Last modified Mar. 24, 1999
There are at least 
18 DICTYOSTELIUM DISCOIDIUM (SLIME MOLD) P450 SEQUENCES
based on comparing the C-terminal sequences.

SEQUENCE 1 40-43% identical to CYP73 sequences SEQUENCE 1 AND 
SEQUENCE TWO ARE FROM THE SAME GENE BASED ON TWO CLONES 
SSJ655 AND SLB521

C92049 D. disc. I-helix to end CLONE SSC117

PMVLMLTNYPEIQEKAFDEIKTVVNGRSKVNLSDRQSTPYLVAVIKETLR
YKPMSPFGLPRSSSKDCMIGGHFIPKNAQILINYQALGMNEEYYENPEQF
DPSRFLKVESNVAFLPFSIGIRSCVGQSFAQDELYICISNILLNFKLKSI
DGKKIDETEEYGLTLKTKNRFNVTLEKRII*

C89925 D. disc I-helix to end CLONE SSG630

QVQLL*NQWY*C*QIIPEIQEKAFDEIKTVVNGRSKVNLSDRQSTPYLVA
VIKETLRYKPMSPFGLPRSSSKDCMIGGHFIPKNAQILINYQALGMNEEY
YENPEQFDPSRFLKVESNVAFLPFSIGIRSCVGQSFAQDELYICISNILL
NFKLKSIDGKKIDETEEYGLTLKTKNRFNVTLEKRII*

C90052 D. disc. I-helix to end CLONE SSG143

LMLTNYPEIQEKAFDEIKTVVNGRSKVNLSDRQSTPYLVAVIKETLRYKP
MSPFGLPRSSSKDCMIGGHFIPKNAQILINYQALGMNEEYYENPEQFDPS
RFLKVESNVAFLPFSIGIRSCVGQSFAQDELYICISNILLNFKLKSIDGK
KIDETEEYGLTLKTKNRFNVTLEKRII*

C91122 D. disc. I-helix to end CLONE SSJ655

ATINDFFLAGVDTSSTALESMVLMLTNYPEIQEKAFDEIKTVVNGRSKVN
LSDRQSTPYLVAVIKETLRYKPMSPFGLPRSSSKDCMIGGHFIPKNAQIL
INYQALGMNEEYYENPEQFDPSRFLKVESNVAFLPFSIGIRSCVGQSFAQ
DELYICISNILLNFKXKSIDGKKIDETEEYGLTLKTKNRFNVTLEKRII*

C25600 D. disc. I-helix to end CLONE SSA247

KVNLSDRQSTPYLVAVIKETLRYKPMSPFGLPRSSSKDCMIGGHFIPKNA
QILINYQALGMNEEYYENPEQFDPSRFLKVESNVAFLPFSIGIRSCVGQS
FAQDELYICISNILLNFKLKSIDGKKIDETEEYGLTLKTKNRFNVTLEKR
II*

C94043 Dictyostelium discoideum slug CLONE SSG323

RQSTPYLVAVIKETLRYKPMSPFGLPRSSSKDCMIGGHFIPKNAQILINYQALGMNEEYY 
ENPEQFDPSRFLKVESNVAFLPFSIGIRSCVGQSFAQDELYICISNILLNFKLKSIDGKK
IDETEEYGLTLKTKNRFNVTLEKRI

C94448 D. disc. CLONE SSK816

VDTSSTALESMVLMLTNYPEIQEKAFDEIKTVVNGRSKVNLSDRQSTPYLVAVIKETLRY 
KPMSPFGLPRSSSKDCMIGGHFIPKNAQILINYQALGMNEEYYENPEQFDPSRFLKVESN 
VAFLPFSIGIRSCVGQSFAQDELYICISNILLNFKLKLIDGKKIDETEEYGLTLKTKNRF
NVTLEKRI 575

AU034703 Dictyostelium discoideum CLONE SLE212

LATINDFFLAGVDTSSTALESMVLMLTNYPEIQEKAFDEIKTVVNGRSKVNLSDRQSTPYL
VAVIKETLRYKPMSPFGLPRSSSKDCMIGGHFIPKNXXILINYQALGMNEEYYENPEQFD
PSRFLKVESNVAFLPFSIGIRSCVGQSFAQDELYICISNILLNFKLKSIDGKKIDETEEY
GLTLKTK

