>CYP513A1 Seq. 8+53 complete same as 8b
MNYLVGLVLIFTIFYFFLQKNDKNMNSKIPGPKGIPILGNLLSMKGDLHLKLQEWYKQYG
VIYRIKMGNVETVVLTEYPIIREAFIGNSNSFVNRFQRKSRLKLNNGENLVIVNGDIHNK
LKTLVLSEMTNQRIKKYETSFIDNEIKKLFKVLDEHADTGKPIILNNHIKMFSMNIVLCF
TFGLNYSYPYDEFEKASEFIKLMVEFFNIAGQPIISDFIPSLEPFIDTSNYLNTYKRIFN
YTSDLITKFKNENEIHNNINDNNKSLADKPILSKLLQSFENGEISWDSVVSTCIDLQTAG
ADTSANTILYCLLELINNPNIQSKVYDDIKQAIIQSKENENQNDNENQEQTEEIITLSFN
KYRTLAPYLSMVVKETFRKYPSGTIGLPHVTSEDVELNGYKICAGTQIIQNIWATHRNEK
QFSEPDSFIPERFISQQQSANSNLIHFGCGVRDCIGKSLADSEIFTMLASLINRYEFTNP
NPSTPLNEIGKFGITYSCPENKIIIKKRF*

>CYP513B1 seq 49 complete seq 45% to seq 7, 50
MNLLVLSVILAIIIYLIFKR
NYKYSPSKINSKIPGPIGLPIFGNILSLDNKNGIHTTFQKWFKIYGPIYSVN
MGNKSAVVLTGFPIIKKAFIDNSEAFAPHYTFESRYKLNKCSDITQENGKNQSALKRIFL
SELTVTRIKKQESHIQNEIVKLMKVLDKHSEDGKPFLLNNYFSMFSINIISRFLFGID
FPYQDFEETSDLMVGIRDLLIASGEIVLSDFLPIPHSKRSKLYTSYQALVVQIETLV
KSHKYKEDDECMLSKLMIEHDKGNIPWDAVISNCNTIITAG
SDSTSSTALFFLIEMMNNPTIQTKVYNDIVVSFEQNQQADDYMNESMVILKYSKYRSLIPYLSLALKENYR
KHPAAPFGAPHETTQETVIEGYTIAKGTMIFQNIYATQRSDTFYSQPDEFIPERWNGDENSQTLIS
FGTGIRDCIGKSLAYNEIFTIIASVLNRYEFINPNPSIPFDDNGIPGLTTQCKNTVVQIKKR*

>CYP513F1 Seq 57 37% to seq 11 with EST SFG519
MILSLLFLFVITLYFLIPSR
ISKINKNIPGPIGYPIVGNLFQINKNVVKSIDGFYKEFGPVYRLRMGNIETVVLTGIDT
LEESFLFNKHSFVDRFVKKSRKINNGLDIIHSNGEYWKILKTIFQTQMTPRKIKSYQFEIQS
QVDLMAEQLYKSKNNDNIVTNINENMKFMLFNIMSILIFGKQSIY 
YDDDVDKEKKHIIFSIGRFFKTSGSLFYSDFIPILLPFDLINLSRNNFF 
KIFKVLTNFVSKNVNQQLSKLNDNNNNNKEKEGEERKSIVEAYLENYLNGEIKFESVL 
SSCTNLLLAGTDSSANTLSFLLVSLINNPEIQEKVYNEIITNLKNDEISINDRFKCPYTCAVIK 
ETHRLYSIAPLSEPHYCSNDVEIKGFKIAKGTQIIQNIYSSSRSEQYWDKPLSFIPERF 
IDNANIKEKNKNIVSFGLGLRGCIGKSFAEYMIFLTVVRLIKNYKFSNPSPNQPLKEIGEYGL
VMNCANYNAKIKKKINKKIK*

>513E1 seq 90+52+51 39% to seq 5+56; 42% to seq 8; 47% to seq 37 shorter match
MNLYISILILIISLIIFFKN (0) 
NNRISKINSKIPGPIRLPIFGNLLQINKDPHIQFQKWYEKYG
VIYSIRLGNIETVVFTGYPIFKKAFIENSQIFAPRFQHLSRFEAN
GCKNLIGSNDEIHSTLKKLILTEITSNKIKKMENHIVL
ECENLCKQLDKHCQDGLPFSLNMYFKLFSLNIILRFLFGTINNSYQDKSNQDIVDVI
IEFLHYGGNPIMSDFIPILKPFYKQNKFFKFYPILCDHLNKLIENYKNNKQLQKQQKQQQ
NEDDDDDDDGTIIGKLLKEYHNGKISWTSVVSTCVDVFLAGVDSTSNSTIFTLIALVNNS
NCQEKLFNEIKNNLKKSDDGHDEIVIRHSLYRSSI
PYLSLVMKEVYRLYSVILIGLPHITSEDVEIEGYKIAKGTQIIQNVFSTHLCEKTFPMSKSFI
PERFIETGSNNMFGGGQTNLVHFGTGVRDCVGKSLADCEIFTVLATLINRYQFINPTLEPLNDIGSFGIAYQPPINNFIIKKRL*

>CYP51 Seq 19 complete 26% to seq 8
MIGTIAVLVIAILVIFAFKKSPSNIPPIVETIPFIGCFYQFAKNPLQLVRNSYDRLGEIF
TLHLMGFKMTFVLGPEAQALFFRGTDEELSPKEAYRFVTPVFGKGVVYDSETEIMYEQLR
FVKNGLVLSQLKKAVGIIQEETEKYFETKWGDSGEIDLLYEMNKLTILTASRCLMGKSIN
KSLGQSGQLADLYHELEEGLNPISFFFPNLPLPSFKKRDAARAKVAAIFHSIIQERRRSTD
DSVDDVLYTLMNSKYKDGSVLEDEQIVGLMIGLLFAGQHTSSITLTYTIFYLLNNLEYFD
ETQKDINDIVQKENQGEINFDGLKRMNRLETVIREVLRLHPPLIFLMRKVMTPMEYKGKT
IPAGHILAVSPQVGMRLPTVYKNPDSFEPKRFDVEDKTPFSFIAFGGGKHGCPGENFGIL
QIKTIWTVLSTKYNLEVGPVPPTDFTSLVAGPKGPCMVKYSKKQK*

>CYP508A1 complete (old seqs. 1 and 2) 28% to seq 8
MALFEIIISLFVVYIIHNAISKYKKIHVNELCGPTPIPILGNLHQFGELPHRVLTKMTKK
YGHILRVYMADMYTVVVSDPLLIREMYVDNSDIFTDRVKKPSVEHGTFYHGTVTSYGEHW
KNNREIVGKAMRKTNLKHIYELLDKQVDVLIRSMKSIETSGKTFDTRYYITKFTMSAMFK
FLFNHDIPEDEDINKGDTQKLMGPMSEVFQNAGRGSLFDVINITQPLYLLYLEMFDQSFK
DIMKYHREKYNEHLKTFDPDVERDLLDILIKEYGTDNDDKILSILATINDFFLAGVDTSS
TALESMVLMLTNYPEIQEKAFDEIKTVVNGRSKVNLSDRQSTPYLVAVIKETLRYKPMSP
FGLPRSSSKDCMIGGHFIPKNAQILINYQALGMNEEYYENPEQFDPSRFLKVESNVAFLP
FSIGIRSCVGQSFAQDELYICISNILLNFKLKSIDGKKIDETEEYGLTLKTKNRFNVTLE
KRII*

>CYP516B2P seq 48 and related seqs 72% to CYP516B1
MFLILSLIIFWAFVA
FHKKRPKGLPPGPFPFPILGNLHQWGRSPFKSLKSFSAKFGGWPPIFWGG
VPPVLIGDPNFLREIFIKN

