 GLKVIQTSVANLLHEFKWKLPNNMTAKDLNMEEILGLSIPRKVPLVAVLE 9434821

9434820 PRLPSELYSL* 9434788

>CYP92A22P

scaffold_2179 (+) 3774-4172

eugene3.21790001|Poptr1

duplicate seq

92A like middle 100% match to LG_VII (-)  9437395

$

3774 VRDHFSDLSFSVISRLVLGRKYMAESEDEKDMLSLKELKEVLDEMFLLNG 3923

3924 VLVIGDFIPWLAFLDLQGYIKRMKAVAKKMDMFMEHALEEHHARRKGVKD 4073

4074 YEPRDMLDILLQVADDPNLEVKLDRIGVKAFTQ 4172

>CYP92A23P

scaffold_1142 (-) 11129-8170

eugene3.11420001|Poptr1

no comment

92A like pseudogene

66% to scaffold_158  8  (-)    68093

$

11129 MDNPSPPAITYTAAGLATAVLILLN 11055

11053 CCCLLRRKLKLSPGPKLWPMIGNFNLIGSLPHRSFHELAKKYEPTVKV 10910

10909 KFGSIAMVRGSSAEVAEAILKKPMTLAQITTDKYTA*NYS 10790

10605 DITWSQCRTCWSQL 10564

10564 NEEIFCPKCLDFYERV 10517

 8339 KTREKFPDSSLSMISRLMSGRSYTLLNRNMKRVV 8238

 8238 GNRGLDPLKAVAKVVDRFTEHALRWSSMWQRSYRQLFEDPSLEVE 8104

>CYP92A24

scaffold_28 (-) 306996-304599

eugene3.00280025|Poptr1

gene model correct

92A like 59% to 92A9

$

306996 MEAFSLVVLVLAWVFALLYLPKFFKSLRNPLKLPPGPKPWPIIGNFDLLG 306847

306846 PLPHQSLHQLSLKYGKTMQLQFGSYPVFVTSSLDIAKQILKTYDHMFASR 306697

306696 PQTAAGKYTTYEYSDLAWAPYGPYWRQGRKIYLTELFSAKRLESYEYMRI 306547

306546 EEMREFTRRLYRNCGKTIELKDYLSHYTLSIISRIVLGKKYFSASESEKE 306397

306396 IVTLEEFQEMLDELFLLNGVLNIGDWIPWLDFLDMQGYVKRMKELKVRFD 306247

306246 RFHDHVIDEHNAKRKATKNWQPKDMVDLLLQLADDPELEVKLTRDNIKGLTQ 306091 (0)

305225 DLIAGGTDTAATMGDWSMSELLKKPQLFKRVTDELDRVVGRDRWVEEKDI 305076

305075 PQLPYIEAIMKEAMRMHPSAVMLAPHLALQDSKVGGYDIPKGTRIFINTW 304926

304925 SMGRDPDLWEDPEDFRPERFIGKGIDIKGHNFELLPFGSGRRMCPGYPLG 304776

304775 TKMILVSLANMLHGFTWELPPGMKPQDVKRDEVFGLATQRKYPTVAVAKP 304626

304625 RLPLHLYN* 304599

>CYP92A25

LG_XVIII (+) 2833441-2835456

estExt_fgenesh1_pm_v1.C_LG_XVIII0052|Poptr1

short at N-term, wrong first exon

92A like 62% to 92A9

$

2833411 MDAFSLIVLVVAWLFALLYLPKYFKSWLSP 2833500

2833501 LKLPPGPKPWPIIGNFNLLGPLPHQSLHQLSLKYGKTMQLHFGSYPVMVT 2833650

2833651 SSLDMAKQILKTYDHMFASRPQTAAGKYTTYEYSDLAWAPYGPYWRQGRK 2833800

2833801 IYLTELFSAKRLESYEYMRVEEMREFTRRLYRNCGKSIELKDYLSHYTLS 2833950

2833951 IISRIVLGKKYFSASESEKEIVSLEEFQEMLDELFLLNGVLNIGDWIPWL 2834100

2834101 DFLDLQGYVKRMKKLKVRFDKFHDHVIDEHNVRRKTTKNWQPKDMVDLLL 2834250

2834251 QLADDPELEVKLTRDNMKGLTQ 2834316 (0)

2834830 DLIAGGTDTAATMGDWSMSELLKKPQLFKRVTDELDRVVGRERWVEEKDI 2834979

2834980 PQLPYIEAIMKEAMRMHPSAVMLAPHLALQDCKVGGYDIPKGTRIFINTW 2835129

2835130 SMGRDPDLWEDPEDFRPERFIGKGVDIKGHNFELLPFGSGRRMCPGYPLG 2835279

2835280 TKMILVSLANMLHGFTWELPPGIKPEDVKRDEVFGLATQRKYPTVAVAKP 2835429

2835430 RLPLHLYN* 2835456

 

>CYP93A4

LG_XVI (-) 3135000-3133112

fgenesh1_pg.C_LG_XVI000375|Poptr1

gene model seems correct

93D like 54% to 93D1

66% to scaffold_152 (+) 154010, 55% to LG_XIII (-)  1795947

61% to 93A1 63% to 93A2, 70% to Medicago truncatula AC141114.14 20271-18191

$

3135000 MADIQGYIILFLLWLLSTILVRAILNKTRAKPRLPPSPLALPIIGHLHLL 3134851

3134850 APIPHQALHKLSTRYGPLIHLFLGSVPCVVASTPETAKEFLKTHENSFCD 3134701

3134700 RPKSTAVDFLTYGSADFSFAPYGPYWKFMKKICMTELLGGRMLDQLLPVK 3134551

3134550 HEEIRQFLQFLLKKANARESIDVGSQLIRLTNNVISRMAMSQRCSDNDDE 3134401

3134400 ADEVRNLVHEVADLTGKFNLSDFIWFCKNLDLQGFGKRLKEVRKRFDTMT 3134251

3134250 ERIIMEHEEARKKKKETGEGDPVKDLLDILLDISEDDSSEMKLTRENIKAFIL 3134092 (0)

3133738 DIFAAGTDTSAVTMEWALAELINNPNILERAREEIDSVVGQSRLVQESDI 3133589

3133588 ANLPYVQAILKETLRLHPTGPIILRESSESCTINGYEIPARTRLFVNVWA 3133439

3133438 INRDPNYWENPLEFEPERFLCAGENGK 3133358

3133357 SQLDVRGQHFHFLPFGSGRRGCPGTTLALQMVQTGLAAMIQCFDWKV 3133217

3133216 NGTVDMQEGTGITLPRAHPLICVPVARLNPFPSF* 3133112

>CYP93A5P

scaffold_152 (+) 158255-159380

fgenesh1_pg.C_scaffold_152000017|Poptr1

missing middle part

93D like pseudogene 49% to 93D1

 84% to LG_XVI      (-)  3133324

$

158255 MSKVSIMAGFQGYIIFFLIWLVSTILVRAILDKKRTKPRLPPSPFALPII 158404

158405 GHLHLLAPIPHQALHKLSTRCGPLIHIFLGSVPCAVASTPETAKEFLKTH 158554

158555 ETSLCDRPKSAAVDFLTYGSTDFSFAPYGPYWKFVKKICMTELLGGRMLD 158704

158705 QLLPARHEEIGQFLQFLLKKANARESINVGSQLKRLTDNVISRMTMNQRC 158854

158855 SDNDDEADEVRKLVHDVAELTGKFNLSDFIWFCKNLDLQGFGKRLKEVHE 159004

159005 KFDPMMERIIKEHEEVRKIKKETDEGDSGKDLLDILLDISEDDSSTDQRR 159154

159155 IKAFIL 159172 (0)

(sequence gap)