AU033852 Dictyostelium discoideum CLONE SLB521

PEIQEKAFDEIKTVVNGRSKVNLSDRQSTPYLVAVIKETLRYKPMSPFGLPRSSSKDCMI 
GGHFIPKNAQILINYQALGMNEEYYENPEQFDPSRFLKVESNVAFLPFSIGIRSCVGQSF 
AQDELYICISXILLNFKLKSIDGKKIDETEEYGLTLKTKNRFNVTLEKRII 

AU037735 Dictyostelium discoideum CLONE SSE231

TALESMVLMLTNY
PEIQEKAFDELKTVVNGRSKVNLSDRQSTPYLVAVIKETLRYKPMSPFGL
PRSSSKDCMIGGHFIPKNAQILINYQALGMNEEYYENPEQFDPSRFLKVESNVAFLPFSI 
GIRSCVGQSFAQDELYICISNILLNFKLKSIDGKKIDETEEYGLTLKTKNRFNVTLEKRII 

AU034252 Dictyostelium discoideum CLONE SLC329

LRYKPMSPFGLPRSSSKDCMIGGHFIPKNAQILINYQALGMNEEYYENPEQFDPSRFLKV 
ESNVAFLPFSIGIRSCVGQSFAQDELYICILNILLNFKLKSIDGKKIDETEEYGLTLKTK 
NRFNVTLEKRII 

AU037979 Dictyostelium discoideum CLONE SSH119

PYLVAVIXETLRYKPMSPFGXPRSSSKDCMIGGHFIPKNAQILINYQALGMNEEYYENPE 
QFDPSRFLKVESNVAFXPFSIGIRSWV 
GQSFAQDELYICISNILLNFKLKSIDGKKIDETEEYGLTLKTKNXFNVTLEKRII 

SEQUENCE 2 34% identical to 73A14 35% identical to Zinnia elegans CYP73

C92378 D. disc. N-terminal to sequence 1 above CLONE SSE715

MALFEIIISLFVVYIIHNAISKYKKIHVNELCGPTPIPILGNLHQFGELPH
RVLTKMTKKYGHILRVYMADMYTVVVSDPLLIREMYVD
NSDIFTDRVKKPSVEHGTFYHGTVTSYGEHWKNNREIVGKAMRKTNLKHI
YELLDKQVDVLIRSMKSIETSGKTFDTRYYITKFTMSAMFKFLFNHDIPE
DEDINKGDTQKKKX

C24684 N-terminal CLONE SSA192

MALFEIIISLFVVYIIHNAISKYKKIHVNELCGPTPIPILGNLHQFGELPH
RVLTKMTKKYGHILRVYMADMYTVVVSDPLLIREMYVD
NSDIFTDRVKKPSVEHGTFYHGTVTSYGEHWKNNREIVGKAMRKTNLKHI
YELLDKQVDVLIX

CONSENSUS SEQUENCE CYP508 OF SEQS 1 AND 2 COMPLETE SEQUENCE

MALFEIIISLF
VVYIIHNAISKYKKIHVNELCGPTPIPILGNLHQFGELPHRVLTKMTKKYGHILRVYMAD
MYTVVVSDPLLIREMYVDNSDIFTDRVKKPSVEHGTFYHGTVTSYGEHWKNNREIVGKAM
RKTNLKHIYELLDKQVDVLIRSMKSIET SGKTFDTRYYITKFTMSAMFKFLFNHDIPEDE
DINKGDTQKLMGPMSEVFQNAGRGSLFDVINITQPLYLLYLEMFDQSFKDIMKYHREKYN
EHLKTFDPDVERDLLDILIKEYGTDNDDKILSILATINDFFLAGVDTSSTALESMVLMLT
NYPEIQEKAFDEIKTVVNGRSKVNLSDRQSTPYLVAVIKETLRYKPMSPFGLPRSSSKDC
MIGGHFIPKNAQILINYQALGMNEEYYENPEQFDPSRFLKVESNVAFLPFSIGIRSCVGQ
SFAQDELYICISNILLNFKLKSIDGKKIDETEEYGLTLKTKNRFNVTLEKRII*