>CYP508A3 seq 21+67+72+82+87 57% to 508A1 458aa
MEFLKLILFLIIFYIIHNT (0) 
YIKFKKINK
NELKGPIPIPILGNLYQLTSGLPHRDLTKISEKYGGIYRFWFADLYTVVLS
DPILIREMFVNNGDYFLDRPKIPSIRHATHYHGIA
TSSGEYWLKIRDIINKAMRKTNLKLIYDSLDQQVDNLIESMNKIESDG
QVFEPRIYFKKYTMAAMYKFIFNEEINFNNEISELIGPIEQVFKDLGSGSLFDVLLISRPLYYQWIEHTDKNYPK
ILNFLKKKYHQHLKTYNPEIQRDLLDLLIKEYYSGSDDDILTIIATINDLFLAGT 
DTSSASLEYMVMMLVNYPEIQEK 
VYDEIKLTVNGRNKVLLSDRQFTPYTVSFIKETLRYKPPSSVGVPRTTSQDIIIGDKFIP
KDAQIFINYYGLSRNQDYFENPEQFEPSRFMNPDTNIAFLPFSIGTRNCV 
GQNFALDEMFLAFSNIILNFKFSSIDGKQIDETELYGVTLRCKNKFNVSIKKRI*

>CYP508A2 Seq (22+45+69+86+88) Complete sequence 62% to CYP508 
MIFGIIGYLFLIYILHNA
YSKYKRLNENQLPGPFPIPILGNIYQLTNL
PHFDLTKMSEKYGKIFRIYLADLYTVIVCDPIIARELFVDKFDNFIDRPKIP
SVKHGTFYHGTVASMGDNW
KNNKEIVGKAMRKTNLKHIYQLLDDQVDVLIESMRTIESSGETFDPRYYLTKFTMSAMFKYIFNEDISKDEDVH
NGQLAQLMKPMQKVFKDFGTGSLFDVLEITRPLYFLYLEWFTSHYYQVINFGKMKIYKHLETYKPDVQRDLMDLL
IKEYGTETDDQILSISATVSDFFLAGVDTSATSLELIVMMLINYPEYQEK
AYNEIKSALSSNGGGGGGGLTQRNKVLLSD
RQSTPFVVSLFKETLRYKPISPFGLPRSTTSDIILNNGQ
FIPKNAQILINYHALSRNEEYFENPNQFDPTRFLNSDSNPAFMPFSIGPRNCVGSNFAQDEIYIALSNMIL
NFKFKSIDGKPVDETQTYGLTLKPNPFKVILEKRK

>CYP517A1 Seq. 3 complete 37% to 508 484 aa
MEIINVFLFLIILFLVKDFVKKNKKIHTKSPSGPIAFPILGNVVQIRFWELFKIQEHELF
GGYSKKYNGVVRAWFGERLFFFVSNYDVVKYFQKDENFHNRPSVLVPGWRYASSNGLGVM
SSSDDKWKRAKSSVSQSLRVRTTKKLMEEKAIEF
IDSLEKISNNNEI 
FYPKGHIQGYACSMLFKYMFNQDLSVESGMSRTIGNAVEHVFGNLSKLTAF
DCFEIFSPLYDWFFTRRLKGCDIVRQIISSQNENHLKSIDPSKPRDLMDDLLIEYGLNEI
TKEDTMQINQICFDIFGPAVGTVTITMNWVILQLCNRPELQEIAYQEIKKAVKDDEYVNL
NHKQNAPYIVAFIKETMRLCSNGFGLPRTAKNDQICGDFFIPKDAIIFINYLEISQNEEI
FKNAKEFNPTRYLDESLPVPNIHFGVGQRACPGRFVAIDKMFLGISNLLLKYKLKSQNGE
KIDDTIHFSVSLKAKDYGIKLEKRI*

>CYP517A4 13 aa diffs with 517A1 ng5440 Contig_2215
MEIVNVLLFLIILFLVKDFVKKNKKIHTKSPSGPIAFPILGNVVQIRFWELFKIQEHELI
GNYSKKYNGVVRAWIGERLFLFVSNYDVVKYFQKDENFLYRPSLLVPGWRYASSNGLGVM
SSSDDEWKRAKSSVSQSLRVHTSKKLMEEKAIEFIDSLEKISNNNEIFYPKGHIQGYACS
MLFKYMFNQDLSVESGMSRTIGNAVEHVFGNLSKLTAFDCFEIFSPLYDWFFTRRLKGCD
IVRQIISSQNENHLKSIDPSKPRDLMDDLLIEYGLNEITKEDTMQINQICFDIFGPAVGT
VTITMNWVILQLCNRPELQEIAYQEIKKAVKDDEYVNLNHKQNAPYIVAFIKETMRLCSN
GFGLPRTAKNDQICGDFFIPKDAIIFINYLEISQNEEIFKNAKEFNPTRYLDESLPVPNK
HFGVGQRACPGRFVAIDKMFLGISNLLLKYKLKTQNGEKIDDSIQFSVSLKAKDYGIKLE
KRI

>CYP508A4 seq (66+70) complete 55% to CYP508
MIMLIKVFVLLLVVYILHNSYKKYKKLDKNELKG
PTPIPVLGNLHQLSSLPHRDLSKMTKDYGDIFRVWFADLY
TVVISDPVLIRKIYVENHESFRDRPKIP
SMKYGTYYHGTAASMGEDWVRNRGIVSSAMRKSNIKHIYEVINNQVDVLMSTMKKYEKR
SEPFEPRYYMTKYTMAAMFKYIFNEDIGEDEDIHTGEIQKIMGPMNQVMEDFGTGSLFDV
LEISQTFYLKWLELTEKNFPLLLKFFNGRYEQHLETIKPESPRDLLDILINEYGTNTHDD
YLNIASTVLDFFFAGTDTSSTTLEYLFLMMANYPEIQDKVHQEVKSYLKQIGKDKVELND
RQSLPYVVAVIKETLRFKPVTPFGVPRSCVNEITIDEKYFIPKGAQVIINYPSIFENEKY
FKNANQFDPSRFLQTTTTNTASNEESSFNSNLAFIPFSIGPRNCVGMQFAQDELFLAFAN
IVLNFTIKSVDGKKIDETISYGVTLKPKTRFKVLLEKRLI

>CYP519A1 Seq. 12 32% to 508 complete sequence
MESIINLIFYIIIFLILIDFLKKNISFRKNEPPRGGVAFPIFGDLPKLGENPHRYLTNLA
MKKGGIYSVWLGDEKVFILTDPEAVRDAWVKQFRNFSDHPKTKSVRIFSGNFNDMAFAEY
SQWKINSKWVSSAFTK TKLKTIGDLIEKESNYFIEHLKAYSNSGQP 
IFPKPYISKFGINVISGMMFSQVISKDESVDKGAMEKLTVPIQAVFKRLGADNLDDFISI 
LQPVFYFQNEKFKRQVQEIYDYLEG
IYNQHDTNLDTENPKDLMDLLIISTEG
KERDMIIHIGMDCLLAGSDSTSATCEWFCLFMINNP
DVQKKAYQELINALKDEDNKKFIPISKKDNCPYMLSIFKEVLRLRPVGVLGIPRVALEET
TIMGYTIPKGSQIFQNVYGMSHLFV
SDPYKFKPERWIEYK
KQKDLLKEKEMQQLQEGADVVIDNKNNIKNNNSSNKPNSKTNSIFDD
LDKVSIPYSVGNRKCPGASLSELALFSLCSNILLNFELKSIDGKPIDDTEVYGLTIHTKVHPISLTLRP*