159226 LVQTSLAALIQCFDWKVHGIIDMEEGPGITLPR 159324

159324 AHPLICVPVARLNPFSSF* 159380

>CYP93A6

scaffold_152 (+) 154010-155780

eugene3.01520023|Poptr1

gene model seems correct

93G like 57% to 93D1

66% to LG_XVI (-) 3135000, 51% to LG_XIII (-) 1795947

56% to 93A1, 56% to 93A2, 56% to 93A3

$

154010 MADIQDYAIPFLIFLASILLVQIILAKIRRNAGLPPSPRALPIIGHMHLL 154159

154160 SRIPHQAFHKLSARYGPLVYFFIGSKPCLLASTPEVAKEILKINEANFLN 154309

154310 RPKVANLDYLTYGSADFATIYYGPHWKFMKKLCMTEILGSRTLTQFLPIR 154459

154460 CEERERFLKLVLKRAEAKEAVDVGGELMRLTNNIISRMLLRTRCSDTENE 154609

154610 ADDVRELVKELNTLGAKFNLSDSIWFCKNFDLQGFDKRLKDARDRYDAMM 154759

154760 ERIMKEHEDARKRKKETGDEDDTVKDLLDILLDIYEDENAEKRLTRENIK 154909

154910 AFIM 154921 (0)

155148 NIFGAGTDTSSITVEWGLAELINHPIMMEKVRQEIDSVVGRSRLVQES 155291

155292 DIANLPYLQAIVKETLRLHPTGPLIVRESLEDCTIAGYRIPAKTRLFVNI 155441

155442 WSLGRDPNHWENPLEFRPERFTSEEWSANSNMMDVRGQHFHLLPFGSGRR 155591

155592 SCPGASFALQFVPTTLAALIQCFEWKVGDGENGTVDMDEGPGLTLPRAHS 155741

155742 LVCIPVSRPCPF* 155780

>CYP93A7P

LG_XVI (-) 3142068-3136957

eugene3.00160432|Poptr1

join with eugene3.00160430|Poptr1

93 like pseudogene 89% to scaffold_152 (+) 155571

$

3142068 MADMQHFAIPFVIFQASIFLVQTISAKIGGKAGLPPSPRALPIIGHMYLL 3141919

3141918 GPIPHQAFHKLSTRYGPLVYFFIGSKPCLLASTREVAKEFLKINEANFLN 3141769

3141768 RPKVS 3141754

3138336 VWKLVKELNTLGAKFNLSDSIWFW 3138265

3138264 LKDARDRYDAMMERIMKEHEEARKKMKETRDEDVTVKDLLDI 3138139

3138137 LLDIYEDKNAEKRLTREKIKAFIM 3138066 (0)

3137597 NIFGAGTDTSSITVEWGLAELINH 3137526

3137526 PIMMEKARQKIDSVVGRSRLVQESDIANPPYLQAIVKETLRLHPTGPLIV 3137377

3137376 RESLEDCTIAGYKIPANTRLFVNIWSLGRDPNHWENPLDFRPQRFTGEDW 3137227

3137226 SGNSNMMDVRGQHFHLLPFGTGRRSCPGASFALQFVPTTLAALIQCFEWK 3137077

3137076 VGDGECGTVDMDEGPGLTLPRAHSLVCIPVSRPCPFLAA* 3136957

>CYP93B7

LG_XIII (-) 1795947-1794304

estExt_fgenesh1_pg_v1.C_LG_XIII0255|Poptr1

gene model seems correct

93 like 43% to 93D1

73% to scaffold_70  (+)  1409929, 62% to 93B3, 58% to 93B2

$

1795947 MIFELIIAGFAVLLLTVFILTNKGHGSLPPGPVPLPIIGHLHLLQPLIHR 1795798

1795797 SFRDLCSCYGPIIYLRLGSVPCVVASTPELARELLKTNDLTFSSRKHSLA 1795648

1795647 IDHLTYSSSFAFAPYGPYWRFIKKLSTFEFLGNRALNQFLPVRRKELRQF 1795498

1795497 IGVLHDKSKVCESVNVTEELLNLSSNIISQIILSLRCSGTDNEAEGVRTL 1795348

1795347 VREVTQIFGEFNVSDFIWFCRNLDFRGYRKKFEDVHRRYDALLENIITNR 1795198

1795197 EIERKKSGGEYKVKDLLDMMLDALEDKSSEVELTREHIKALVL 1795069 (0)

1794972 DFITAATDTTAAATEWALAELINNPKVLEKARQEIDTVVGNKRLVEESDS 1794823

1794822 PNLPYIQAIIKETFRLHPPIPMITRKSIQESKINGYTIPKNTMLFVNIWS 1794673

1794672 IGRDSRYWKNPLEFEPERFLKSEGDMVQSTASMDIKGQHYELLPFGTGRR 1794523

1794522 SCPGIALALQELPVSLAAMIQCFEWKVADPHGVKIKGNALVDMTERPGLT 1794373

1794372 APRLHDLVCAPVPRPALDSFQP* 1794304

>CYP93B8v1

scaffold_70 (+) 1407665-1410186

eugene3.00700209|Poptr1

gene model seems correct

43% to 93D1, 45% to 93F1

73% to CYP93B7, 52% to LG_XVI (-) 3135000, 51% to scaf_152 154010

57% to 93B2 58% to 93B3

$

1407665 MMLELIGFAILLLSIFLIFTNRPRHACFPPGPRSLPIIGHLHLLGPLIHH 1407814

1407815 SFRDISSRYGPLIFLRLGSAPCVVASSPELAKEFLKIHDVIFSSREMDSR 1407964

1407965 AIKLLTYNSSFAFAPYGPLWKFLKRLSTFELLSSRALNHFQPVRKIELQQ 1408114

1408115 FLQNLLTKSKISESVNVTQELLNLSNNIISQMMLSIRCSGSDSQGEDAKT 1408264

1408265 LAREVTQIFGEFNVSDFIWLCRNFDFQGSRKKSEDVHTRFDALLDNIITN 1408414

1408415 RELERKQSGGKVQARDLLDMMLDTLEAQNSEIEFTRDHIKALVL 1408546 (0)