CQMKRANPSVSQSLRVRQLKKLMEEKAIEFIDSLEKISNNNEIVSF

SEQUENCE 3 32% identical to many 1A seqs. especially fish 1As

C84055 D. disc. I-helix to end CLONE SSC561

LLIEYGLNEITKEDTMQINQICFDIFGPAVGTVTITMNWVI*QLCNRPEL
QEIAYXEXKKAVKDDEYVNLNHKQNAPYIVAFIKETMRLCSNGFGLPRTA
KNDQICGDFFIPKDAIIFINYLEISQNEEIFKNAKEFNPTRYLDESLPVP
NIHFGVGQRACPGRFVAIDKMFLGISNLLLKYKLKTQNGEKIDDSIQFSV
SLKAKDYGIKLEKRI*

5 PRIME END OF CLONE SCC317.   C84138 IS THE 3 PRIME READ
NHLKSIDPSKPRDLMDDLLIEYGLNEITKEDTMQINQICFDIFGPAVGTVTITMNWVIL
QLCNRPELQEIAYQEIKKAVKDDEYVNLNHKQNAPYIVAFIKETMRLCSNGFGLPRTAKN
DQICGDFFIPKDAIIFINYLEISQNEEIFKNAKEFNPTRYLDESLPVPNIHFGVGQRACP
GRFV

CONSENSUS OF SEQ. 3 
MEIINVFLFLIILFLVKDFVKKNKKIHTKS
PSGPIAFPILGNVVQIRFWELFKIQEHELFGGYSKKYNGVVRAWFGERLFFFVSNYD
VVKYFQKDENFHNRPSVLVPGWRYASSNGLGVMSSSDDKWKRAKSSVSQSLRVRTTK
KLMEEKAIEFMIHLKKFQIIMKLGDP
(15 amino acid gap or small intron)
IFIFSFIQRTYSRICLFNVFKYMFIQDLSVESGMSRTIGNAVEHVFGNLS
KLTAFDCFEIFSPLYDWFFTRRLKGCDIVRQIISSQN
ENHLKSIDPSKPRDLMDD
LLIEYGLNEITKEDTMQINQICFDIFGPAVGTVTITMNWVILQLCNRPEL
QEIAYQEIKKAVKDDEYVNLNHKQNAPYIVAFIKETMRLCSNGFGLPRTA
KNDQICGDFFIPKDAIIFINYLEISQNEEIFKNAKEFNPTRYLDESLPVP
NIHFGVGQRACPGRFVAIDKMFLGISNLLLKYKLKTQNGEKIDDSIQFSV
SLKAKDYGIKLEKRI*

New From Jena
>JAX4a82d03.r1 Clone JAX4a82d03, reverse read, bases 21 through 741, from 98-11-27
IFIFSFIQRTYSRICLFNVFKYMFIQDLSVESGMSRTIGNAVEHVFGNLS
KLTAFDCFEIFSPLYDWFFTRRLKGCDIVRQIISSQN
ENHLKSIDPSKPRDLMDDLLIEYGLNEITKEDTMQINQICFDIFGPAVGTVTITMNWVILQLCNRPELQEIAYQEIKKAVKDD
EYVNLNHKQNAPYIVAFIKETMRLCSNGFGLPRTAKNDQIWGIFSFQKSYYFINYLEIRPKWKKSLKC

>JC2b115g01.r1 Clone JC2b115g01, reverse read, bases 43 through 498, from 99-10-06
frame -1
*CQMKRANPSVSQSLRVRQLKKLMEEKAIEFIDSLEKISNNNEIVSF*K**LQSKY**HINLLNFYF*FYPKGHIQGYACSML
FKYMFNQDLSVESGMSRTIGNAVEHVFGNLSKLTAFDCFEIFSPLYDWFFTRRLKGCDIVRQIISS

frame -2
DAK*KEQIQVFRNH*EFVNLKN*WKKKQLNLLIHLKKFQIIMKL*VFKNNNYNQNIDNILIY*IFIFSFIQKDIFKDMLVQCY
SNICLIKIYQLKVACQELLVMQLNMFLVIFQN*LHLIVLKFSHHFMIGSLQED*KVAISLDK*SVV

Frame -3
MPNEKSKSKCFAIIKSSST*KINGRKSN*IY*FT*KNFK***NCKFLKIIITIKILITY*FIKFLFLVLSKRTYSRICLFNVI
QIYV*SRFIS*KWHVKNYW*CS*TCFW*SFKINCI*LF*NFLTTL*LVLYKKIKRLRYR*TNNQ*S