>CYP519B1 Seq (35+44+75) complete seq 51% to seq 12 496 aa
MNLINLILYFILFWIVFDFIRKNRRISFNDPPSPWALPIIGHLHKLSLNPHRSLTELAKV
YGGVYSLHIGDSKTVVITDVSAFKDVTIKQFKNFANRPQPKSIRVITNFKGLAFADYDQW
QKTRKLVSSALTKTKIKTFNNLIEKQTENLIESMNEFSNKNELFHPRKYLTKYSLNIILS
MLFSKEIGKNESINKGTMERLTIPFNEAFKKVGKVDDFLWFLSPFFYFSNKQYKKYIFDI
YYFMEEIYDQHLLDLDYNEPKDLLDQLIIASQGREKETVILVGMDFLLAGSDTQKATQEW
FCLYLINNPDVQKKAYQELISVVGKDCKFVTSNHIENCPYFISIIKEVFRIRSPGPLGLP
RISIDDTYLSNGMFIPKGTQILLNIFGMGNLLVSEPDQFKPERWINYKNQQQQKQQQQQQ
QVNNKNSIDSSESSNLEFFDDLEKVSNPFSLGPRNCVGMAIAKSSIYSVCSNILLNFELS
SINNQIIDDNEVFGVSINPKEFSIKLTKR

>CYP521A1 Seq. 13 complete seq 36% to seq 12
MILLTLLYLIIFYIIIDFIKKNYKTKNQLPSPLGIALPIIGHLHLLRTDPYKTLAKASKK
TEHGILKCWNGEHLMVVVDNPSIIKQMYVNTNNFTDRPQTKVFEIISRNYKNSGFANGEK
WKHLRGLYAPSFTKIKSRPHENIILKYVNFEIKSLKNHAITNSIYNPFLIENINSFGTKV
ITEIIFGREFSENEVYSLIGPMNKLFGILDTPFPSESISFLKPFYRRSYKECDKQCEELF
KLVEKVYDDHLLNLDKDNPKDVMDVMIVETDFKEKDHVICICCDLLMGTKDTFNTIVLWF
FVLMINYQDVQLKGYQEIIK
VLECTGRDHVTIEDIDKLPYIDGIIKEISRIH PAGPLSVPRTAINDIMINGYFIPK
GCHVFQNTYGAVYNYMK
ESDEPCKMKPERWIENEKLRK
DGKLDPTNDLALISLPFSSGIRNCPGVGFAEYELFLLFSNIILNFHLSSPNNLKLNESGH
FGLTMKPFPFLVDLN*

>CYP519D1 Seq. (14+34) complete seq 38% to seq 12 492 aa
MNVFVLTVFICIIYLLFDL (0)
IKKNKKLKDEPPTPKLALPLIGHLYLLGDRPNRSFLELSKRYGG
IFKIWMGEYPTVVLTDPDHVNEVWCKQFLNFTNRPHFNSLDQFSSGFRNLSFSDYPLWSE
LRKLVSSSFTKSKVKGISNLLETQTNYLINTMNNYSINNKPFNPKKYIHKLTLNVVCMIA
FSKEIKNDEDVNEGDMARLTKPKEMILKHLGSSNFCDFVPLVRPLFYLKNKRFDQTLKQV
IEYIKEIYDDHLLNLDLNSSPKDIMDLLIMSTNDSKEDIIIHTCIDLLIAGSDTVGVTFR
VFRFIYPNNPIIQEKCFNELFNAFSNSNNTDNNNNNSTITAA
IGFGDEYSSKTPFLNACIKEVLRIKPVTSLGLPRIANDDTFVNGYRIPKGT
PIIENIYGLSNSDQLIDDPTTFNPYRWLEYQKLKS
FQNDLKQQQQQQQQQQQQQQQLQLQQEQQEQEQQKINLEFNNNNNNNNNNNNNNS
NNKHKYYNDLDKISIPFSTGRRGCVGVQLGEAELYIVCANLVYNFKIESWDGKKINELEDFG
IIIHPSSHNLKITKRNNK*

>CYP513A3 Seq. (7+50)complete seq 49% to seq 8
MTSLTLYLIIFSIILYLFVN
RNKRKNLKIPGPNGIPIFGNLLSLSGEMHLTLQEWYKTYGSVFSIRMGNIDTVVLT
EYPTIRKAFVDNSLAFASRYQLKSRVVLTGAKDLAIQNGEIHSLLKKVVLSEMTTTKIKRMEIHIIKE
TEKILKILDKHAERGEPFIINNYLNMFSMNVILRFLLGIDYPYENVDETVGYVKSIKSFFAVAGLPIL
SDFIPIPLKKSGVFFDSYKELEIETDKLIEKFKKSRNEKIENGTYNEEEDESILSKLLKEYEHGNITW
ECVSHTCIDIISAGTDTSANTLVMALIELINNQEIQSKAFSSIRSSCLNDSNDDDDDDEIVITHSKY
RSLLPYISMIIKETFRKHPIALLGLPHVTTEDVEIDGYKIEAGTYIIQNIFSSHRSDKI
FQSPNEFIPERFFESSQNQGLIHFGLGVRDCVGKSLAECEIFTLIATLLNRYQFINPNN
SKKLNDIGTFGLAQVCPDTNIILKKRI*

>CYP519C1 Seq (31+32+33) complete sequence 39% to seq 12
MNILLLIFYFLVCFLIFDF
IKKNKVKKYDVPTLSYALPIIGHLYKLGVNPHRNLTKLVEKNGGIFSLWLGDIKTVIVTDP 
SINKEI MVKQFTNFSDRPRLKSFESFTGGGVNLIFIDYNEKWPVIRKIVSSSITK 
TKIISNYKEVIENQTKILINSMRTHSKINEP 
FKSKKYFGKFSISIVLGIMFKQDNDEKQININDNNIDNDPIT
KLTEPIQQVFLLLGTGNISDFIKILRPFFKNEYKKLNNSAS
KVFKFMEEIYDQHLLKFDKSNPRDLMDYFIEYEFTNSPNTTLEEKKISIIKGCMSFVFAGDDTVAAT
LEWVCLYLINNPAIQEKCYNELISVLGDNNNESKIKFISLKERDNCQYLINVIKE
VLRIRTPLPLSVPRIATQNCEINGFFIEKGTQILSNAFGMSHLYVDEPNVFNPDRW
INYYNQKQQQQQQQQQPQPIQNNNYFNDLDRVCLPFSTGPRNCVGISIAELNLFSVCANI
ILNFQIKSIDGMQLKDIEVSGISIHPIPFSIKLISRN

>CYP508E1 seq (71+85) complete seq 38% to 508A1
MNIINIVIFLIIFYLFKSNYKKYIKKN
KFEVNGPFPLPIIGFTSNYIKPHIKCHELVKQYGDIFRV
YLGDNKTIMVSDYKIIEELFIKNHNSFLERPITPSF
SHCSDNQNGILLSNEKWVNNREMIQKAMKKGIVKSVYELLNKQINDLIQSVKPFSESG 
EPLNFRLFATRFTLSTMMTYIFNEPLSYNENLENGTVLYMF 
LENIFVLADVGHIGDYIS FLKPIYSLFLKLTDSNVPLARDYVYKKFYEHLKTIDNEKEE (2)
NYDLLHTFIKEVGIKDKESVKSIVSNSLDLLVAGTDTAAKGIEWIILRIANNQDVQELIFKELKSIVDSCGR
VEDRIYLSDRSSTPYLNATIKESMRITPITPYGIPRVVGKDLIIKG
HFIPKGSHVVINYRALNHDESIYKNPNQFNPNRFLDNNIESFIPFSIGNRNCVGQQIANH
ELFLFVSNFILNYKITPITNEPIDTTENFGINIRPNSFKINVYKRN*

>CYP508C1 seq 4, 23, 24, 83 complete seq 42% to seq 66 486 aa
MGPWG (0)
YIKNKRIHKNEAKGPIGFPLIGN 
MIQIGKTKPHIELMKLEKIYNQRILKIWLGDYYSVFLSD
IDLIKDIFINKFENFSSRPKSPLTRLGTNDFRGINGSSGETWFKNKNIIVNAMKRANTKTIYTLLDNQ
VNDLIKEISKFESQNKS (0)
FNPKYYFRKFVLSTMFKYIFNEDVPYDENLENGKLSELTMEMENIFKTLKVGKLAN
SIEILETPYYYYLQKTDKVFKNIKKLIIEKYKNHNLSINPEKPRDLLDILINEY
GTTDDDVLNITQVTLDMFMAGTDT (1)
TANTLEWIIIKLCNSPIHQEIAYNELKKVVSSKVIIDDSIKREITLSDRPNTPYIQA
IIKETMRMHPVVVFGLPRYCENDIFIGDENYFIPKGCKVFINFHSIGYNEKYFKDPYKFE
PNRFLENSNNSMDSFFPFGLGNRVCLGRQLANDQLYLVIANLILKYKLKTIDENKINEDG
IFGLTVSPNKYKINLESR*

