The newest Human P450 gene CYP2W1 


CYP2W1 AC073957.3 chromosome 7 clone RP11-449P15 40% to 2F1
MALLLLLFLGLLGLWGLLCACAQDPSPAARWAPGLRPLPLVGNLHLLRLSQQDRSLME 
LSERYGPVFTVHLGRQKTVVLTGFEAVKEALAGPGQELADRP
PIAIFQLIQRGGGIFFSSGARWRAARQFTVRALHSLGVGREPVADKILQELKCLSGQL
DGYRGRPFPLALLGWAPSNITFALLFGRRFDYRDPVFVSLLGLIDEVMVLLGSPGLQL
FNVHPWLGALLQLHRPVLRKIEEVRAILRTLLEARRPHVCPGDPVCSYVDALIQQGQG
DDPEGLFAEANAVACTLDMVMAGTETTSATLQWAALLMGRHPDVQGRVQEELDRVLGP
GRTPRLEDQQALPYTSAVLHEVQRFITLLPHVPRCTAADTQLGGFLLPKGTPVIPLLT
SVLLDETQWQTPGQFNPGHFLDANGHFVKREAFLPFSA
GRRVCVGERLARTELFLLFAGLLQRYRLLPPPGVSPASLDTTPARAFTMRPRPRALCAVPRP*

This sequence is about 40% identical to 2F1

The following cDNA has been reported from Japan in a project to identify 
Full length cDNAs.  This is a part of the 2W1 gene.  The reported 
sequence shown below is not full length.  It is missing the N-terminal 
exon and the C-terminal exon. If one translates the sequence upstream of 
the ATG shown below, one finds the N-terminal exon sequence as shown 
above, however, there are only about 7 amino acids worth before the 
sequence runs out and stops. Similarly, if the genomic clone is searched 
downstream of the end of the cDNA, a clear heme binding sequence is 
found and another exon is identified.  The last exon has a problem.  It 
is too long if allowed to run until it hits a natural stop codon.  
However, in another frame there is a sequence LCAVPRP* that is identical 
to the end of CYP2D6 and this sequence is at the right location for this 
to be the end of the 2W1 gene.  I suspect there is a frameshift between 
the heme binding region and the LCAVPRP* sequence.  I have shown the 2W1 
gene with this frameshift, though the exact location is uncertain.


>dbj|AK000366.1|AK000366 Homo sapiens cDNA FLJ20359 fis, clone HEP16626
          Length = 2384

MELSERYGPVFTVHLGRQKTVVLTGFEAVKEALAGPGQELADRP
PIAIFQLIQRGGGIFFSSGARWRAARQFTVRALHSLGVGREPVADKILQELKCLSGQL
DGYRGRPFPLALLGWAPSNITFALLFGRRFDYRDPVFVSLLGLIDEVMVLLGSPGLQL
FNVHPWLGALLQLHRPVLRKIEEVRAILRTLLEARRPHVCPGDPVCSYVDALIQQGQG
DDPEGLFAEANAVACTLDMVMAGTETTSATLQWAALLMGRHPDVQGRVQEELDRVLGP
GRTPRLEDQQALPYTSAVLHEVQRFITLLPHVPRCTAADTQLGGFLLPKGTPVIPLLT
SVLLDETQWQTPGQFNPGHFLDANGHFVKREAFLPFSAGQQPSGPGWGGTSRAPGVGR
PQLRLPPLHPPPDLRF"

KEYWORDS    oligo capping; fis (full insert sequence).
SOURCE      Homo sapiens hepatoma cell_line:HepG2 cDNA to mRNA, 
clone_lib:HEP
            clone:HEP16626.
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; 
Mammalia;
            Eutheria; Primates; Catarrhini; Hominidae; Homo.
REFERENCE   1  (sites)
  AUTHORS   Kawakami,T., Noguchi,S., Itoh,T., Shigeta,K., Senba,T.,
            Matsumura,K., Nakajima,Y., Mizuno,T., Morinaga,M., Ota,T.,
            Suzuki,Y., Obayashi,M., Nishi,T., Shibahara,T., Tanaka,T.,
            Nakamura,Y., Isogai,T. and Sugano,S.
  TITLE     NEDO human cDNA sequencing project

This cDNA has been made into a refrence sequence and renamed
>ref|NM_017781.1| Homo sapiens hypothetical protein FLJ20359 (FLJ20359), mRNA
          Length = 2384