JAX4a27h12.s1 Clone JAX4a27h12
Frame -1
KKKLKKKKKKNIALNLKFYIKKNGNN*CFFVSNHSFLGKRFCMYLNFYILENYYNLLILSIKKKKNKKKKVKKNKKIHTKSPS
GPIAFPILGNVVQIRFWELFKIQEHELFGGYSKKYNGVVRAWFGERLFFFVSNYDVVKYFQKDENFHNRPSVLVPGWRYASSN
GLGVMSSSDDKWKRAKSSVSLIKSSYN*KLKKKKQLNL*FT*KNFK***NWGILRV

Frame -2
KKN*KKKKKKI*L*I*NFILRKMEIINVFLFLIILFLVKDFVCI*IFIF*KIITIY*FFP*KKKKIKKKRLKKIRKFIQNLQV
DQLHFLFLEMLFKLDFGNYSKFKNMNYLVVIVKNIMVL*EHGLEKDYFFLFQIMML*SIFKKMKTSITDHQF*FQVGDMLQVM
G*V**AHLMTNGKEQNQVFRSLRVRTTKN*RRKSN*IYDSLEKISNNNEIGGSLEW

Frame -3
KKIKKKKKKKYSFKFKILY*EKWK*LMFFCF*SFFSW*KILYVFKFLYFRKLLQFINSFHKKKKK*KKKG*KK*ENSYKISKW
TNCISYSWKCCSN*ILGIIQNSRT*IIWWL**KI*WCCKSMVWRKIIFFCFKL*CCKVFSKR*KLP*QTISFSSRLEICFK*W
ARCNELI**QMEKSKIKCFAH*EFVQLKIKEEKAIEFMIHLKKFQIIMKLGDP*SG

>JAX4a207g03.s1 Clone JAX4a207g03, 
KKKKKLCRKKKI*KKKKKKYSFKFKILY*EKWK*LMFFVSNHSFLGKNFVCI*IFIF*KIITFINSLHQKKKK*KKKG*KK*E
NSYKISKWPIAFPILGNVVQIRFWELFKIQEHELFGGYSKKYNGVVRAWFGERLFFFVSNYDVVKYFQKDENFHNRPSVLVPG
WRYASSNGLGVMSSSDDKWKRAKSSVSQSLRVRTTKKLMEEKARG

JC2e75c06.s1 Clone JC2e75c06

Frame -3
FVCI*FYIF*K*LKLIN*FFTKKKKVKKIRKFIKISKWPIAFPILGNVVQIRFWELFKIQEHELIVRAWIGERLFLFVSIMM*
SIFKKMKISFTNHPFSSRLEICFK*WIRCNELIDDEWKRAKSVFLIIKSSYIKKLMEEKALNLLIP*KNFE***NYRFFFKEI
IIQLKLLILIYSPLF*VLSHPYSRICLFNVIQYMFNQDLSVG

-2
FCMYLILYILEIIKIN*LILYKKKKGKKNKKIHQNLQVANCISYSWKCCSN*ILGIIQNSRT*INCKSMDWRKIIFICLNYDV
KYFQKDENFLYKPSF*FQVGDMLQVMD*V**AH**RMEKSKISVFNN*EFIH*KINGRKSIEFIDSLKKFRIIMKL*VFF*RN
NNSIKIININLFPIILSFIPPIFKDMLVQCYSIYV*SRFISW

-1
ILYVFNFIYFRNN*N*LINSLQKKKR*KK*ENSSKSPSGQLHFLFLEMLFKLDFGNYSKFKNMN*L*EHGLEKDYFYLSQL*C
KVFSKR*KFPLQTILLVPGWRYASSNGLGVMSSLMTNGKEQNQCF**LRVHTLKN*WKKKH*IY*FLEKISNNNEIIGFFLKK
**FN*NY*Y*FIPHYFKFYPTHIQGYACSMLFNICLIKIYQL

IFIFSFIQRTYSRICLFNVFKYMFIQDLSVESGMSRTIGNAVEHVFGNLS


SEQUENCE 4 32% identical to CYP17s especially fish 17s

C84082 Dictyostelium discoideum slug CLONE SSC732

IIIKLCNSPIHQEIAYNELKKVVSSKVIIDDSIKREITLSDRPNTPYIQAIIKETMRMHP 
VVVFGLPRYCENDIFIGDENYFIPKGCKVFINFHSIGYNEKYFKDPYKFEPNRFLENSNN 
SMDSFFPFGLGNRVCLGXQLANDQLYLVIANLILKYKLKTIDENKINEDGIFGLTVSPNK
YKINLESR*