>CYP519H1P = old CYP523A1 seq 39, 73 complete 41% to seq 14 487 aa
MFIIYFIFLFLLIISLFIDF (0)
IKKNLKKSNNDPPGPISLPLLGNLHNLTKNPHRGLKNLSDKYGGIFRCYLGDHYSIVVSDP 
VIINEIYIKKFEKVCTRPNNDTFKMFSSGFKDLAFSDNYNIWSKIRTIVNSNFTKTKLT
KTIYNYLEDQTNQLIENMGNYSKSGEPV (1)
FLSTITIYMKISLNVICKLFFSKEILQNESFDNGKMRRIAVPIQIVCKELGAGN 
FGDFVGILSPLLYFTKKKYQKNSSTSTDFIGEINDEHLKNLDHD 
PKDLMDMLIIDSTKGKDEDKEPIVHIGYDFLMVDQIRHLVLWN (1)
DCQEKAYNEIVSVMGEDCNKISYADRP
KLPYLVACINECLRMRTEDPLGIPRGAVEDIEINGYFMPKGAKVHHYLYAFGMNETVFEN
VNKFQPDRWLTNDQVHLKQMLNHLVPFSVGPRSCFGKNLSELEVFVVCSNILLNFELSSY
NGKPVDDFEIFGIHPPEFPVKLIKRK*

>CYP513D1 Seq (54+55+78) complete seq 38% to seq 8
MGISSIIIILFIIVLLKKLIKK (0)
EDRIHRINKNIPGPKSKLLVGNLFDLKGQVHEKLKEWYEQYGSVYRIEFGSVSTVVLTEYATLKEAFV
DNGEIFQSRFQRKSRTTCNKGLNLANSNGEYFNHLKKTLSNEITNQKMKK
NEKIIKIQVGLLSEFFNEISGGGGGGSGGSGISKE
PINNIIKMYSLNVML
SLLFNIHFPYNNNSYQDELMSTITRYFKSTGLPYPSDFIPILYPFLKNK
PKEYFEDYESVKKLITRITNEYQLKHMTEISNKSTIEEIENYQPTNILESLLKQYRLNKI
PYDGVIGCLMDLILAGSDTTGNTCLFSLVALVNNSNIQEKLFNEISNAFNDDDGDEL
NGANDISNSLLKLSYFSDRIKTPYLVAFIKEVKRYYPCAPLSVPHL
LTEDCEIQGYKIAKGTQVIQNIYSTHLSQSFC
SNPLEFSPERFLDSTNEPKIITFGIGQRKCPGENIFEIEIYIFLVYLIKKFKFSHPI
DDNLQLNDRGQFGLSLQCPQLNIKVESR*

>CYP513C1 Seq 5+56 complete seq 43% to seq 7 486 aa 
MNYLVLILVSLVSIYFLFIKN (0?)
QDRKKKINSKIPGPKGFLFGNLIELARTKKNLHLKY
LEWFEKYGPVFRVSIGSLETVVLTGYPILREAFIDNSDTFTSRFQRENARS
INGYKGLINSNGDYHKNLKSVILSEMTATKIKKMESHINQESKRLCELLDQHAKQGTPFTMNKYLNLF
SINIILRFLFGVNYPYTELDDGSSSIIQVIQQFLKLVSQPSITTYFPILSPFMNDRSKEF
YDIHKLLSNHIINLIERYKDSKQHQQQEQEPIDGATEPTVTILDKLLIEVENNRITQNAL
ISICIDVLIAGTDTVGQTLSFAIVALVNNAEIQEKLSRNIIDSMEKGDNHYSYSKYRNGI
PYLALVVKEVFRMYPAGILGLPHMTSEDCEIQGHKIAKGTQIIQNIYSTHRSESFWPNPN
NFIPERHIQNDVSKSVHFAVGTRNCMGMSLSEAEVHTAMAELFGNFKFTNPSNIPLNDQG
TFSVALNCPDFFVKIERRN*

>CYP513G1P pseudogene seq 41 56% to seq 8
MIYFIIIVLIIFLIIKNLNNRIYQI
NSKIPGPGFSLPILGNLHSMNNEPHLKIHEWYNKYGNIFRIKMA
NIETVVLTEKPLLKKAFIDNSNLFKKRYLYLNKNAGIILS
NGEVHNKIKTAVLS
TITNSKIKSIKDHHFNRELLKLIEILDEIANQGKPVQLISLIKQFTLNITCSLIF
GFSFPIKVENDGEASKLVNGVNNFLN
FSKFNVFLQYLPKIGNYLKCDPHSIFIEMVSDLVDKYIENEKKMILQILL
FQINF*NYMKKMKLLKEXXXXXXXXXXIYYFYA
DLLFTGVDLTSNTALFSLV
ELINNRNYQIKLYDQVKNNXXXXXXXXXXHGELILLNSKYNNNFTFLKSFLLETYRLHPALPLSA
FTPHYLIEDVEINHIKIAKGXXXXXXXXXXXX
SNKFFKSPNDFIPERFEKENDEMDLAAYGIGVRDCIGKSIAKSELFTILATL
INRYEFINPGTNGFGSYKIGLSCPDNFILIKKRNNKN*

>CYP513A2P seq 38 54% to seq 8
MNFLIILINIIIVLTTIIFLK
KIIKKKNKYIPGPIGLPILGNLLSLKG 
ISFQEFYKQYGPIYRIRMGSIETIVLTESSTLKEAFIGNSYIFENRFQ 
KERNNCENVLLANGEMF 
KLFKELDNLAEIGEPIILNRY
IKLISSNVMLTFTYGDKLLYKYNEIETFEEYLKNLSNYLKVTGRPILSDFIPFLKPF 
SKNVNIEEWDDFFYINSNKYIEKFKSGKNSKQSKTENK
PIISKLLSLYENGEISWASVIGSCIDMQASSTDTIMFCLIELTNLKNIQNKV
YNEIKQEIKKQNINNNNNEDEVLIQYNKYRNSLPYFSMVIKETFRKHPVTAH
ETSNDVEFRGYKISKGTQIIKNIWATHRNEKIFQSPNSFIPERFLEELPNSNLVHFGV
GVRDCMGKSLAESQIFTILASFINRYEFLNPNPSIPLNDVGKFGLAFSCPQNKIIIKKRK*

>513E2P Seq 37a 45% to seq 5
KNRINKINSKIPGPIGLPIIGNLHQLKNNPNK
VFKKWYKKYGPIYRIRMGNIETIILTGYPIIKKSFIDNSNVFQKRYEYRSKIQFNNCSDL
TFTNGETHSNLKKIILSEMTLTKLKKQENYIILECEKLCKHLDNHCESGLPFKFKFYGKL
FSLNIIFRFLFGLNYQYDNEKIIEIINLILELVEGAGDPIISDFIPLVKYFENINQNKFL
KIYKKLIILIENIINNLKLKFIENNYDDDNDENNITIFLKLFKEFKNGKITWDNLVGTCV
DLTVGGTDTVSDSLNFSLIALINNPNCQEKLYNEIKNELLKNNNNNNIDDLIILKHSLYR
LSIPYLSMVMKETYRNFPVALLGLPIITTQDMEINGYKISKGTQVFKNIFLSHKSKDFFK
SPNDFNPERFSDSGNNFMFGGGTTNLVQFGAGSRDCIGKNVVDCELFTVLGTLINRYQFL
NPVLSKPLNENGIIGLANQSPDNYFIIKKRK*