1409500 DFLTAGTDTTAASTEWALAELINHPKILEKARQEIDAVVG 1409619

1409620 NKRLVEESDFPNLPYLQAIFKETFRLHPPIPMISRKSTQECKINGYTIPA 1409769

1409770 NSLLFVNMWSIGRDSKYWTNPSEFEPERFLKPNGDMCNESASVDFKGQHY 1409919

1409920 QLLPFGTGRRSCPGLALAMQELSTTLPAMIQCFEWKVAGSQGEKINGNVA 1410069

1410070 VDMTERPGLTVPRAHDLVCIPVPRQPDIIQAFIKSGLR* 1410186

>CYP93B8P2

scaffold_70 (-) 1388718-1387837

fgenesh1_pg.C_scaffold_70000201|Poptr1

exon 1 only, exon 2 in a seq gap

93 like 39% to 93D1, 40% to 93G1

100% to scaffold_70   (+)  1409929 probable duplicate sequence

$

1388718 MMLELIGFAILLLSIFLIFTNRPRHACFPPGPRSLPIIGHLHLLGPLIHH 1388569

1388568 SFRDISSRYGPLIFLRLGSAPCVVASSPELAKEFLKIHDVIFSSREMDSR 1388419

1388418 AIKLLTYNSSFAFAPYGPLWKFLKRLSTFELLSSRALNHFQPVRKIELQQ 1388269

1388268 FLQNLLTKSKISESVNVTQELLNLSNNIISQMMLSIRCSGSDSQGEDAKT 1388119

1388118 LAREVTQIFGEFNVSDFIWLCRNFDFQGSRKKSEDVHTRFDALLDNIITN 1387969

1387968 RELERKQSGGKVQARDLLDMMLDTLEAQNSEIEFTRDHIKALVL 1387837 (0)

>CYP93B8v2

scaffold_1994 (-) 5560-3035

eugene3.19940001|Poptr1

gene model seems correct but possible assembly error

57% to 93B2 58% to 93B3

46% TO 93C1v1 soybean

duplicate seq 1aa diff to scaffold_70   (+)  1409929

$

5560 MMLELIGFAILLLSIFLIFTNRPRHACFPPGPRSLPIIGHLHLLGPLIHH 5411

5410 SFRDISSRYGPLIFLRLGSAPCVVASSPELAKEFLKIHDVIFSSREMDSR 5261

5260 AIKLLTYNSSFAFAPYGPLWKFLKRLSTFELLSSRALNHFQPIRKIELQQ 5111

5110 FLQNLLTKSKISESVNVTQELLNLSNNIISQMMLSIRCSGSDSQGEDAKT 4961

4960 LAREVTQIFGEFNVSDFIWLCRNFDFQGSRKKSEDVHTRFDALLDNIITN 4811

4810 RELERKQSGGKVQARDLLDMMLDTLEAQNSEIEFTRDHIKALVL 4679 (0)

3721 DFLTAGTDTTAASTEWALAELINHPKILEKARQEIDAVVG 3602

3601 NKRLVEESDFPNLPYLQAIFKETFRLHPPIPMISRKSTQECKINGYTIPA 3452

3451 NSLLFVNMWSIGRDSKYWTNPSEFEPERFLKPNGDMCNESASVDFKGQHY 3302

3301 QLLPFGTGRRSCPGLALAMQELSTTLPAMIQCFEWKVAGSQGEKINGNVA 3152

3151 VDMTERPGLTVPRAHDLVCIPVPRQPDIIQAFIKSGLR* 3035

>CYP93B8P1

scaffold_70 (-) 1392931-1392122

eugene3.00700208|Poptr1

duplicate sequence

100% match to scaf_1994

$

1392931 MMLELIGFAILLLSIFLIFTNRPRHACFPPGPRSLPIIGHLHLLGPLIHH 1392782

1392781 SFRDISSRYGPLIFLRLGSAPCVVASSPELAKEFLKIHDVIFSSREMDSR 1392632

1392631 AIKLLTYNSSFAFAPYGPLWKFLKRLSTFELLSSRALNHFQPIRKIELQQ 1392482

1392481 FLQNLLTKSKISESVNVTQELLNLSNNIISQMMLSIRCSGSDSQGEDAKT 1392332

1392331 LAREVTQIFGEFNVSDFIWLCRNFDFQGSRKKSEDVHTRFDALLDNIITN 1392182

1392181 RELERKQSGGKVQARDLLDM 1392122

 

>CYP98A23

LG_XVI (-) 1542608-1539021

eugene3.00160247|Poptr1

gene model correct

98A like 76% to 98A3

$

1542608 MALPLLVLVSIFVLLLAYILYQRLRFKLPPGPRPWPIVGNLYAIKPIRFRCFAE 1542447

1542446 WAQAYGPVVSVWFGSTLNVVVCNAELAKQVLKENDQQLADRHRSRLAARF 1542297

1542296 SRDGKDLIWADYGPHYVKVRRVSTLELFSAKRLEELRPIREDEVTFMAES 1542147

1542146 IFKDCTNP 1542123 (1)

1540200 ENHGKSLLVKKYLGDVAFNNITRLAFGKRFMNSEGIIDEQGQEFKAIVSN 1540051

1540050 GVRLGGSLTMAEHIPWLQWMFPLEEEAVEKHNARRDGLTRVIMEEHTNAR 1539901

1539900 KKSGGAKKHFVDALLTLQEKYDLSEVTITGLLW 1539802 (0)

1539665 DMITAGMDTTAITVEWAMAELIKNPRVQQKAQDELDRVVGFERVMTEADF 1539516

1539515 PNLPYLQAVVKESLRLHPPTPLMLPHRANTTVKIGGYDIPKGSVVHVNVW 1539366

1539365 AVARDPALWKNPLEFRPERFFEEDVDMRGHDFRLLPFGAGRRVCPGAQLG 1539216

1539215 INLVTSIIGHLLHHFHWTTPDGVKPEEIDMSERPGLVTYMMTPLQAVATP 1539066

1539065 RLPSHLYKRMASDM* 1539021

>CYP98A24

scaffold_1454 (+) 1851-5548

eugene3.14540001|Poptr1

gene model seems correct duplicate? allele?