C90646 Dictyostelium discoideum slug CLONE SSI265

IHQEIAYNELKKVVSSKVIIDDSIKREITLSDRPNTPYIQAIIKETMRMHPVVVFGLPRYCE
NDIFIGDENYFIPKGCKVFINFHSIGYNEKYFKDPYKFEPNRFLENSXXXXXXXXX
FGLGNRVCLGRQLANDQLYLVIANLILKYKLKTIDENKINEDGIFGLTVSPNKYKINLESR 

SEQUENCE 5 34% identical to CYP82 family

C91402 Dictyostelium discoideum slug CLONE SSK171

LDKLLIEVENNRITQNALISICIDVLIAGTDTVGQTLSFAIVALVNNAEIQEKLSRNIID 
SMEKGDNHYSYSKYRNGIPYLALVVKEVFRMYPAGILGLPHMTSEDCEIQGHKIAKGTQI
IQNIYSTHRSESFWPNPNNFIPERHIQNDVSKSVHFAVGTRNCMGMSLSEAEVHTAMAE
LFGNFKFTNPSNIPLNDQGTFSVALNCPDFFVKIERRN*

SEQUENCE 6 34% identical to CYP2, 17, 21 members

C92981 Dictyostelium discoideum MISSING PERF REGION CLONE SSF410
Perf added in and N-terminal extension added on

KVELLDQDNPKCFIDYLILQIRSDPSQTI (AU071546)
KIDAIQYIVLDLLVGGTDSTSSALEWMILFLSNHESIQEKLYNEICKNTNTNTTATTTENDNES 
YFPKLIEKNNYPLFNACVKETLRRSPPVPLGLPHLCSEDTEIGGYLIPKGTQIISNIYSA 
SNCDKVFTDPLEFNPLRFIENS
PPQTVTFSTGPRVCPGKNLSEDELFSFGTKLFKTFKFSRPNKNQLYDEVAILGITLEPKP
FITKVSLRS*

C91073 Dictyostelium CLONE SSJ454

EKNNYPLFNACVKETLRRSPPVPLGLPHLCSEDTEIGGYLIPKGTQIISNIYSASNCDKVF
TDPLEFNPLRFIENSPPQTVTFSTGPRVCPGPNSSEDELFSFGTKLFKTFIFSRPNKNQ
LYDEVAILGITLEPKPFITKVSLRS* 

AU037975 Dictyostelium discoideum CLONE SSH115

DLLVGGTDSTSSALEWMILFLSNHESIQXKLYNEICKNTNTTATTTENDNESYFPK
LIEXNNYPLFNACVKETLRRSPPVPLGLPHLCSEDTEIGGYLIPKGTQIISNIYSA
PPQTVTFSTGPRVCPGKNLSEDELFSFGTKLFKTFKFSRPN
KNQLYDEVAILGITLEPKPFITKVSLR

CLONE SSB769 
KVELLDQDNPKCFIDYLILQIRSDPSQTIKIDAIQYIVLDLLVGGTDSTSSALEWMIL
FLSNHESIQEKLYNEICKNTNTNTTATTTENDNESYFPKLIEKNNYPLFNACV

SEQUENCE 7 36% identical to rabbit 2C1 40% with 93C1

C90627 Dictyostelium CLONE SSI868

DIISAGTDTSANTLVMALIELINNQEIQSKAFSSIRSSCLNDSNDDDDDDEIVITHSKYR 
SLLPYISMIIKETFRKHPIALLGLPHVTTEDVEIDGYKIEAGTYIIQNIFSSHRSDKIFQ 
SPNEFIPERFFESSQNQGLIHFGLGVRDCVGKSLAECEIFTLIATLLNRYQFINPNNSKK
LNDIGTFGLAQVCPDTNIILKKRI*

SEQUENCE 8 33% with 83D1 34% with 81D3

C90256 Dictyostelium CLONE SSI504

QSLENGEISWDSVVST
CIDLQTAGADTSANTILYCLLELINNPNIQSKVYDDIKQAIIQSKENENQNDNENQEQTE
EIITLSFNKYRTLAPYLSMVVKETFRKYPSGTIGLPHVTSEDVELNGYKICAGTQIIQNI
WATHRNEKQFSEPDSFIPERFISQQQSANSNLIHFGCGVRDCIGKSLADSEIFTMLASLI
NRYEFTNPNPSTPLNEIGKFGITYSCPENKIIIKKRF*