>CYP513E3P seq 37b
WYEKFGPIYKIKLGSIETVVLTGYPIMKRSIKDYPTIFSNRYQF
SSKIKMNNNSNLLICNGEQYKLLRKIIHSELT*TKVKIIENYILLQVEKLCNNIDKTIND
ESILHLGDGISIYDFLKHFSLYIILCLLFG
DLCIGGTDTSSDTLIFSLIL*TNNQSCQEKLYNEIQKSLINNN
NKDLLIIKNSNYSSS
ITYPSMIMKEVYRLYPVGVLGLPVLIDNDIEIDGFKIKKGTQ
IIKNFYQSHRHEDFFKLPNHFIPERNIESGNKFIYGCGDTNMVQFGLGNRDCIGKSLATSEIFTLLATLINRYEF
*NPKPSIPLNDKGKLSLILHPPNVKFLIKKRK*

>CYP516A1 seq 9, 43 complete seq 39% to 10, 42; 30% to 508A1
MIILLLSIIIFILYIVKI (0)
FKNKSCCGNEII
LPPGPISLPFIGNLHQLAIDPHLAIQKLMFKYGNVMTVYFANIKTVV
ISDPNYLKEVFVNQSHKTSDRYLMGTSRIIGNEKDILFSNGQYWKNYRQILAQSFLKLRDHKGITEKI
SLESVKLSQAFEWYATSGQVVNPCSLFKMYTLNVIMQLLYSHRSSYDLKGQHPIIDA
LKMVEESLAVGNVLDLFPILNIFLKKNKLKLVNNLQQVWSYSQDSIKEHREKLLIN 
PEKIDDLLDLFINEIKLSKNSEFFDDEGLYRVCSDLLLSGTETSSSTMSWLLL
FLINNPNFQDKVRTELLEATGGKKTIGLTEKSKTPFFNACIKEALRIRPVGALSLPRIAS
EDVTCGPYTIEKGSQIIMNVYGLAMDPTVWEDPETFNPYRWLSSDISQSTYSFIPFGCGS
RVCVGSSLARDEIFLGIGNILLNYIFESQNGKPINEKGHFGIALQTVDYNVKLTKI*

>CYP516A2P Seq 64 70% to 516A1
KMAREDGTWGPXXXRGGQIKKERVRGLGRGPTVWGGPETFLPXXXXXXXXXXXXX
SVIPCGWGSRGWGGSSLAREEILVGMGNV*LNYIWESQKGKPIKEKGHLGSALQTGDYNVKVTKI

>CYP516B1 seq 10, 42 complete seq 39% to 9, 43
MYLILSLIIFLAYVA 
FHKKRTNGMPPGPFPLPIIGNLHQLGKSPYKSLKSF
SDKYGGLTTIFLGSVPTVLISEPNILREIIIKNNDSIIDRYISDSGLIIG
GERNLLFSKGSFWIKYRKIFSSAMTNARKFNIASRIEQQA
ISLNNYFGTYANSKQA 
INHDYIRRYSLNGVIDYSFSDSVEYESDTHHIVIRAAEIMEEILATGNPHDYLPFLKPF 
YTKKRNTLAMAVGQVWDYCNDAITVHRKTLDHEKPRDLLDLILMEIEKSEE 
KQFYDDDSLSKCLTDLIVAGHETVAITLGWMILFLSNHQDVQQKVYDELINVVGKGN 
LPALVHRKDTSYLNACIQETMRIRTAAPLALPRIASEDIKVGG
YTIPKGTQVMMSVYGMASDERYWKDPHIFNPERWLSSNHSTENGGGGGGVVGNSSQSEV
FIPFGVGPRMCVGMGVAKDELYYCASQMFMNFKWSPVNDKPIDDEGVARIALEYKEYQVVLERRK*

>CYP554A1 SEQ 40 30% to 508 469 aa complete
MDLLLFIFFLILFYYSVK (0)
YYKADNQNSLSLSGPTPVPILGNIHQVGKDAHLTIPIISKKYHGLFRMWFGGTYYVVV
SDYKLIREMYIENFENFKNRIA
TFKTMTGDDSRGIIGCNGDIWDSNKELIMKSYKKVLNKDMNDFILLKSKELFNFFEKNGIKNE
EEEDDDDDGNKSIINNTRFYFQSLTLT
VMFKMIFNENKSFQLYSDST
EFKLIFKTILNLLNSLNVYNVI
YDFLGIFQPILLKFTKILDKNSFLSKIA
TEKFNSRIKEIDFTSDDFKANDLLDSLIMTINEDEN
GLNEKQIENIKSICIDFLMAGTDTTGSTIEWIILKLVNNPEFQELIFQELK
KLNKSEITANDKINTPFLNSFIKETNRLYPIAPLSLP
KSNNNFFFRKSINEMIIGDNKYYIPANTNILMDVKGFSLDENNYKDPNEFKPDRFLNSKVSDTLNFGI
GPRNCIGQTIAMNQIHIFLSNLILNYRMFSIDCLPLPENLILSVSVRPTEYSLKLIKRV*

>CYP525A1 Seq 62 33% to seq 22 no ESTs
MEDYSVQSVVSLVVFLLVL (0)
QILKYYNKTNKNNKYNLPKGPSFLKC (2)
QEELIEDTSENT
VLKWFNQLNSDNYSVSFFGRPMIFTRDTTISKYILSSNNIDNYTKPPDSSGVLIRLAQNS
ILMSEGDQWRYHRSIINQPFSSKN    
VKLMIPTIITTINKLINHL (?) 
TIIIDIHSYCTKLTFDIIGKLSIG
YDFNSIESSDNDNDNNDDDDISKQFDFILNEMIRPIRRFSSYLPLYNDIKLFKFLNELES
IIKGAINSRSLITDNNNNKTYKKNFLLDNLLDDNVKEKD (0)
IIGNINTFLLAGHETSANLLTFIFYLLSTHNNVQNDLYNHLIENQKKKINKDNKFTEEDE
DYQSIEFLDWVIYETLRLFPPAPMIGRTSKNDDILKSGN
NNNNNNNNISIPSETLILISV
YAIHRDPKLWKDPNIFNPYRWKNIENINNRSDFIPFSSGGRVCVGQKFSIVEARIIISKL
ILNFELSFNNLKSKPFKIYQRATLPPKYPVFLNFKKRENK*

>CYP508B1 Seq. 15, 77  50% identical to 508A1
MLFNIFLYLFIFCIVSSG (0)
IKKYKKIHKNELSGPFPIPLLGNLHQLGKE
PHYTLTKMHNVYGEIFRLHFGDVYTVVVSDPILIREMFVDNHENFKYRPLLPTFKFGAGG
DHGLSLSNERWERTRELVQNAMKRTSIKKIYDMLDSQVYELIKSMKQYQVTGNPFEIHLY
AQRFTLSIMFKYIFNEDISYDEDITKGKIAELVQPMDQIFKSLGSGKLGDFISIAQPFYY
QWLKFSDKQFNGPFSTVKKFIYKRYLEHINTIDHDNPRDLMDLLINEFSNDKNLIPTILQ
TSLDMFLAGNDTTAASIIWFVLRMQEHPEIQLKAYNEIKDAVGDRDRVLLSDRPKTPYLN
AIIKEILRLNPVGPFGLPHRSSNDIVIGNGKYFIPKDSQILVNYRGLGFNEKYFENPSQF
DPSRFLNKNNDAYMPFGVGDRKCVGLQLAGDEQYLSFSNILLNFNLKNIGTPVSDYEEFG
LTLKPNKFKVLLESRK*