98A like 76% to 98A3

98% to LG_XVI (-) 1542608 (8 aa diffs)

$

1851 MALPLLVLVSIFVLVLAYILYQRLRFKLPPGPRPWPIVGNLYDVKPIMFRCFAE 2012

2013 WAQAYGPVVSVWFGSTLNVVVCNAELAKQVLKENDQQLADRHRSRLAARF 2162

2163 SRDGKDLIWADYGPHYVKVRRVSTLELFSAKRLEELRPIREDEVTFMAES 2312

2313 IFKDCTNP 2336 (1)

4368 ENHGKSLLVKKYLGDVAFNNITRLAFGKRFMNSEGIIDEQGQEFKAIVSN 4517

4518 GVRLGGSLTMAEHIPWLQWMFPLEEEAVEKHNARRDGLTRVIMEEHTNAR 4667

4668 KKSGGAKKHFVDALLTLQEKYDLSEVTIAGLLW 4766 (0)

4904 DMITAGMDTTAISVEWAMAELLKNPRVQQKAQDELDRVVGFERVMTEADF 5053

5054 PNLPYLQAVVKESLRLHPPTPLMLPHRASTTVKIGGYDIPKGSVVHVNVW 5203

5204 AVARDPALWKNPLEFRPERFFEEDVDMRGHDFRLLPFGAGRRVCPGAQLG 5353

5354 INLVTSIIGHLLHHFHWTTPDGVKPEEIDMSERPGLVTYMMTPLQAVATP 5503

5504 RLPSHLYKRMASDM* 5548

>CYP98A25

scaffold_3616 (+) 3009-5285

eugene3.36160002|Poptr1

gene model correct

98A like 74% to 98A3

93% to scaffold_1454, 92% to LG_XVI (-) 1542608, 81% to LG_VI (-) 1982315

$

3009 MALPLLVLVSIFVLVLAYILYQRLRFKLPPGPRPWPIVGNLYDVKLIMFRCFAE 3170

3171 WAQAYGPIVSVWFGSTLNVVVCNAELARQVLKENDQQLADRHRTRFLARF 3320

3321 SRGGEDLIWADYGPHYVKLRKVSTLELFSAKRLEELRPIREDEVSFMAES 3470

3471 IFKDCTNP 3494 (1)

4106 ENHGKILLVKKYLGDVAWNNITRLAFGKRFMNSEGIIDEQGQ 4231

4232 EFKAIVSDGFRLGASHSMAEHIPWLQWMVRLEEEAFAKLNARRDRLVRSI 4381

4382 MEEHNNARKKSGGAKNHFVDALLTLQEKYDLSEVTFISLLW 4504 (0)

4641 DMISAGMDTTAISVEWAMAELLKNPRVQQKAQDELDRVVGFERVMTEADF 4790

4791 PNLPYLQAVVKESLRLHPPTPLMLPHRANTTVKIGGYDIPRGSVVHVNVW 4940

4941 AVARDPALWKNPLEFRPERFFEEDVDMRGHDFRLLPFGAGRRVCPGAQLG 5090

5091 INLVTSIIGHLLHHFHWTTPDGVKPEEIDMSERPGLVTYMMTPLQAVATP 5240

5241 RLPSHLYKRMASDM* 5285

>CYP98A25

scaffold_21067 (+) 515-913

eugene3.210670001|Poptr1

exon 2 only

98A like 100% to scaffold_3616 (+) 4923 duplicate seq

$

515 ENHGKILLVKKYLGDVAWNNITRLAFGKRFMNSEGIIDEQGQ 640

641 EFKAIVSDGFRLGASHSMAEHIPWLQWMVRLEEEAFAKLNARRDRLVRSI 790

791 MEEHNNARKKSGGAKNHFVDALLTLQEKYDLSEVTFISLLW 913 (0)

>CYP98A26

scaffold_3616 (+) 3-478

eugene3.36160001|Poptr1

no comment

98A like runs off the end of the clone

95% to scaffold_1454, 93% (9aa diffs) to scaffold_3616 (+) 4923

possible tandem duplication of the full length gene on this scaffold.

$

  3 AVVKESLRLHPPTPLMLPHRASTTVKIGGYDIPKGSVVHVNVWAVARDPAL 155

156 WKNPLEFRPERFFEEDVDMKGHDFRLLPFGAGRRVCL 266

269 GAQLAINLVTSMIGHLLHHFHWTTPDGVKPEEIDMSERPGIVTYMMTPLQ 418

419 AVATPRLPPHLYKRVASDM* 478

>CYP98A27

LG_VI (-) 1982315-1979658

estExt_fgenesh1_pm_v1.C_LG_VI0711|Poptr1

gene model correct

98A like 81% to 98A3

83% to LG_XVI (-) 1542608, 83% to scaffold_1454, 81% to scaffold_3616

$

1982315 MNLLLIPISFITLLLTYKIYQRLRFKLPPGPRPWPIVGNLYDVKPVRFRC 1982166

1982165 FAEWAQAYGPIISVWFGSTLNVIVSNTELAKEVLKENDQQLADRHRSRSA 1982016

1982015 AKFSRDGKDLIWADYGPHYVKVRKVCTLELFSPKRLEALRPIREDEVAAM 1981866

1981865 VESIFNDCTNP 1981833 (1)

1980833 ENNGKTLTVKKYLGAVAFNNITRLAFGKRFVNAEGVMDEQGLEFKAIVSN 1980684

1980683 GLKLGASLAMAEHIPWLRWMFPLEEDAFAKHGARRDRLTRAIMDEHTLAR 1980534

1980533 QTSGGAKQHFVDALLTLKEKYDLSEDTIIGLLW 1980435 (0)

1980296 DMITAGMDTTAISVEWAMAELIKNPRVQQKAQEELDSVVGFERVMTEADF 1980147

1980146 SGLPYLQCVAKEALRLHPPTPLMLPHRANANVKVGGYDIPKGSNVHVNVW 1979997

1979996 AVARDPATWKKPLEFRPERFLEEDVDMKGHDFRLLPFGAGRRVCPGAQLG 1979847

1979846 INLVTSMLGHLLHHFCWTPPEGMKPEEIDMSENPGLVTYMTTPLQAVATP 1979697

1979696 RLPSHLYKRVAVDI* 1979658

 

 

>CYP701A11

LG_II (-)  9774605-9770969

fgenesh1_pg.C_LG_II001196 [Poptr1:347690] N-term

join with eugene3.00021204 [Poptr1:551889] C-term

68% to 701A3 8 exons not CYP71 clan

$

9774065 MDVATSILPAFQAMPYATPAAVGGLVFAVFFINKFISNQKKGNPNLLPLP 9773916 (1)

9773837 VVPGWPVIGNLLQLKEKKPHKTFLRWAEAYGPIYSIKTGASTVIVLNSTEVAKE 9773676 (0)

9772673 AMVTRYSSISTRKLSKALEVLTDNKSMVATSDYGDFHKMVKRYILTNVLGAGAQ 9772512 (0)

9772405 RRHRGHRDTLVENVSSQLLDHIKTNPQLQAVDFREIFESELFGLSMKE 9772262 (0)

9772140 ALGKDMESLYVDELQATLSREEIFNVLVLDPMEGAIDVDWRDFFPYLRW 9771994

9771993 IPNKGFEMKIERMNFRRQSVMNALVQEQKKRIASGE 9771886 (0)

9771805 EINCYIDYLLSEGKTTLTEKQIGMLVWETIIETSDTTMVTTEWAMYELAKNPKCQ 9771641 (0)

9771557 DRLYHEIQNVCGSEKLKEEHLSQLPYLNAVFHETIRKYSPAPIIPLRYAHEDTQIGGYYVPAGSE 9771363 (0)

9771283 IAINIYGCNMDKKRWENPEEWKPERFLDGKYDPMDLHKTMAFGAGKRSC 9771137

9771136 AGALQASLIASATIGKVAQEFEWRLKDGEEEHVDTVGLTTRKLQPLHVMIKTRNV* 9770969

 