C91045 CLONE SSJ415

NQNDNENQEQTEEIITLSFNKYRTLAPYLSMVVKETFRKYPSGTIGLPHV
TSEDVELNGYKICAGTQIIQNIWATHRNEKQFSEPDSFIPERFISQQQSA
NSNLIHFXCGVRDCIGKSLADSEIFTMLASLINRYEFTNPNPSTPLNEIG
KFGITYSCPENKIIIKKRF*

AU039107 Dictyostelium discoideum CLONE SSM394

SFNKYRTLAPYL 
SMVVKETFRKYPSGTIGLPHVTSEDVELNGYKICAGTQIIQNIWATHRNEKQFSEPDSFI 
PERFISQQQSANSNLIHFGCGVRDCIGKSLADSEIFTMLASLINRYEFTNPNPSTPLNEI 
GKFGITYSCPENKIIIKKRF 

AU039893 Dictyostelium discoideum 3 PRIME END OF CLONE SLG684

ENENQHDNENQEQTEEIITLSFNKYRTLAPYLSMVVKETFRKYPSGTIGLPHVTSEDVEL 
NGYKICAGTQIIQNIWATHRNEKQFSEPDSFIPERFISQQQSANSNLIHFGCGVRDCIGK 
SLADSEIFTMLASLINRYEFTNPNPSTPLNEIGKFGITYSCPENKIIIKKRF 

5 PRIME END OF CLONE SLG684 

MNYLVGLVLIFTIFYFFLQKNDKNMNSKIPGPKGIPILGNLLSMKGDLHLKLQEWYKQYG
VIYRIKMGNVETVVLTEYPIIREAFIGNSNSFVNRFQRKSRLKLNNGENLVIVNGDIHNK
LKTLVLSEMTNQRIKKYETSFIDNEIKKLFKVLDEHADTGKPIILNNHIKMFSMNIVLCF
TFGLNYSYPYDEFEKASEFI

SEQUENCE 9 43% identical to CYP17 sequences

C90082 Dictyostelium discoideum CLONE SSG513

AMDPTVWEDPETFNPYRWLSSDISQSTYSFIPFGCGSRVCVGSSLARDEIFLGIGNILLNYIFES
QNGKPINEKGHFGIALQTVDYNVKLTKI*

SEQUENCE 10 34% identical with CYP2B members 33% identical to CYP17 members

C25607 Dictyostelium discoideum CLONE SSA260

YTIPKGTQVMMSVYGMASDERYWKDPHIFNPERWLSSNHSTENGGGGGGVVGNSSQSEVF 
IPFGVGPRMCVGMGVAKDELYYCASQMFMNFKWSPVNDKPIDDEGVARIALEYKEYQVVL 
ERRK* 

SEQUENCE 11 42% identical to CYP81D6

C93191 Dictyostelium discoideum CLONE SSM757 5 PRIME AND 3 PRIME READS ADDED

ILFSISDIIFAAVDSTSNGFSLLIGQLINKPEIQDK
IYEEIMRNDENNNTNNISFADHTKYPYIISVMNESYRYNSSVPITEPNKTTEDVEVNGYKIA 
KGTMIIKNLRGTHLSKEFWGEDALEFKPERFKNQPLNQKGLFHFGAGARACPGGRFTESF 
TFTFLVIMLKNFKIVNPTDIPIDVEGEVGLAMQCKPFDALFIKRN*

SEQUENCE 12 37% identical to CYP83

C84123 Dictyostelium CLONE SSC825

N TERMINAL OF SSC825

MESIINLIFYIIIFLILIDFLKKNISFRKNEPPRGGVAFPIFGD
LPKLGENPHRYLTNLAMKKGGIYSVWLGDEKVFILTDPEAVRDAWVKQFRNFSDHPKTKS
VRIFSGNFNDMAFAEYSQWKINSKWVSSAFTKTKLKTIGDLIEKESNYFIEHLKAYSNSG
QPIFPKPYISKFGINVISGMMFSQVISKDESVDKGA