>CYP508D1 Seq (59+81) 42% to seq 4  483 aa complete
MVYLNNIFIFFIIFFIYSFVKKNKKSTKENDLKGPIALPIIGNLFGLRNDTYSIMD
FYHKMYGGIYRLWFGDYFVVSLNDPEIIREIFIKNYSNFSS 
RPFLPTIT FGSFNYRGISGSNGDYWKRNRNLLLNAMKKSNLKQTYDNLSDSVNSLINLMKEFQSSNES
FQPDMYLRKYALTTMFKYVFNETVSFENKIVQGEEAELIDNINEAFNFMTLGNAGDFFKILQPLYYQY
LLYRGGCFNRIRTLIRNRYIEHRKTIDIENPRDLLDLLIIEYGDHSDENMISIVQVCFDVILAGVDTL
ASSLEWFLVMLCNNQQIQDTVYNELKETVVGPVVTL
NDRPSTPYTMACIKETIRLKAPAPFGLPHTTDQDIIVKGHFI 
PKDSMVLINFYSLGRNPKDFPDPLKFDPNRFIGSTPDSFMPFGTGPRNCI 
GQALGMDQIYLLLSNIFLNFKITSENGKKLDDTDYVSGLNLKPAKYKVCLEKR*

>508B2P Seq 60 58% to seq 15 probable pseudogene
MIETFVFIFISILMFQFFIKC (0)
YILYRPKFKNELDGPSFPIPFFGNNLQIGKNKILYFHKLENYFKKGIFRVWIGE
VFTVIISDPLIEKEM KKTIKEKPKY
IKRDIFI

LNLKSNLINLVFNESTINLIQSMNCSIKNNKE (0)
FEPKLLCSIFSFSIIFKLLFNIDLKNENYKEIKKIMKLVNEINK
NKEKSNSSDLNSITNFIENQFYY
HISNIDQRLVDFFFFYNLIINNIIYNLYFNL
ISLKDFMDIIIYKENSFETKEKIKKQVVYKCTDYILNK
SESISKVIENFFVLIAQDQDYQYLAFNELKSVINTKL LYNGVGENIIKLSDKSYTPITNSICK
EVLRLNPVDQLSS
PITCKKDSLVNGYFIPKDSQIIINHKSMNLNEKYFNDPFNFNPKRFLNYNNQSINF 
DEIYIAISNILLNFKITAVKNHYNFNVFDDNLQSSVLIEKR*

>CYP517A3P Seq 36 pseudogene 77% to seq 3 77% to seq 61 
MEIVNV 
FIILIILFLVKDF 
VKKNKKIHTKSPSGPIAFPILGNVVQIRFWELFKIQEHEL 
IVRAWIGERLFLFVSNYDVKYFQKDENFLYKPSLLVPGWRYASSNGLGVMSSSDDEWKRAKSS
VS**LRVHTSKKLMEEKAIEFIDSLEKISNNNEI 
FYPKGHIQGYACSMLFKYMFNQDLSVESGLSRTIGNAVEHVFGNLSKLTAFDCFE
IFSPLYDWFFTRRLKGCDIVRQIISSQNENH FKSIDPSKPRDLMDDLLIEYGLNEITK EDTMKINQICFDIFGPAIG
TVTITMNWVILQLCNRP EPQEIAYLEIKKAVKDDEYVNFNHKQNAPYIVAFIKETMRLCS
NG

>CYP515B1 Seq. 6 34% to seq 5
MATLLLVIIFMITFIIYKN (0)
FDSKRKNKYPPGPINLPFIGGLYKLKPGKQHLSLNELYQKYG
KVFSMKFGSYDTVILNEPDVIVEAFHLNSTSFMDRILLPSFEVVGKNQNIGFT
QTEYWKKIRGILNISLTKSKTRLLEGLFNQEYFRFDQFIKKQLKSKSDT (0)
MFIRPYLKRLSFNIIYSYLFSETIPYEDELIPSDILDFIHASEELLVVLSRMPS
DYIKVLRPFESHKKLKEICDRMSKFIKPRVDKKVELLDQD
NPKCFIDYLILQIRSDPSQTIKIDAIQYIVLDLLVGGTDSTSSALEWMILFLSNHESIQEKLYNEIC
KNTNTNTTATTTENDNESYFPKLIEKNNYPLFNACV
KETLRRSPPVPLGLPHLCSED TEIGGYLIPKGTQIISNIYSASNCDKVFTDPLEFNPLRFIENSPPQTV
TFSTGPRVCPGKNLSEDELFSFGTKLFK
TFKFSRPNKNQLYDEVAILGITLEPKPFITKVSLRS* 

>CYP522A1 Seq. 18 29% to seq 85 489aa
MILTIVIIILTVIFVNKYLLNNGGKNDLRKVQGPFNLPLLGALYAFDKER
FHKSFDKFYDKYKDFYFIKFGQHDCIVLNSPKLIKQVVIEQSDSVFERFHTPSIKRYAQ
GKSILGCSPDEWKKLRSFIVISFSKNKMGQQVLDKIFHTQYLKFENHIKKLIKSNNNIVT
LEPEFKRLTISIIFNFQFGTDLEFTDPLIDSLLVCTEKIIASCQKASDLMP
IFEIFTSYKDIDGVVKEMYALVKPFLEKYLKQH
DRNNPKCALDHMINCILDQDEPKL 
ITYEHLPHFLMDMFIGGTESTARTMDWFTLMMTNRKEMQDR
IRTELLDVGIRLPVLVDKQKYPLLNASIKEIHR 
LRPIQPIIASRVVNDPIVLKHECSAKGES 
YTIPVGTLIIPNAHSFNFDPQYHKDPLTFNPNRYIGDNPEILHMTFDIGIRTCPF
MSFAIDELFIIFSRLFQSFEFQPIDNTPISEEAFTINSIRPKQWSCQVIERDHK*

>CYP514A1 Seq. 11 complete seq 35% to seq 7
MNTIFTIILTITILVLSLILK (0)
DLLFEGRIKKINKLIPGPSTIPVFGNLLQINAKDFPKSVNDFYERYGKVF
RLRLGSVEIVVLTGPEVIDECFNKKHREIFKERYIKFSRFFGKDYNIISS
NGDYHYVLRGILTSEITTRKLNNGRLESNKFILEMFSNLCKDNKETLVKN
TPNQIRILAVKLILNFTLGIEENDETILIIVEKIKCIFEAAGLLIYSDYL
PFLFPLDIKSMSKNDIISSYFFLKDFIGIKLDAIKIKYEKENELKNETT
DETSSKLNNIPIIENYYKNYLDGSIHYDS
ILFSISDIIFAAVDSTSNGFSLLIGQLINKPEIQDKIYEEIMRNDENNNTNNISFADHTKYPYIISVMN (1)
ESYRYNSSVPITEPNKTTEDVEVNGYKIAKGTMIIKNLRGTHLSKEF
WGEDALEFKPERFKNQPLYQKGLFHFGA (1)
GARACPGGRFTESFTFTFLVIMLKNFKIVNPTDIPI
DVEGEVGLAMQCKPFDALFIKRN*

>CYP514A2 Seq 65 similar to seq 11 448 aa missing N-term 31 aa Dict_IV1e09.p1c
MNLIYTIILTIIILVLIISIK (0)
DLFFEDKIKKINKSIPSPPTIPIFGNLLQINSKDVATCFNDFYKQYGKVYRLRLGSVET
VVLTGGDIIDECFNKKYRDFLKARYVKFSRYLGKDTNILHSNGDYHFLLKGVLS
SQVTVRKLNNGRLEFNKYILQMFNNLNNNDEGSTMFLANDVPSQIKKLILKVVLNFTLGI
EENDDINLSLFQNGSN
IFKAAGLFIYSDYLPFLFPLDIKSMAKSNMISSYVFVRDYLAKKLEEVKKKEYIING
DDDGGVDTSQTPLIESYYKLYLQGLIGYDSILLSIVDIIIASVDTTS
NSISFIIARLTNHQEIQSKIYEEIMSNDINNNSNNISFSDHSKYPYIISIMN
ETYRYYASVPLPEPNMTTEDIEVDGYKIAKGTQIYKNIRGTLIS
KEFWGEDALEFKPERFKTQTLNQKGLLHFGAGPRGCPGARFTECFFFTLMVLL
FKNYKLQNPNDNPIDDRGDVGLSMQCKPYDALFIKRN*