>CYP703A4

LG_II (-) 13208335-13206633

fgenesh1_pg.C_LG_II001592 [Poptr1:348086]

gene model correct

703A like 78% to 703A2

$

13208335 MDIIATLFSLLLFLVIVANFILRWGNLKSQHKSKRLPPGPPRLPVFGNLL 13208186

13208185 QLGQQPHRDLASLCDKYGPLVYLRLGSVDAITTNDPEIIREILVRQDEVF 13208036

13208035 ASRPRTLAAVHLAYGCGDVALAPLGPHWKRMRRICMEQLLTTRRLESFAN 13207886

13207885 HRADEAQHLVMDVWSRTQTGKPLSLREVLGAFSMNNVTRMLLGKQYFGAE 13207736

13207735 SAGPQEAMEFMHITHELFRLLGVIYLGDYLPFWRWIDPHGCEKKMREVEK 13207586

13207585 RVDDFHNKIIEEHRKTRKTKRKETGEEDKDMDFVDVLLSLPGENGKEHMD 13207436

13207435 DVEIKALIQ 13207409 (0)

13207271 DMIAAATDTSAVTNEWAMAEVIKHPRVLSKIQQELDSVVGPNRMVTESDL 13207122

13207121 AHLNYLRCVVRETFRMHPAGPLLIPHESLRATTINGYHIPDKTRVFINTH 13206972

13206971 GLGRNTKLWADVEEFRPERHWLADGSRVEISHGADFKILPFSAGKRKCPG 13206822

13206821 APLGVTLVLMALARLFHCFDWTPPEGLSPEDIDTTEVYGMTMPKAKPLLA 13206672

13206671 MARPRLAEHMYH* 13206633

>CYP703A5P

LG_XIV (-) 3557159-3556743

eugene3.00140448|Poptr1

N-term gene model wrong

703A like pseudogene 76% to 703A4

$

3557159 MDLVAAQCFILLFV 3557115

3557118 GYLKSQHKSIRLPPGPPRLPVFGNLLQLGQQPHQDVASLCDK 3556993

3556991 KRIESIANHRAGEAQKLVQDVWA*SQTEKPVSLREVLGAFSMNNVTRMLL 3556842

3556841 SKQYFGAESAGPREAMEFIHA*HELFRLIYLGY 3556743

 