C-terminal of clone SSC825

LDKVSIPYSVGNRKCPGASLSELALFSLCSNILLNFELKSIDGKPIDDTEVYGLTIHTKVHPISLTLRP*

AU039172 Dictyostelium discoideum CLONE SSM473

PVGVLGIPRVALEETTIMGYTIPKGSQIFQNVYGMSHLFVSDPYKFKPERWIEYKLDKVSIPYSVGNRKCP 
GASLSELALFSLCSNILLNFELKSIDGKPIDDTEVYGLTIHTKVHPISLTLRP* 

AU037246 Dictyostelium discoideum CLONE SSB654

DQLVYKVFPRVALEEKTIMGYTIPKGSQIFQNVYGMSXLLESDPXKFKPERWIEYK 
XDKVSIPYSVGNRKCPGASLXELA*FSLCSNIFLNFELKSIDGKPIDDTEVYGXTIHTK 

SEQUENCE 13 55% identical to 2B19 (short region)

C90134 CLONE SSI130

DGKLDPTNDLALISLPFSSGIRNCPGVGFAEYELFLLFSNIILNFHLSSP
NNLKLNESGHFGLTMKPFPFLVDL

C84168 Dictyostelium discoideum slug cDNA, clone SSC405

GIRNCPGVGFAEYELFLLFSNIILNFHLSSPNNLKLNESGHFGLTMKPFPFLV 

N-terminal half of SSC405 starting before the C-helix

NNFTDRPQTKVFEIISRNYKNSGFANGEKWKHLRGLYAPSFTKIKSRPHENIILKYVNFE
IKSLKNHAITNSIYNPFLIENINSFGTKVITEIIFGREFSENEVYSLIG PMNKLFGILDT
PFPSESISFLKPFYRRSYKECDKQCEELFKLVEKVYDDHLLNLDKDNPKDVMDVMIVETD
FKEKDHVICICCDLLMGTKDTFNTIVLWFFVLMINYQDVQLKGYQEIIK

CLONE SSK320 NTERM (NOT IN GENBANK)
MILLTLLYLIIFYIIIDFIKKNYKTKNQLPSPLGIALPIIGHLHLLRTDPYKTLA
KASKKTEHGILKCWNGEHLMVVVDNPSIIKQMYVNTNNFTDRPQTKVFEIISRNY
KNSGFANGEKWKHLRGLYAPSFTKIKSRPHENIILKYVNFEIKSLKNHAITNSIYN
PFLIENINSFGTKVITEIIFGREFSENEVYSLIG

CONSENSUS OF SEQ. 13

MILLTLLYLIIFYIIIDFIKKNYKTKNQLPSPLGIALPIIGHLHLLRTDPYKTLA
KASKKTEHGILKCWNGEHLMVVVDNPSIIKQMYVNTNNFTDRPQTKVFEIISRNY
KNSGFANGEKWKHLRGLYAPSFTKIKSRPHENIILKYVNFEIKSLKNHAITNSIYN
PFLIENINSFGTKVITEIIFGREFSENEVYSLIGPMNKLFGILDTPFPSESISFLKPFYR
RSYKECDKQCEELFKLVEKVYDDHLLNLDKDNPKDVMDVMIVETDFKEKDHVICI
CCDLLMGTKDTFNTIVLWFFVLMINYQDVQLKGYQEIIK
(GAP)
DGKLDPTNDLALISLPFSSGIRNCPGVGFAEYELFLLFSNIILNFHLSSP
NNLKLNESGHFGLTMKPFPFLVDL


SEQUENCE 14 54% identical to CYP23A1 (C. elegans) 60% with 34A1 
(C. elegans) short region

C90413 CLONE SSI404

N-TERMINAL OF CLONE SSI404

PTPKLALPLIGHLYLLGDRPNRSFLELSKRYGGIFKIWMGEYPTVVLTDPDHVNEVWCKQ
FLNFTNRPHFNSLDQFSSGFRNLSFSDYPLWSELRKLVSSSFTKSKVKGISNLLETQTNY
LINTMNNYSINNKPFNPKKYIHKLTLNVVCMIAFSKEIKNDEDVNEGDMARLTKPKEM