>CYP514A3P seq 89 67% to seq 514A1
LSGIPFVEDCYESYLDGSVRYDSFLFSVSDVVFAAVDSASNGFSLLIGQLFNRPGIQDGI
YEGIMRNDEVSNADDMSFADRAECPCVFSVMD
ESYRFYSSVPITEPNVATGDVEVNGYRIAEGAMIIXNLRGAHFSRGFWG

>CYP514A4 almost identical to 514A1 (7 aa diffs)
MNTIFTIILTITILVLSLILKDLLFEGRIKKINKLIPGPSTIPVFGNLLQINAKDFPKSV
NDFYERYGKVFRLRLGSVEIVVLTGPEVIDECFNKKHREIFKERYIKFSRFLGKDYNIFS
SNGDYHYVLRGILTSEITTRKLNNGRLESNKFILEMFSNLCKDNKETLVKNTPNQIRILA
VKLILNFTLGIEENDETILIIVEKIKCIFEAAGLLIYSDYLPFLFPLDIKSMSKNDIISS
YFFIKDFIGIKLDAIKIKYEKENELKNETTDETSSKLNNIPIIENYYKNYLDGSIHYDSI
LFSISDIIFAAVDSTSNGFSLLIGQLINKPEIQDKIYEEIMRNDENNNTNNISFADHTKY
PYIISVMNESYRYNSSVPITEPNKTTEDVEVNGYKIAKGTMIIKNLRGTHLSKEFWGEDA
LEFKPERFKNQPLNQKGLFHFGAGARACPGGRFTESFTFTFLVIMLKNFKIVNPTDIPID
VEGEVGLAMQCKPFDALFIKRN

>CYP519C2P seq 46 and related seqs 77% to seq 32
KIKKNDIPTLPFALPIIGHLYRPGSNPHRDLTKLVEKNGGIISLCLGDIKTVIFTDPSITKEL

>CYP520A1 seq (47+68+80) complete 47% to seq 58 517 aa
MEILTFIIYLITFFILFDF
KKKKFKKNKRYSKSPNKEANGPWSLPIIGGLHLIGDRPNRSFSELSKIYGGIYKIWLAERMLMI
VTDPEIIQDIWIKQHDKFVNRPHNITSQIFSLNHKSLVFGDVDEWNKVRPKMTCHFTKIK
LNSTKPKQIVNDQLKKMLKIMTTHSLDSKPFNQYVYLNTYSMNIILGLMLSIELPHSNSN
DKDGQFSKVLHSIDEIFKSIGTNGPEDIFPTLLPFFKNRISTFTNHLNVIKDFIRSIYKQ
QIKTFDINIEPRNIMDCLISEYYEDDDQEDEVAKQELIIQLCIDMLVAATDTSASTLEWF
MLFMINNPNLQEDLYEEVVNVVGKDCPYVTFDDVPKLALIKACYFEILRIRPVTSLSLPR
VSMEDTTTLNDIFIPKDTIIIQNIFGMGNSEKFVSNPTVFNPSRWLEYKKMKDLN QFGNR
DDSIDTTNTTTNTTLNGTTS KYYNDLERVSIPFGVGKRRCMAPSMADHNVLIAMANIVLN
FTMKSSDPKQMPLSEEEQYAITIKPKYPFKVLFEKRS

>CYP520B1 Seq 58 47% to seq 47 317 aa
MNYLLIIICIIFFSLFFDF
KIRKNWNLNFKRLFKKDVNGPWSLPIIGGIYLINDNPNRALTKLSKKYGGIYKIWLGESFSM 
VVSDPEIVNEIWVKQHDNFINRPKNITHK
MFSSNYRSLNFGDNPNWKFNRSMASSHFTKTKLLSSK
VTSVVEKKLNKLIETMEYHSINKLP 
FDSYVGFSEYSLNIILNMLVSMDIDECENSTQNVIYSINEIFKMLSTNSPQYSFPYLKF
FFKKDLNNFKFHLDKIKSFIHSIYLKQLESYDPSNPRNILDSF
ISDLQSNDIDILLQICIDIVVAGTDTVANLLQWFVLFCINY
PEIQEKLYNEIIEVVGKDCKVLKYEHISKMPYLYGCFRESLRIRPVTPLS
LPRVAKCDTYIKDDIFIPKG
ATIIQNIFGMGNDEKYISEPNKFKPERWVEYIKNKKVNKNGNENSVNKYF
NDLDKISIPFGVGKRQCLSPAMAEQESLLSIATVVLNYKLKSNGQKKLNE
KEVYSITIKPQPFKLFLEKRV*

>CYP518A1 Seq. 20 38% to CYP508 complete
MSILIILIISIIFYLIFDFLYKNFSNRQFKGPLALPLVGSLLHLKDDTHL
VFQNDSKLYKDGDNNGKIIKYWFCDQLTLAIYDTNTMKEIYLKNPESLNTRVKSPSTNVIGNRFRGIVTADENYWQF
HRDILMKSFTGRKVKSLSSSIEKETIDLITYMKFIEKSGQS
FSPRSNFMNFYSNIIFDYVFSRRIENIYEGVNEEQGKVLLAIRELFDYLADTLIVNYLIFTK
PFYFLYLKMFGHPADSLKKILTKYYLEHFESIDLNNARDVLDSLI
IEYRKVGGKEEQSSIIPMVNELILAGTETNSSTAEWFILTMVNNLDYQDKIYNELKSTLE
TTTAMIKLSNRNQTPLFNAALKEVLRLYPPVPFGVPRQVNQSFEINGGSLKIPKGTQIIQ
SLYSIFRDENYWDSPDQFKPERFLDQDSHSNNYFPYGIGVRNCIGMGFSQDELYISLSNL
VLNFKLLPLIENSKICDKPIFGFSFKPNEFKINLEKRNN*

>CYP518B1 Seq (26+28) 50% to seq 20
MLTNIIILIILYLFYDF
CYKNFKYRNYGSPWALPVI 
GHFIHVINQPHLVVHNDRMKYNNGRFVNYWFGDYL
SIAITDPILYKKIYLNFPKQINSRLKSPTVLNISERFRGIISSNENNWDF
HHGILSKLFNGHKAKINNFLFEKETKFIIEYMKKISKSGEN
FDTRSNFLYFYSNILFDYILGKRVENIYENELRKDRKKFMVSIQEVMDSVG
LIKFLNYLILSYPFLSIYLRYFTYTTFNLKKIL
KQYYDEHLETIDLNKPRDVLDNLIMEYKNQNAIECDKSFVAIAIELLAAGT (1)
DTNSSTSEWFLTYLVNNPIYQDKIYDELIGALKINKPLKGSDVLINLSHRPLTPLFNATLKEVLRLIP
ATPFSVPRMSNEGFEVDGIKIPKG  
TYLFPSMYSIFRDEKYWGENANKFYPERFLTDSHSNNYFPYGVGKRMCLG
SNFSQHELYICLTNIVLNFKIKSIDGKPLNEIP (1)
NYGITFRPNIFEVKLENR*

>CYP518A2P Seq 25,27,29,30  62% to seq 20 pseudogene two in frame stops and 1 fs 
PFYFIYSKIFGHPSDPLKNIINKYY*EHCETIYIDNPR
DVLDSIISEYRKVNGKEECS 
LINLSHRPLTPLFNASLKEVLRLYPPV
SIGVSRLVIEEFTIDNGKYTFLKGAQIIQSLYSIFRDEKYWSSPNEFIP
ERFIYQNN*SNNWFPYSIGVRNCVGMGFSQDEL
YLLLTNLVLNFHILPPFENTKIDGTPIFGFSFKPKLR*