>CYP705B1

LG_IX (+) 6276537-6278244

fgenesh1_pg.C_LG_IX000935|Poptr1

gene model seems correct

705A like 46% to 705A2

97% to LG_IX (+) 6288042

$

6276537 MIAIQYVLAIFVLWVITVFLQFIFKRPGKKPAGYCPPPSPPTLPLIGHLH 6276686

6276687 LLTPVAYKGFHALNNKYGPLLYLRLATYPAVLVSSAPLATEIFKALDVHF 6276836

6276837 TSRIKSPFEDNLLFGSSTSFFNAPYGDYWKFMKKICTTELLGTRQMKKLK 6276986

6276987 NVRREEVVRFLSKMLEIGQKHEVANVSAEVLTLANNSTCRMIMSARCSGE 6277136

6277137 DNQAEKCRGLVSESFDLAAKLALFSVFGPLKRIGTWYLRKKIADVPRRYD 6277286

6277287 ELFENVLVEHEEKAKREGPHMENKDLMDILLEVYHDKNAEIRITRKQMKTFFL 6277445 (0)

6277615 DLFTGGTNTTSDAILWILAELVNHPAAFKKLREEIDSAVGTERLVDEEDI 6277764

6277765 PNLPYFQACVKEAMRLNPPVPLFDRICGENCKLGGYDIPKGITMIMNAYS 6277914

6277915 IMRDPKIWENPNDFIPERFLTEQDNAEGQNLQVYVPFGGGRRMCPGTNMT 6278064

6278065 SSLINCSVTAMVQCFDWKVLGGDGPDGSKVNMDSKSGVVKSMDKPFVAIP 6278214

6278215 VLRRNLFSA* 6278244

>CYP705B2

LG_IX (+) 6288042-6289749

estExt_fgenesh1_pg_v1.C_LG_IX0927|Poptr1

gene model correct

705A like 46% to 705A2

97% to LG_IX (+) 6276537 87% to LG_I  (-) 19703740

$

6288042 MTAIQYVLAIFILLFITVFLQFIFKRPGKKPAGYCPPPSPPTLPLIGHLH 6288191

6288192 LLTPVAYKGFHALNNKYGPLLYLRLATYPAVLVSSAPLATEIFKALDVHF 6288341

6288342 TSRIKSPFEDNLLFGSSTSFFNAPYGDYWKFMKKICTTELLGTRQMKKLK 6288491

6288492 NVRREEVVRFLSKMLEIGQKHEVANVSAEVLTLANNSTCRMIMSARCSGE 6288641

6288642 DNQAEKCRGLVGESFDLAAKLALFSVFGPLKRIGIWYLRKKIADVPRRYD 6288791

6288792 ELFENVLVEHEEKAKREGPHMENKDLMDILLEVYHDKNAEIRITRKQMKTFFL 6288950 (0)

6289123 DLFTGGTNTTSDAILWILAELVNHPAAFKKLREEIDSAVGTERLVDEEDI 6289272

6289273 PNLPYFQACVKEAMRLNPPVPLFDRICGENCKLGGYDIPKGITMIMNAYS 6289422

6289423 IMRDPKIFENPNDFIPERFLTEQDNAKEQNLQVYVPFGGGRRMCPGTNMT 6289572

6289573 SSLINCSVTAMVQCFDWKVLSGDGPDGSKVNMDSKSGVVKSMDKPFVAIP 6289722

6289723 VLHSNLFSA* 6289749

>CYP705B3P

LG_IX (+)  6356567-6357732

fgenesh1_pg.C_LG_IX000946|Poptr1

gene model wrong 57% to LG_IX (+)  6358443

705A like pseudogene 48% to 705A12

EXXR motif mutated

$

6356567 LMNTTSDTPSLHYLQAAVKGGLRLHPPIPITR 6356659

6356660 RLRGDGCKIGEFGLPEETAVLINLYSIPRDPEAWDNPDEFCPQRFLV 6356800

6356801 CPVEQGNEMETKKGQNFGFVLFGGGRRRCPGAKLAFILMNTTVAAMVQCLFGRL 6356962

6356963 VQMKMEQSLT 6356992

second C-term piece

6357649 KKKRYFNFVPFGWGRRICTGSNMAFSLM 6357732

>CYP705B4P

LG_IX (+) 6358443-6360623

fgenesh1_pg.C_LG_IX000947|Poptr1

gene model short at N-term frameshift, insertion

705A like pseudogene

57% to LG_IX  X         (+)  6369234

$

6358443 MAAMTDVEYYFITFLLVLTSTFILQYILRRLTKHSTHLCLPPSPPALPLI 6358592

6358593 GHLHYLSPAA 6358622

6358624 INACTLHNLCSKYGPLLYLRLGSFPVLLVSSASMANEIFKTHDLNFAYKP 6358773

6358774 KSPFEDSILFGTSSFRHAPYGDYWRFMKKLCLTELLGARQLERSRGVRRE 6358923

6358924 ELVRFLRKAFEKAKKKEVVDLSKEIMTLTNNITYRMVMSARCSGQDNDVE 6359073

6359074 KCVGLVRESFQLVAKMTLANLLGPLRKVGVFFFGEQLLDVPRRFDELLER 6359223

6359224 IMEEHEERARRDGGEIENKDLMDIVLEAHHDKDAEVKISRTQMKSFFL 6359367 (0?)

6359458 DLFFGGTSTTAHSMQWLMAEMINHPQVFKKLREEIDSLVGRNRLVEDSDI 6359607

6359608 PSLHYLQAVVKETLRLHPP 6359664

6360174 SIITRLSLEDCKFGGFDVP* 6360233

6360234 GTLAVVNSHSVMRDPEVWDNPDEFYPERFLLAIPKEEADDKMGRKGQDLN 6360383

6360384 FWSFGGGRRKCPGVNLAFSLINATVAAMVQCFDWKLDGAEYMARANMEVT 6360533

6360534 SGVTMSMAHPLLCLPVVHFNPFNTPTKDN* 6360623

>CYP705B4P

scaffold_4756 (-) 3708-3244

fgenesh1_pg.C_scaffold_4756000001|Poptr1

duplicate seq

705A pseudogene 1aa diff to LG_IX (+)  6360333

$

3708 RFDELLERIMEEHEERARRDGGEIENKDLMDIVLEAHHDKDAEVKISRTQMKSFFL 3541 (0?)

3450 DLFFGGTSTTAHSMQWLMAEMINHPQVFKKLREEIDSVVGRNRLVEDSDI 3301

3300 PSLHYLQAVVKETLRLHPP 3244

>CYP705B5

LG_IX (+) 6367706-6369461

eugene3.00091000|Poptr1

gene model seems correct

705A like 45% to 705A2

92% to LG_I 19702300

$

6367706 MTVIQYFLAFFVLWFITIFLQYIFKRTGKKPAGYCPPPSPPTLPLIGHLH 6367855

6367856 LLTPVAYKGFHALNNKYGPLLYLRLVTYPAVLVSSAPVATEIFRAQDVHF 6368005

6368006 ASRIKSPFEDNLLFGSSTSFFNAPYGDYWKFMKKICMTELLGTSQMKKLK 6368155

6368156 NLRREEVVRFLSKMLEMGKKNEGADLSAEVLTLANNSTCRMIMSARCSGE 6368305

6368306 DNQADKCRELVSESFDLAAKLAVCNLFGPLKRIGIWFLRKKIADVPRRYD 6368455

6368456 ELFENVMVEHEEKAKREGPHLENKDLMDILLEVYHDKNAEMRITRKQMKTFFL 6368614 (0)

6368832 DLFTGGTSTTADAILWILGELVNHPAAFKKLREEIDSVVGTERLVDE 6368972

6368973 ADIPNLPYFQACVKEAMRLHPPVPLFDRVCREDCKLAGYDIPKGITMIMN 6369122

6369123 AYSIMRDPKIWDNPNDFIPERFLKEEENTKGQNLQVYVPFGGGRRMCPGT 6369272

6369273 NMSSSLINGSVTAMVQCFDWKVVGGDGPDGSKVNMDTKAGVTMSLDKPFL 6369422

6369423 SNPVLHRNLFSA* 6369461

>CYP705B6

LG_I (-) 19703740-19702073

fgenesh1_pg.C_LG_I001940 [Poptr1:64588]

gene model seems correct

705A like 44% to 705A2

92% to LG_IX (+)  6369234

$

19703740 MTAIQYVIALFVLWFITVFLQYIFKRPGKKPAGYCPPPSPPTLPLIGHLH 19703591

19703590 LLTPVAYKGFHALNNKYGPLLYLRLATYPAVLVSSAPVATEIFKAQDVHF 19703441

19703440 ASRIKSPFEDNLLFGSSTSFFNAPYGDYWKFMKKICMTELLGSSQMKKLK 19703291

19703290 NVRHEEVVRFLSKMLEIGQKNDVADLSAEVLTLANNATCRMIMSARCSGE 19703141

19703140 DNQADQCRGLVSESFDLAAKLAVCNLFGPLKRIGTWYLRKKIAAVPKRYD 19702991

19702990 ELFENILVEHEEKAKRGGPHMENKDLMDILLEVYHDKNAEMRITRKQMKTFFL 19702832 (0)

19702705 DLFTGGTSTTADAVLWILGELVNHPASFKKLREEIDSVVGTERLA 19702571

19702570 DEADIPNMPYFQACVKEAMRLHPPVPLFDRVCREDCKLAGHDIPKGITMI 19702421

19702420 MNAYSIMRDPKIWDNPNDFIPERFLTEHDSTKGP 19702319

19702318 QNLQIYVPFGGGRRMCPGTNMSSSLINCSVSAMVQCFDWKVVGGDGPDGS 19702169

19702168 KVNMDTKAGVTMSLDKPFMSTPVLHRNLFSA* 19702073

>CYP705B7P

LG_XVI (+) 7802640-7803110

no model

no comment

705A like no model at JGI

45% to 705A16 N-term, two frameshifts, no C-term, probable pseudogene

54% to LG_IX  (+)  6360333 705A like

$

7802640 MASIIDMNTYIHINNYIFLLFCMILTILPQFIFKKLTKATTNTKLHLPPS 7802789

7802790 PPALPVIGHFHLFTLALYKCFYNLSSKL 7802873

7802875 YGPLLYLRLGPSHCLLVSSASMATEIFQINDLAFSSRPXXXXXXX 7802988

7803015 LPCGTSGFITALYGDYWKFMKKLFVTELLGPK 7803110

 