C-TERMINAL OF CLONE SSI404

KHKYYNDLDKISIPFSTGRRGCVGVQLGEAELYIVCANLV
YNFKIESWDGKKINELEDFGIIIHPSSHNLKITKRNNK*

SEQUENCE 15 57% identical to C92049 40% identical to fish CYP17

AU038895 Dictyostelium discoideum SS (H.Urushihara)CLONE SSM113

N-TERMINAL PART OF CLONE SSM113

AQRFTLSIMFKYIFNEDISYDEDITKGKIAELVQPMDQIFKSLGSGKLGDFISIAQPFYY
QWLKFSDKQFNGPFSTVKKFIYKRYLEHINTIDHDNPRDLMDLLI

C-TERMINAL OF CLONE SSM113

INEFSNDKNLIPTILQTSLDMFLAGN
SASIIWFVLRMQEHPEIQLKAYNEIKDAVGDRDRVLLSDRPKTPYLNAIIKEILRLNPVG 
PFGLPHRSSNDIVIGNGKYFIPKDSQILVNYRGLGFNEKYFENPSQFDPSRFLNKNNDA 
YMPFGVGDRKCVGLQLAGDEQYLSFSNILLNFNLKNIGTPVSDYEEFGLTLKPNKFKV 
LLESRK*


SEQUENCE 17 41% to Y10491 from soybean

AU037557 Dictyostelium discoideum CLONE SSD784

LRMRTPAPLSLIRVSEEDFMTSGGIFIPKGTQIVPNLYGIGQNFVDDPSSYKPERWVE 
NDLDKVVLPFSIGPRNCPGNIISEINLFLACSN 
ILLNFEFSNGGKKIDETEVFGITIHPKDFSIQLKKRE* 

SEQUENCE 18 38% identical to A. bisporus Z82021 (mushroom)

AU036927 Dictyostelium discoideum SS (H.Urushihara) Dictyostelium

N-TERMINAL PART OF CLONE SSB828

IFHKSFDKFYDKYKDFYFIKFGQHDCIVLXSPKLIKQVVIEQSDSVFERFHTPSIKRYAQ
GKSILGCSPDEWKKLRSFIVISFSKNKMGQQVLDKIFHTQYLXFENHIKKLIKSNNNIVT
LEPEFKRLTISIIFNFQFGTDLEFTDPLIDSLLVCTEKIIASCQKASDLMPIFEIFTSYK
DIDGVVKEMY

C-TERMINAL PART OF CLONE SSB828

AKGESYTIPVGTLIIPNAHSFNFDPQYHKDPLTFNPNRYIGDNPEILHMTFDIGIRTCPFMSFAIDE 
LFIIFSRLFQSFEFQPIDNTPISEEAFTINSIRPKQWSCQVIERDHK* 

SEQUENCE 19 complete sequence
This is the Dicty CYP51 sequence.  
41% to S. bicolor CYP51 

AU033519 Dictyostelium discoideum  CLONE SLB124

MIGTIAVLVIAILVIFAFKKSPSNIPPIVETIPFIGCFYQFAKNPLQLVRNSYDRLGEIF
TLHLMGFKMTFVLGPEAQALFFRGTDEELSPKEAYRFVTPVFGKGVVYDSETEIMY
EQLRFVKNGLVLSQLKKAVGIIQEETEKYFETKWGDSGEIDLLYEMNKLTILTASRCLMGKS
INKSLGQSGQLADLYPNWKK
VSIQFHSFSQISHYHHSKRETLPVLKSRHFPSIIQERRRSTDDSVDDVLYTLMNSKYKDGSVLEDEQIVGLM
IGLLFAGQHTSSITLTYTI
FYLLNNLEYFDETQKDINDIVQKENQGEINFDGLKRMNRLETVIREVLRLHPPLIFLMRKVMTPMEYK 
GKTIPAGHILAVSPQVGMRLPTVYKNPDSFEPKRFDVEDKTPFSFIAFGGGKHGCPGENF 
GILQIKTIWTVLSTKYNLEVGPVPPTDFTSLVAGPKGPCMVKYSKKQK*

SEQUENCE 20 not in genbank yet from Tsukuba 33% identical to mammalian CYP17s
FC-BG13 I-HELIX TO END

GGKEEQSSIIPMVNELILAGTETNSSTAEWFILTMVNNLDYQDKIYNELKSTLETTT
AMIKLSNRNQTPLFNAALKEVLRLYPPVPFGVPRQVNQSFEINGGSLKIPKGTQIIQSLY
SIFRDENYWDSPDQFKPERFLDQDSHSNNYFPYGIGVRNCIGMGFSQDELYISLSNLVLN
FKLLPLIENSKICDKPIFGFSFKPNEFKINLEKRNN*