>CYP517A2 SEQ 74 66% to seq 3
MRILIIIILIIIVFLVKDT
IKKNKKVNSKSPCGPFAFPILGNIIQYFFYQILNIKEHSIIERYSRKYDG
ITRIWFGDIFILYVSNYEIVKCFQKEENFFDRPSTFVPTWRYMSSNGGGI
MSSNDEKWKRAKTTFLKSLKIHGKKYLIEKKSIEFVNSIEKFSNSNQV
FYPKQYSQGFTSSIFFKYMFNEDISIDNKFLKEIGTAVGMVFTKNSHLT
VFDCFGILSPFYDLFFKFRLRPIEILK
KTIDKQLTNHLNSMDSKMGDHQSRDIMDDLLIEYGSLNEISNQDRIQINQ
ICFDVMSTDIGTVATTIDWVLLQLCNRQDLQEIICNEIQDTIKIKRNNVI
NDGGGGADTDNLFINLCDKQSIPYLIAFIKETMRVFSNGWSLPKTSKHDQ
ICANYFIPKGSILFINYFSIHLNEEFFKNPREFNPARYLDDSIPIPDLHF
GIGQRGCPGRFVAMDQVFLCIANTLLKYKIKSIDGKKIDDTIQFSVYLKP
KDFGILLEKRNKLFVND*

>CYP555A1 seq 76 41% to seq 4
MIIIVIVVFLFYFSFLNLNLNPKKKRPPSPITLPVIGNLISLLNNQPQNILFNYYKKYGKIYQLQYGIVNTVVL
SEFDILKEAFIENGEVFIERYNKITKKFKS (1)
SENIVNSNGLIWKKLQSISIQ
ELSPNIKIKKYEPMIINETNKLIDSFNEHIKSNESIDPTLNIKICFLNIIISFLFNFRYNDYKDEKVIQLVDYIHSIF
RMGSHPIPQDYIPILNKFYINKTTKIHQKIFENIYEYIENQVQKRLEILNKNNNNNNNNINECFVDLLLLKFKSNLLTWNEVIKTTTDLMIAGSDTN (0)
SLFTIHLIIALTNRENIQNKVFNEILNFYILNENNKITFSNKSKTPYYNSVLKEVERRFTVSPLSQPHRTNKDIILNG
YFIPSGSQIIQNVYSCHLNDKDWENPFQFNPDRFLNNNQLEKKLITFGMGPRNCLGFQFA 256
LMSIWIVNLILFKSIKFSSNKLIEEEIREGGTTLSPFPFKINLIKR* 394

>CYP515A2 seq 79 38% to 508A1
DMGPIFKRILLNILYRFLFGVSFEYDDNLLSK*FYSFIQSYNKLFEYLAKQ 45989
PADFIPILKPFNNYKEIEKEYNNCLNFFQPLIDNILKNIIDDDDDG 45851
SEPKCFLEYFISEIRKDTSNLIKITDL 45690

(1)TTSTTMDWLLLYLTNYPNIQEKLFFEINTPNHPLHKDKLQFPYLNSFIKETLRISPP(1)
APFALPHICTDDIVIDDIFIPKNTQVIPNLYGCNRSNIESS
EPNIFNPDRFLSKDESNIGQCAFSSGLRQCPGANVADSIMFLVSTKLYKTFKFERTTTQL
NDENGYLTKTLCPLEFKSKLIIRK*

>CYP515A1 Seq 79b
MILGIILGLFIYIYLINIK (0)
FFNRAVPSSLLVGENKLKCKFPSGPLILPIIGSLYKLSLKYPHLSFKQLSDKYGKVFSLK
MGSIDTIVINDINFLQKSFRDNPTFFSQRFHLPSFYYMGKYQGII (2)
FGNGSHWRKLKDILSSSITKSKSRQMEELFYNEYFKAEEYLLKKINQDNNI
DMGPIFKRILLNILYRFLFGVSFEYDDNLLSKEFYSFIQSYNKLF
EYLAKQPADFIPILKPFNNYKEIEKEYNNCLNFFQPLIDNILKNISDDDDDGN
EPKCFLEYFISEIRKDTSNLIKITDLPYICFDIIVAGIV
TTSTTMDWMLLYLTNYPNIQEKLFFEINTPNHPLHKDKLQFPYLNSIIKETLRISPP (1)
APFALPHICTDDIVIDDIFIPKNTQVIPNIYGCNRSNIESSESNVFNPDHFLSKDELNIGQ
CAFSFGSRQCPGANVADSIMFLVSTKLYKTFKFERTTTQL
NDENGHFTRSLSPFEFKSKLIIRK*

>CYP519E1 seq 84+17 41% to seq 14
MGIGLIILYLLIGLLAYDF (0)
TKKNKKISKNDPKQPLAIPVLGHLHLFGSQPHRSLTELAKKFGGIFTLWMGDERSMVITDPNILRELYVKNHLNFYNRASS
ESIRIYSGNLVDISFSVGESWKNRRRYVSAALTKTKVLNVITLIEEQANFLINSMQYYAKSGEP 
FFPHKYYNKYTMNIVMSIGFSKTISENESVEEGPISQLIIPFYNILENLGSGNLGD
YVWYTQPFFYFKNKKLEQDTKKVYTFLEEIYNEHIKNLDESNPRDLMDQLIISTG
GKEKDMVIHVST   
DFLLAGSDTNASTLEWFCIFLANNPEIQKKAYEELISVVGKDCKAVTTKYRDDCPYLV
GAIKETLRMRTPAPLSLIRVSEEDFMTSGGIFIPKGTQIVPNLYGIGQNFVDDPSSYK
PERWVEYYKNKTPTREMEATTETKSNITTEILP
NDLDKVVLPFSIGPRNCPGNIISEINLFLACSNILLNFEFSNGGKKIDETEV
FGITIHPKDFSIQLKKRE*

>CYP524A1 Seq 91 complete seq 25% to 10, 42 468 aa
MKTPTKYFIIFILLAALAVF 
KGSLPGPSFVPPFFGMLFQLIFT
PFSFYEKQEKYGPISWTSIMNKFVLFVTDAEINRQVFKEENAKLYLSLGAKKILTEKAIPFIEG
APHRQLRKQLLPLFTIRALSSYLPIQESIVDEHIAMWIKNGKADINARNNCRDLNMAISTGVFV
GNNTPESVRDDIAKNFFVMNEGFLCLPIDLPGTTLRKAINARVRLVEIFTDIIAKSRKRMGDGE
KPQSLIDLWVEHFLNCPKEERDELSNDTIIFTLLSFMFASQDALTS
SLVWTVQLMAEHPDILAKVRAEQASLRPNNEKLDLDTMRQATYTRMVVSEILRFRPPAVMVPHE
NIEDIVIGDNVHVPKGTMILPSIWSAHFQEGGYSDPYKFDPQRFDSVRKEDVTCAKNSLVFGAG
PHFCIGKELAKNQIEVFLTKLAMSTEWTHNKTPGGDEIIFGPTIFPKDGCNITIKARN*

>CYP556A1 Seq 92
MFLTSILYTIIIILIFYKGLE (0)
YLIEKRSFPLVHPIKGVMNGT
KPYFIFGDLPFQRLLNLKPKLKELGSIYFRWFFWYPIVEIKDINAIQYVYNEKSNNYSLY
WNLNKSSNFILTGSEIKRFFRIYYWAFNCKDSLQRIMPVIKSQVFDFIHSHKFQNSTLST
NDDVTN (0)
FMLKLLSRVYLGSSDEAYHCFKANYKKFNKSYLDFFHYL
FPTLLK IPSKFLRKYIKNKNKRALYQVLAMKAYYGVVKQSSDDHIEESMINIIAETSYN
DKEGLSLEEIKMPSYLLNASSIKGPMIMVENLMFQLIEKSEIESKIRKEIKLVFEKNGKDVN
SFDFDDIMEMKYLEATLDEINRLYPPFPKLMPRQTKESDRILGYHIPKGTMISCPVADILRD
PSNFQDPLTFKPER QLIFSNPKFASPSITSIQEINGLS (1)
KRNQIIKNLPWGIGSKKCLGKELAKLIVKTIIVILYSQYTFDKHLDEND
EELCDTNNQPKIQITFNPEIKPPLLLKSRKLFSISQPKQ*