>CYP706B3

scaffold_127 (-) 281038-279097

eugene3.01270031|Poptr1

no comment

706B like 52% to 706B1

55% to 706B2

$

281038 MLNTVTGLWSRWWDASNERQKLFLIMAVTIITMFWFLWNNIKPKKAV 280898

280897 AAPFPPGPRGLPLVGYLPFLGNDLHKKFTELAGVYGPIYKLRLGNKLCMV 280748

280747 VSSPPLAKEIARDKDTIFADRDPPISARVLSYGGNDIAWSSYSPQWRKMR 280598

280597 KVLVREMLGNSLDASYALRKQEVKKAIREVYNKIGNPIDFGELAYVTSLNT 280445

280444 VLRILLGGGTIQGEKWTNFVAQFRCHAAEMMVLLGKPNVSDLFPVLARYD 280295

280294 LQGIERRSKRLAVTLDEFLESAIEQRLNEEK 280202

280201 ARMDVREDLLQILLDLNKHEDTATSITMDQLKAMLM (0)

279723 DIFVGGTDTTTTMIEWTMARLMQHQEVRQKVYQELQEVVGANNTVEEFHL 279574

279573 PKLRYLDAVMKETFRLHPALPLLVPRFSGQSCTLGGYTVPKGTTVFLNVY 279424

279423 AIHRDPNLWDNPLEFRPERFLNDD 279352

279351 TSTFDYSGNNFQYLPFGSGRRVCAGLRLAEKMLMFLQASLLHSFEWKLPV 279202

279201 GGVLELSDKYGIVVKKKKPLIVIPTPRLCNLELY* 279097

>CYP706C5

scaffold_70 (-) 879822-876621

fgenesh1_pg.C_scaffold_70000124 [Poptr1:95599]

no comment

706C like 75% to scaffold_127 288016

47% to 706B1, 56% to 706C4

$

879822 MKRSSSLPPGPRGLPLIGNLASLEPDIHSYFAKLAQTHGPIFKLQLGSKL 879673

879672 GIVVTSPSLASEVLKDHDITFANRDIPDVSRAMDYGRSNIVATPYGPEWR 879523

879522 MLRKVCVAKMLSNATLDSLYPLRSREVRNTIKYIYSHAGSPINVGDQLFL 879373

879372 TVFNVVTSMLWGGTVLGKDRASLGAEFRGVVAEMTELLSKPNVSDFFPSL 879223

879222 ARFDLQGVVKKMRGLAMKFEQIFEKMIDKRLKVDENGTRDAARSRSIECE 879073

879072 DFLGFLLKLKDEGDPKTPLTMTHVKALLM 878986 (0)

877237 DMVVGGTETSSNAVEFAMAEIMRKPEVMRKAQQE 877146

877145 LDEVIGKDRMVQESDINKLPYLYAIMKESLRLHPVLPLLVPHCPSQTCTV 876996

876995 GGYTIPKGVRVFVNVWAIHRDPTVWENPLDFNPERFLNGSSKWDYSGSDL 876846

876845 SYFPFGSGRRSCAGIAMAERMFMYFLATLLHCFDWELPEGKEPDLSEKFG 876696

876695 IVIKLKNPLVVIPAPRLPDPNLYE* 876621

>CYP706C6

scaffold_127 (-) 288016-285624

estExt_fgenesh1_pg_v1.C_1270033|Poptr1

no comment

706C like 55% to 706C1

$

288016 MTPLTSTIATLLTLFAIIWYARRRAESK 287933

287932 KGRPSLPPGPRGLPLIGNLASLDPDLHTYFAGLARTYGPILKLQLGSKLG 287783

287782 IIVSSPNLAREVLKDHDITFANRDVPDVARIAAYGGSDIAWSPYGPEWRM 287633

287632 LRKVCVLKMLSNSTLDSVYELRRREVRNIIAYIYSKPGSPINVGEQTFLT 287483

287482 ILNVVTSMLWGGTVQGEERGSLGAEFRRVVADMTELVGAPNISDFFPALA 287333

287332 RFDLQGLVKKMSGLAPKFDQIFDRMIEKQLSIDALGDTAGASS 287204

287203 KDFLQFLLKVKDEGDVKTPLTMTHIKALLM 287114 (0)

286244 DMVVGGSDTSSNAIEFAFAEVMNKPEVMRKAQDELDRVVGKDNIVEESHI 286095

286094 HKLPYLHAIMKESLRLHPVLPLLIPHCPSETCTIGGFSVPKGARVFINVW 285945

285944 AVHRDPSIWENPLEFKPERFLN 285879

285878 SKFDYSGSDFNYFPFGSGRRICAGIAMAERMFLYFLATLLHSFDWKLPE 285732

285731 GKQMDLTEKFGIVLKLKNPLVAIPTPRLSNPALYA* 285624

>CYP706D1

LG_III (+) 11000576-11004081

fgenesh1_pg.C_LG_III000920|Poptr1 duplicate seq.

no comment

706A like 98% to scaf_796

50% to 706B1

$

11000576 MSSSTICGPWSWFCKGDQDNEDILLPIILLAVSVTILGTCLFQWGFKKQRET 11000731

11000732 ADKLPPGPRGLPIVGYLPFLGPNLHQLFMELAQTYGPIYKLSIGRKLCVI 11000881

11000882 ISSPALVKEVVRDQDITFANRNPTIAAKTFSYGGKDIAFQPYGPEWRMLR 11001031

11001032 KILLREMQSNANLDAFYSLRRNKVKESVNETYRKIGKPVNIGELAFSTVI 11001181

11001182 SMISGMFWGGTLEVDTEIDIGSEFRAAASELIEILGKPNVSDFFPVLARF 11001331

11001332 DIQGIERKMKKATQRIEKIYDFVMDE 11001409

11001410 WIEKGSARVESEAKNDQRKDFMHFLLGFKEQDSRRSISREQIKALLM (0) 11001550

11003455 DIVVGGTDTTSTTVEWAMAEMMLHPEVMKNAQKELTDAVGTDEIVEERHI 11003604

11003605 DKLQFLHAVVKETLRLHPVAPLLLPRSPSNTCCVGGYTIPRNAKVFLNVW 11003754

11003755 AIHRDPKFWDNPSEFQPERFLSDVSRLDYLGNNMQYLPFGSGRRICAGLP 11003904

11003905 LGERMLMYCLATFLHMFKWELPNGERADTSEKFGVVLEKSTPLIAIPTPR 11004054

11004055 LSNLNLYA* 11004081

>CYP706D2

scaffold_796 (+) 8760-12990

fgenesh1_pg.C_scaffold_796000001|Poptr1

no comment

706A like 49% to 706A5

50% to 706B1, 49% to 706A5, 45% to 706C1

$

 8760 MSSSTICGPWSWFCKGDQDNEDMLLPIILLAVSVTILGTCLFQWGFKKQR 8909

 8910 ETADKLPPGPRGLPIVGYLPFLGPNLHQMFMELALTYGPIYKLSIGRKLC 9059

 9060 VIISSPALVKEVVRDQDITFANRNPTIAAKTFSYGGKDIAFQPYGPEWRM 9209

 9210 LRKIFVREMQSNANLDAFYSLRRNKVKESVNETYRKIGKPVNIGELAFST 9359

 9360 VINMISGMFWGGTLEVDTEIDIGSEFRAAASELIEILGKPNVSDFFPVLA 9509

 9510 RFDIQGIERKMKKATQRIEKIYDFVMDEWIEKGGARVESEAKNDQRKDFM 9659

 9660 HFLLGFKEQDSGRSISREQIKALLM 9734 (0)

12364 DIVVGGTDTTSTTVEWAMAEMMLHPEVMKNAQKELTDAVGTDEIVEERHI 12513

12514 DKLQFLHAVVKETLRLHPVAPLLLPRSPSNTCCVGGYTIPRNAKVFLNVW 12663

12664 AIHRDPKFWDNPSEFQPERFLSNVSRLDYLGNNMQYLPFGSGRRICAGLP 12813

12814 LGERMLMYCLATFLHMFKWELPNGERADTSEKFGVVLEKSTPLIAIPTPR 12963

12964 LSNLNLYA* 12990

 

>CYP712A3v1

scaffold_152a (+) 143579-145208

eugene3.01520021|Poptr1

gene model seems correct duplicate seq.

712A like 71% to 712A1 only 4aa diffs to scaffold_4672

$

143579 MFYYLIFLLWFVTALLAHFFIKIFLRSRSQNNLPPSPPALPVIGHLHLIG 143728

143729 SVLAKSFQTLAVRYGPLMQIRLGASTCVVASNAVVAKEIFKTQDINFSSR 143878

143879 PEFGSSEYFIYRGSRFVTAQYGDYWRFMKKLCMTRLLSVPQLEKFTDILD 144028

144029 EEKVKLVESVMGCAREGKLCDLSGEFTALTNNTICRMTMSTRCSGSNNDA 144178

144179 DKIERLVKTCLQLAGKLSLGDVLGPFKIFDFSGNGKKLVGALQAYDRLVE 144328

144329 RIFKEHEEKADKGFKEGERKDLMDILLEIYNDPTAEIKLSKNDIKSFLL 144475 (0)

144579 DLFFAGTDTSATAMQWAMGELINNPKAFKRLRDEINTVVGPNRLVKESDV 144728

144729 PNLPYLKAVMRETLRLHPSAPLIIRECAEDCKVNGSVVKAKTRVLVNVYA 144878

144879 VMRDPESWANPDEFMPERFLESSEEKIGEHQMEFKGQNFRFLPFGSGRRG 145028

145029 CPGASLAMMIMHAAVGALVQCFDWKIKDGKEVDLTLGPGFAAEMAHPLVC 145178

145179 YPIKHMNAY* 145208

>CYP712A3v2

scaffold_4672 (-) 2892-1263

eugene3.46720001|Poptr1

gene model seems correct

712A like 71% to 712A1

4 aa diffs to scaffold_152  (+) 143579 duplicate seq

$

2892 MFYYLIFLLWFVTALLAHFFIKIFLRSRSQNNLPPSPPALPVIGHLHLIG 2743

2742 SVLAKSFQTLAVRYGPLMQIRLGASTCVVASNAVVAKEIFKTQDINFSSR 2593

2592 PEFGSSEYFIYRGSRFVTAQYGDYWRFMKKLCMTRLLSVPQLEKFTDILD 2443

2442 EEKVKLVESVMGCAREGKLCDLSGEFTALTNNTICRMTMSTRCSGSNNDA 2293

2292 DKIERLVKTCLQLAGKLSLGDILGPFKIFDFSGNGKKLVGALQAYDRLVE 2143

2142 RIFKEHEEKADKGFKEGERKDLMDILLEIYNDPTAEIKLSKNDIKSFLL 1990 (0)

1892 DLFFAGTDTSATAMQWAMGELINNPKAFKRLRDEINTVVGPNRLVKESDV 1743

1742 PNLPYLKAVMRETLRLHPSAPLIIRECAEDCKVNGSVIKAKTRVLVNVYA 1593

1592 VMRDPESWANPDEFMPERFLE SSEEKIGEHQMEFKGQNFRFLPFGSGRRG 1443

1442 CPGASLAMMVMHAAVGALVQCFDWKIKDGKEVDLTLGPGFAAEMAHPIVC 1293

1292 YPIKHMNAY* 1263

>CYP712A4P

LG_X (-) 19404794-19403073

fgenesh1_pg.C_LG_X002071|Poptr1

join with eugene3.00102217|Poptr1 same gene as above

712A pseudogene 70% to scaffold_4672

$

19404794 MAAPEISYYLPFFLGLITAVLSFVRTFFKYRSQIEAPPSPPSLPLIGHLH 19404645

19404644 LLGPVLP 19404624

19404622 NLANRYGPLMQIRLGTY 19404572

19404573 TCVIASNAAVAKEIFKTH 19404520

19404517 ELNFISLPEFGCSEYFIYRGSRFVTA* 19404437

19404436 YGDYWRFMKKLCMARVLSI 19404380

19404378 VPQLDKFSTDIREEERVKLFESVT 19404307

19404304 NCAREGRLCDLNRAFTAFTA 19404245

19404243 SDNIICGMAMSTGCSGSDNDAKKIKKMCETSTRLAGKLVIGDILGPFKKI 19404094

19404093 YSSRGRKLVGVLKYYDCLVERIIKEHEEKAKEGFERGDRKDLTGILLEIF 19403944

19403943 KDPAAEIRLSKNDIKSFLL 19403887 (0)

19403699 DMFFAVTDTTSVALEWAMAELINNPEIFKKLRDEISAVVGPNRLVKESDV 19403550

19403549 PNLPYLRAIIKETLRLHPPAP 19403487

19403487 APLIMRECTEDCRVNSCVIKAKTRAVTNVYAIMKDPNSWANPNEFMPEGFME 19403332

19403330 SEEKIGEHQMEFKAQNFRYLPFGNGRRGCPGASFAMLVTHATLGALVQC 19403184

19403183 CGWKIKDGEKIDLRPGPGFSAEMARSLVCNPIKHMK* 19403073

>CYP712C1

LG_XVIa (-) 3144892-3142631

fgenesh1_pg.C_LG_XVI000378|Poptr1

gene model seems correct

712A like 51% to 712A2

 80% to scaffold_152  (+)   146873, 48% to scaffold_152  (+) 143579

$

3144892 MAPSDHSFAYYCCLCITWSTIIIIVVHLFIKTCTSFCNKTRHPPSPLGLPIIGHLHLLSS 3144713

3144712 DLPNSLKTLASRYGPLMKIRFGSTPIYVVSDAKTAKEILKIHDVDFASKY 3144563

3144562 TLGFGLSKFDIYDGYTFFNAPYGTYWRFMKKLCMTKLFRGPQLDRFVHIR 3144413

3144412 EQETLKLLKSLVDKSREGKPCDLGEELSVFSSNIICRMVIGNICVEDPNL 3144263

3144262 PIEIRKLVGDIMENAAKFSFNEVFGPLNRFDLLGKGKRLVSATRKYDKLL 3144113

3144112 EQLMKKYEDNFDKLINSGDEEQKDVMIILMEAYKDTNAELKLTRTHIKKFFL 3143957 (0)

3143278 EIFFAGVETTATAMQSAITELINNPKAFMKLREEIHSVFGSNYRLLKESD 3143129

3143128 VPKLPFLQAVVKETLRLNPIATLRARQCDVDTRINGYDIKAGTRILINAY 3142979

3142978 AIMRDSDSWEKPDDFFPERFLADSMDT 3142898

3142897 NFDHHPTMDFKGDHDFHFLPFGSGRRACIAASHGLIVTHATIGALVQCFD 3142748

3142747 WEVKDDAKIDNEMATGYSGSRVLPLACYPITRFDPTNA* 3142631